4DRQA

Exploration of pipecolate sulfonamides as binders of the fk506-binding proteins 51 and 52: complex of fkbp51 with 2-(3-((r)-1-((s)-1-(3,5-dichlorophenylsulfonyl)piperidine-2-carbonyloxy)-3-(3,4-dimethoxy -phenyl)propyl)phenoxy)acetic acid
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
128
structure length
128
Chain Sequence
b'GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Exploration of Pipecolate Sulfonamides as Binders of the FK506-Binding Proteins 51 and 52.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 35
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4drqA00
2RQSA 3KABA 3O5DA 3O5QA 5HW8A 2IF4A 1Q1CA 1FKTA 3RFWA 1HXVA 2F2DA 1D7JA 4ITZA 4LAXA 1FKFA 2XP4A 1PBKA 3WH0A 4DZ3A 1J4IA 1ROUA 1ZCNA 5HT1A 3OOBA 5B8IC 2K8IA 2DG4A 4DT4A 1JVWA 2ZQSA 2VN1A 1FKLA 3UQBA 3PA7A 2M2AA 1D7HA 5GPGA 3NRKA 2ZQUA 1T11A 2LJ4A 1QZ2A 5DIUA 4JFKA 5I98A 2LKNA 4IPXA 2XP7A 3GPKA 1ROTA 3O5IA 4ODPA 4DRNA 3KAHA 1L1PA 4DRMA 3CGMA 4FN2A 1BKFA 2N87A 1NSGA 1YATA 3EY6A 2LPVA 3UQIA 3IKGA 1Q6UA 1BL4A 2PV3A 1FKJA 3O5LA 1FD9A 3KAGA 3KAFA 2UZ5A 4DIPA 4DRIA 2XP5A 2PPOA 2L2SA 4J4OA 4U84A 2KO7A 4JFMA 3UI6A 1EYMA 4MGVA 2PPNA 1FKRA 3JYMA 3UI5A 2OFNA 2ZR5A 3KCEA 1ZK6A 4G50A 2PV2A 1D6OA 1Q6HA 4DRHA 5HKGA 4ODMA 3JYJA 4FAPA 4JFLA 1QPFA 4NNRA 1B6CA 1FAPA 5D75A 4DH0A 1JNTA 3CGNA 2F21A 4JFIA 3PRBA 4ODKA 4DZ2A 1EQ3A 2AWGA 2RUDA 2MLXA 5HW6A 1FKIA 3JXVA 3O5GA 4C02B 4W9PA 4J4NA 2XPAA 4DRQA 2XP3A 1Y0OA 2KGJA 2XP6A 5HTGA 2XPBA 1JNSA 4TW8A 3PRDA 4DROA 1W26A 3B7XA 4ODRA 4W9OA 1J4HA 4GGQA 1PINA 3KACA 3KAIA 2Y78A 2ZR4A 4TYOA 1NMWA 3O5FA 5HWBA 2PPPA 3FAPA 4TX0A 1D7IA 1Q6IA 2D9FA 2KI3A 3MDYB 4R0XA 2ITKA 1YW5A 5BXJA 2M08A 2ZR6A 3O5KA 2MLYA 1QPLA 3ODKA 3O5PA 3O5EA 4TW6A 4DRJA 2XP8A 2PV1A 4IQCA 4IQ2A 3RGCA 1N1AA 1FKHA 1U79A 4MSPA 4BF8A 1M5YA 2FAPA 1P5QA 1FKDA 1KT0A 4QT3A 2F4EA 3O5MA 4DRKA 3IK8A 2ZQTA 5HUAA 3O5OA 4TW7A 2LGOA 2M1IA 4JFJA 3UF8A 3IHZA 1FJDA 1FKSA 3IKDA 1NMVA 5HW7A 4ODQA 2DG3A 2KR7A 1R9HA 1F40A 4ODNA 3UI4A 3TC5A 4JYSA 2JZVA 3O5JA 5J6EA 4QIBA 2KFWA 4QT2A 4W9QA 2XP9A 1F8AB 2VCDA 1FKGA 2FKEA 3NTPA 4ODOA 4DRPA 1J6YA 2KE0A 4U86A 4ODLA 2RURA 1FKBA 1C9HA 1J4RA 2PBCA 1KT1A 2RSEA 2RUQA 2ZQVA 3I6CA 3O5RA 3NI6A 4LAWA 5DIVA 2RUCA 4G2PA 1FKKA 3H9RB 3TCZA 3TDBA 2Q5AA 4O2TA 1A7XA 4TNSA 3UQAA 3LUOA 5HWCA 4LAYA 2MF9A 2MNTA 3KZ7A 4U85A 3KADA 3VAWA 2MLZA 4GIVA 4LAVA 4N19A 2DG9A 1TCOC 5DITA 2MPHA
chains in the Genus database with same CATH superfamily
3KABA 3O5DA 3O5QA 1Q1CA 2DT3A 1HXVA 2F2DA 4P8WA 1FKFA 3WH0A 1W1PA 3RM9A 3PRAA 2M2AA 1W9PA 1W9VA 3B9DA 4JFKA 5I98A 4HBOA 3WKZA 4MAVA 2DSZA 4Z2IA 2PV3A 2XP5A 3GU0A 2KO7A 1EYMA 2PPNA 4DWSB 4MNJA 2ETNA 3UI5A 2A3EA 5HBFA 1D6OA 1HKMA 3CHFA 4FAPA 4JFLA 5D75A 1JNTA 3AS2A 2F21A 3PRBA 2PN0A 2PI6A 1D2KA 2AWGA 2MLXA 3CHCA 1HJWA 1FKIA 1GOIA 4MNLA 3WL0A 3ARVA 2IUZA 2XP3A 1Y0OA 4TW8A 1OWQA 1W26A 2Y78A 2ZR4A 1NMWA 5HWBA 4DWSC 2PPPA 1D7IA 4Z2HA 2ITKA 3WD0A 1WNOA 3ODKA 2PV1A 4IQCA 1HJXA 1FKHA 1U79A 1NWTA 1M5YA 4AY1A 2FAPA 3PR9A 1P5QA 4QT3A 2M1IA 3UF8A 4Z2LA 1FFQA 4PTMA 1R9HA 1E6RA 3CZ8A 3TC5A 4JYSA 4WK9A 5J6EA 4ML4A 2KFWA 1F8AB 1WAWA 5GPRA 4DRPA 3OA5A 1VF8A 4S3JA 2O9OA 3ALFA 1ZBCA 2PBCA 1KT1A 3WD4A 3TCZA 4G2PA 1ITXA 1FKKA 3UQAA 1E15A 4GIVA 4N19A 2DG9A 1T11A 3AQUA 1FKTA 2A3CA 1J4IA 1ZBKA 3OOBA 4P8XA 1FKLA 3ARQA 1ZL1A 3UQBA 1D7HA 5GPGA 5DEZA 2LKNA 4MTVA 2XP7A 4ODPA 4DRNA 4HARA 4HBEA 1L1PA 4MNKA 3FY1A 2WLYA 1GPFA 2N87A 1NSGA 3IKGA 3CHDA 1BL4A 1FKJA 1FD9A 3KAGA 2UZ5A 2PPOA 3JYMA 1ZK6A 3ARSA 2PV2A 4WIWA 5HKGA 3FXYA 3JYJA 1CTNA 4XAKA 4L72B 1W1TA 3GTYX 4ZS6A 2RUDA 1JNEA 3JXVA 4C02B 1ZU8A 4UDMA 4W9PA 3W4RA 3WD1A 4DRQA 2QF8A 2XP6A 2YBTA 4ZPWR 4DROA 3BMBA 4IT4A 1X6LA 3KACA 4TYOA 4TX0A 2DSVA 2DSWA 2M08A 1QPLA 1HKIA 3O5EA 2XP8A 1EHNA 2OLHA 3RGCA 3ARWA 3RM8A 3B9EA 1LG2A 2F4EA 3ARZA 3O5MA 4DRKA 1TFVA 3O5OA 4TW7A 2B31A 2ESCA 5HW7A 2DG3A 2KR7A 1F40A 4ODNA 3UI4A 3G6MA 1LJYA 3O5JA 4P8VA 4QIBA 2XP9A 1WB0A 2FKEA 1H0GA 3NTPA 4IT6A 1J6YA 2KE0A 4U86A 4Q22A 1C9HA 2RSEA 5BXJA 3ARUA 2RUCA 3H9RB 3WQVA 2DT0A 4O2TA 4TNSA 4LAYA 4Z2JA 2MNTA 3KZ7A 4U85A 4DWSD 2MLZA 1KFWA 3TDBA 5DITA 2RQSA 3AROA 2IF4A 4NSBA 5GQBA 1HKJA 4ITZA 3WL1A 2DSUA 1LL4A 1ROUA 5HT1A 5B8IC 2K8IA 2F23A 4MNMA 1JVWA 4W5UA 2ZQSA 4DT4A 2VN1A 2DPEA 3B8SA 2ZQUA 2LJ4A 1QZ2A 1GUVA 5DIUA 1LL6A 3GPKA 3O5IA 2G8ZA 3KAHA 3CGMA 4FN2A 4Z2KA 4KR0B 1YATA 1HKKA 2LPVA 3UQIA 1Q6UA 1XRVA 1RD6A 1ZBWA 4J4OA 4U84A 3UI6A 1LG1A 4MGVA 1E9LA 2FDMA 2OFNA 2ZR5A 4ODMA 4R5EA 3ALGA 4NNRA 1B6CA 4DH0A 3CGNA 4KQZA 1UR8A 3O5GA 2XPAA 4WJXA 1W1VA 1K9TA 1ZB5A 3ARTA 5HTGA 1H0IA 2KGJA 2XPBA 1E6PA 3PRDA 3B7XA 1E6NA 4W9OA 1J4HA 1PINA 1OGBA 3G6LA 2D9FA 2KI3A 3MDYB 4R0XA 1YW5A 3ARPA 4NZCA 1XHGA 2MLYA 3WIJA 4TW6A 4MSPA 1W9UA 4ZPTR 2ZQTA 5HUAA 2LGOA 4JFJA 1FJDA 1FKSA 4URIA 1NWUA 3WD2A 2JZVA 1IX5A 3ARYA 4W9QA 1HJVA 1OGGA 2VCDA 1EIBA 4Q7NA 1FKGA 1LL7A 2RURA 1FKBA 1UR9A 4LAWA 2ZQVA 3EIPA 5HW6A 3I6CA 5DIVA 2Q5AA 3ARXA 4ZPVR 5HWCA 3QOKA 4LGXA 5DO2A 2WK2A 4P8UA 3KADA 4LAVA 1TCOC 5DF0A 1X6NA 3WD3A 5HW8A 4WKAA 4WKFA 3RFWA 1D7JA 4LAXA 2XP4A 1PBKA 3AS0A 3AS3A 3ARRA 4DZ3A 1ZCNA 1W1YA 2DG4A 3BXWA 4Z2GA 3CH9A 3PA7A 1SYTA 3NRKA 4IPXA 1ROTA 3AS1A 1NWSA 1JNDA 2G41A 4DRMA 4L3NA 2WM0A 1BKFA 3EY6A 1O6IA 3O5LA 4DIPA 4DRIA 3KAFA 2L2SA 3RMEA 4JFMA 2AOSA 1FKRA 3KCEA 4G50A 2DT2A 1Q6HA 4DRHA 1QPFA 1FAPA 2P4VA 4JFIA 3CHEA 4ODKA 3B9AA 4DZ2A 1EQ3A 3WQWA 4J4NA 1ZBVA 2B5UB 2A3AA 4QZVB 4DWSA 1JNSA 1FFRA 4ODRA 4GGQA 3KAIA 2DT1A 3O5FA 1E44A 3FAPA 1Q6IA 1NH6A 2EULA 2ZR6A 1NWRA 1EDQA 3O5KA 4WKHA 4DRJA 3O5PA 4IQ2A 1N1AA 4BF8A 2A3BA 2YBUA 1FKDA 1KT0A 3IK8A 3IHZA 1LQ0A 3IKDA 4MPKA 1NMVA 4ODQA 1SR0A 1E6ZA 4QT2A 4S3KA 4ODOA 4ODLA 3RM4A 2WLZA 5JH8A 1J4RA 3O5RA 2RUQA 3NI6A 2O92A 1GRJA 1A7XA 3LUOA 2MF9A 1JCHB 3VAWA 2MPHA
chains in the Genus database with same CATH topology
3KABA 3O5DA 3O5QA 1Q1CA 2DT3A 1HXVA 2F2DA 4P8WA 1FKFA 3WH0A 1W1PA 3RM9A 3PRAA 2M2AA 1W9PA 1W9VA 3B9DA 4JFKA 5I98A 4HBOA 3WKZA 4MAVA 2DSZA 4Z2IA 2PV3A 2XP5A 2KO7A 1EYMA 2PPNA 4DWSB 4MNJA 3UI5A 2A3EA 5HBFA 1D6OA 1HKMA 3CHFA 4FAPA 4JFLA 5D75A 1JNTA 3AS2A 2F21A 3PRBA 2PI6A 1D2KA 2AWGA 2MLXA 3CHCA 1HJWA 1FKIA 1GOIA 4MNLA 3WL0A 3ARVA 2IUZA 2XP3A 1Y0OA 4TW8A 1OWQA 1W26A 2Y78A 2ZR4A 1NMWA 5HWBA 4DWSC 2PPPA 1D7IA 4Z2HA 2ITKA 3WD0A 1WNOA 3ODKA 2PV1A 4IQCA 1HJXA 1FKHA 1U79A 1NWTA 1M5YA 4AY1A 2FAPA 3PR9A 1P5QA 4QT3A 2M1IA 3UF8A 4Z2LA 1FFQA 4PTMA 1R9HA 1E6RA 3CZ8A 3TC5A 4JYSA 4WK9A 5J6EA 4ML4A 2KFWA 1F8AB 1WAWA 5GPRA 4DRPA 3OA5A 1VF8A 4S3JA 2O9OA 3ALFA 1ZBCA 2PBCA 1KT1A 3WD4A 3TCZA 4G2PA 1ITXA 1FKKA 3UQAA 1E15A 4GIVA 4N19A 2DG9A 1T11A 3AQUA 1FKTA 2A3CA 1J4IA 1ZBKA 3OOBA 4P8XA 1FKLA 3ARQA 1ZL1A 3UQBA 1D7HA 5GPGA 5DEZA 2LKNA 4MTVA 2XP7A 4ODPA 4DRNA 4HARA 4HBEA 1L1PA 4MNKA 3FY1A 2WLYA 1GPFA 2N87A 1NSGA 3IKGA 3CHDA 1BL4A 1FKJA 1FD9A 3KAGA 2UZ5A 2PPOA 3JYMA 1ZK6A 3ARSA 2PV2A 4WIWA 5HKGA 3FXYA 3JYJA 1CTNA 4XAKA 4L72B 1W1TA 4ZS6A 2RUDA 1JNEA 3JXVA 4C02B 1ZU8A 4W9PA 3W4RA 3WD1A 4DRQA 2QF8A 2XP6A 2YBTA 4ZPWR 4DROA 4IT4A 1X6LA 3KACA 4TYOA 4TX0A 2DSVA 2DSWA 2M08A 1QPLA 1HKIA 3O5EA 2XP8A 1EHNA 2OLHA 3RGCA 3ARWA 3RM8A 3B9EA 1LG2A 2F4EA 3ARZA 3O5MA 4DRKA 1TFVA 3O5OA 4TW7A 2B31A 2ESCA 5HW7A 2DG3A 2KR7A 1F40A 4ODNA 3UI4A 3G6MA 1LJYA 3O5JA 4P8VA 4QIBA 2XP9A 1WB0A 2FKEA 1H0GA 3NTPA 4IT6A 1J6YA 2KE0A 4U86A 4Q22A 1C9HA 2RSEA 5BXJA 3ARUA 2RUCA 3H9RB 3WQVA 2DT0A 4O2TA 4TNSA 4LAYA 4Z2JA 2MNTA 3KZ7A 4U85A 4DWSD 2MLZA 1KFWA 3TDBA 5DITA 2RQSA 3AROA 2IF4A 4NSBA 5GQBA 1HKJA 4ITZA 3WL1A 2DSUA 1LL4A 1ROUA 5HT1A 5B8IC 2K8IA 4W5UA 4MNMA 1JVWA 4DT4A 2ZQSA 2VN1A 2DPEA 3B8SA 2ZQUA 2LJ4A 1QZ2A 1GUVA 5DIUA 1LL6A 3GPKA 3O5IA 2G8ZA 3KAHA 3CGMA 4FN2A 4Z2KA 4KR0B 1YATA 1HKKA 2LPVA 3UQIA 1Q6UA 1XRVA 1RD6A 1ZBWA 4J4OA 4U84A 3UI6A 1LG1A 4MGVA 1E9LA 2FDMA 2OFNA 2ZR5A 4ODMA 4R5EA 3ALGA 4NNRA 1B6CA 4DH0A 3CGNA 4KQZA 1UR8A 3O5GA 2XPAA 4WJXA 1W1VA 1K9TA 1ZB5A 3ARTA 5HTGA 1H0IA 2KGJA 2XPBA 1E6PA 3PRDA 3B7XA 1E6NA 4W9OA 1J4HA 1PINA 1OGBA 3G6LA 2D9FA 2KI3A 3MDYB 4R0XA 1YW5A 3ARPA 4NZCA 1XHGA 2MLYA 3WIJA 4TW6A 4MSPA 1W9UA 4ZPTR 2ZQTA 5HUAA 2LGOA 4JFJA 1FJDA 1FKSA 4URIA 1NWUA 3WD2A 2JZVA 1IX5A 3ARYA 4W9QA 1HJVA 1OGGA 2VCDA 1EIBA 4Q7NA 1FKGA 1LL7A 2RURA 1FKBA 1UR9A 4LAWA 2ZQVA 5HW6A 3I6CA 5DIVA 2Q5AA 3ARXA 4ZPVR 5HWCA 3QOKA 4LGXA 5DO2A 2WK2A 4P8UA 3KADA 4LAVA 1TCOC 5DF0A 1X6NA 3WD3A 5HW8A 4WKAA 4WKFA 3RFWA 1D7JA 4LAXA 2XP4A 1PBKA 3AS0A 3AS3A 3ARRA 4DZ3A 1ZCNA 1W1YA 2DG4A 3BXWA 4Z2GA 3CH9A 3PA7A 1SYTA 3NRKA 4IPXA 1ROTA 3AS1A 1NWSA 1JNDA 2G41A 4DRMA 4L3NA 2WM0A 1BKFA 3EY6A 1O6IA 3O5LA 4DIPA 4DRIA 3KAFA 2L2SA 3RMEA 4JFMA 2AOSA 1FKRA 3KCEA 4G50A 2DT2A 1Q6HA 4DRHA 1QPFA 1FAPA 4JFIA 3CHEA 4ODKA 3B9AA 4DZ2A 1EQ3A 3WQWA 4J4NA 1ZBVA 2A3AA 4QZVB 4DWSA 1JNSA 1FFRA 4ODRA 4GGQA 3KAIA 2DT1A 3O5FA 3FAPA 1Q6IA 1NH6A 2ZR6A 1NWRA 1EDQA 3O5KA 4WKHA 4DRJA 3O5PA 4IQ2A 1N1AA 4BF8A 2A3BA 2YBUA 1FKDA 1KT0A 3IK8A 3IHZA 1LQ0A 3IKDA 4MPKA 1NMVA 4ODQA 1SR0A 1E6ZA 4QT2A 4S3KA 4ODOA 4ODLA 3RM4A 2WLZA 5JH8A 1J4RA 3O5RA 2RUQA 3NI6A 2O92A 1A7XA 3LUOA 2MF9A 3VAWA 2MPHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RQS A;  3KAB A;  3O5D A;  3O5Q A;  5HW8 A;  2IF4 A;  1Q1C A;  1FKT A;  3RFW A;  1HXV A;  2F2D A;  1D7J A;  4ITZ A;  4LAX A;  1FKF A;  2XP4 A;  1PBK A;  3WH0 A;  4DZ3 A;  1J4I A;  1ROU A;  1ZCN A;  5HT1 A;  3OOB A;  5B8I C;  2K8I A;  2DG4 A;  4DT4 A;  1JVW A;  2ZQS A;  2VN1 A;  1FKL A;  3UQB A;  3PA7 A;  2M2A A;  1D7H A;  5GPG A;  3NRK A;  2ZQU A;  1T11 A;  2LJ4 A;  1QZ2 A;  5DIU A;  4JFK A;  5I98 A;  2LKN A;  4IPX A;  2XP7 A;  3GPK A;  1ROT A;  3O5I A;  4ODP A;  4DRN A;  3KAH A;  1L1P A;  4DRM A;  3CGM A;  4FN2 A;  1BKF A;  2N87 A;  1NSG A;  1YAT A;  3EY6 A;  2LPV A;  3UQI A;  3IKG A;  1Q6U A;  1BL4 A;  2PV3 A;  1FKJ A;  3O5L A;  1FD9 A;  3KAG A;  3KAF A;  2UZ5 A;  4DIP A;  4DRI A;  2XP5 A;  2PPO A;  2L2S A;  4J4O A;  4U84 A;  2KO7 A;  4JFM A;  3UI6 A;  1EYM A;  4MGV A;  2PPN A;  1FKR A;  3JYM A;  3UI5 A;  2OFN A;  2ZR5 A;  3KCE A;  1ZK6 A;  4G50 A;  2PV2 A;  1D6O A;  1Q6H A;  4DRH A;  5HKG A;  4ODM A;  3JYJ A;  4FAP A;  4JFL A;  1QPF A;  4NNR A;  1B6C A;  1FAP A;  5D75 A;  4DH0 A;  1JNT A;  3CGN A;  2F21 A;  4JFI A;  3PRB A;  4ODK A;  4DZ2 A;  1EQ3 A;  2AWG A;  2RUD A;  2MLX A;  5HW6 A;  1FKI A;  3JXV A;  3O5G A;  4C02 B;  4W9P A;  4J4N A;  2XPA A;  4DRQ A;  2XP3 A;  1Y0O A;  2KGJ A;  2XP6 A;  5HTG A;  2XPB A;  1JNS A;  4TW8 A;  3PRD A;  4DRO A;  1W26 A;  3B7X A;  4ODR A;  4W9O A;  1J4H A;  4GGQ A;  1PIN A;  3KAC A;  3KAI A;  2Y78 A;  2ZR4 A;  4TYO A;  1NMW A;  3O5F A;  5HWB A;  2PPP A;  3FAP A;  4TX0 A;  1D7I A;  1Q6I A;  2D9F A;  2KI3 A;  3MDY B;  4R0X A;  2ITK A;  1YW5 A;  5BXJ A;  2M08 A;  2ZR6 A;  3O5K A;  2MLY A;  1QPL A;  3ODK A;  3O5P A;  3O5E A;  4TW6 A;  4DRJ A;  2XP8 A;  2PV1 A;  4IQC A;  4IQ2 A;  3RGC A;  1N1A A;  1FKH A;  1U79 A;  4MSP A;  4BF8 A;  1M5Y A;  2FAP A;  1P5Q A;  1FKD A;  1KT0 A;  4QT3 A;  2F4E A;  3O5M A;  4DRK A;  3IK8 A;  2ZQT A;  5HUA A;  3O5O A;  4TW7 A;  2LGO A;  2M1I A;  4JFJ A;  3UF8 A;  3IHZ A;  1FJD A;  1FKS A;  3IKD A;  1NMV A;  5HW7 A;  4ODQ A;  2DG3 A;  2KR7 A;  1R9H A;  1F40 A;  4ODN A;  3UI4 A;  3TC5 A;  4JYS A;  2JZV A;  3O5J A;  5J6E A;  4QIB A;  2KFW A;  4QT2 A;  4W9Q A;  2XP9 A;  1F8A B;  2VCD A;  1FKG A;  2FKE A;  3NTP A;  4ODO A;  4DRP A;  1J6Y A;  2KE0 A;  4U86 A;  4ODL A;  2RUR A;  1FKB A;  1C9H A;  1J4R A;  2PBC A;  1KT1 A;  2RSE A;  2RUQ A;  2ZQV A;  3I6C A;  3O5R A;  3NI6 A;  4LAW A;  5DIV A;  2RUC A;  4G2P A;  1FKK A;  3H9R B;  3TCZ A;  3TDB A;  2Q5A A;  4O2T A;  1A7X A;  4TNS A;  3UQA A;  3LUO A;  5HWC A;  4LAY A;  2MF9 A;  2MNT A;  3KZ7 A;  4U85 A;  3KAD A;  3VAW A;  2MLZ A;  4GIV A;  4LAV A;  4N19 A;  2DG9 A;  1TCO C;  5DIT A;  2MPH A; 
#chains in the Genus database with same CATH topology
 3KAB A;  3O5D A;  3O5Q A;  1Q1C A;  2DT3 A;  1HXV A;  2F2D A;  4P8W A;  1FKF A;  3WH0 A;  1W1P A;  3RM9 A;  3PRA A;  2M2A A;  1W9P A;  1W9V A;  3B9D A;  4JFK A;  5I98 A;  4HBO A;  3WKZ A;  4MAV A;  2DSZ A;  4Z2I A;  2PV3 A;  2XP5 A;  3GU0 A;  2KO7 A;  1EYM A;  2PPN A;  4DWS B;  4MNJ A;  2ETN A;  3UI5 A;  2A3E A;  5HBF A;  1D6O A;  1HKM A;  3CHF A;  4FAP A;  4JFL A;  5D75 A;  1JNT A;  3AS2 A;  2F21 A;  3PRB A;  2PN0 A;  2PI6 A;  1D2K A;  2AWG A;  2MLX A;  3CHC A;  1HJW A;  1FKI A;  1GOI A;  4MNL A;  3WL0 A;  3ARV A;  2IUZ A;  2XP3 A;  1Y0O A;  4TW8 A;  1OWQ A;  1W26 A;  2Y78 A;  2ZR4 A;  1NMW A;  5HWB A;  4DWS C;  2PPP A;  1D7I A;  4Z2H A;  2ITK A;  3WD0 A;  1WNO A;  3ODK A;  2PV1 A;  4IQC A;  1HJX A;  1FKH A;  1U79 A;  1NWT A;  1M5Y A;  4AY1 A;  2FAP A;  3PR9 A;  1P5Q A;  4QT3 A;  2M1I A;  3UF8 A;  4Z2L A;  1FFQ A;  4PTM A;  1R9H A;  1E6R A;  3CZ8 A;  3TC5 A;  4JYS A;  4WK9 A;  5J6E A;  4ML4 A;  2KFW A;  1F8A B;  1WAW A;  5GPR A;  4DRP A;  3OA5 A;  1VF8 A;  4S3J A;  2O9O A;  3ALF A;  1ZBC A;  2PBC A;  1KT1 A;  3WD4 A;  3TCZ A;  4G2P A;  1ITX A;  1FKK A;  3UQA A;  1E15 A;  4GIV A;  4N19 A;  2DG9 A;  1T11 A;  3AQU A;  1FKT A;  2A3C A;  1J4I A;  1ZBK A;  3OOB A;  4P8X A;  1FKL A;  3ARQ A;  1ZL1 A;  3UQB A;  1D7H A;  5GPG A;  5DEZ A;  2LKN A;  4MTV A;  2XP7 A;  4ODP A;  4DRN A;  4HAR A;  4HBE A;  1L1P A;  4MNK A;  3FY1 A;  2WLY A;  1GPF A;  2N87 A;  1NSG A;  3IKG A;  3CHD A;  1BL4 A;  1FKJ A;  1FD9 A;  3KAG A;  2UZ5 A;  2PPO A;  3JYM A;  1ZK6 A;  3ARS A;  2PV2 A;  4WIW A;  5HKG A;  3FXY A;  3JYJ A;  1CTN A;  4XAK A;  4L72 B;  1W1T A;  3GTY X;  4ZS6 A;  2RUD A;  1JNE A;  3JXV A;  4C02 B;  1ZU8 A;  4UDM A;  4W9P A;  3W4R A;  3WD1 A;  4DRQ A;  2QF8 A;  2XP6 A;  2YBT A;  4ZPW R;  4DRO A;  3BMB A;  4IT4 A;  1X6L A;  3KAC A;  4TYO A;  4TX0 A;  2DSV A;  2DSW A;  2M08 A;  1QPL A;  1HKI A;  3O5E A;  2XP8 A;  1EHN A;  2OLH A;  3RGC A;  3ARW A;  3RM8 A;  3B9E A;  1LG2 A;  2F4E A;  3ARZ A;  3O5M A;  4DRK A;  1TFV A;  3O5O A;  4TW7 A;  2B31 A;  2ESC A;  5HW7 A;  2DG3 A;  2KR7 A;  1F40 A;  4ODN A;  3UI4 A;  3G6M A;  1LJY A;  3O5J A;  4P8V A;  4QIB A;  2XP9 A;  1WB0 A;  2FKE A;  1H0G A;  3NTP A;  4IT6 A;  1J6Y A;  2KE0 A;  4U86 A;  4Q22 A;  1C9H A;  2RSE A;  5BXJ A;  3ARU A;  2RUC A;  3H9R B;  3WQV A;  2DT0 A;  4O2T A;  4TNS A;  4LAY A;  4Z2J A;  2MNT A;  3KZ7 A;  4U85 A;  4DWS D;  2MLZ A;  1KFW A;  3TDB A;  5DIT A;  2RQS A;  3ARO A;  2IF4 A;  4NSB A;  5GQB A;  1HKJ A;  4ITZ A;  3WL1 A;  2DSU A;  1LL4 A;  1ROU A;  5HT1 A;  5B8I C;  2K8I A;  2F23 A;  4MNM A;  1JVW A;  4W5U A;  2ZQS A;  4DT4 A;  2VN1 A;  2DPE A;  3B8S A;  2ZQU A;  2LJ4 A;  1QZ2 A;  1GUV A;  5DIU A;  1LL6 A;  3GPK A;  3O5I A;  2G8Z A;  3KAH A;  3CGM A;  4FN2 A;  4Z2K A;  4KR0 B;  1YAT A;  1HKK A;  2LPV A;  3UQI A;  1Q6U A;  1XRV A;  1RD6 A;  1ZBW A;  4J4O A;  4U84 A;  3UI6 A;  1LG1 A;  4MGV A;  1E9L A;  2FDM A;  2OFN A;  2ZR5 A;  4ODM A;  4R5E A;  3ALG A;  4NNR A;  1B6C A;  4DH0 A;  3CGN A;  4KQZ A;  1UR8 A;  3O5G A;  2XPA A;  4WJX A;  1W1V A;  1K9T A;  1ZB5 A;  3ART A;  5HTG A;  1H0I A;  2KGJ A;  2XPB A;  1E6P A;  3PRD A;  3B7X A;  1E6N A;  4W9O A;  1J4H A;  1PIN A;  1OGB A;  3G6L A;  2D9F A;  2KI3 A;  3MDY B;  4R0X A;  1YW5 A;  3ARP A;  4NZC A;  1XHG A;  2MLY A;  3WIJ A;  4TW6 A;  4MSP A;  1W9U A;  4ZPT R;  2ZQT A;  5HUA A;  2LGO A;  4JFJ A;  1FJD A;  1FKS A;  4URI A;  1NWU A;  3WD2 A;  2JZV A;  1IX5 A;  3ARY A;  4W9Q A;  1HJV A;  1OGG A;  2VCD A;  1EIB A;  4Q7N A;  1FKG A;  1LL7 A;  2RUR A;  1FKB A;  1UR9 A;  4LAW A;  2ZQV A;  3EIP A;  5HW6 A;  3I6C A;  5DIV A;  2Q5A A;  3ARX A;  4ZPV R;  5HWC A;  3QOK A;  4LGX A;  5DO2 A;  2WK2 A;  4P8U A;  3KAD A;  4LAV A;  1TCO C;  5DF0 A;  1X6N A;  3WD3 A;  5HW8 A;  4WKA A;  4WKF A;  3RFW A;  1D7J A;  4LAX A;  2XP4 A;  1PBK A;  3AS0 A;  3AS3 A;  3ARR A;  4DZ3 A;  1ZCN A;  1W1Y A;  2DG4 A;  3BXW A;  4Z2G A;  3CH9 A;  3PA7 A;  1SYT A;  3NRK A;  4IPX A;  1ROT A;  3AS1 A;  1NWS A;  1JND A;  2G41 A;  4DRM A;  4L3N A;  2WM0 A;  1BKF A;  3EY6 A;  1O6I A;  3O5L A;  4DIP A;  4DRI A;  3KAF A;  2L2S A;  3RME A;  4JFM A;  2AOS A;  1FKR A;  3KCE A;  4G50 A;  2DT2 A;  1Q6H A;  4DRH A;  1QPF A;  1FAP A;  2P4V A;  4JFI A;  3CHE A;  4ODK A;  3B9A A;  4DZ2 A;  1EQ3 A;  3WQW A;  4J4N A;  1ZBV A;  2B5U B;  2A3A A;  4QZV B;  4DWS A;  1JNS A;  1FFR A;  4ODR A;  4GGQ A;  3KAI A;  2DT1 A;  3O5F A;  1E44 A;  3FAP A;  1Q6I A;  1NH6 A;  2EUL A;  2ZR6 A;  1NWR A;  1EDQ A;  3O5K A;  4WKH A;  4DRJ A;  3O5P A;  4IQ2 A;  1N1A A;  4BF8 A;  2A3B A;  2YBU A;  1FKD A;  1KT0 A;  3IK8 A;  3IHZ A;  1LQ0 A;  3IKD A;  4MPK A;  1NMV A;  4ODQ A;  1SR0 A;  1E6Z A;  4QT2 A;  4S3K A;  4ODO A;  4ODL A;  3RM4 A;  2WLZ A;  5JH8 A;  1J4R A;  3O5R A;  2RUQ A;  3NI6 A;  2O92 A;  1GRJ A;  1A7X A;  3LUO A;  2MF9 A;  1JCH B;  3VAW A;  2MPH A; 
#chains in the Genus database with same CATH homology
 3KAB A;  3O5D A;  3O5Q A;  1Q1C A;  2DT3 A;  1HXV A;  2F2D A;  4P8W A;  1FKF A;  3WH0 A;  1W1P A;  3RM9 A;  3PRA A;  2M2A A;  1W9P A;  1W9V A;  3B9D A;  4JFK A;  5I98 A;  4HBO A;  3WKZ A;  4MAV A;  2DSZ A;  4Z2I A;  2PV3 A;  2XP5 A;  2KO7 A;  1EYM A;  2PPN A;  4DWS B;  4MNJ A;  3UI5 A;  2A3E A;  5HBF A;  1D6O A;  1HKM A;  3CHF A;  4FAP A;  4JFL A;  5D75 A;  1JNT A;  3AS2 A;  2F21 A;  3PRB A;  2PI6 A;  1D2K A;  2AWG A;  2MLX A;  3CHC A;  1HJW A;  1FKI A;  1GOI A;  4MNL A;  3WL0 A;  3ARV A;  2IUZ A;  2XP3 A;  1Y0O A;  4TW8 A;  1OWQ A;  1W26 A;  2Y78 A;  2ZR4 A;  1NMW A;  5HWB A;  4DWS C;  2PPP A;  1D7I A;  4Z2H A;  2ITK A;  3WD0 A;  1WNO A;  3ODK A;  2PV1 A;  4IQC A;  1HJX A;  1FKH A;  1U79 A;  1NWT A;  1M5Y A;  4AY1 A;  2FAP A;  3PR9 A;  1P5Q A;  4QT3 A;  2M1I A;  3UF8 A;  4Z2L A;  1FFQ A;  4PTM A;  1R9H A;  1E6R A;  3CZ8 A;  3TC5 A;  4JYS A;  4WK9 A;  5J6E A;  4ML4 A;  2KFW A;  1F8A B;  1WAW A;  5GPR A;  4DRP A;  3OA5 A;  1VF8 A;  4S3J A;  2O9O A;  3ALF A;  1ZBC A;  2PBC A;  1KT1 A;  3WD4 A;  3TCZ A;  4G2P A;  1ITX A;  1FKK A;  3UQA A;  1E15 A;  4GIV A;  4N19 A;  2DG9 A;  1T11 A;  3AQU A;  1FKT A;  2A3C A;  1J4I A;  1ZBK A;  3OOB A;  4P8X A;  1FKL A;  3ARQ A;  1ZL1 A;  3UQB A;  1D7H A;  5GPG A;  5DEZ A;  2LKN A;  4MTV A;  2XP7 A;  4ODP A;  4DRN A;  4HAR A;  4HBE A;  1L1P A;  4MNK A;  3FY1 A;  2WLY A;  1GPF A;  2N87 A;  1NSG A;  3IKG A;  3CHD A;  1BL4 A;  1FKJ A;  1FD9 A;  3KAG A;  2UZ5 A;  2PPO A;  3JYM A;  1ZK6 A;  3ARS A;  2PV2 A;  4WIW A;  5HKG A;  3FXY A;  3JYJ A;  1CTN A;  4XAK A;  4L72 B;  1W1T A;  4ZS6 A;  2RUD A;  1JNE A;  3JXV A;  4C02 B;  1ZU8 A;  4W9P A;  3W4R A;  3WD1 A;  4DRQ A;  2QF8 A;  2XP6 A;  2YBT A;  4ZPW R;  4DRO A;  4IT4 A;  1X6L A;  3KAC A;  4TYO A;  4TX0 A;  2DSV A;  2DSW A;  2M08 A;  1QPL A;  1HKI A;  3O5E A;  2XP8 A;  1EHN A;  2OLH A;  3RGC A;  3ARW A;  3RM8 A;  3B9E A;  1LG2 A;  2F4E A;  3ARZ A;  3O5M A;  4DRK A;  1TFV A;  3O5O A;  4TW7 A;  2B31 A;  2ESC A;  5HW7 A;  2DG3 A;  2KR7 A;  1F40 A;  4ODN A;  3UI4 A;  3G6M A;  1LJY A;  3O5J A;  4P8V A;  4QIB A;  2XP9 A;  1WB0 A;  2FKE A;  1H0G A;  3NTP A;  4IT6 A;  1J6Y A;  2KE0 A;  4U86 A;  4Q22 A;  1C9H A;  2RSE A;  5BXJ A;  3ARU A;  2RUC A;  3H9R B;  3WQV A;  2DT0 A;  4O2T A;  4TNS A;  4LAY A;  4Z2J A;  2MNT A;  3KZ7 A;  4U85 A;  4DWS D;  2MLZ A;  1KFW A;  3TDB A;  5DIT A;  2RQS A;  3ARO A;  2IF4 A;  4NSB A;  5GQB A;  1HKJ A;  4ITZ A;  3WL1 A;  2DSU A;  1LL4 A;  1ROU A;  5HT1 A;  5B8I C;  2K8I A;  4W5U A;  4MNM A;  1JVW A;  4DT4 A;  2ZQS A;  2VN1 A;  2DPE A;  3B8S A;  2ZQU A;  2LJ4 A;  1QZ2 A;  1GUV A;  5DIU A;  1LL6 A;  3GPK A;  3O5I A;  2G8Z A;  3KAH A;  3CGM A;  4FN2 A;  4Z2K A;  4KR0 B;  1YAT A;  1HKK A;  2LPV A;  3UQI A;  1Q6U A;  1XRV A;  1RD6 A;  1ZBW A;  4J4O A;  4U84 A;  3UI6 A;  1LG1 A;  4MGV A;  1E9L A;  2FDM A;  2OFN A;  2ZR5 A;  4ODM A;  4R5E A;  3ALG A;  4NNR A;  1B6C A;  4DH0 A;  3CGN A;  4KQZ A;  1UR8 A;  3O5G A;  2XPA A;  4WJX A;  1W1V A;  1K9T A;  1ZB5 A;  3ART A;  5HTG A;  1H0I A;  2KGJ A;  2XPB A;  1E6P A;  3PRD A;  3B7X A;  1E6N A;  4W9O A;  1J4H A;  1PIN A;  1OGB A;  3G6L A;  2D9F A;  2KI3 A;  3MDY B;  4R0X A;  1YW5 A;  3ARP A;  4NZC A;  1XHG A;  2MLY A;  3WIJ A;  4TW6 A;  4MSP A;  1W9U A;  4ZPT R;  2ZQT A;  5HUA A;  2LGO A;  4JFJ A;  1FJD A;  1FKS A;  4URI A;  1NWU A;  3WD2 A;  2JZV A;  1IX5 A;  3ARY A;  4W9Q A;  1HJV A;  1OGG A;  2VCD A;  1EIB A;  4Q7N A;  1FKG A;  1LL7 A;  2RUR A;  1FKB A;  1UR9 A;  4LAW A;  2ZQV A;  5HW6 A;  3I6C A;  5DIV A;  2Q5A A;  3ARX A;  4ZPV R;  5HWC A;  3QOK A;  4LGX A;  5DO2 A;  2WK2 A;  4P8U A;  3KAD A;  4LAV A;  1TCO C;  5DF0 A;  1X6N A;  3WD3 A;  5HW8 A;  4WKA A;  4WKF A;  3RFW A;  1D7J A;  4LAX A;  2XP4 A;  1PBK A;  3AS0 A;  3AS3 A;  3ARR A;  4DZ3 A;  1ZCN A;  1W1Y A;  2DG4 A;  3BXW A;  4Z2G A;  3CH9 A;  3PA7 A;  1SYT A;  3NRK A;  4IPX A;  1ROT A;  3AS1 A;  1NWS A;  1JND A;  2G41 A;  4DRM A;  4L3N A;  2WM0 A;  1BKF A;  3EY6 A;  1O6I A;  3O5L A;  4DIP A;  4DRI A;  3KAF A;  2L2S A;  3RME A;  4JFM A;  2AOS A;  1FKR A;  3KCE A;  4G50 A;  2DT2 A;  1Q6H A;  4DRH A;  1QPF A;  1FAP A;  4JFI A;  3CHE A;  4ODK A;  3B9A A;  4DZ2 A;  1EQ3 A;  3WQW A;  4J4N A;  1ZBV A;  2A3A A;  4QZV B;  4DWS A;  1JNS A;  1FFR A;  4ODR A;  4GGQ A;  3KAI A;  2DT1 A;  3O5F A;  3FAP A;  1Q6I A;  1NH6 A;  2ZR6 A;  1NWR A;  1EDQ A;  3O5K A;  4WKH A;  4DRJ A;  3O5P A;  4IQ2 A;  1N1A A;  4BF8 A;  2A3B A;  2YBU A;  1FKD A;  1KT0 A;  3IK8 A;  3IHZ A;  1LQ0 A;  3IKD A;  4MPK A;  1NMV A;  4ODQ A;  1SR0 A;  1E6Z A;  4QT2 A;  4S3K A;  4ODO A;  4ODL A;  3RM4 A;  2WLZ A;  5JH8 A;  1J4R A;  3O5R A;  2RUQ A;  3NI6 A;  2O92 A;  1A7X A;  3LUO A;  2MF9 A;  3VAW A;  2MPH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...