4DRQA

Exploration of pipecolate sulfonamides as binders of the fk506-binding proteins 51 and 52: complex of fkbp51 with 2-(3-((r)-1-((s)-1-(3,5-dichlorophenylsulfonyl)piperidine-2-carbonyloxy)-3-(3,4-dimethoxy -phenyl)propyl)phenoxy)acetic acid
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
128
structure length
128
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Exploration of Pipecolate Sulfonamides as Binders of the FK506-Binding Proteins 51 and 52.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
total genus 35
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4drqA00
3CGMA 1FKJA 1R9HA 4JYSA 3IK8A 1KT1A 3EY6A 4ODNA 4DH0A 2XP7A 1Y0OA 1NMVA 1FKHA 1D7HA 1YW5A 2XPAA 2ZQSA 3CGNA 3O5QA 1P5QA 4J4NA 4ODPA 4ODQA 4ODKA 4DRMA 4JFIA 1KT0A 2DG4A 3TDBA 1FKRA 2MNTA 3UI5A 3UQAA 1D7IA 2KE0A 1D7JA 2OFNA 3KADA 4TYOA 3WH0A 3UQBA 1EQ3A 2RURA 3OOBA 2KR7A 3UQIA 2RQSA 3NRKA 5HW6A 1FKGA 4TX0A 4DROA 3UI6A 2XP5A 4C02B 3O5KA 4J4OA 2LGOA 2DG3A 1PBKA 2MLZA 2XP9A 4JFLA 4DRJA 2ZR4A 4DRIA 5HW8A 2ITKA 2AWGA 3IKDA 3KAIA 1ZK6A 2KI3A 1FKLA 1EYMA 2F21A 3PA7A 4LAXA 4MSPA 2PPOA 4FAPA 1NMWA 5HT1A 2ZQUA 4FN2A 1FJDA 1A7XA 4ODOA 4QIBA 3O5EA 4ITZA 4LAYA 3KABA 4DZ2A 1HXVA 2Y78A 5GPGA 4DRKA 2VN1A 2L2SA 5B8IC 1ROUA 3UF8A 1FKFA 1F40A 3O5PA 1ZCNA 3KCEA 3O5GA 1M5YA 2PPNA 1J4HA 2KO7A 5BXJA 1FKSA 1PINA 1QZ2A 2ZQVA 3IKGA 1J6YA 2XPBA 4GGQA 4TNSA 3JYJA 1QPFA 3GPKA 1BL4A 3O5DA 1JNTA 2XP6A 3LUOA 3IHZA 4W9OA 1FKKA 4DRQA 2PV3A 2M2AA 4NNRA 1Q6UA 1W26A 2RUQA 2ZR6A 1BKFA 5HKGA 1JNSA 1Q6IA 1C9HA 2KFWA 4W9QA 2ZQTA 2MPHA 2ZR5A 2PBCA 1B6CA 2D9FA 3KAGA 3TCZA 2FAPA 2LKNA 4DRNA 1FKTA 1YATA 2F4EA 2M1IA 2UZ5A 2MF9A 3H9RB 4JFMA 3KACA 4ODMA 4DT4A 1FKIA 2MLYA 1T11A 3O5OA 2M08A 4JFKA 1ROTA 2VCDA 4TW8A 5D75A 5HWCA 1Q1CA 2FKEA 3KAFA 4QT3A 5HUAA 3JYMA 4R0XA 1F8AB 1J4IA 2KGJA 4W9PA 3O5FA 4IQCA 4BF8A 1Q6HA 2IF4A 5HW7A 1FKBA 1JVWA 3KAHA 3O5LA 4IPXA 3JXVA 3O5JA 4MGVA 5J6EA 3O5RA 4G50A 4ODRA 3FAPA 4QT2A 1QPLA 4DRHA 1D6OA 4DIPA 3NTPA 3NI6A 2F2DA 4JFJA 1FD9A 3RFWA 4IQ2A 1FAPA 3KZ7A 3PRDA 2RUDA 1J4RA 2K8IA 2RUCA 4ODLA 1NSGA 2LPVA 5DIVA 1N1AA 4N19A 1TCOC 2PV1A 3B7XA 4O2TA 5HWBA 3PRBA 5HTGA 4U85A 2PPPA 4DRPA 3ODKA 4DZ3A 2RSEA 2XP3A 2XP8A 4U86A 5DIUA 3VAWA 1L1PA 2LJ4A 4GIVA 1U79A 2N87A 3TC5A 3I6CA 3O5MA 4LAVA 5DITA 2DG9A 2JZVA 2MLXA 2PV2A 2XP4A 4TW6A 4TW7A 3RGCA 3UI4A 1FKDA 4G2PA 3MDYB 3O5IA 2Q5AA 4U84A 4LAWA 5I98A
chains in the Genus database with same CATH superfamily
2B31A 1SR0A 3CHEA 2XP7A 1YW5A 2ZQSA 3CGNA 4ODQA 4Z2GA 3WL0A 4JFIA 1KT0A 1ITXA 2OFNA 1D7JA 3KADA 2WM0A 1EQ3A 3OOBA 5HW6A 1O6IA 1TFVA 4TX0A 4DROA 2XP5A 4Z2HA 4Z2IA 1E9LA 2A3CA 1PBKA 2XP9A 3PA7A 4LAXA 2PPOA 4FAPA 1NMWA 2ZQUA 4FN2A 4WKHA 2DT0A 1FJDA 4Z2LA 1HXVA 2Y78A 2WK2A 3RMEA 4DRKA 2L2SA 4HARA 1EIBA 3KCEA 3O5GA 1J4HA 5BXJA 3ARUA 1GOIA 3IKGA 4R5EA 1HKKA 2XPBA 3EIPA 1QPFA 1ZBCA 3G6MA 1JNTA 2ETNA 1E6RA 3LUOA 3ARSA 1GRJA 1FKKA 1NH6A 4NNRA 1Q6UA 2RUQA 1C9HA 2ZR5A 1KFWA 4HBEA 2FAPA 2LKNA 3ARYA 3FY1A 2F4EA 1X6LA 2M1IA 2UZ5A 4JFMA 3KACA 1LJYA 4ODMA 1JCHB 4NZCA 4WKFA 4WK9A 4ZPWR 4KR0B 1EDQA 5HWCA 4ZPTR 2EULA 5HUAA 4MPKA 4R0XA 4W9PA 1XRVA 1UR8A 3KAHA 3O5LA 3JXVA 3O5JA 1W1PA 4XAKA 1QPLA 4DIPA 3GTYX 1E15A 1HKJA 1N1AA 4N19A 2DT1A 1ZBVA 5HWBA 4Q22A 4U85A 4QZVB 5DF0A 4DZ3A 2RSEA 3WL1A 1XHGA 1GUVA 3TC5A 3O5MA 3OA5A 3RGCA 3UI4A 2DG9A 2MLXA 2XP4A 4DZ2A 3QOKA 2Q5AA 1FKJA 3WKZA 3ARXA 4IT4A 4AY1A 1W1YA 4DH0A 1NMVA 1NWSA 1P5QA 4ODKA 1ZBKA 4TYOA 2RURA 2RQSA 1FKGA 3BMBA 4C02B 4J4OA 2DG3A 4DRJA 5HW8A 2ZR4A 4DRIA 2FDMA 3KAIA 1EYMA 4MNKA 4KQZA 2DSWA 1RD6A 4ITZA 4LAYA 2G41A 4W5UA 5B8IC 2YBTA 3UF8A 3GU0A 4WJXA 4ML4A 1ZCNA 2PPNA 4UDMA 1FKSA 1QZ2A 2ZQVA 4HBOA 3GPKA 1W1VA 1BL4A 3BXWA 4W9OA 4DRQA 2M2AA 1W9UA 2ZQTA 3TCZA 1HKMA 1YATA 4Z2KA 1W9PA 1FKIA 1T11A 3RM4A 3O5OA 2M08A 4TW8A 5D75A 2FKEA 5GPRA 4QT3A 4MNMA 1F8AB 2KGJA 4L72B 1ZB5A 1ZL1A 4P8UA 1FKBA 4IPXA 4MGVA 5J6EA 1WNOA 4MAVA 1HJXA 2PN0A 3FAPA 4WKAA 1D6OA 2AOSA 1H0GA 4P8WA 1WAWA 2F2DA 4MNLA 1HKIA 1J4RA 2K8IA 4MNJA 5DEZA 4ZS6A 2LPVA 4NSBA 3B7XA 3AS3A 3PRBA 3ODKA 4U86A 5DIUA 1HJVA 4GIVA 2N87A 3I6CA 4LAVA 3MDYB 5JH8A 1R9HA 2PI6A 1KT1A 3EY6A 3WQVA 3CHFA 2XPAA 2DSVA 4ODPA 1D2KA 2DG4A 3TDBA 3ARTA 3UI5A 1D7IA 1NWUA 1LG1A 2KE0A 3UQBA 3ALGA 2KR7A 4DWSD 3WD1A 3UI6A 3ARZA 3WQWA 2B5UB 3RM8A 2LGOA 4JFLA 2AWGA 3IKDA 3ARPA 1FKLA 1LL4A 2F21A 4MSPA 3B9EA 4S3JA 1A7XA 4QIBA 3CHDA 3FXYA 3B9DA 3PR9A 1ROUA 1F40A 4ZPVR 1M5YA 4GGQA 4TNSA 1H0IA 3O5DA 3B9AA 2XP6A 2PV3A 3ARRA 2ZR6A 1W26A 1BKFA 2YBUA 4W9QA 2KFWA 4L3NA 3CH9A 1W1TA 3KAGA 1B6CA 1K9TA 4DRNA 1FKTA 5GQBA 3WIJA 2MF9A 3CHCA 3H9RB 4DT4A 1NWTA 4P8XA 1CTNA 3AS2A 2DSUA 1Q1CA 1ZU8A 1FFQA 3JYMA 1GPFA 4IQCA 1JVWA 2DSZA 4G50A 4ODRA 5DO2A 4DRHA 2O9OA 3NI6A 4JFJA 3RFWA 4IQ2A 3ARVA 1FAPA 3KZ7A 2RUDA 2RUCA 1NSGA 4MTVA 4DWSB 2A3EA 1TCOC 2PV1A 5HTGA 1JNEA 3ALFA 2XP3A 2XP8A 4DWSA 2A3BA 1U79A 1FKRA 2JZVA 4Q7NA 2PV2A 4TW7A 3AROA 1FKDA 1UR9A 2WLZA 4U84A 4LAWA 3CGMA 3WD3A 4JYSA 3IK8A 4ODNA 2WLYA 1Y0OA 3O5QA 1D7HA 1FKHA 1JNDA 1EHNA 1E6NA 4J4NA 5DIVA 3AS0A 4DRMA 1IX5A 2MNTA 3UQAA 4URIA 3WH0A 3UQIA 3NRKA 4LGXA 3CZ8A 3O5KA 2DPEA 3WD4A 2MLZA 3WD2A 2ITKA 1VF8A 1ZK6A 2KI3A 1OWQA 2G8ZA 2IUZA 5HT1A 1E6ZA 4ODOA 3O5EA 3KABA 3WD0A 5GPGA 2DT2A 2VN1A 1FKFA 3O5PA 1LQ0A 2KO7A 1PINA 3JYJA 2P4VA 2ESCA 3B8SA 1E44A 3IHZA 3ARWA 5HKGA 1JNSA 1Q6IA 2MPHA 2PBCA 2D9FA 2QF8A 3AS1A 1E6PA 3W4RA 3G6LA 2MLYA 2O92A 3PRAA 4JFKA 3ARQA 1ROTA 2VCDA 4P8VA 3KAFA 1OGBA 1J4IA 3O5FA 1SYTA 4BF8A 1Q6HA 4PTMA 4DWSC 2IF4A 5HW7A 4WIWA 1OGGA 2A3AA 3O5RA 4QT2A 4IT6A 1X6NA 2F23A 3NTPA 1LL7A 1FD9A 1W9VA 1NWRA 3PRDA 1ZBWA 4ODLA 4Z2JA 1LL6A 4O2TA 2DT3A 2PPPA 4DRPA 3RM9A 1WB0A 1LG2A 3VAWA 1FFRA 1L1PA 2LJ4A 5HBFA 2OLHA 5DITA 1J6YA 3AQUA 4TW6A 4G2PA 3O5IA 4S3KA 5I98A 1HJWA
chains in the Genus database with same CATH topology
2B31A 1SR0A 3CHEA 2XP7A 1YW5A 2ZQSA 3CGNA 4ODQA 4Z2GA 3WL0A 4JFIA 1KT0A 1ITXA 2OFNA 1D7JA 3KADA 2WM0A 1EQ3A 3OOBA 5HW6A 1O6IA 1TFVA 4TX0A 4DROA 2XP5A 4Z2HA 4Z2IA 1E9LA 2A3CA 1PBKA 2XP9A 3PA7A 4LAXA 2PPOA 4FAPA 1NMWA 2ZQUA 4FN2A 4WKHA 2DT0A 1FJDA 4Z2LA 1HXVA 2Y78A 2WK2A 3RMEA 4DRKA 2L2SA 4HARA 1EIBA 3KCEA 3O5GA 1J4HA 5BXJA 3ARUA 1GOIA 3IKGA 4R5EA 1HKKA 2XPBA 1QPFA 1ZBCA 3G6MA 1JNTA 3LUOA 1E6RA 3ARSA 1FKKA 1NH6A 4NNRA 1Q6UA 2RUQA 1C9HA 2ZR5A 1KFWA 4HBEA 2FAPA 2LKNA 3ARYA 3FY1A 2F4EA 1X6LA 2M1IA 2UZ5A 4JFMA 3KACA 1LJYA 4ODMA 4NZCA 4WKFA 4WK9A 4ZPWR 4KR0B 1EDQA 5HWCA 4ZPTR 5HUAA 4MPKA 4R0XA 4W9PA 1XRVA 1UR8A 3KAHA 3O5LA 3JXVA 3O5JA 1W1PA 4XAKA 1QPLA 4DIPA 1E15A 1HKJA 1N1AA 4N19A 2DT1A 1ZBVA 5HWBA 4Q22A 4U85A 4QZVB 5DF0A 4DZ3A 2RSEA 3WL1A 1XHGA 1GUVA 3TC5A 3O5MA 3OA5A 3RGCA 3UI4A 2DG9A 2MLXA 2XP4A 4DZ2A 3QOKA 2Q5AA 1FKJA 3WKZA 3ARXA 4IT4A 4AY1A 1W1YA 4DH0A 1NMVA 1NWSA 1P5QA 4ODKA 1ZBKA 4TYOA 2RURA 2RQSA 1FKGA 4C02B 4J4OA 2DG3A 4DRJA 5HW8A 2ZR4A 4DRIA 2FDMA 3KAIA 1EYMA 4MNKA 4KQZA 2DSWA 1RD6A 4ITZA 4LAYA 2G41A 4W5UA 5B8IC 2YBTA 3UF8A 4WJXA 4ML4A 1ZCNA 2PPNA 1FKSA 1QZ2A 2ZQVA 4HBOA 3GPKA 1W1VA 1BL4A 3BXWA 4W9OA 4DRQA 2M2AA 1W9UA 2ZQTA 3TCZA 1HKMA 1YATA 4Z2KA 1W9PA 1FKIA 1T11A 3RM4A 3O5OA 2M08A 4TW8A 5D75A 2FKEA 5GPRA 4QT3A 4MNMA 1F8AB 2KGJA 4L72B 1ZB5A 1ZL1A 4P8UA 1FKBA 4IPXA 4MGVA 5J6EA 1WNOA 4MAVA 1HJXA 3FAPA 4WKAA 1D6OA 2AOSA 1H0GA 4P8WA 1WAWA 2F2DA 4MNLA 1HKIA 1J4RA 2K8IA 4MNJA 5DEZA 4ZS6A 2LPVA 4NSBA 3B7XA 3AS3A 3PRBA 3ODKA 4U86A 5DIUA 1HJVA 4GIVA 2N87A 3I6CA 4LAVA 3MDYB 5JH8A 1R9HA 2PI6A 1KT1A 3EY6A 3WQVA 3CHFA 2XPAA 2DSVA 4ODPA 1D2KA 2DG4A 3TDBA 3ARTA 3UI5A 1D7IA 1NWUA 1LG1A 2KE0A 3UQBA 3ALGA 2KR7A 4DWSD 3WD1A 3UI6A 3ARZA 3WQWA 3RM8A 2LGOA 4JFLA 2AWGA 3IKDA 3ARPA 1FKLA 1LL4A 2F21A 4MSPA 3B9EA 4S3JA 1A7XA 4QIBA 3CHDA 3FXYA 3B9DA 3PR9A 1ROUA 1F40A 4ZPVR 1M5YA 4GGQA 4TNSA 3O5DA 1H0IA 3B9AA 2XP6A 2PV3A 3ARRA 2ZR6A 1W26A 1BKFA 2YBUA 4W9QA 2KFWA 4L3NA 3CH9A 1W1TA 3KAGA 1B6CA 1K9TA 4DRNA 1FKTA 5GQBA 3WIJA 2MF9A 3CHCA 3H9RB 4DT4A 1NWTA 4P8XA 1CTNA 3AS2A 2DSUA 1Q1CA 1ZU8A 1FFQA 3JYMA 1GPFA 4IQCA 1JVWA 2DSZA 4G50A 4ODRA 5DO2A 4DRHA 2O9OA 3NI6A 4JFJA 3RFWA 4IQ2A 3ARVA 1FAPA 3KZ7A 2RUDA 2RUCA 1NSGA 4MTVA 4DWSB 2A3EA 1TCOC 2PV1A 5HTGA 1JNEA 3ALFA 2XP3A 2XP8A 4DWSA 2A3BA 1U79A 1FKRA 2JZVA 4Q7NA 2PV2A 4TW7A 3AROA 1FKDA 1UR9A 2WLZA 4U84A 4LAWA 3CGMA 3WD3A 4JYSA 3IK8A 4ODNA 2WLYA 1Y0OA 3O5QA 1D7HA 1FKHA 1JNDA 1EHNA 1E6NA 4J4NA 5DIVA 3AS0A 4DRMA 1IX5A 2MNTA 3UQAA 4URIA 3WH0A 3UQIA 3NRKA 4LGXA 3CZ8A 3O5KA 2DPEA 3WD4A 2MLZA 3WD2A 2ITKA 1VF8A 1ZK6A 2KI3A 1OWQA 2G8ZA 2IUZA 5HT1A 1E6ZA 4ODOA 3O5EA 3KABA 3WD0A 5GPGA 2DT2A 2VN1A 1FKFA 3O5PA 1LQ0A 2KO7A 1PINA 3JYJA 2ESCA 3B8SA 3IHZA 3ARWA 5HKGA 1JNSA 1Q6IA 2MPHA 2PBCA 2D9FA 2QF8A 3AS1A 1E6PA 3W4RA 3G6LA 2MLYA 2O92A 3PRAA 4JFKA 3ARQA 1ROTA 2VCDA 4P8VA 3KAFA 1OGBA 1J4IA 3O5FA 1SYTA 4BF8A 1Q6HA 4PTMA 4DWSC 2IF4A 5HW7A 4WIWA 1OGGA 2A3AA 3O5RA 4QT2A 4IT6A 1X6NA 3NTPA 1LL7A 1FD9A 1W9VA 1NWRA 3PRDA 1ZBWA 4ODLA 4Z2JA 1LL6A 4O2TA 2DT3A 2PPPA 4DRPA 3RM9A 1WB0A 1LG2A 3VAWA 1FFRA 1L1PA 2LJ4A 5HBFA 2OLHA 5DITA 1J6YA 3AQUA 4TW6A 4G2PA 3O5IA 4S3KA 5I98A 1HJWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CGM A;  1FKJ A;  1R9H A;  4JYS A;  3IK8 A;  1KT1 A;  3EY6 A;  4ODN A;  4DH0 A;  2XP7 A;  1Y0O A;  1NMV A;  1FKH A;  1D7H A;  1YW5 A;  2XPA A;  2ZQS A;  3CGN A;  3O5Q A;  1P5Q A;  4J4N A;  4ODP A;  4ODQ A;  4ODK A;  4DRM A;  4JFI A;  1KT0 A;  2DG4 A;  3TDB A;  1FKR A;  2MNT A;  3UI5 A;  3UQA A;  1D7I A;  2KE0 A;  1D7J A;  2OFN A;  3KAD A;  4TYO A;  3WH0 A;  3UQB A;  1EQ3 A;  2RUR A;  3OOB A;  2KR7 A;  3UQI A;  2RQS A;  3NRK A;  5HW6 A;  1FKG A;  4TX0 A;  4DRO A;  3UI6 A;  2XP5 A;  4C02 B;  3O5K A;  4J4O A;  2LGO A;  2DG3 A;  1PBK A;  2MLZ A;  2XP9 A;  4JFL A;  4DRJ A;  2ZR4 A;  4DRI A;  5HW8 A;  2ITK A;  2AWG A;  3IKD A;  3KAI A;  1ZK6 A;  2KI3 A;  1FKL A;  1EYM A;  2F21 A;  3PA7 A;  4LAX A;  4MSP A;  2PPO A;  4FAP A;  1NMW A;  5HT1 A;  2ZQU A;  4FN2 A;  1FJD A;  1A7X A;  4ODO A;  4QIB A;  3O5E A;  4ITZ A;  4LAY A;  3KAB A;  4DZ2 A;  1HXV A;  2Y78 A;  5GPG A;  4DRK A;  2VN1 A;  2L2S A;  5B8I C;  1ROU A;  3UF8 A;  1FKF A;  1F40 A;  3O5P A;  1ZCN A;  3KCE A;  3O5G A;  1M5Y A;  2PPN A;  1J4H A;  2KO7 A;  5BXJ A;  1FKS A;  1PIN A;  1QZ2 A;  2ZQV A;  3IKG A;  1J6Y A;  2XPB A;  4GGQ A;  4TNS A;  3JYJ A;  1QPF A;  3GPK A;  1BL4 A;  3O5D A;  1JNT A;  2XP6 A;  3LUO A;  3IHZ A;  4W9O A;  1FKK A;  4DRQ A;  2PV3 A;  2M2A A;  4NNR A;  1Q6U A;  1W26 A;  2RUQ A;  2ZR6 A;  1BKF A;  5HKG A;  1JNS A;  1Q6I A;  1C9H A;  2KFW A;  4W9Q A;  2ZQT A;  2MPH A;  2ZR5 A;  2PBC A;  1B6C A;  2D9F A;  3KAG A;  3TCZ A;  2FAP A;  2LKN A;  4DRN A;  1FKT A;  1YAT A;  2F4E A;  2M1I A;  2UZ5 A;  2MF9 A;  3H9R B;  4JFM A;  3KAC A;  4ODM A;  4DT4 A;  1FKI A;  2MLY A;  1T11 A;  3O5O A;  2M08 A;  4JFK A;  1ROT A;  2VCD A;  4TW8 A;  5D75 A;  5HWC A;  1Q1C A;  2FKE A;  3KAF A;  4QT3 A;  5HUA A;  3JYM A;  4R0X A;  1F8A B;  1J4I A;  2KGJ A;  4W9P A;  3O5F A;  4IQC A;  4BF8 A;  1Q6H A;  2IF4 A;  5HW7 A;  1FKB A;  1JVW A;  3KAH A;  3O5L A;  4IPX A;  3JXV A;  3O5J A;  4MGV A;  5J6E A;  3O5R A;  4G50 A;  4ODR A;  3FAP A;  4QT2 A;  1QPL A;  4DRH A;  1D6O A;  4DIP A;  3NTP A;  3NI6 A;  2F2D A;  4JFJ A;  1FD9 A;  3RFW A;  4IQ2 A;  1FAP A;  3KZ7 A;  3PRD A;  2RUD A;  1J4R A;  2K8I A;  2RUC A;  4ODL A;  1NSG A;  2LPV A;  5DIV A;  1N1A A;  4N19 A;  1TCO C;  2PV1 A;  3B7X A;  4O2T A;  5HWB A;  3PRB A;  5HTG A;  4U85 A;  2PPP A;  4DRP A;  3ODK A;  4DZ3 A;  2RSE A;  2XP3 A;  2XP8 A;  4U86 A;  5DIU A;  3VAW A;  1L1P A;  2LJ4 A;  4GIV A;  1U79 A;  2N87 A;  3TC5 A;  3I6C A;  3O5M A;  4LAV A;  5DIT A;  2DG9 A;  2JZV A;  2MLX A;  2PV2 A;  2XP4 A;  4TW6 A;  4TW7 A;  3RGC A;  3UI4 A;  1FKD A;  4G2P A;  3MDY B;  3O5I A;  2Q5A A;  4U84 A;  4LAW A;  5I98 A; 
#chains in the Genus database with same CATH topology
 2B31 A;  1SR0 A;  3CHE A;  2XP7 A;  1YW5 A;  2ZQS A;  3CGN A;  4ODQ A;  4Z2G A;  3WL0 A;  4JFI A;  1KT0 A;  1ITX A;  2OFN A;  1D7J A;  3KAD A;  2WM0 A;  1EQ3 A;  3OOB A;  5HW6 A;  1O6I A;  1TFV A;  4TX0 A;  4DRO A;  2XP5 A;  4Z2H A;  4Z2I A;  1E9L A;  2A3C A;  1PBK A;  2XP9 A;  3PA7 A;  4LAX A;  2PPO A;  4FAP A;  1NMW A;  2ZQU A;  4FN2 A;  4WKH A;  2DT0 A;  1FJD A;  4Z2L A;  1HXV A;  2Y78 A;  2WK2 A;  3RME A;  4DRK A;  2L2S A;  4HAR A;  1EIB A;  3KCE A;  3O5G A;  1J4H A;  5BXJ A;  3ARU A;  1GOI A;  3IKG A;  4R5E A;  1HKK A;  2XPB A;  3EIP A;  1QPF A;  1ZBC A;  3G6M A;  1JNT A;  2ETN A;  1E6R A;  3LUO A;  3ARS A;  1GRJ A;  1FKK A;  1NH6 A;  4NNR A;  1Q6U A;  2RUQ A;  1C9H A;  2ZR5 A;  1KFW A;  4HBE A;  2FAP A;  2LKN A;  3ARY A;  3FY1 A;  2F4E A;  1X6L A;  2M1I A;  2UZ5 A;  4JFM A;  3KAC A;  1LJY A;  4ODM A;  1JCH B;  4NZC A;  4WKF A;  4WK9 A;  4ZPW R;  4KR0 B;  1EDQ A;  5HWC A;  4ZPT R;  2EUL A;  5HUA A;  4MPK A;  4R0X A;  4W9P A;  1XRV A;  1UR8 A;  3KAH A;  3O5L A;  3JXV A;  3O5J A;  1W1P A;  4XAK A;  1QPL A;  4DIP A;  3GTY X;  1E15 A;  1HKJ A;  1N1A A;  4N19 A;  2DT1 A;  1ZBV A;  5HWB A;  4Q22 A;  4U85 A;  4QZV B;  5DF0 A;  4DZ3 A;  2RSE A;  3WL1 A;  1XHG A;  1GUV A;  3TC5 A;  3O5M A;  3OA5 A;  3RGC A;  3UI4 A;  2DG9 A;  2MLX A;  2XP4 A;  4DZ2 A;  3QOK A;  2Q5A A;  1FKJ A;  3WKZ A;  3ARX A;  4IT4 A;  4AY1 A;  1W1Y A;  4DH0 A;  1NMV A;  1NWS A;  1P5Q A;  4ODK A;  1ZBK A;  4TYO A;  2RUR A;  2RQS A;  1FKG A;  3BMB A;  4C02 B;  4J4O A;  2DG3 A;  4DRJ A;  5HW8 A;  2ZR4 A;  4DRI A;  2FDM A;  3KAI A;  1EYM A;  4MNK A;  4KQZ A;  2DSW A;  1RD6 A;  4ITZ A;  4LAY A;  2G41 A;  4W5U A;  5B8I C;  2YBT A;  3UF8 A;  3GU0 A;  4WJX A;  4ML4 A;  1ZCN A;  2PPN A;  4UDM A;  1FKS A;  1QZ2 A;  2ZQV A;  4HBO A;  3GPK A;  1W1V A;  1BL4 A;  3BXW A;  4W9O A;  4DRQ A;  2M2A A;  1W9U A;  2ZQT A;  3TCZ A;  1HKM A;  1YAT A;  4Z2K A;  1W9P A;  1FKI A;  1T11 A;  3RM4 A;  3O5O A;  2M08 A;  4TW8 A;  5D75 A;  2FKE A;  5GPR A;  4QT3 A;  4MNM A;  1F8A B;  2KGJ A;  4L72 B;  1ZB5 A;  1ZL1 A;  4P8U A;  1FKB A;  4IPX A;  4MGV A;  5J6E A;  1WNO A;  4MAV A;  1HJX A;  2PN0 A;  3FAP A;  4WKA A;  1D6O A;  2AOS A;  1H0G A;  4P8W A;  1WAW A;  2F2D A;  4MNL A;  1HKI A;  1J4R A;  2K8I A;  4MNJ A;  5DEZ A;  4ZS6 A;  2LPV A;  4NSB A;  3B7X A;  3AS3 A;  3PRB A;  3ODK A;  4U86 A;  5DIU A;  1HJV A;  4GIV A;  2N87 A;  3I6C A;  4LAV A;  3MDY B;  5JH8 A;  1R9H A;  2PI6 A;  1KT1 A;  3EY6 A;  3WQV A;  3CHF A;  2XPA A;  2DSV A;  4ODP A;  1D2K A;  2DG4 A;  3TDB A;  3ART A;  3UI5 A;  1D7I A;  1NWU A;  1LG1 A;  2KE0 A;  3UQB A;  3ALG A;  2KR7 A;  4DWS D;  3WD1 A;  3UI6 A;  3ARZ A;  3WQW A;  2B5U B;  3RM8 A;  2LGO A;  4JFL A;  2AWG A;  3IKD A;  3ARP A;  1FKL A;  1LL4 A;  2F21 A;  4MSP A;  3B9E A;  4S3J A;  1A7X A;  4QIB A;  3CHD A;  3FXY A;  3B9D A;  3PR9 A;  1ROU A;  1F40 A;  4ZPV R;  1M5Y A;  4GGQ A;  4TNS A;  1H0I A;  3O5D A;  3B9A A;  2XP6 A;  2PV3 A;  3ARR A;  2ZR6 A;  1W26 A;  1BKF A;  2YBU A;  4W9Q A;  2KFW A;  4L3N A;  3CH9 A;  1W1T A;  3KAG A;  1B6C A;  1K9T A;  4DRN A;  1FKT A;  5GQB A;  3WIJ A;  2MF9 A;  3CHC A;  3H9R B;  4DT4 A;  1NWT A;  4P8X A;  1CTN A;  3AS2 A;  2DSU A;  1Q1C A;  1ZU8 A;  1FFQ A;  3JYM A;  1GPF A;  4IQC A;  1JVW A;  2DSZ A;  4G50 A;  4ODR A;  5DO2 A;  4DRH A;  2O9O A;  3NI6 A;  4JFJ A;  3RFW A;  4IQ2 A;  3ARV A;  1FAP A;  3KZ7 A;  2RUD A;  2RUC A;  1NSG A;  4MTV A;  4DWS B;  2A3E A;  1TCO C;  2PV1 A;  5HTG A;  1JNE A;  3ALF A;  2XP3 A;  2XP8 A;  4DWS A;  2A3B A;  1U79 A;  1FKR A;  2JZV A;  4Q7N A;  2PV2 A;  4TW7 A;  3ARO A;  1FKD A;  1UR9 A;  2WLZ A;  4U84 A;  4LAW A;  3CGM A;  3WD3 A;  4JYS A;  3IK8 A;  4ODN A;  2WLY A;  1Y0O A;  3O5Q A;  1D7H A;  1FKH A;  1JND A;  1EHN A;  1E6N A;  4J4N A;  5DIV A;  3AS0 A;  4DRM A;  1IX5 A;  2MNT A;  3UQA A;  4URI A;  3WH0 A;  3UQI A;  3NRK A;  4LGX A;  3CZ8 A;  3O5K A;  2DPE A;  3WD4 A;  2MLZ A;  3WD2 A;  2ITK A;  1VF8 A;  1ZK6 A;  2KI3 A;  1OWQ A;  2G8Z A;  2IUZ A;  5HT1 A;  1E6Z A;  4ODO A;  3O5E A;  3KAB A;  3WD0 A;  5GPG A;  2DT2 A;  2VN1 A;  1FKF A;  3O5P A;  1LQ0 A;  2KO7 A;  1PIN A;  3JYJ A;  2P4V A;  2ESC A;  3B8S A;  1E44 A;  3IHZ A;  3ARW A;  5HKG A;  1JNS A;  1Q6I A;  2MPH A;  2PBC A;  2D9F A;  2QF8 A;  3AS1 A;  1E6P A;  3W4R A;  3G6L A;  2MLY A;  2O92 A;  3PRA A;  4JFK A;  3ARQ A;  1ROT A;  2VCD A;  4P8V A;  3KAF A;  1OGB A;  1J4I A;  3O5F A;  1SYT A;  4BF8 A;  1Q6H A;  4PTM A;  4DWS C;  2IF4 A;  5HW7 A;  4WIW A;  1OGG A;  2A3A A;  3O5R A;  4QT2 A;  4IT6 A;  1X6N A;  2F23 A;  3NTP A;  1LL7 A;  1FD9 A;  1W9V A;  1NWR A;  3PRD A;  1ZBW A;  4ODL A;  4Z2J A;  1LL6 A;  4O2T A;  2DT3 A;  2PPP A;  4DRP A;  3RM9 A;  1WB0 A;  1LG2 A;  3VAW A;  1FFR A;  1L1P A;  2LJ4 A;  5HBF A;  2OLH A;  5DIT A;  1J6Y A;  3AQU A;  4TW6 A;  4G2P A;  3O5I A;  4S3K A;  5I98 A;  1HJW A; 
#chains in the Genus database with same CATH homology
 2B31 A;  1SR0 A;  3CHE A;  2XP7 A;  1YW5 A;  2ZQS A;  3CGN A;  4ODQ A;  4Z2G A;  3WL0 A;  4JFI A;  1KT0 A;  1ITX A;  2OFN A;  1D7J A;  3KAD A;  2WM0 A;  1EQ3 A;  3OOB A;  5HW6 A;  1O6I A;  1TFV A;  4TX0 A;  4DRO A;  2XP5 A;  4Z2H A;  4Z2I A;  1E9L A;  2A3C A;  1PBK A;  2XP9 A;  3PA7 A;  4LAX A;  2PPO A;  4FAP A;  1NMW A;  2ZQU A;  4FN2 A;  4WKH A;  2DT0 A;  1FJD A;  4Z2L A;  1HXV A;  2Y78 A;  2WK2 A;  3RME A;  4DRK A;  2L2S A;  4HAR A;  1EIB A;  3KCE A;  3O5G A;  1J4H A;  5BXJ A;  3ARU A;  1GOI A;  3IKG A;  4R5E A;  1HKK A;  2XPB A;  1QPF A;  1ZBC A;  3G6M A;  1JNT A;  3LUO A;  1E6R A;  3ARS A;  1FKK A;  1NH6 A;  4NNR A;  1Q6U A;  2RUQ A;  1C9H A;  2ZR5 A;  1KFW A;  4HBE A;  2FAP A;  2LKN A;  3ARY A;  3FY1 A;  2F4E A;  1X6L A;  2M1I A;  2UZ5 A;  4JFM A;  3KAC A;  1LJY A;  4ODM A;  4NZC A;  4WKF A;  4WK9 A;  4ZPW R;  4KR0 B;  1EDQ A;  5HWC A;  4ZPT R;  5HUA A;  4MPK A;  4R0X A;  4W9P A;  1XRV A;  1UR8 A;  3KAH A;  3O5L A;  3JXV A;  3O5J A;  1W1P A;  4XAK A;  1QPL A;  4DIP A;  1E15 A;  1HKJ A;  1N1A A;  4N19 A;  2DT1 A;  1ZBV A;  5HWB A;  4Q22 A;  4U85 A;  4QZV B;  5DF0 A;  4DZ3 A;  2RSE A;  3WL1 A;  1XHG A;  1GUV A;  3TC5 A;  3O5M A;  3OA5 A;  3RGC A;  3UI4 A;  2DG9 A;  2MLX A;  2XP4 A;  4DZ2 A;  3QOK A;  2Q5A A;  1FKJ A;  3WKZ A;  3ARX A;  4IT4 A;  4AY1 A;  1W1Y A;  4DH0 A;  1NMV A;  1NWS A;  1P5Q A;  4ODK A;  1ZBK A;  4TYO A;  2RUR A;  2RQS A;  1FKG A;  4C02 B;  4J4O A;  2DG3 A;  4DRJ A;  5HW8 A;  2ZR4 A;  4DRI A;  2FDM A;  3KAI A;  1EYM A;  4MNK A;  4KQZ A;  2DSW A;  1RD6 A;  4ITZ A;  4LAY A;  2G41 A;  4W5U A;  5B8I C;  2YBT A;  3UF8 A;  4WJX A;  4ML4 A;  1ZCN A;  2PPN A;  1FKS A;  1QZ2 A;  2ZQV A;  4HBO A;  3GPK A;  1W1V A;  1BL4 A;  3BXW A;  4W9O A;  4DRQ A;  2M2A A;  1W9U A;  2ZQT A;  3TCZ A;  1HKM A;  1YAT A;  4Z2K A;  1W9P A;  1FKI A;  1T11 A;  3RM4 A;  3O5O A;  2M08 A;  4TW8 A;  5D75 A;  2FKE A;  5GPR A;  4QT3 A;  4MNM A;  1F8A B;  2KGJ A;  4L72 B;  1ZB5 A;  1ZL1 A;  4P8U A;  1FKB A;  4IPX A;  4MGV A;  5J6E A;  1WNO A;  4MAV A;  1HJX A;  3FAP A;  4WKA A;  1D6O A;  2AOS A;  1H0G A;  4P8W A;  1WAW A;  2F2D A;  4MNL A;  1HKI A;  1J4R A;  2K8I A;  4MNJ A;  5DEZ A;  4ZS6 A;  2LPV A;  4NSB A;  3B7X A;  3AS3 A;  3PRB A;  3ODK A;  4U86 A;  5DIU A;  1HJV A;  4GIV A;  2N87 A;  3I6C A;  4LAV A;  3MDY B;  5JH8 A;  1R9H A;  2PI6 A;  1KT1 A;  3EY6 A;  3WQV A;  3CHF A;  2XPA A;  2DSV A;  4ODP A;  1D2K A;  2DG4 A;  3TDB A;  3ART A;  3UI5 A;  1D7I A;  1NWU A;  1LG1 A;  2KE0 A;  3UQB A;  3ALG A;  2KR7 A;  4DWS D;  3WD1 A;  3UI6 A;  3ARZ A;  3WQW A;  3RM8 A;  2LGO A;  4JFL A;  2AWG A;  3IKD A;  3ARP A;  1FKL A;  1LL4 A;  2F21 A;  4MSP A;  3B9E A;  4S3J A;  1A7X A;  4QIB A;  3CHD A;  3FXY A;  3B9D A;  3PR9 A;  1ROU A;  1F40 A;  4ZPV R;  1M5Y A;  4GGQ A;  4TNS A;  3O5D A;  1H0I A;  3B9A A;  2XP6 A;  2PV3 A;  3ARR A;  2ZR6 A;  1W26 A;  1BKF A;  2YBU A;  4W9Q A;  2KFW A;  4L3N A;  3CH9 A;  1W1T A;  3KAG A;  1B6C A;  1K9T A;  4DRN A;  1FKT A;  5GQB A;  3WIJ A;  2MF9 A;  3CHC A;  3H9R B;  4DT4 A;  1NWT A;  4P8X A;  1CTN A;  3AS2 A;  2DSU A;  1Q1C A;  1ZU8 A;  1FFQ A;  3JYM A;  1GPF A;  4IQC A;  1JVW A;  2DSZ A;  4G50 A;  4ODR A;  5DO2 A;  4DRH A;  2O9O A;  3NI6 A;  4JFJ A;  3RFW A;  4IQ2 A;  3ARV A;  1FAP A;  3KZ7 A;  2RUD A;  2RUC A;  1NSG A;  4MTV A;  4DWS B;  2A3E A;  1TCO C;  2PV1 A;  5HTG A;  1JNE A;  3ALF A;  2XP3 A;  2XP8 A;  4DWS A;  2A3B A;  1U79 A;  1FKR A;  2JZV A;  4Q7N A;  2PV2 A;  4TW7 A;  3ARO A;  1FKD A;  1UR9 A;  2WLZ A;  4U84 A;  4LAW A;  3CGM A;  3WD3 A;  4JYS A;  3IK8 A;  4ODN A;  2WLY A;  1Y0O A;  3O5Q A;  1D7H A;  1FKH A;  1JND A;  1EHN A;  1E6N A;  4J4N A;  5DIV A;  3AS0 A;  4DRM A;  1IX5 A;  2MNT A;  3UQA A;  4URI A;  3WH0 A;  3UQI A;  3NRK A;  4LGX A;  3CZ8 A;  3O5K A;  2DPE A;  3WD4 A;  2MLZ A;  3WD2 A;  2ITK A;  1VF8 A;  1ZK6 A;  2KI3 A;  1OWQ A;  2G8Z A;  2IUZ A;  5HT1 A;  1E6Z A;  4ODO A;  3O5E A;  3KAB A;  3WD0 A;  5GPG A;  2DT2 A;  2VN1 A;  1FKF A;  3O5P A;  1LQ0 A;  2KO7 A;  1PIN A;  3JYJ A;  2ESC A;  3B8S A;  3IHZ A;  3ARW A;  5HKG A;  1JNS A;  1Q6I A;  2MPH A;  2PBC A;  2D9F A;  2QF8 A;  3AS1 A;  1E6P A;  3W4R A;  3G6L A;  2MLY A;  2O92 A;  3PRA A;  4JFK A;  3ARQ A;  1ROT A;  2VCD A;  4P8V A;  3KAF A;  1OGB A;  1J4I A;  3O5F A;  1SYT A;  4BF8 A;  1Q6H A;  4PTM A;  4DWS C;  2IF4 A;  5HW7 A;  4WIW A;  1OGG A;  2A3A A;  3O5R A;  4QT2 A;  4IT6 A;  1X6N A;  3NTP A;  1LL7 A;  1FD9 A;  1W9V A;  1NWR A;  3PRD A;  1ZBW A;  4ODL A;  4Z2J A;  1LL6 A;  4O2T A;  2DT3 A;  2PPP A;  4DRP A;  3RM9 A;  1WB0 A;  1LG2 A;  3VAW A;  1FFR A;  1L1P A;  2LJ4 A;  5HBF A;  2OLH A;  5DIT A;  1J6Y A;  3AQU A;  4TW6 A;  4G2P A;  3O5I A;  4S3K A;  5I98 A;  1HJW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...