4DRQA

Exploration of pipecolate sulfonamides as binders of the fk506-binding proteins 51 and 52: complex of fkbp51 with 2-(3-((r)-1-((s)-1-(3,5-dichlorophenylsulfonyl)piperidine-2-carbonyloxy)-3-(3,4-dimethoxy -phenyl)propyl)phenoxy)acetic acid
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
128
structure length
128
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Exploration of Pipecolate Sulfonamides as Binders of the FK506-Binding Proteins 51 and 52.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 35
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4drqA00
2PBCA 4TW7A 2M2AA 3KACA 2MLYA 2XP6A 4J4OA 1N1AA 2RURA 3RFWA 4ODNA 3UI6A 3UI5A 1QZ2A 1R9HA 5GPGA 3RGCA 3CGMA 4ODPA 3VAWA 1JVWA 1ROTA 1FJDA 2RQSA 2XP3A 2N87A 2KGJA 2RUDA 4O2TA 3PA7A 3NRKA 4QT3A 5HT1A 4TX0A 2PV1A 1FD9A 2PPPA 1FKSA 1FKGA 2ZQTA 3EY6A 3IKDA 3OOBA 4J4NA 4DT4A 3O5EA 4GIVA 2M1IA 2PPOA 3O5LA 1W26A 2LKNA 1FKKA 2F4EA 3JYMA 3O5RA 4TNSA 2ZR6A 2RUQA 4IQ2A 2D9FA 2KFWA 5HW6A 1ROUA 2DG4A 1J4HA 1EQ3A 5HUAA 4DRQA 4DRIA 1F40A 1D7IA 1FKJA 2Y78A 1FKLA 2XPAA 4LAXA 4U84A 2KI3A 2MLZA 2XP5A 1ZCNA 5DIUA 1KT0A 2MPHA 4ITZA 4ODKA 3B7XA 1D7HA 1Y0OA 2ZR5A 1Q1CA 2Q5AA 4IPXA 1B6CA 4DRHA 4DZ3A 1D6OA 3IHZA 4JFKA 4U85A 3PRDA 2F21A 1YW5A 1JNTA 5DIVA 1FKRA 1C9HA 1TCOC 3IKGA 2ZQSA 3O5DA 1BKFA 4ODMA 3UQBA 3FAPA 5J6EA 3NI6A 1D7JA 4DROA 4DZ2A 3O5QA 2K8IA 2LGOA 4W9QA 5HWCA 1FAPA 1EYMA 1Q6UA 3I6CA 4JYSA 1T11A 3IK8A 1FKHA 2XP9A 1M5YA 3O5PA 3O5KA 5DITA 1A7XA 2PV2A 1NMWA 3GPKA 2XPBA 4DRPA 4DRJA 2LPVA 5HTGA 1L1PA 1NMVA 4DRMA 1QPFA 1QPLA 2OFNA 2RSEA 3LUOA 4GGQA 4ODOA 2UZ5A 4LAWA 3H9RB 2AWGA 3NTPA 3O5GA 4MGVA 4NNRA 3TCZA 4DIPA 3MDYB 2DG9A 2ZR4A 4LAYA 4N19A 3UI4A 4DRKA 4FAPA 5HWBA 1Q6HA 2KE0A 3JYJA 3KADA 2MLXA 3UQIA 2XP7A 2XP8A 4R0XA 4BF8A 5HW7A 5B8IC 3KABA 1FKFA 4TW8A 1PBKA 1PINA 3KAGA 1NSGA 2MNTA 1J4IA 3KZ7A 4IQCA 2KO7A 4U86A 2JZVA 2XP4A 3KAHA 2M08A 4G2PA 1P5QA 4ODLA 4QIBA 3TDBA 1KT1A 3UQAA 4FN2A 4JFIA 3JXVA 4DH0A 5HKGA 3O5OA 2IF4A 1J6YA 2L2SA 1ZK6A 4JFLA 4ODQA 3O5IA 1J4RA 3ODKA 4LAVA 1Q6IA 4ODRA 4MSPA 2MF9A 2LJ4A 4W9OA 3UF8A 3PRBA 3KAIA 2FKEA 4JFJA 4QT2A 1FKBA 3O5FA 3KAFA 1YATA 4TW6A 3O5MA 3O5JA 2ZQVA 1FKIA 2VN1A 2KR7A 2ZQUA 3KCEA 4G50A 2PPNA 3TC5A 4DRNA 1FKDA 2ITKA 4W9PA 5HW8A 2PV3A 1BL4A 4JFMA 1HXVA 1F8AB 2VCDA 1FKTA 4C02B 5BXJA 1JNSA 2FAPA 2F2DA 4TYOA 3WH0A 3CGNA 5D75A 1U79A 5I98A 2RUCA 2DG3A
chains in the Genus database with same CATH superfamily
3B9EA 4DWSB 2XP6A 1N1AA 1LJYA 1XHGA 5GPGA 1LL6A 3CHEA 1ROTA 1FJDA 2RUDA 2AOSA 3PA7A 3NRKA 4QT3A 2PPPA 1O6IA 1FKGA 2O92A 2ZQTA 3IKDA 3OOBA 1OGBA 2PPOA 4Z2KA 4Z2HA 1W9UA 3O5RA 3CH9A 4Z2LA 1WNOA 4IQ2A 4R5EA 5HUAA 1D7IA 2Y78A 1E44A 4XAKA 2MPHA 4ODKA 3WD0A 4JFKA 1YW5A 4WIWA 1W9PA 5GPRA 2ZQSA 1BKFA 1ZB5A 3FXYA 4QZVB 1D7JA 1FFRA 3PRAA 2K8IA 3B9AA 1FAPA 1EYMA 1Q6UA 3GU0A 1EIBA 3ARTA 1K9TA 1NMWA 3GPKA 3WD1A 3RM8A 4DRPA 1E6NA 5HTGA 3ARYA 2OFNA 4GGQA 1LG1A 4P8WA 2DSWA 4LAWA 4MGVA 3NTPA 3O5GA 2ZR4A 4N19A 3WD3A 4FAPA 1Q6HA 2MLXA 1D2KA 4TW8A 1W1YA 1NSGA 1HKKA 3KZ7A 2JZVA 4FN2A 2ETNA 4L3NA 3JXVA 4DWSA 3O5OA 3W4RA 1J6YA 4MTVA 4JFLA 1J4RA 4ODRA 2MF9A 2OLHA 4NSBA 1FKBA 4UDMA 2YBTA 4L72B 4NZCA 1YATA 4ML4A 3O5MA 3RM4A 1NWRA 4DRNA 2DT0A 1BL4A 1UR9A 2A3EA 4WKFA 4C02B 3BXWA 2F2DA 4TYOA 3WH0A 3KACA 2DG3A 2PBCA 4TX0A 1HKJA 1SR0A 3RFWA 4ODNA 3UI6A 3UI5A 1R9HA 2WM0A 5HBFA 1JVWA 4IT4A 3RM9A 2XP3A 4HARA 2A3AA 3WKZA 3EY6A 4J4NA 4P8UA 2M1IA 4P8VA 2PI6A 1FKKA 1HJWA 2ZR6A 2RUQA 1NH6A 5HW6A 1X6LA 1HKMA 2DG4A 1EQ3A 4DRQA 4DRIA 3CHCA 2YBUA 3WQVA 4HBEA 1FKLA 2XPAA 2XP5A 1ZCNA 1GUVA 3B7XA 1D7HA 1WAWA 1Q1CA 2Q5AA 4IPXA 4DZ3A 1KFWA 1D6OA 3PRDA 1FKRA 4DWSD 1ZBVA 4URIA 4MNMA 4MNJA 4ZPTR 1E15A 2O9OA 3WQWA 4W9QA 5HWCA 1T11A 4WJXA 1FKHA 1M5YA 5DITA 3O5KA 2XPBA 4DRJA 3ARXA 1NMVA 3AS0A 3AS3A 1QPFA 2RSEA 1ITXA 3RMEA 2UZ5A 3ALGA 4DIPA 3MDYB 5HWBA 4DRKA 2WK2A 2XP7A 4BF8A 3KABA 1GPFA 3ALFA 1PINA 3KAGA 2MNTA 2XP4A 3KAHA 1P5QA 4QIBA 3ARSA 3UQAA 3ARVA 4Z2GA 5HKGA 2IF4A 1ZK6A 3ODKA 5DIVA 4W9OA 4JFJA 4QT2A 3KAFA 4TW6A 4AY1A 3O5JA 3KCEA 2PPNA 2ITKA 1HXVA 1EDQA 1LQ0A 1WB0A 5BXJA 3QOKA 2FAPA 3CGNA 1LL4A 5D75A 5I98A 4TW7A 1ZBKA 2M2AA 2MLYA 4J4OA 2RURA 3EIPA 2F23A 3PR9A 3OA5A 2DT1A 3RGCA 3CGMA 4ODPA 2DSZA 2B5UB 2N87A 5DO2A 2DPEA 4O2TA 5HT1A 2PV1A 4W5UA 1FD9A 2DSUA 1TFVA 4Q22A 1OGGA 3O5LA 1W26A 3JYMA 2F4EA 2A3BA 4TNSA 3WL0A 3AS2A 4MPKA 1GOIA 3FY1A 2KFWA 5JH8A 4DWSC 1J4HA 1VF8A 1FKJA 1NWTA 2DT3A 4U84A 2KI3A 1H0IA 2ZR5A 4MAVA 1B6CA 4U85A 1IX5A 3WD2A 1C9HA 1TCOC 3IKGA 5DEZA 1OWQA 3UQBA 1ZU8A 5J6EA 3NI6A 4MNKA 4WKHA 3G6MA 3ARPA 1RD6A 3I6CA 2WLZA 3IK8A 3BMBA 2XP9A 2PV2A 4ZPVR 2LPVA 1L1PA 3WIJA 3LUOA 1W1PA 4NNRA 1LG2A 4LAYA 4ZPWR 3UI4A 4WK9A 3KADA 1HKIA 1E6PA 5HW7A 1PBKA 3ARWA 1W9VA 4ODLA 2DT2A 3TDBA 3WD4A 3AQUA 1UR8A 3CHFA 2A3CA 3O5IA 4LAVA 3UF8A 3GTYX 1H0GA 4S3KA 5GQBA 3KAIA 4P8XA 3B9DA 2ZQVA 2ZQUA 4G50A 3TC5A 1FKDA 2PV3A 1F8AB 4Z2IA 1HJVA 1SYTA 1FKIA 1F40A 1JNDA 4S3JA 4PTMA 2QF8A 1QZ2A 3VAWA 3CHDA 1ZL1A 2RQSA 2KGJA 1NWSA 2EULA 1W1TA 4MNLA 2WLYA 1FKSA 4DT4A 2DSVA 4Z2JA 1JNEA 3O5EA 4GIVA 1XRVA 2LKNA 2G8ZA 2FDMA 2D9FA 3ARQA 3G6LA 1ROUA 1FFQA 4LAXA 2MLZA 5DIUA 1KT0A 4ITZA 1Y0OA 4DRHA 3IHZA 4ZS6A 2F21A 1JNTA 3B8SA 4IT6A 5DF0A 1CTNA 1HJXA 3O5DA 4ODMA 3FAPA 3AS1A 4DROA 4DZ2A 3O5QA 2LGOA 1ZBWA 4JYSA 4KQZA 3O5PA 1ZBCA 1A7XA 4Q7NA 1W1VA 3CZ8A 4DRMA 1QPLA 1GRJA 4ODOA 3H9RB 2AWGA 3TCZA 2DG9A 3ARZA 2KE0A 3JYJA 3UQIA 4HBOA 2XP8A 4R0XA 2ESCA 5B8IC 1FKFA 3ARUA 4IQCA 1J4IA 4U86A 1JCHB 2KO7A 2M08A 4KR0B 4G2PA 1LL7A 2P4VA 1KT1A 4JFIA 4DH0A 3AROA 1EHNA 1X6NA 2L2SA 4ODQA 1Q6IA 1NWUA 2G41A 2LJ4A 4MSPA 3PRBA 2B31A 2FKEA 3O5FA 3WL1A 4LGXA 1E6ZA 2VN1A 2KR7A 3ARRA 4W9PA 4WKAA 5HW8A 4JFMA 2VCDA 1FKTA 1JNSA 2PN0A 1E6RA 2IUZA 1U79A 2RUCA 1E9LA
chains in the Genus database with same CATH topology
3B9EA 4DWSB 2XP6A 1N1AA 1LJYA 1XHGA 5GPGA 1LL6A 3CHEA 1ROTA 1FJDA 2RUDA 2AOSA 3PA7A 3NRKA 4QT3A 2PPPA 1O6IA 1FKGA 2O92A 2ZQTA 3IKDA 3OOBA 1OGBA 2PPOA 4Z2KA 4Z2HA 1W9UA 3O5RA 3CH9A 4Z2LA 1WNOA 4IQ2A 4R5EA 5HUAA 1D7IA 2Y78A 4XAKA 2MPHA 4ODKA 3WD0A 4JFKA 1YW5A 4WIWA 1W9PA 5GPRA 2ZQSA 1BKFA 1ZB5A 3FXYA 4QZVB 1D7JA 1FFRA 3PRAA 2K8IA 3B9AA 1FAPA 1EYMA 1Q6UA 1EIBA 3ARTA 1K9TA 1NMWA 3GPKA 3WD1A 3RM8A 4DRPA 1E6NA 5HTGA 3ARYA 2OFNA 4GGQA 1LG1A 4P8WA 2DSWA 4LAWA 4MGVA 3NTPA 3O5GA 2ZR4A 4N19A 3WD3A 4FAPA 1Q6HA 2MLXA 1D2KA 4TW8A 1W1YA 1NSGA 1HKKA 3KZ7A 2JZVA 4FN2A 4L3NA 3JXVA 4DWSA 3O5OA 3W4RA 1J6YA 4MTVA 4JFLA 1J4RA 4ODRA 2MF9A 2OLHA 4NSBA 1FKBA 2YBTA 4L72B 4NZCA 1YATA 4ML4A 3O5MA 3RM4A 1NWRA 4DRNA 2DT0A 1BL4A 1UR9A 2A3EA 4WKFA 4C02B 3BXWA 2F2DA 4TYOA 3WH0A 3KACA 2DG3A 2PBCA 4TX0A 1HKJA 1SR0A 3RFWA 4ODNA 3UI6A 3UI5A 1R9HA 2WM0A 5HBFA 1JVWA 4IT4A 3RM9A 2XP3A 4HARA 2A3AA 3WKZA 3EY6A 4J4NA 4P8UA 2M1IA 4P8VA 2PI6A 1FKKA 1HJWA 2ZR6A 2RUQA 1NH6A 5HW6A 1X6LA 1HKMA 2DG4A 1EQ3A 4DRQA 4DRIA 3CHCA 2YBUA 3WQVA 4HBEA 1FKLA 2XPAA 2XP5A 1ZCNA 1GUVA 3B7XA 1D7HA 1WAWA 1Q1CA 2Q5AA 4IPXA 4DZ3A 1KFWA 1D6OA 3PRDA 1FKRA 4DWSD 1ZBVA 4URIA 4MNMA 4MNJA 4ZPTR 1E15A 2O9OA 3WQWA 4W9QA 5HWCA 1T11A 4WJXA 1FKHA 1M5YA 5DITA 3O5KA 2XPBA 4DRJA 3ARXA 1NMVA 3AS0A 3AS3A 1QPFA 2RSEA 1ITXA 3RMEA 2UZ5A 3ALGA 4DIPA 3MDYB 5HWBA 4DRKA 2WK2A 2XP7A 4BF8A 3KABA 1GPFA 3ALFA 1PINA 3KAGA 2MNTA 2XP4A 3KAHA 1P5QA 4QIBA 3ARSA 3UQAA 3ARVA 4Z2GA 5HKGA 2IF4A 1ZK6A 3ODKA 5DIVA 4W9OA 4JFJA 4QT2A 3KAFA 4TW6A 4AY1A 3O5JA 3KCEA 2PPNA 2ITKA 1HXVA 1EDQA 1LQ0A 1WB0A 5BXJA 3QOKA 2FAPA 3CGNA 1LL4A 5D75A 5I98A 4TW7A 1ZBKA 2M2AA 2MLYA 4J4OA 2RURA 3PR9A 3OA5A 2DT1A 3RGCA 3CGMA 4ODPA 2DSZA 2N87A 5DO2A 2DPEA 4O2TA 5HT1A 2PV1A 4W5UA 1FD9A 2DSUA 1TFVA 4Q22A 1OGGA 3O5LA 1W26A 3JYMA 2F4EA 2A3BA 4TNSA 3WL0A 3AS2A 4MPKA 1GOIA 3FY1A 2KFWA 5JH8A 4DWSC 1J4HA 1VF8A 1FKJA 1NWTA 2DT3A 4U84A 2KI3A 1H0IA 2ZR5A 4MAVA 1B6CA 4U85A 1IX5A 3WD2A 1C9HA 1TCOC 3IKGA 5DEZA 1OWQA 3UQBA 1ZU8A 5J6EA 3NI6A 4MNKA 4WKHA 3G6MA 3ARPA 1RD6A 3I6CA 2WLZA 3IK8A 2XP9A 2PV2A 4ZPVR 2LPVA 1L1PA 3WIJA 1W1PA 3LUOA 4NNRA 1LG2A 4LAYA 4ZPWR 3UI4A 4WK9A 3KADA 1HKIA 1E6PA 5HW7A 1PBKA 3ARWA 1W9VA 4ODLA 2DT2A 3TDBA 3WD4A 3AQUA 1UR8A 3CHFA 2A3CA 3O5IA 4LAVA 3UF8A 5GQBA 1H0GA 4S3KA 3KAIA 4P8XA 3B9DA 2ZQVA 2ZQUA 4G50A 3TC5A 1FKDA 2PV3A 1F8AB 4Z2IA 1HJVA 1SYTA 1FKIA 1F40A 1JNDA 4S3JA 4PTMA 2QF8A 1QZ2A 3VAWA 3CHDA 1ZL1A 2RQSA 2KGJA 1NWSA 1W1TA 4MNLA 2WLYA 1FKSA 4DT4A 2DSVA 4Z2JA 1JNEA 3O5EA 4GIVA 1XRVA 2LKNA 2G8ZA 2FDMA 2D9FA 3ARQA 3G6LA 1ROUA 1FFQA 4LAXA 2MLZA 5DIUA 1KT0A 4ITZA 1Y0OA 4DRHA 3IHZA 4ZS6A 2F21A 1JNTA 3B8SA 4IT6A 5DF0A 1CTNA 1HJXA 3O5DA 4ODMA 3FAPA 3AS1A 4DROA 4DZ2A 3O5QA 2LGOA 1ZBWA 4JYSA 4KQZA 3O5PA 1ZBCA 1A7XA 4Q7NA 1W1VA 3CZ8A 4DRMA 1QPLA 4ODOA 3H9RB 2AWGA 3TCZA 2DG9A 3ARZA 2KE0A 3JYJA 3UQIA 4HBOA 2XP8A 4R0XA 2ESCA 5B8IC 1FKFA 3ARUA 4IQCA 1J4IA 4U86A 2KO7A 2M08A 4KR0B 4G2PA 1LL7A 1KT1A 4JFIA 4DH0A 3AROA 1EHNA 1X6NA 2L2SA 4ODQA 1Q6IA 1NWUA 2G41A 2LJ4A 4MSPA 3PRBA 2B31A 2FKEA 3O5FA 3WL1A 4LGXA 1E6ZA 2VN1A 2KR7A 3ARRA 4W9PA 4WKAA 5HW8A 4JFMA 2VCDA 1FKTA 1JNSA 1E6RA 2IUZA 1U79A 2RUCA 1E9LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PBC A;  4TW7 A;  2M2A A;  3KAC A;  2MLY A;  2XP6 A;  4J4O A;  1N1A A;  2RUR A;  3RFW A;  4ODN A;  3UI6 A;  3UI5 A;  1QZ2 A;  1R9H A;  5GPG A;  3RGC A;  3CGM A;  4ODP A;  3VAW A;  1JVW A;  1ROT A;  1FJD A;  2RQS A;  2XP3 A;  2N87 A;  2KGJ A;  2RUD A;  4O2T A;  3PA7 A;  3NRK A;  4QT3 A;  5HT1 A;  4TX0 A;  2PV1 A;  1FD9 A;  2PPP A;  1FKS A;  1FKG A;  2ZQT A;  3EY6 A;  3IKD A;  3OOB A;  4J4N A;  4DT4 A;  3O5E A;  4GIV A;  2M1I A;  2PPO A;  3O5L A;  1W26 A;  2LKN A;  1FKK A;  2F4E A;  3JYM A;  3O5R A;  4TNS A;  2ZR6 A;  2RUQ A;  4IQ2 A;  2D9F A;  2KFW A;  5HW6 A;  1ROU A;  2DG4 A;  1J4H A;  1EQ3 A;  5HUA A;  4DRQ A;  4DRI A;  1F40 A;  1D7I A;  1FKJ A;  2Y78 A;  1FKL A;  2XPA A;  4LAX A;  4U84 A;  2KI3 A;  2MLZ A;  2XP5 A;  1ZCN A;  5DIU A;  1KT0 A;  2MPH A;  4ITZ A;  4ODK A;  3B7X A;  1D7H A;  1Y0O A;  2ZR5 A;  1Q1C A;  2Q5A A;  4IPX A;  1B6C A;  4DRH A;  4DZ3 A;  1D6O A;  3IHZ A;  4JFK A;  4U85 A;  3PRD A;  2F21 A;  1YW5 A;  1JNT A;  5DIV A;  1FKR A;  1C9H A;  1TCO C;  3IKG A;  2ZQS A;  3O5D A;  1BKF A;  4ODM A;  3UQB A;  3FAP A;  5J6E A;  3NI6 A;  1D7J A;  4DRO A;  4DZ2 A;  3O5Q A;  2K8I A;  2LGO A;  4W9Q A;  5HWC A;  1FAP A;  1EYM A;  1Q6U A;  3I6C A;  4JYS A;  1T11 A;  3IK8 A;  1FKH A;  2XP9 A;  1M5Y A;  3O5P A;  3O5K A;  5DIT A;  1A7X A;  2PV2 A;  1NMW A;  3GPK A;  2XPB A;  4DRP A;  4DRJ A;  2LPV A;  5HTG A;  1L1P A;  1NMV A;  4DRM A;  1QPF A;  1QPL A;  2OFN A;  2RSE A;  3LUO A;  4GGQ A;  4ODO A;  2UZ5 A;  4LAW A;  3H9R B;  2AWG A;  3NTP A;  3O5G A;  4MGV A;  4NNR A;  3TCZ A;  4DIP A;  3MDY B;  2DG9 A;  2ZR4 A;  4LAY A;  4N19 A;  3UI4 A;  4DRK A;  4FAP A;  5HWB A;  1Q6H A;  2KE0 A;  3JYJ A;  3KAD A;  2MLX A;  3UQI A;  2XP7 A;  2XP8 A;  4R0X A;  4BF8 A;  5HW7 A;  5B8I C;  3KAB A;  1FKF A;  4TW8 A;  1PBK A;  1PIN A;  3KAG A;  1NSG A;  2MNT A;  1J4I A;  3KZ7 A;  4IQC A;  2KO7 A;  4U86 A;  2JZV A;  2XP4 A;  3KAH A;  2M08 A;  4G2P A;  1P5Q A;  4ODL A;  4QIB A;  3TDB A;  1KT1 A;  3UQA A;  4FN2 A;  4JFI A;  3JXV A;  4DH0 A;  5HKG A;  3O5O A;  2IF4 A;  1J6Y A;  2L2S A;  1ZK6 A;  4JFL A;  4ODQ A;  3O5I A;  1J4R A;  3ODK A;  4LAV A;  1Q6I A;  4ODR A;  4MSP A;  2MF9 A;  2LJ4 A;  4W9O A;  3UF8 A;  3PRB A;  3KAI A;  2FKE A;  4JFJ A;  4QT2 A;  1FKB A;  3O5F A;  3KAF A;  1YAT A;  4TW6 A;  3O5M A;  3O5J A;  2ZQV A;  1FKI A;  2VN1 A;  2KR7 A;  2ZQU A;  3KCE A;  4G50 A;  2PPN A;  3TC5 A;  4DRN A;  1FKD A;  2ITK A;  4W9P A;  5HW8 A;  2PV3 A;  1BL4 A;  4JFM A;  1HXV A;  1F8A B;  2VCD A;  1FKT A;  4C02 B;  5BXJ A;  1JNS A;  2FAP A;  2F2D A;  4TYO A;  3WH0 A;  3CGN A;  5D75 A;  1U79 A;  5I98 A;  2RUC A;  2DG3 A; 
#chains in the Genus database with same CATH topology
 3B9E A;  4DWS B;  2XP6 A;  1N1A A;  1LJY A;  1XHG A;  5GPG A;  1LL6 A;  3CHE A;  1ROT A;  1FJD A;  2RUD A;  2AOS A;  3PA7 A;  3NRK A;  4QT3 A;  2PPP A;  1O6I A;  1FKG A;  2O92 A;  2ZQT A;  3IKD A;  3OOB A;  1OGB A;  2PPO A;  4Z2K A;  4Z2H A;  1W9U A;  3O5R A;  3CH9 A;  4Z2L A;  1WNO A;  4IQ2 A;  4R5E A;  5HUA A;  1D7I A;  2Y78 A;  1E44 A;  4XAK A;  2MPH A;  4ODK A;  3WD0 A;  4JFK A;  1YW5 A;  4WIW A;  1W9P A;  5GPR A;  2ZQS A;  1BKF A;  1ZB5 A;  3FXY A;  4QZV B;  1D7J A;  1FFR A;  3PRA A;  2K8I A;  3B9A A;  1FAP A;  1EYM A;  1Q6U A;  3GU0 A;  1EIB A;  3ART A;  1K9T A;  1NMW A;  3GPK A;  3WD1 A;  3RM8 A;  4DRP A;  1E6N A;  5HTG A;  3ARY A;  2OFN A;  4GGQ A;  1LG1 A;  4P8W A;  2DSW A;  4LAW A;  4MGV A;  3NTP A;  3O5G A;  2ZR4 A;  4N19 A;  3WD3 A;  4FAP A;  1Q6H A;  2MLX A;  1D2K A;  4TW8 A;  1W1Y A;  1NSG A;  1HKK A;  3KZ7 A;  2JZV A;  4FN2 A;  2ETN A;  4L3N A;  3JXV A;  4DWS A;  3O5O A;  3W4R A;  1J6Y A;  4MTV A;  4JFL A;  1J4R A;  4ODR A;  2MF9 A;  2OLH A;  4NSB A;  1FKB A;  4UDM A;  2YBT A;  4L72 B;  4NZC A;  1YAT A;  4ML4 A;  3O5M A;  3RM4 A;  1NWR A;  4DRN A;  2DT0 A;  1BL4 A;  1UR9 A;  2A3E A;  4WKF A;  4C02 B;  3BXW A;  2F2D A;  4TYO A;  3WH0 A;  3KAC A;  2DG3 A;  2PBC A;  4TX0 A;  1HKJ A;  1SR0 A;  3RFW A;  4ODN A;  3UI6 A;  3UI5 A;  1R9H A;  2WM0 A;  5HBF A;  1JVW A;  4IT4 A;  3RM9 A;  2XP3 A;  4HAR A;  2A3A A;  3WKZ A;  3EY6 A;  4J4N A;  4P8U A;  2M1I A;  4P8V A;  2PI6 A;  1FKK A;  1HJW A;  2ZR6 A;  2RUQ A;  1NH6 A;  5HW6 A;  1X6L A;  1HKM A;  2DG4 A;  1EQ3 A;  4DRQ A;  4DRI A;  3CHC A;  2YBU A;  3WQV A;  4HBE A;  1FKL A;  2XPA A;  2XP5 A;  1ZCN A;  1GUV A;  3B7X A;  1D7H A;  1WAW A;  1Q1C A;  2Q5A A;  4IPX A;  4DZ3 A;  1KFW A;  1D6O A;  3PRD A;  1FKR A;  4DWS D;  1ZBV A;  4URI A;  4MNM A;  4MNJ A;  4ZPT R;  1E15 A;  2O9O A;  3WQW A;  4W9Q A;  5HWC A;  1T11 A;  4WJX A;  1FKH A;  1M5Y A;  5DIT A;  3O5K A;  2XPB A;  4DRJ A;  3ARX A;  1NMV A;  3AS0 A;  3AS3 A;  1QPF A;  2RSE A;  1ITX A;  3RME A;  2UZ5 A;  3ALG A;  4DIP A;  3MDY B;  5HWB A;  4DRK A;  2WK2 A;  2XP7 A;  4BF8 A;  3KAB A;  1GPF A;  3ALF A;  1PIN A;  3KAG A;  2MNT A;  2XP4 A;  3KAH A;  1P5Q A;  4QIB A;  3ARS A;  3UQA A;  3ARV A;  4Z2G A;  5HKG A;  2IF4 A;  1ZK6 A;  3ODK A;  5DIV A;  4W9O A;  4JFJ A;  4QT2 A;  3KAF A;  4TW6 A;  4AY1 A;  3O5J A;  3KCE A;  2PPN A;  2ITK A;  1HXV A;  1EDQ A;  1LQ0 A;  1WB0 A;  5BXJ A;  3QOK A;  2FAP A;  3CGN A;  1LL4 A;  5D75 A;  5I98 A;  4TW7 A;  1ZBK A;  2M2A A;  2MLY A;  4J4O A;  2RUR A;  3EIP A;  2F23 A;  3PR9 A;  3OA5 A;  2DT1 A;  3RGC A;  3CGM A;  4ODP A;  2DSZ A;  2B5U B;  2N87 A;  5DO2 A;  2DPE A;  4O2T A;  5HT1 A;  2PV1 A;  4W5U A;  1FD9 A;  2DSU A;  1TFV A;  4Q22 A;  1OGG A;  3O5L A;  1W26 A;  3JYM A;  2F4E A;  2A3B A;  4TNS A;  3WL0 A;  3AS2 A;  4MPK A;  1GOI A;  3FY1 A;  2KFW A;  5JH8 A;  4DWS C;  1J4H A;  1VF8 A;  1FKJ A;  1NWT A;  2DT3 A;  4U84 A;  2KI3 A;  1H0I A;  2ZR5 A;  4MAV A;  1B6C A;  4U85 A;  1IX5 A;  3WD2 A;  1C9H A;  1TCO C;  3IKG A;  5DEZ A;  1OWQ A;  3UQB A;  1ZU8 A;  5J6E A;  3NI6 A;  4MNK A;  4WKH A;  3G6M A;  3ARP A;  1RD6 A;  3I6C A;  2WLZ A;  3IK8 A;  3BMB A;  2XP9 A;  2PV2 A;  4ZPV R;  2LPV A;  1L1P A;  3WIJ A;  3LUO A;  1W1P A;  4NNR A;  1LG2 A;  4LAY A;  4ZPW R;  3UI4 A;  4WK9 A;  3KAD A;  1HKI A;  1E6P A;  5HW7 A;  1PBK A;  3ARW A;  1W9V A;  4ODL A;  2DT2 A;  3TDB A;  3WD4 A;  3AQU A;  1UR8 A;  3CHF A;  2A3C A;  3O5I A;  4LAV A;  3UF8 A;  3GTY X;  1H0G A;  4S3K A;  5GQB A;  3KAI A;  4P8X A;  3B9D A;  2ZQV A;  2ZQU A;  4G50 A;  3TC5 A;  1FKD A;  2PV3 A;  1F8A B;  4Z2I A;  1HJV A;  1SYT A;  1FKI A;  1F40 A;  1JND A;  4S3J A;  4PTM A;  2QF8 A;  1QZ2 A;  3VAW A;  3CHD A;  1ZL1 A;  2RQS A;  2KGJ A;  1NWS A;  2EUL A;  1W1T A;  4MNL A;  2WLY A;  1FKS A;  4DT4 A;  2DSV A;  4Z2J A;  1JNE A;  3O5E A;  4GIV A;  1XRV A;  2LKN A;  2G8Z A;  2FDM A;  2D9F A;  3ARQ A;  3G6L A;  1ROU A;  1FFQ A;  4LAX A;  2MLZ A;  5DIU A;  1KT0 A;  4ITZ A;  1Y0O A;  4DRH A;  3IHZ A;  4ZS6 A;  2F21 A;  1JNT A;  3B8S A;  4IT6 A;  5DF0 A;  1CTN A;  1HJX A;  3O5D A;  4ODM A;  3FAP A;  3AS1 A;  4DRO A;  4DZ2 A;  3O5Q A;  2LGO A;  1ZBW A;  4JYS A;  4KQZ A;  3O5P A;  1ZBC A;  1A7X A;  4Q7N A;  1W1V A;  3CZ8 A;  4DRM A;  1QPL A;  1GRJ A;  4ODO A;  3H9R B;  2AWG A;  3TCZ A;  2DG9 A;  3ARZ A;  2KE0 A;  3JYJ A;  3UQI A;  4HBO A;  2XP8 A;  4R0X A;  2ESC A;  5B8I C;  1FKF A;  3ARU A;  4IQC A;  1J4I A;  4U86 A;  1JCH B;  2KO7 A;  2M08 A;  4KR0 B;  4G2P A;  1LL7 A;  2P4V A;  1KT1 A;  4JFI A;  4DH0 A;  3ARO A;  1EHN A;  1X6N A;  2L2S A;  4ODQ A;  1Q6I A;  1NWU A;  2G41 A;  2LJ4 A;  4MSP A;  3PRB A;  2B31 A;  2FKE A;  3O5F A;  3WL1 A;  4LGX A;  1E6Z A;  2VN1 A;  2KR7 A;  3ARR A;  4W9P A;  4WKA A;  5HW8 A;  4JFM A;  2VCD A;  1FKT A;  1JNS A;  2PN0 A;  1E6R A;  2IUZ A;  1U79 A;  2RUC A;  1E9L A; 
#chains in the Genus database with same CATH homology
 3B9E A;  4DWS B;  2XP6 A;  1N1A A;  1LJY A;  1XHG A;  5GPG A;  1LL6 A;  3CHE A;  1ROT A;  1FJD A;  2RUD A;  2AOS A;  3PA7 A;  3NRK A;  4QT3 A;  2PPP A;  1O6I A;  1FKG A;  2O92 A;  2ZQT A;  3IKD A;  3OOB A;  1OGB A;  2PPO A;  4Z2K A;  4Z2H A;  1W9U A;  3O5R A;  3CH9 A;  4Z2L A;  1WNO A;  4IQ2 A;  4R5E A;  5HUA A;  1D7I A;  2Y78 A;  4XAK A;  2MPH A;  4ODK A;  3WD0 A;  4JFK A;  1YW5 A;  4WIW A;  1W9P A;  5GPR A;  2ZQS A;  1BKF A;  1ZB5 A;  3FXY A;  4QZV B;  1D7J A;  1FFR A;  3PRA A;  2K8I A;  3B9A A;  1FAP A;  1EYM A;  1Q6U A;  1EIB A;  3ART A;  1K9T A;  1NMW A;  3GPK A;  3WD1 A;  3RM8 A;  4DRP A;  1E6N A;  5HTG A;  3ARY A;  2OFN A;  4GGQ A;  1LG1 A;  4P8W A;  2DSW A;  4LAW A;  4MGV A;  3NTP A;  3O5G A;  2ZR4 A;  4N19 A;  3WD3 A;  4FAP A;  1Q6H A;  2MLX A;  1D2K A;  4TW8 A;  1W1Y A;  1NSG A;  1HKK A;  3KZ7 A;  2JZV A;  4FN2 A;  4L3N A;  3JXV A;  4DWS A;  3O5O A;  3W4R A;  1J6Y A;  4MTV A;  4JFL A;  1J4R A;  4ODR A;  2MF9 A;  2OLH A;  4NSB A;  1FKB A;  2YBT A;  4L72 B;  4NZC A;  1YAT A;  4ML4 A;  3O5M A;  3RM4 A;  1NWR A;  4DRN A;  2DT0 A;  1BL4 A;  1UR9 A;  2A3E A;  4WKF A;  4C02 B;  3BXW A;  2F2D A;  4TYO A;  3WH0 A;  3KAC A;  2DG3 A;  2PBC A;  4TX0 A;  1HKJ A;  1SR0 A;  3RFW A;  4ODN A;  3UI6 A;  3UI5 A;  1R9H A;  2WM0 A;  5HBF A;  1JVW A;  4IT4 A;  3RM9 A;  2XP3 A;  4HAR A;  2A3A A;  3WKZ A;  3EY6 A;  4J4N A;  4P8U A;  2M1I A;  4P8V A;  2PI6 A;  1FKK A;  1HJW A;  2ZR6 A;  2RUQ A;  1NH6 A;  5HW6 A;  1X6L A;  1HKM A;  2DG4 A;  1EQ3 A;  4DRQ A;  4DRI A;  3CHC A;  2YBU A;  3WQV A;  4HBE A;  1FKL A;  2XPA A;  2XP5 A;  1ZCN A;  1GUV A;  3B7X A;  1D7H A;  1WAW A;  1Q1C A;  2Q5A A;  4IPX A;  4DZ3 A;  1KFW A;  1D6O A;  3PRD A;  1FKR A;  4DWS D;  1ZBV A;  4URI A;  4MNM A;  4MNJ A;  4ZPT R;  1E15 A;  2O9O A;  3WQW A;  4W9Q A;  5HWC A;  1T11 A;  4WJX A;  1FKH A;  1M5Y A;  5DIT A;  3O5K A;  2XPB A;  4DRJ A;  3ARX A;  1NMV A;  3AS0 A;  3AS3 A;  1QPF A;  2RSE A;  1ITX A;  3RME A;  2UZ5 A;  3ALG A;  4DIP A;  3MDY B;  5HWB A;  4DRK A;  2WK2 A;  2XP7 A;  4BF8 A;  3KAB A;  1GPF A;  3ALF A;  1PIN A;  3KAG A;  2MNT A;  2XP4 A;  3KAH A;  1P5Q A;  4QIB A;  3ARS A;  3UQA A;  3ARV A;  4Z2G A;  5HKG A;  2IF4 A;  1ZK6 A;  3ODK A;  5DIV A;  4W9O A;  4JFJ A;  4QT2 A;  3KAF A;  4TW6 A;  4AY1 A;  3O5J A;  3KCE A;  2PPN A;  2ITK A;  1HXV A;  1EDQ A;  1LQ0 A;  1WB0 A;  5BXJ A;  3QOK A;  2FAP A;  3CGN A;  1LL4 A;  5D75 A;  5I98 A;  4TW7 A;  1ZBK A;  2M2A A;  2MLY A;  4J4O A;  2RUR A;  3PR9 A;  3OA5 A;  2DT1 A;  3RGC A;  3CGM A;  4ODP A;  2DSZ A;  2N87 A;  5DO2 A;  2DPE A;  4O2T A;  5HT1 A;  2PV1 A;  4W5U A;  1FD9 A;  2DSU A;  1TFV A;  4Q22 A;  1OGG A;  3O5L A;  1W26 A;  3JYM A;  2F4E A;  2A3B A;  4TNS A;  3WL0 A;  3AS2 A;  4MPK A;  1GOI A;  3FY1 A;  2KFW A;  5JH8 A;  4DWS C;  1J4H A;  1VF8 A;  1FKJ A;  1NWT A;  2DT3 A;  4U84 A;  2KI3 A;  1H0I A;  2ZR5 A;  4MAV A;  1B6C A;  4U85 A;  1IX5 A;  3WD2 A;  1C9H A;  1TCO C;  3IKG A;  5DEZ A;  1OWQ A;  3UQB A;  1ZU8 A;  5J6E A;  3NI6 A;  4MNK A;  4WKH A;  3G6M A;  3ARP A;  1RD6 A;  3I6C A;  2WLZ A;  3IK8 A;  2XP9 A;  2PV2 A;  4ZPV R;  2LPV A;  1L1P A;  3WIJ A;  1W1P A;  3LUO A;  4NNR A;  1LG2 A;  4LAY A;  4ZPW R;  3UI4 A;  4WK9 A;  3KAD A;  1HKI A;  1E6P A;  5HW7 A;  1PBK A;  3ARW A;  1W9V A;  4ODL A;  2DT2 A;  3TDB A;  3WD4 A;  3AQU A;  1UR8 A;  3CHF A;  2A3C A;  3O5I A;  4LAV A;  3UF8 A;  5GQB A;  1H0G A;  4S3K A;  3KAI A;  4P8X A;  3B9D A;  2ZQV A;  2ZQU A;  4G50 A;  3TC5 A;  1FKD A;  2PV3 A;  1F8A B;  4Z2I A;  1HJV A;  1SYT A;  1FKI A;  1F40 A;  1JND A;  4S3J A;  4PTM A;  2QF8 A;  1QZ2 A;  3VAW A;  3CHD A;  1ZL1 A;  2RQS A;  2KGJ A;  1NWS A;  1W1T A;  4MNL A;  2WLY A;  1FKS A;  4DT4 A;  2DSV A;  4Z2J A;  1JNE A;  3O5E A;  4GIV A;  1XRV A;  2LKN A;  2G8Z A;  2FDM A;  2D9F A;  3ARQ A;  3G6L A;  1ROU A;  1FFQ A;  4LAX A;  2MLZ A;  5DIU A;  1KT0 A;  4ITZ A;  1Y0O A;  4DRH A;  3IHZ A;  4ZS6 A;  2F21 A;  1JNT A;  3B8S A;  4IT6 A;  5DF0 A;  1CTN A;  1HJX A;  3O5D A;  4ODM A;  3FAP A;  3AS1 A;  4DRO A;  4DZ2 A;  3O5Q A;  2LGO A;  1ZBW A;  4JYS A;  4KQZ A;  3O5P A;  1ZBC A;  1A7X A;  4Q7N A;  1W1V A;  3CZ8 A;  4DRM A;  1QPL A;  4ODO A;  3H9R B;  2AWG A;  3TCZ A;  2DG9 A;  3ARZ A;  2KE0 A;  3JYJ A;  3UQI A;  4HBO A;  2XP8 A;  4R0X A;  2ESC A;  5B8I C;  1FKF A;  3ARU A;  4IQC A;  1J4I A;  4U86 A;  2KO7 A;  2M08 A;  4KR0 B;  4G2P A;  1LL7 A;  1KT1 A;  4JFI A;  4DH0 A;  3ARO A;  1EHN A;  1X6N A;  2L2S A;  4ODQ A;  1Q6I A;  1NWU A;  2G41 A;  2LJ4 A;  4MSP A;  3PRB A;  2B31 A;  2FKE A;  3O5F A;  3WL1 A;  4LGX A;  1E6Z A;  2VN1 A;  2KR7 A;  3ARR A;  4W9P A;  4WKA A;  5HW8 A;  4JFM A;  2VCD A;  1FKT A;  1JNS A;  1E6R A;  2IUZ A;  1U79 A;  2RUC A;  1E9L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...