4DRQA

Exploration of pipecolate sulfonamides as binders of the fk506-binding proteins 51 and 52: complex of fkbp51 with 2-(3-((r)-1-((s)-1-(3,5-dichlorophenylsulfonyl)piperidine-2-carbonyloxy)-3-(3,4-dimethoxy -phenyl)propyl)phenoxy)acetic acid
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
128
structure length
128
Chain Sequence
b'GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Exploration of Pipecolate Sulfonamides as Binders of the FK506-Binding Proteins 51 and 52.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 35
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4drqA00
2ZR5A 4JFKA 4G2PA 4IQ2A 3NRKA 3UI5A 3RFWA 3O5KA 1Y0OA 3O5QA 2PPOA 2F21A 2PV2A 5J6EA 2UZ5A 2F4EA 1TCOC 1QPLA 4O2TA 2XP9A 4J4NA 1L1PA 3O5JA 2XP4A 3KAFA 4J4OA 1Q6IA 3O5GA 2VCDA 4TYOA 4TW6A 4LAXA 4DRMA 1BL4A 3IKDA 4U86A 3UI4A 3KAGA 2KR7A 2PPNA 3TCZA 2IF4A 3KABA 4W9QA 4U84A 1M5YA 1D7JA 4DROA 1J6YA 1QPFA 2JZVA 3O5FA 4R0XA 4W9PA 3O5EA 4GGQA 2DG4A 4W9OA 1Q6HA 2LPVA 3UF8A 2LKNA 3KCEA 1ROUA 3TC5A 2FKEA 2RUDA 2KI3A 3OOBA 2Y78A 1J4HA 4MSPA 4DH0A 2MPHA 1J4RA 1FKBA 2MNTA 2KO7A 2DG3A 1NMWA 1N1AA 2RSEA 2XP5A 3O5RA 3CGMA 4TW8A 2PPPA 3WH0A 4QIBA 3JYMA 1JVWA 1YW5A 2ZQVA 2RURA 1YATA 2VN1A 4TX0A 4ODPA 1T11A 2PV3A 2RUQA 3PA7A 2LGOA 3O5OA 3JYJA 2D9FA 3RGCA 4C02B 2DG9A 3NTPA 2L2SA 1D7HA 4LAWA 4ODQA 1Q1CA 4QT2A 2RQSA 2MLZA 5I98A 4IQCA 5B8IC 1JNTA 2MLYA 3MDYB 1NSGA 1Q6UA 2PV1A 3VAWA 4ODMA 5BXJA 2OFNA 3H9RB 3KAIA 4TNSA 4JFIA 5DIVA 4DRNA 3FAPA 5HW7A 2F2DA 4LAVA 2XPAA 4GIVA 5D75A 1P5QA 1NMVA 2AWGA 3TDBA 1FKIA 1FD9A 3O5DA 4FN2A 3CGNA 4ODOA 4JYSA 3UI6A 4G50A 2XP3A 4IPXA 5HWCA 2M1IA 3ODKA 4QT3A 4DRJA 1FJDA 2M2AA 1JNSA 3I6CA 4DT4A 4DZ2A 4TW7A 3PRBA 4DRIA 1C9HA 2N87A 2XP6A 2ZR6A 4DZ3A 5HUAA 2ITKA 4DRKA 2LJ4A 4LAYA 1EQ3A 4DIPA 2RUCA 4JFLA 2KGJA 1QZ2A 2XP8A 3O5PA 4JFJA 2ZQTA 1BKFA 4DRHA 2KE0A 1D7IA 1W26A 4ODNA 1EYMA 1FKLA 3KACA 1ZCNA 3UQBA 3B7XA 1FKHA 1FKDA 2KFWA 1A7XA 4ODRA 3UQAA 1U79A 2MF9A 3KADA 1FKGA 2XPBA 5DIUA 4DRQA 3UQIA 3IKGA 2ZR4A 5HW6A 1FKJA 5HWBA 4ODLA 3NI6A 3PRDA 1FAPA 4JFMA 4NNRA 4N19A 5GPGA 4DRPA 2MLXA 2ZQSA 4MGVA 1PINA 2PBCA 3KAHA 1FKTA 1R9HA 1F40A 4BF8A 1FKRA 5HKGA 5HW8A 1KT1A 3LUOA 1FKKA 1B6CA 4FAPA 3IHZA 2FAPA 2ZQUA 1PBKA 5HT1A 4U85A 3O5MA 1FKFA 2K8IA 1D6OA 1ROTA 1KT0A 3GPKA 4ITZA 3EY6A 3JXVA 2Q5AA 1F8AB 1FKSA 5DITA 1HXVA 2M08A 2XP7A 3O5IA 3O5LA 4ODKA 1ZK6A 1J4IA 3IK8A 3KZ7A 5HTGA
chains in the Genus database with same CATH superfamily
4JFKA 3RFWA 3O5KA 1Y0OA 2WM0A 1L1PA 1NWRA 3O5JA 2XP4A 3G6MA 3KAFA 1GPFA 3O5GA 2VCDA 4DRMA 2KR7A 2PPNA 3TCZA 4W9QA 4U84A 1D7JA 1QPFA 2JZVA 3O5FA 4R0XA 2DG4A 3WD4A 2LKNA 3TC5A 2Y78A 1J4HA 4AY1A 4DH0A 2MPHA 2MNTA 4DRJA 4TW8A 1NMWA 3WH0A 3CGMA 2PPPA 2RURA 4TX0A 2LGOA 1CTNA 3JYJA 4C02B 2L2SA 1X6LA 1Q1CA 3WD1A 1OGBA 2RQSA 2A3BA 1E6NA 5B8IC 1JNTA 2MLYA 3MDYB 4P8UA 1NSGA 2PV1A 3ALGA 3VAWA 4ODMA 2B5UB 4JFIA 5HW7A 3FAPA 5GQBA 3WQVA 1ZBWA 1EIBA 3TDBA 3WL0A 4JYSA 2XP3A 4IPXA 1FJDA 2FDMA 4DZ2A 4TW7A 3PR9A 4URIA 2LJ4A 1EQ3A 3RM8A 4DIPA 2EULA 1QZ2A 2XP8A 4JFJA 4DWSA 1D7IA 2KE0A 1EYMA 4Q7NA 1UR8A 2KFWA 3UQAA 3KADA 2MF9A 2XPBA 4S3JA 3UQIA 3IKGA 3ARVA 5HW6A 3AROA 1UR9A 1WB0A 4S3KA 3NI6A 3PRDA 4JFMA 5HBFA 4N19A 4Z2KA 2MLXA 1F40A 1FKRA 4WK9A 5HKGA 2FAPA 2K8IA 1HKJA 3GPKA 2AOSA 4HBEA 3JXVA 1OGGA 3WD3A 1W1PA 1W1VA 2QF8A 4ODKA 1J4IA 1E15A 3IK8A 2DSUA 4DWSD 2ZR5A 4G2PA 1E9LA 3WL1A 3O5QA 2PPOA 2F21A 3AQUA 2PV2A 2UZ5A 1TFVA 4J4NA 1Q6IA 4LAXA 3IKDA 2DT2A 1GOIA 3KABA 1J6YA 3CHEA 1ROUA 2FKEA 2RUDA 2KI3A 4MSPA 3CHCA 5DITA 2F23A 1JVWA 1YW5A 3RM9A 1LG1A 3B9DA 4KR0B 4ODPA 1ZBCA 1WAWA 2PV3A 2RUQA 3O5OA 3NTPA 4P8WA 3WD0A 4QT2A 2MLZA 1W9PA 1FFQA 2OFNA 3H9RB 4TNSA 3RM4A 5DIVA 2A3EA 4LAVA 4GIVA 1FKIA 1FD9A 1JNDA 3O5DA 4FN2A 4ZPWR 4G50A 3ARXA 4HBOA 4DT4A 1ITXA 4Q22A 2XP6A 5HUAA 1IX5A 4LAYA 4W5UA 3ARSA 4JFLA 1W1YA 2ZQTA 1BKFA 4ODNA 1ZCNA 3WQWA 1FKHA 1E6PA 1SR0A 3ARPA 1HKKA 1SYTA 3ARZA 3EIPA 3WKZA 3ARRA 3ARWA 4MAVA 4DRQA 3AS1A 5DEZA 2A3CA 4PTMA 1ZBKA 4KQZA 3FY1A 3AS3A 4WKAA 1FAPA 1JNEA 4DRPA 3KAHA 2B31A 5HW8A 4DWSC 1B6CA 4FAPA 2O92A 2ZQUA 1EDQA 3O5MA 1D6OA 1HXVA 2M08A 1HKMA 1HJVA 2O9OA 2XP7A 1K9TA 2P4VA 5DF0A 1NWSA 3OA5A 1WNOA 3CH9A 4IQ2A 3UI5A 4ZS6A 2F4EA 1TCOC 3CZ8A 2XP9A 4L3NA 3PRAA 4J4OA 1BL4A 2G8ZA 1M5YA 1E44A 2PN0A 3O5EA 2G41A 1Q6HA 3UF8A 4Z2HA 1NWUA 3OOBA 1KFWA 1J4RA 1FKBA 2DG3A 3O5RA 3RMEA 4QIBA 3JYMA 3ARQA 2ZQVA 5GPRA 2VN1A 3AS2A 2D9FA 3RGCA 2DG9A 3CHDA 4ODQA 3GU0A 5I98A 2DT0A 3ARYA 1Q6UA 1VF8A 1X6NA 4LGXA 5BXJA 3BMBA 3KAIA 4UDMA 1ZB5A 2XPAA 3ARUA 3ARTA 1LL6A 5D75A 1P5QA 1NMVA 1W9UA 3CGNA 3G6LA 3B9AA 5HWCA 2M1IA 3BXWA 3ODKA 1FFRA 2M2AA 1HJWA 3PRBA 4DRIA 2N87A 4DZ3A 4MNLA 2ITKA 1XRVA 4Z2GA 2RUCA 2KGJA 3O5PA 2YBTA 4P8VA 4DRHA 1W26A 1H0GA 4WKHA 1A7XA 4ODRA 1LG2A 4MNMA 2WLZA 2ZR4A 4WJXA 2YBUA 1FKJA 5HWBA 4ODLA 1HJXA 2DSWA 5GPGA 4MGVA 1FKTA 4L72B 1LL4A 4QZVB 2IUZA 4MTVA 3LUOA 1FKKA 3IHZA 1ZL1A 1GRJA 1HKIA 4U85A 1ROTA 1KT0A 4MNJA 3EY6A 2Q5AA 1F8AB 1FKSA 4R5EA 4HARA 5JH8A 3O5LA 1ZK6A 3ALFA 4MNKA 2DT1A 1H0IA 5HTGA 4ZPVR 4IT6A 1OWQA 2WLYA 1GUVA 3NRKA 3AS0A 5J6EA 3QOKA 1W1TA 4NSBA 1QPLA 4O2TA 1NH6A 4Z2JA 3FXYA 4TYOA 4TW6A 1ZBVA 4U86A 3UI4A 3KAGA 1W9VA 2DPEA 2IF4A 4DROA 4XAKA 4WKFA 3CHFA 4W9PA 4GGQA 4W9OA 2LPVA 2ESCA 2WK2A 3KCEA 4MPKA 4NZCA 4ODOA 1NWTA 2KO7A 2XP5A 1N1AA 2RSEA 4DWSB 1YATA 4IT4A 1T11A 3PA7A 2DSVA 4LAWA 1D7HA 1D2KA 1LL7A 4IQCA 5DO2A 4DRNA 2F2DA 2AWGA 1E6RA 4P8XA 2A3AA 3UI6A 3WIJA 2PI6A 4QT3A 1JNSA 3I6CA 1LJYA 1C9HA 2ZR6A 4Z2IA 4DRKA 4WIWA 2OLHA 3UQBA 1FKLA 3KACA 3B7XA 1FKDA 1U79A 1FKGA 5DIUA 4Z2LA 1JCHB 1ZU8A 1E6ZA 2ETNA 2DSZA 4NNRA 1RD6A 2ZQSA 1PINA 2PBCA 1R9HA 3B8SA 4BF8A 1KT1A 3WD2A 3W4RA 1PBKA 5HT1A 1FKFA 1LQ0A 4ZPTR 1XHGA 4ITZA 2DT3A 3GTYX 1O6IA 3O5IA 1EHNA 3B9EA 4ML4A 3KZ7A
chains in the Genus database with same CATH topology
4JFKA 3RFWA 3O5KA 1Y0OA 2WM0A 1L1PA 1NWRA 3O5JA 2XP4A 3G6MA 3KAFA 1GPFA 3O5GA 2VCDA 4DRMA 2KR7A 2PPNA 3TCZA 4W9QA 4U84A 1D7JA 1QPFA 2JZVA 3O5FA 4R0XA 2DG4A 3WD4A 2LKNA 3TC5A 2Y78A 1J4HA 4AY1A 4DH0A 2MPHA 2MNTA 4DRJA 4TW8A 1NMWA 3WH0A 3CGMA 2PPPA 2RURA 4TX0A 2LGOA 1CTNA 3JYJA 4C02B 2L2SA 1X6LA 1Q1CA 3WD1A 1OGBA 2RQSA 2A3BA 1E6NA 5B8IC 1JNTA 2MLYA 3MDYB 4P8UA 1NSGA 2PV1A 3ALGA 3VAWA 4ODMA 4JFIA 5HW7A 3FAPA 5GQBA 3WQVA 1ZBWA 1EIBA 3TDBA 3WL0A 4JYSA 2XP3A 4IPXA 1FJDA 2FDMA 4DZ2A 4TW7A 3PR9A 4URIA 2LJ4A 1EQ3A 3RM8A 4DIPA 1QZ2A 2XP8A 4JFJA 4DWSA 1D7IA 2KE0A 1EYMA 4Q7NA 1UR8A 2KFWA 3UQAA 3KADA 2MF9A 2XPBA 4S3JA 3UQIA 3IKGA 3ARVA 5HW6A 3AROA 1UR9A 1WB0A 4S3KA 3NI6A 3PRDA 4JFMA 5HBFA 4N19A 4Z2KA 2MLXA 1F40A 1FKRA 4WK9A 5HKGA 2FAPA 2K8IA 1HKJA 3GPKA 2AOSA 4HBEA 3JXVA 1OGGA 3WD3A 1W1PA 1W1VA 2QF8A 4ODKA 1J4IA 1E15A 3IK8A 2DSUA 4DWSD 2ZR5A 4G2PA 1E9LA 3WL1A 3O5QA 2PPOA 2F21A 3AQUA 2PV2A 2UZ5A 1TFVA 4J4NA 1Q6IA 4LAXA 3IKDA 2DT2A 1GOIA 3KABA 1J6YA 3CHEA 1ROUA 2FKEA 2RUDA 2KI3A 4MSPA 3CHCA 5DITA 1JVWA 1YW5A 3RM9A 1LG1A 3B9DA 4KR0B 4ODPA 1ZBCA 1WAWA 2PV3A 2RUQA 3O5OA 3NTPA 4P8WA 3WD0A 4QT2A 2MLZA 1W9PA 1FFQA 2OFNA 3H9RB 4TNSA 3RM4A 5DIVA 2A3EA 4LAVA 4GIVA 1FKIA 1FD9A 1JNDA 3O5DA 4FN2A 4ZPWR 4G50A 3ARXA 4HBOA 4DT4A 1ITXA 4Q22A 2XP6A 5HUAA 1IX5A 4LAYA 4W5UA 3ARSA 4JFLA 1W1YA 2ZQTA 1BKFA 4ODNA 1ZCNA 3WQWA 1FKHA 1E6PA 1SR0A 3ARPA 1HKKA 1SYTA 3ARZA 3WKZA 3ARRA 3ARWA 4MAVA 4DRQA 3AS1A 5DEZA 2A3CA 4PTMA 1ZBKA 4KQZA 3FY1A 3AS3A 4WKAA 1FAPA 1JNEA 4DRPA 3KAHA 2B31A 5HW8A 4DWSC 1B6CA 4FAPA 2O92A 2ZQUA 1EDQA 3O5MA 1D6OA 1HXVA 2M08A 1HKMA 1HJVA 2O9OA 2XP7A 1K9TA 5DF0A 1NWSA 3OA5A 1WNOA 3CH9A 4IQ2A 3UI5A 4ZS6A 2F4EA 1TCOC 3CZ8A 2XP9A 4L3NA 3PRAA 4J4OA 1BL4A 2G8ZA 1M5YA 3O5EA 2G41A 1Q6HA 3UF8A 4Z2HA 1NWUA 3OOBA 1KFWA 1J4RA 1FKBA 2DG3A 3O5RA 3RMEA 4QIBA 3JYMA 3ARQA 2ZQVA 5GPRA 2VN1A 3AS2A 2D9FA 3RGCA 2DG9A 3CHDA 4ODQA 5I98A 2DT0A 3ARYA 1Q6UA 1VF8A 1X6NA 4LGXA 5BXJA 3KAIA 1ZB5A 2XPAA 3ARUA 3ARTA 1LL6A 5D75A 1P5QA 1NMVA 1W9UA 3CGNA 3G6LA 3B9AA 5HWCA 2M1IA 3BXWA 3ODKA 1FFRA 2M2AA 1HJWA 3PRBA 4DRIA 2N87A 4DZ3A 4MNLA 2ITKA 1XRVA 4Z2GA 2RUCA 2KGJA 3O5PA 2YBTA 4P8VA 4DRHA 1W26A 1H0GA 4WKHA 1A7XA 4ODRA 1LG2A 4MNMA 2WLZA 2ZR4A 4WJXA 2YBUA 1FKJA 5HWBA 4ODLA 1HJXA 2DSWA 5GPGA 4MGVA 1FKTA 4L72B 1LL4A 4QZVB 2IUZA 4MTVA 3LUOA 1FKKA 3IHZA 1ZL1A 1HKIA 4U85A 1ROTA 1KT0A 4MNJA 3EY6A 2Q5AA 1F8AB 1FKSA 4R5EA 4HARA 5JH8A 3O5LA 1ZK6A 3ALFA 4MNKA 2DT1A 1H0IA 5HTGA 4ZPVR 4IT6A 1OWQA 2WLYA 1GUVA 3NRKA 3AS0A 5J6EA 3QOKA 1W1TA 4NSBA 1QPLA 4O2TA 1NH6A 4Z2JA 3FXYA 4TYOA 4TW6A 1ZBVA 4U86A 3UI4A 3KAGA 1W9VA 2DPEA 2IF4A 4DROA 4XAKA 4WKFA 3CHFA 4W9PA 4GGQA 4W9OA 2LPVA 2ESCA 2WK2A 3KCEA 4MPKA 4NZCA 4ODOA 1NWTA 2KO7A 2XP5A 1N1AA 2RSEA 4DWSB 1YATA 4IT4A 1T11A 3PA7A 2DSVA 4LAWA 1D7HA 1D2KA 1LL7A 4IQCA 5DO2A 4DRNA 2F2DA 2AWGA 1E6RA 4P8XA 2A3AA 3UI6A 3WIJA 2PI6A 4QT3A 1JNSA 3I6CA 1LJYA 1C9HA 2ZR6A 4Z2IA 4DRKA 4WIWA 2OLHA 3UQBA 1FKLA 3KACA 3B7XA 1FKDA 1U79A 1FKGA 5DIUA 4Z2LA 1ZU8A 1E6ZA 2DSZA 4NNRA 1RD6A 2ZQSA 1PINA 2PBCA 1R9HA 3B8SA 4BF8A 1KT1A 3WD2A 3W4RA 1PBKA 5HT1A 1FKFA 1LQ0A 4ZPTR 1XHGA 4ITZA 2DT3A 1O6IA 3O5IA 1EHNA 3B9EA 4ML4A 3KZ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZR5 A;  4JFK A;  4G2P A;  4IQ2 A;  3NRK A;  3UI5 A;  3RFW A;  3O5K A;  1Y0O A;  3O5Q A;  2PPO A;  2F21 A;  2PV2 A;  5J6E A;  2UZ5 A;  2F4E A;  1TCO C;  1QPL A;  4O2T A;  2XP9 A;  4J4N A;  1L1P A;  3O5J A;  2XP4 A;  3KAF A;  4J4O A;  1Q6I A;  3O5G A;  2VCD A;  4TYO A;  4TW6 A;  4LAX A;  4DRM A;  1BL4 A;  3IKD A;  4U86 A;  3UI4 A;  3KAG A;  2KR7 A;  2PPN A;  3TCZ A;  2IF4 A;  3KAB A;  4W9Q A;  4U84 A;  1M5Y A;  1D7J A;  4DRO A;  1J6Y A;  1QPF A;  2JZV A;  3O5F A;  4R0X A;  4W9P A;  3O5E A;  4GGQ A;  2DG4 A;  4W9O A;  1Q6H A;  2LPV A;  3UF8 A;  2LKN A;  3KCE A;  1ROU A;  3TC5 A;  2FKE A;  2RUD A;  2KI3 A;  3OOB A;  2Y78 A;  1J4H A;  4MSP A;  4DH0 A;  2MPH A;  1J4R A;  1FKB A;  2MNT A;  2KO7 A;  2DG3 A;  1NMW A;  1N1A A;  2RSE A;  2XP5 A;  3O5R A;  3CGM A;  4TW8 A;  2PPP A;  3WH0 A;  4QIB A;  3JYM A;  1JVW A;  1YW5 A;  2ZQV A;  2RUR A;  1YAT A;  2VN1 A;  4TX0 A;  4ODP A;  1T11 A;  2PV3 A;  2RUQ A;  3PA7 A;  2LGO A;  3O5O A;  3JYJ A;  2D9F A;  3RGC A;  4C02 B;  2DG9 A;  3NTP A;  2L2S A;  1D7H A;  4LAW A;  4ODQ A;  1Q1C A;  4QT2 A;  2RQS A;  2MLZ A;  5I98 A;  4IQC A;  5B8I C;  1JNT A;  2MLY A;  3MDY B;  1NSG A;  1Q6U A;  2PV1 A;  3VAW A;  4ODM A;  5BXJ A;  2OFN A;  3H9R B;  3KAI A;  4TNS A;  4JFI A;  5DIV A;  4DRN A;  3FAP A;  5HW7 A;  2F2D A;  4LAV A;  2XPA A;  4GIV A;  5D75 A;  1P5Q A;  1NMV A;  2AWG A;  3TDB A;  1FKI A;  1FD9 A;  3O5D A;  4FN2 A;  3CGN A;  4ODO A;  4JYS A;  3UI6 A;  4G50 A;  2XP3 A;  4IPX A;  5HWC A;  2M1I A;  3ODK A;  4QT3 A;  4DRJ A;  1FJD A;  2M2A A;  1JNS A;  3I6C A;  4DT4 A;  4DZ2 A;  4TW7 A;  3PRB A;  4DRI A;  1C9H A;  2N87 A;  2XP6 A;  2ZR6 A;  4DZ3 A;  5HUA A;  2ITK A;  4DRK A;  2LJ4 A;  4LAY A;  1EQ3 A;  4DIP A;  2RUC A;  4JFL A;  2KGJ A;  1QZ2 A;  2XP8 A;  3O5P A;  4JFJ A;  2ZQT A;  1BKF A;  4DRH A;  2KE0 A;  1D7I A;  1W26 A;  4ODN A;  1EYM A;  1FKL A;  3KAC A;  1ZCN A;  3UQB A;  3B7X A;  1FKH A;  1FKD A;  2KFW A;  1A7X A;  4ODR A;  3UQA A;  1U79 A;  2MF9 A;  3KAD A;  1FKG A;  2XPB A;  5DIU A;  4DRQ A;  3UQI A;  3IKG A;  2ZR4 A;  5HW6 A;  1FKJ A;  5HWB A;  4ODL A;  3NI6 A;  3PRD A;  1FAP A;  4JFM A;  4NNR A;  4N19 A;  5GPG A;  4DRP A;  2MLX A;  2ZQS A;  4MGV A;  1PIN A;  2PBC A;  3KAH A;  1FKT A;  1R9H A;  1F40 A;  4BF8 A;  1FKR A;  5HKG A;  5HW8 A;  1KT1 A;  3LUO A;  1FKK A;  1B6C A;  4FAP A;  3IHZ A;  2FAP A;  2ZQU A;  1PBK A;  5HT1 A;  4U85 A;  3O5M A;  1FKF A;  2K8I A;  1D6O A;  1ROT A;  1KT0 A;  3GPK A;  4ITZ A;  3EY6 A;  3JXV A;  2Q5A A;  1F8A B;  1FKS A;  5DIT A;  1HXV A;  2M08 A;  2XP7 A;  3O5I A;  3O5L A;  4ODK A;  1ZK6 A;  1J4I A;  3IK8 A;  3KZ7 A;  5HTG A; 
#chains in the Genus database with same CATH topology
 4JFK A;  3RFW A;  3O5K A;  1Y0O A;  2WM0 A;  1L1P A;  1NWR A;  3O5J A;  2XP4 A;  3G6M A;  3KAF A;  1GPF A;  3O5G A;  2VCD A;  4DRM A;  2KR7 A;  2PPN A;  3TCZ A;  4W9Q A;  4U84 A;  1D7J A;  1QPF A;  2JZV A;  3O5F A;  4R0X A;  2DG4 A;  3WD4 A;  2LKN A;  3TC5 A;  2Y78 A;  1J4H A;  4AY1 A;  4DH0 A;  2MPH A;  2MNT A;  4DRJ A;  4TW8 A;  1NMW A;  3WH0 A;  3CGM A;  2PPP A;  2RUR A;  4TX0 A;  2LGO A;  1CTN A;  3JYJ A;  4C02 B;  2L2S A;  1X6L A;  1Q1C A;  3WD1 A;  1OGB A;  2RQS A;  2A3B A;  1E6N A;  5B8I C;  1JNT A;  2MLY A;  3MDY B;  4P8U A;  1NSG A;  2PV1 A;  3ALG A;  3VAW A;  4ODM A;  2B5U B;  4JFI A;  5HW7 A;  3FAP A;  5GQB A;  3WQV A;  1ZBW A;  1EIB A;  3TDB A;  3WL0 A;  4JYS A;  2XP3 A;  4IPX A;  1FJD A;  2FDM A;  4DZ2 A;  4TW7 A;  3PR9 A;  4URI A;  2LJ4 A;  1EQ3 A;  3RM8 A;  4DIP A;  2EUL A;  1QZ2 A;  2XP8 A;  4JFJ A;  4DWS A;  1D7I A;  2KE0 A;  1EYM A;  4Q7N A;  1UR8 A;  2KFW A;  3UQA A;  3KAD A;  2MF9 A;  2XPB A;  4S3J A;  3UQI A;  3IKG A;  3ARV A;  5HW6 A;  3ARO A;  1UR9 A;  1WB0 A;  4S3K A;  3NI6 A;  3PRD A;  4JFM A;  5HBF A;  4N19 A;  4Z2K A;  2MLX A;  1F40 A;  1FKR A;  4WK9 A;  5HKG A;  2FAP A;  2K8I A;  1HKJ A;  3GPK A;  2AOS A;  4HBE A;  3JXV A;  1OGG A;  3WD3 A;  1W1P A;  1W1V A;  2QF8 A;  4ODK A;  1J4I A;  1E15 A;  3IK8 A;  2DSU A;  4DWS D;  2ZR5 A;  4G2P A;  1E9L A;  3WL1 A;  3O5Q A;  2PPO A;  2F21 A;  3AQU A;  2PV2 A;  2UZ5 A;  1TFV A;  4J4N A;  1Q6I A;  4LAX A;  3IKD A;  2DT2 A;  1GOI A;  3KAB A;  1J6Y A;  3CHE A;  1ROU A;  2FKE A;  2RUD A;  2KI3 A;  4MSP A;  3CHC A;  5DIT A;  2F23 A;  1JVW A;  1YW5 A;  3RM9 A;  1LG1 A;  3B9D A;  4KR0 B;  4ODP A;  1ZBC A;  1WAW A;  2PV3 A;  2RUQ A;  3O5O A;  3NTP A;  4P8W A;  3WD0 A;  4QT2 A;  2MLZ A;  1W9P A;  1FFQ A;  2OFN A;  3H9R B;  4TNS A;  3RM4 A;  5DIV A;  2A3E A;  4LAV A;  4GIV A;  1FKI A;  1FD9 A;  1JND A;  3O5D A;  4FN2 A;  4ZPW R;  4G50 A;  3ARX A;  4HBO A;  4DT4 A;  1ITX A;  4Q22 A;  2XP6 A;  5HUA A;  1IX5 A;  4LAY A;  4W5U A;  3ARS A;  4JFL A;  1W1Y A;  2ZQT A;  1BKF A;  4ODN A;  1ZCN A;  3WQW A;  1FKH A;  1E6P A;  1SR0 A;  3ARP A;  1HKK A;  1SYT A;  3ARZ A;  3EIP A;  3WKZ A;  3ARR A;  3ARW A;  4MAV A;  4DRQ A;  3AS1 A;  5DEZ A;  2A3C A;  4PTM A;  1ZBK A;  4KQZ A;  3FY1 A;  3AS3 A;  4WKA A;  1FAP A;  1JNE A;  4DRP A;  3KAH A;  2B31 A;  5HW8 A;  4DWS C;  1B6C A;  4FAP A;  2O92 A;  2ZQU A;  1EDQ A;  3O5M A;  1D6O A;  1HXV A;  2M08 A;  1HKM A;  1HJV A;  2O9O A;  2XP7 A;  1K9T A;  2P4V A;  5DF0 A;  1NWS A;  3OA5 A;  1WNO A;  3CH9 A;  4IQ2 A;  3UI5 A;  4ZS6 A;  2F4E A;  1TCO C;  3CZ8 A;  2XP9 A;  4L3N A;  3PRA A;  4J4O A;  1BL4 A;  2G8Z A;  1M5Y A;  1E44 A;  2PN0 A;  3O5E A;  2G41 A;  1Q6H A;  3UF8 A;  4Z2H A;  1NWU A;  3OOB A;  1KFW A;  1J4R A;  1FKB A;  2DG3 A;  3O5R A;  3RME A;  4QIB A;  3JYM A;  3ARQ A;  2ZQV A;  5GPR A;  2VN1 A;  3AS2 A;  2D9F A;  3RGC A;  2DG9 A;  3CHD A;  4ODQ A;  3GU0 A;  5I98 A;  2DT0 A;  3ARY A;  1Q6U A;  1VF8 A;  1X6N A;  4LGX A;  5BXJ A;  3BMB A;  3KAI A;  4UDM A;  1ZB5 A;  2XPA A;  3ARU A;  3ART A;  1LL6 A;  5D75 A;  1P5Q A;  1NMV A;  1W9U A;  3CGN A;  3G6L A;  3B9A A;  5HWC A;  2M1I A;  3BXW A;  3ODK A;  1FFR A;  2M2A A;  1HJW A;  3PRB A;  4DRI A;  2N87 A;  4DZ3 A;  4MNL A;  2ITK A;  1XRV A;  4Z2G A;  2RUC A;  2KGJ A;  3O5P A;  2YBT A;  4P8V A;  4DRH A;  1W26 A;  1H0G A;  4WKH A;  1A7X A;  4ODR A;  1LG2 A;  4MNM A;  2WLZ A;  2ZR4 A;  4WJX A;  2YBU A;  1FKJ A;  5HWB A;  4ODL A;  1HJX A;  2DSW A;  5GPG A;  4MGV A;  1FKT A;  4L72 B;  1LL4 A;  4QZV B;  2IUZ A;  4MTV A;  3LUO A;  1FKK A;  3IHZ A;  1ZL1 A;  1GRJ A;  1HKI A;  4U85 A;  1ROT A;  1KT0 A;  4MNJ A;  3EY6 A;  2Q5A A;  1F8A B;  1FKS A;  4R5E A;  4HAR A;  5JH8 A;  3O5L A;  1ZK6 A;  3ALF A;  4MNK A;  2DT1 A;  1H0I A;  5HTG A;  4ZPV R;  4IT6 A;  1OWQ A;  2WLY A;  1GUV A;  3NRK A;  3AS0 A;  5J6E A;  3QOK A;  1W1T A;  4NSB A;  1QPL A;  4O2T A;  1NH6 A;  4Z2J A;  3FXY A;  4TYO A;  4TW6 A;  1ZBV A;  4U86 A;  3UI4 A;  3KAG A;  1W9V A;  2DPE A;  2IF4 A;  4DRO A;  4XAK A;  4WKF A;  3CHF A;  4W9P A;  4GGQ A;  4W9O A;  2LPV A;  2ESC A;  2WK2 A;  3KCE A;  4MPK A;  4NZC A;  4ODO A;  1NWT A;  2KO7 A;  2XP5 A;  1N1A A;  2RSE A;  4DWS B;  1YAT A;  4IT4 A;  1T11 A;  3PA7 A;  2DSV A;  4LAW A;  1D7H A;  1D2K A;  1LL7 A;  4IQC A;  5DO2 A;  4DRN A;  2F2D A;  2AWG A;  1E6R A;  4P8X A;  2A3A A;  3UI6 A;  3WIJ A;  2PI6 A;  4QT3 A;  1JNS A;  3I6C A;  1LJY A;  1C9H A;  2ZR6 A;  4Z2I A;  4DRK A;  4WIW A;  2OLH A;  3UQB A;  1FKL A;  3KAC A;  3B7X A;  1FKD A;  1U79 A;  1FKG A;  5DIU A;  4Z2L A;  1JCH B;  1ZU8 A;  1E6Z A;  2ETN A;  2DSZ A;  4NNR A;  1RD6 A;  2ZQS A;  1PIN A;  2PBC A;  1R9H A;  3B8S A;  4BF8 A;  1KT1 A;  3WD2 A;  3W4R A;  1PBK A;  5HT1 A;  1FKF A;  1LQ0 A;  4ZPT R;  1XHG A;  4ITZ A;  2DT3 A;  3GTY X;  1O6I A;  3O5I A;  1EHN A;  3B9E A;  4ML4 A;  3KZ7 A; 
#chains in the Genus database with same CATH homology
 4JFK A;  3RFW A;  3O5K A;  1Y0O A;  2WM0 A;  1L1P A;  1NWR A;  3O5J A;  2XP4 A;  3G6M A;  3KAF A;  1GPF A;  3O5G A;  2VCD A;  4DRM A;  2KR7 A;  2PPN A;  3TCZ A;  4W9Q A;  4U84 A;  1D7J A;  1QPF A;  2JZV A;  3O5F A;  4R0X A;  2DG4 A;  3WD4 A;  2LKN A;  3TC5 A;  2Y78 A;  1J4H A;  4AY1 A;  4DH0 A;  2MPH A;  2MNT A;  4DRJ A;  4TW8 A;  1NMW A;  3WH0 A;  3CGM A;  2PPP A;  2RUR A;  4TX0 A;  2LGO A;  1CTN A;  3JYJ A;  4C02 B;  2L2S A;  1X6L A;  1Q1C A;  3WD1 A;  1OGB A;  2RQS A;  2A3B A;  1E6N A;  5B8I C;  1JNT A;  2MLY A;  3MDY B;  4P8U A;  1NSG A;  2PV1 A;  3ALG A;  3VAW A;  4ODM A;  4JFI A;  5HW7 A;  3FAP A;  5GQB A;  3WQV A;  1ZBW A;  1EIB A;  3TDB A;  3WL0 A;  4JYS A;  2XP3 A;  4IPX A;  1FJD A;  2FDM A;  4DZ2 A;  4TW7 A;  3PR9 A;  4URI A;  2LJ4 A;  1EQ3 A;  3RM8 A;  4DIP A;  1QZ2 A;  2XP8 A;  4JFJ A;  4DWS A;  1D7I A;  2KE0 A;  1EYM A;  4Q7N A;  1UR8 A;  2KFW A;  3UQA A;  3KAD A;  2MF9 A;  2XPB A;  4S3J A;  3UQI A;  3IKG A;  3ARV A;  5HW6 A;  3ARO A;  1UR9 A;  1WB0 A;  4S3K A;  3NI6 A;  3PRD A;  4JFM A;  5HBF A;  4N19 A;  4Z2K A;  2MLX A;  1F40 A;  1FKR A;  4WK9 A;  5HKG A;  2FAP A;  2K8I A;  1HKJ A;  3GPK A;  2AOS A;  4HBE A;  3JXV A;  1OGG A;  3WD3 A;  1W1P A;  1W1V A;  2QF8 A;  4ODK A;  1J4I A;  1E15 A;  3IK8 A;  2DSU A;  4DWS D;  2ZR5 A;  4G2P A;  1E9L A;  3WL1 A;  3O5Q A;  2PPO A;  2F21 A;  3AQU A;  2PV2 A;  2UZ5 A;  1TFV A;  4J4N A;  1Q6I A;  4LAX A;  3IKD A;  2DT2 A;  1GOI A;  3KAB A;  1J6Y A;  3CHE A;  1ROU A;  2FKE A;  2RUD A;  2KI3 A;  4MSP A;  3CHC A;  5DIT A;  1JVW A;  1YW5 A;  3RM9 A;  1LG1 A;  3B9D A;  4KR0 B;  4ODP A;  1ZBC A;  1WAW A;  2PV3 A;  2RUQ A;  3O5O A;  3NTP A;  4P8W A;  3WD0 A;  4QT2 A;  2MLZ A;  1W9P A;  1FFQ A;  2OFN A;  3H9R B;  4TNS A;  3RM4 A;  5DIV A;  2A3E A;  4LAV A;  4GIV A;  1FKI A;  1FD9 A;  1JND A;  3O5D A;  4FN2 A;  4ZPW R;  4G50 A;  3ARX A;  4HBO A;  4DT4 A;  1ITX A;  4Q22 A;  2XP6 A;  5HUA A;  1IX5 A;  4LAY A;  4W5U A;  3ARS A;  4JFL A;  1W1Y A;  2ZQT A;  1BKF A;  4ODN A;  1ZCN A;  3WQW A;  1FKH A;  1E6P A;  1SR0 A;  3ARP A;  1HKK A;  1SYT A;  3ARZ A;  3WKZ A;  3ARR A;  3ARW A;  4MAV A;  4DRQ A;  3AS1 A;  5DEZ A;  2A3C A;  4PTM A;  1ZBK A;  4KQZ A;  3FY1 A;  3AS3 A;  4WKA A;  1FAP A;  1JNE A;  4DRP A;  3KAH A;  2B31 A;  5HW8 A;  4DWS C;  1B6C A;  4FAP A;  2O92 A;  2ZQU A;  1EDQ A;  3O5M A;  1D6O A;  1HXV A;  2M08 A;  1HKM A;  1HJV A;  2O9O A;  2XP7 A;  1K9T A;  5DF0 A;  1NWS A;  3OA5 A;  1WNO A;  3CH9 A;  4IQ2 A;  3UI5 A;  4ZS6 A;  2F4E A;  1TCO C;  3CZ8 A;  2XP9 A;  4L3N A;  3PRA A;  4J4O A;  1BL4 A;  2G8Z A;  1M5Y A;  3O5E A;  2G41 A;  1Q6H A;  3UF8 A;  4Z2H A;  1NWU A;  3OOB A;  1KFW A;  1J4R A;  1FKB A;  2DG3 A;  3O5R A;  3RME A;  4QIB A;  3JYM A;  3ARQ A;  2ZQV A;  5GPR A;  2VN1 A;  3AS2 A;  2D9F A;  3RGC A;  2DG9 A;  3CHD A;  4ODQ A;  5I98 A;  2DT0 A;  3ARY A;  1Q6U A;  1VF8 A;  1X6N A;  4LGX A;  5BXJ A;  3KAI A;  1ZB5 A;  2XPA A;  3ARU A;  3ART A;  1LL6 A;  5D75 A;  1P5Q A;  1NMV A;  1W9U A;  3CGN A;  3G6L A;  3B9A A;  5HWC A;  2M1I A;  3BXW A;  3ODK A;  1FFR A;  2M2A A;  1HJW A;  3PRB A;  4DRI A;  2N87 A;  4DZ3 A;  4MNL A;  2ITK A;  1XRV A;  4Z2G A;  2RUC A;  2KGJ A;  3O5P A;  2YBT A;  4P8V A;  4DRH A;  1W26 A;  1H0G A;  4WKH A;  1A7X A;  4ODR A;  1LG2 A;  4MNM A;  2WLZ A;  2ZR4 A;  4WJX A;  2YBU A;  1FKJ A;  5HWB A;  4ODL A;  1HJX A;  2DSW A;  5GPG A;  4MGV A;  1FKT A;  4L72 B;  1LL4 A;  4QZV B;  2IUZ A;  4MTV A;  3LUO A;  1FKK A;  3IHZ A;  1ZL1 A;  1HKI A;  4U85 A;  1ROT A;  1KT0 A;  4MNJ A;  3EY6 A;  2Q5A A;  1F8A B;  1FKS A;  4R5E A;  4HAR A;  5JH8 A;  3O5L A;  1ZK6 A;  3ALF A;  4MNK A;  2DT1 A;  1H0I A;  5HTG A;  4ZPV R;  4IT6 A;  1OWQ A;  2WLY A;  1GUV A;  3NRK A;  3AS0 A;  5J6E A;  3QOK A;  1W1T A;  4NSB A;  1QPL A;  4O2T A;  1NH6 A;  4Z2J A;  3FXY A;  4TYO A;  4TW6 A;  1ZBV A;  4U86 A;  3UI4 A;  3KAG A;  1W9V A;  2DPE A;  2IF4 A;  4DRO A;  4XAK A;  4WKF A;  3CHF A;  4W9P A;  4GGQ A;  4W9O A;  2LPV A;  2ESC A;  2WK2 A;  3KCE A;  4MPK A;  4NZC A;  4ODO A;  1NWT A;  2KO7 A;  2XP5 A;  1N1A A;  2RSE A;  4DWS B;  1YAT A;  4IT4 A;  1T11 A;  3PA7 A;  2DSV A;  4LAW A;  1D7H A;  1D2K A;  1LL7 A;  4IQC A;  5DO2 A;  4DRN A;  2F2D A;  2AWG A;  1E6R A;  4P8X A;  2A3A A;  3UI6 A;  3WIJ A;  2PI6 A;  4QT3 A;  1JNS A;  3I6C A;  1LJY A;  1C9H A;  2ZR6 A;  4Z2I A;  4DRK A;  4WIW A;  2OLH A;  3UQB A;  1FKL A;  3KAC A;  3B7X A;  1FKD A;  1U79 A;  1FKG A;  5DIU A;  4Z2L A;  1ZU8 A;  1E6Z A;  2DSZ A;  4NNR A;  1RD6 A;  2ZQS A;  1PIN A;  2PBC A;  1R9H A;  3B8S A;  4BF8 A;  1KT1 A;  3WD2 A;  3W4R A;  1PBK A;  5HT1 A;  1FKF A;  1LQ0 A;  4ZPT R;  1XHG A;  4ITZ A;  2DT3 A;  1O6I A;  3O5I A;  1EHN A;  3B9E A;  4ML4 A;  3KZ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...