4DRVA

Cell attachment protein vp8* of a human rotavirus specifically interacts with a-type histo-blood group antigen
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
163
structure length
163
Chain Sequence
b'GSTLDGPYQPTTFNLPIDYWMLIAPTQIGRVAEGTNTTDRWFACVLVEPNVQNTQREYVLDGQTVQLQVSNNSSTLWKFILFIKLEKNGAYSQYSTLSTSNKLCAWMKREGRVYWYAGTTPNASESYYLTINNDNSNVSCDAEFYLIPRSQTELCTQYINNGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer capsid protein VP4
publication title Cell attachment protein VP8* of a human rotavirus specifically interacts with A-type histo-blood group antigen.
pubmed doi rcsb
source organism Rotavirus sp.
molecule tags Viral protein
total genus 40
structure length 163
sequence length 163
ec nomenclature
pdb deposition date 2012-02-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4drvA00
1DYPA 3AP9A 3NV1A 3ILNA 3N36A 5FRAA 1GLHA 5H9SA 1LESA 2UWCA 3V65A 3AXEA 4ATEA 4XXPA 3C2UA 4NOTA 3H0OA 5H9RA 3WDXA 3ZSMA 4BOWA 4PBOA 1FAYA 1Q8PA 5T54A 3RMYA 3MW3A 1IOAA 1CN1A 3MEPA 3O5SA 3WCSA 1FV3A 1V6KA 1N1VA 3A0NA 3AP7A 1SLLA 5JLVA 2WLQA 1QDCA 2HYKA 4XJAA 2ZBJA 4XJ8A 4ATFA 1RINA 5JMCA 2ARXA 3ZYPA 1OKQA 4LBJA 1S0DA 4XBNA 1N1SA 1UZZA 3ILRA 2ZACA 2ZZJA 1N3QA 1WD4A 1C57A 2DTYA 3GNEA 4UW4A 5EYXA 1KRIA 1UAIA 1IS4A 1CR7A 1QMJA 2ZGLA 5JOXA 4Y26A 4SLIA 3V64A 2LALA 3BIWE 1QOOA 1UPSA 1GANA 1DBNA 4K1YA 1IS6A 4P14A 4YM1A 2EXHA 3ASIA 3ENRA 3ZPYA 3BTAA 1DQ2A 4UW3A 1PZ7A 1CQ9A 1JW6A 1GZCA 1LEMA 1V6IA 4PF5A 1LHWA 1CPMA 1KQRA 1MVEA 4JRAA 5T52A 1LEDA 3FUOA 1LODA 3T1MA 1AXYA 4AYUA 1F5FA 4XJ9A 2P3IA 2DYCA 2UWAA 2H0BA 5HCAA 1LGBA 3MW4A 4XBQA 1N1TA 2VW1A 5GLUA 3N7JA 3A4UA 4YFWA 1V6NA 1BXHA 1A78A 2PHWA 1FNYA 4BM8A 5JOZA 3FBYA 4L8QA 1GZWB 1LHVA 3MW2A 2UWBA 4YZ1A 1FX5A 2P37A 3B9CA 4WVVA 5DZEA 5T5PA 1CVNA 5IK7A 4XJUA 4GKXA 3ZXFA 4CRQA 4M00A 4XDQA 3FLPA 1A3KA 1MS0A 1LULA 2ZHMA 2A6YA 2V5YA 3FLTA 2FHRA 3LSDA 2A70A 2GN3A 1DIWA 2R0FA 4FPKA 2D6MA 2JDZA 1W6QA 1LOFA 5IK8A 3LCPA 2GMMA 1FV2A 2D6OX 1XQNA 1C1LA 1LOCA 1S0CA 4DQAA 3D4KA 1MS9A 1LOBA 5L73A 3OY8A 1YIFA 1LU1A 2CTVA 3B01A 4YGDA 2GNDA 1G8WA 3WUCA 1MACA 2EF6A 3R4SA 4K20A 5T55A 5KXEA 1RITA 1DYKA 3I4IA 4D69A 1N3PA 1OQ1A 1QNWA 1V00A 3D6EA 5H9QA 4Q2FA 4ISRA 3ZXLA 1JN2P 1SLBA 5EXOA 1I3HA 2VW2A 3AK0A 2VY0A 2P3JA 2ZAAA 1G9CA 2ENRA 3AJYA 1ZM1A 1TEIA 2WSVA 1CJPA 3M3CA 4U2AA 4DFSA 2W52A 1AJKA 1MS3A 2ZGUA 4BMEA 3WNXA 5DG1A 1AX0A 1G9BA 1MS1A 1HLCA 1S0FA 2ZMNA 1ULFA 2D6LX 3CNAA 4YM3A 3VKOA 2GNTA 5T50A 4XE9A 4FOVA 5DZGA 4PQ9A 1ULCA 1LECA 5IK5A 1MS5A 4R9DA 1ULEA 2VU9A 4AGGA 5DZFA 3WZ1A 2DVAA 3VV1A 3WVJA 4Y1VA 3OGGA 2EALA 3OBRA 3POYA 3WHUA 2GNMA 2YXSA 1WW4A 1YI7A 1BZWA 5DUXA 3KM5A 2A6WA 4P9XA 2NYYA 1Y7BA 4AVTA 2WSUA 2ES3A 2VW0A 2NZ9A 1BJQA 1GBGA 2ZABA 2YROA 2W68A 4LBQD 4XHXA 4LBMA 2YMZA 5F9TA 5GALA 1DGLA 2R49A 4DS0A 4FPHA 3M2MA 1AX1A 1YXWA 1LJ7A 4AVVA 3A0KA 4XIKA 1SLIA 2NN8A 3NV4A 5DG2A 2E51A 1HQWA 1C1FA 1ULGA 5GM0A 2JECA 5BYNA 3V0AA 1CIWA 2C9AA 4PBPA 3DGTA 4YZ3A 1KITA 1ULDA 1X50A 2PHRA 1SCRA 4XIOA 1H9WA 1AJOA 2AYHA 4FPCA 4BPZA 3AX4A 1LOAA 1AF9A 1BQPA 1S0JA 5GZFA 4YM2A 1LENA 4F83A 2YZ4A 1IS5A 2P2KA 4PCRA 4YGBA 3N3HA 4ISQA 2V73A 2XG3A 4TYSA 4BQ1A 2ZGTA 1HDKA 4GA9A 2E53A 4Y1YA 1QOSA 3O0XA 2D6PA 2WQZC 1MS8A 1LOFC 4MYEA 1QOTA 2DURA 3ZXEA 4YGCA 1YRZA 1UL9A 4YZ4A 3WCRA 1WD3A 4XTPA 5JOYA 2BQPA 4DRVA 4LBKA 2GDFA 4RL7A 1VIWB 3IMNA 1W6PA 5IUQA 1LHOA 2R1DA 2ZGPA 3AZWA 2YV8A 1I1EA 3WUDA 1GNHA 2WT1A 4YZ5A 1AXKA 4K1ZA 1IKPA 1IS3A 1DQ4A 2A5ZA 1FATA 4FOQA 3SITA 4AWDA 3VKNA 3FLRA 4XJZA 2WT2A 1SLAA 4XTMA 4FQZA 1UX6A 4Y24A 2EXIA 1QU0A 1ENRA 3SH3A 1O4YA 1N1YA 4YM0A 3UJQA 2DTWA 2OW4A 5EYYA 3RG0A 1SLCA 3AYEA 2AREA 1Z78A 3SH4A 3WDUA 5IT6A 1D0HA 2A6VA 2CYFA 1DZQA 1GYKA 2PHTA 3BOPA 3MPPG 3R4UA 4UW6A 2WT0A 1KDMA 4YW1A 1WW7A 1ENQA 3AZXA 2GN7A 4YZ2A 4TZDA 3L2YA 2ZHKA 4BLJA 1DQ6A 3PVOA 1V6JA 4UW5A 1KDKA 4K21A 2ZGMA 3ILFA 3WLUA 2A6ZA 4Q8LA 1ENSA 4W65A 3PVNA 1W6QB 2EXJA 4ZXKA 1VALA 4FOYA 4Q1RA 2ZKNA 2ZGNA 1W6MA 5T5JA 3PVEA 2DVGA 3JU9A 1WBFA 4FVVA 2Q5TA 2D43A 4ITCA 2EXKA 2UURA 3OY8B 3UL2A 2OVUA 2D44A 3SH5A 3OPZA 1G9FA 1F31A 3DUIA 3RSJA 2SBAA 1CESA 4FPOB 1GSLA 2E7QA 2D3PA 5JOWA 1AX2A 2A3YA 3N35A 1LU2A 1QF3A 4XILA 5GZCA 1LGCA 3O0WA 4OZXA 5CBLA 2GMEA 1LOEA 5H9PA 5GZGA 3AYAA 4Y20A 1R1ZA 3AYCA 1MZ5A 5KXBA 2YY1A 1D2SA 3HN1A 4NO4A 2NMOA 3AXDA 2OUHA 4LBNA 1SBDA 2CY6A 2AR6A 3B00A 3PJQA 4AGRA 1BYHA 1WW6A 3PMEA 5GZDA 3I8TA 1J1TA 3TAYA 4CZSA 5JVVA 4Z8BA 3D5OA 3WDYA 4Q1PA 4JC1A 2NP0A 2GNBA 2AH2A 1SFYA 2VUAA 3ATGA 3AFKA 5T5OA 1GICA 2JJ6A 1F9KA 2KM2A 1DQ0A 3SNMA 2ZMLA 4HL0A 4FP2A 2ERFA 4FOWA 4FPGA 4Q26A 4R9BA 1HKDA 2DUQA 1UZYA 2OUJA 2D3RA 3QLQA 4KBBA 1LCLA 1PZ8A 1H30A 1WUVA 1JOJA 1O4ZA 5E8AA 4YFZA 1MZ6A 1OFSA 1WLCA 4IQPA 2DVFA 1JYIA 1FYUA 5SV8A 4FPEA 5DUVA 4DRRA 3N7LA 3AJZA 1IKQA 2GALA 3RQ0A 4M3CA 4FPFA 3ZSJA 1NLSA 2D3SA 2D6KA 4C1XA 4M3CB 2TEPA 2ZGKA 1Q8VA 5GJ6A 1V6MA 1QDOA 3B3QE 4XZPA 1W6NA 4BMBA 1W6NB 1DQ5A 4FPLA 1G9AA 3ZSLA 2A3XA 3V0AB 1LHNA 1CONA 1SBEA 1YO8A 3ZXJA 2WNEA 3T1LA 2DUPA 1KJRA 4LBLA 2ZHNA 2ZMKA 3M3QA 1Q8OA 3OYWA 3JUUA 1URXA 1VAVA 4AGVA 3BODA 3WOGA 2VXRA 3OYWB 3WG4A 1AVBA 1DFQA 3N7KA 2R1BA 3M1HA 1V6OA 1SCSA 3T2TA 5T5LA 3ZYRA 1KJLA 3AZZA 3OJBA 4YG0A 5GLTA 3USUA 4Y1ZA 1QKQA 3R05A 4GALA 3FFZA 3USUB 2E6VA 1B09A 1W0PA 4R9CA 2ZHLA 1JHNA 3NWKA 5F5QA 4C1WA 1EPWA 1V6LA 3ZVXA 2UU8A 3LSEA 2R16A 3FUQA 4FPYA 4GXLA 2EAKA 1Q8QA 3WG1A 3AP6A 1WBLA 5CB7A 1LGNA 2A7AA 2DUOA 5DXDA 3VKMA 2XB6C 4XHBA 5AVAA 3ZSKA 2W08A 4P9WA 4CTEA 1N3OA 1FNZA 4XJWA 1W6PB 3AYDA 2CNAA 3APBA 4YGEA 2CL2A 5GLZA 3WV6A 4ZKTB 1YYNA 1DHKB 1G86A 4FQ4A 3NV2A 5CA6A 3WDTA 1MS4A 4Y1UA 3WG2A 2R0HA 2WKKA 3V0BA 3RRDA 3V0BB 4Q8KA 3WG3A 3AZVA 4YLZA 2RHPA 5CNAA 4LBQA 1AZDA 1GNZA 4M3CF 2LTNA 3OBTA 4LBQB 2ARBA 2NM1A 3VKLA 2B7YA 4Q27A 3GALA 1MVQA 1MR5A 4ASMB 2C5DA 1A8DA 4BLIA 5LK5A 1PZ9A 2A75A 3IM0A 1SBFA 4U36A 4WV8A 4GWMA 4R9AA 3HMYA 1NXD1 1H9PA 3HR9A 1JYCA 2A3WA 2I2SA 2ZGQA 3IPVA 4Y1XA 3SISA 2AGSA 2ZGOA 3IN9A 3IPVB 3O12A 1WW5A 1S0GA 4HANA 1S0BA 1G7YA 1ZA4A 2ZGRA 3M3OA 3INAA 1WCSA 2ZGSA 1BKZA 1S0IA 1GZWA 4WVWA 5CAZA 5IK4A 1LHUA 2DV9A 3AP5A 2PHFA 2DU0A 2DU1A 3RMXA 1W6MB 1G9DA 2DWRA 1GZ9A 1Q8SA 4YG3A 2P34A 1APNA 4FP3A 5FREA 3N7MA 2DVDA 4Y22A 4DPNA 2AUYA 4Y22B 3M3EA 2GMPA 5E88A 4YW2A 1Z0HA 2JD4A 3VUOA 2FMDA 1WLWA 1S0EA 2CWSA 2A71A 4YG6A 2E7TA 4LBOA 2P3KA 3QCWA 1W6OA 2Z42A 2VH9A 4XOGA 1S1AA 1W6OB 5E89A 4JCKA 1VLNA 5HCBA 4Y20B 5GLVA 5KXCA 3W58A 4GWNA 4XBLA 3VKFC 1WLDA 2WJSA 3TB0A 1AXZA 1HQLA 4AVSA 4WZFA 4RA0A 1JXNA 2DVBA 2G4IA 1SACA 1GKBA 1QGLA 2JKBA 3POSA 5GZEA 4P9YA 4GKYA 4XMIA 1QNYA 1RIRA 1VAMA 4M3CE 2AENA 1JBCA 2D6NA 1LOGA 1UKGA 2A6XA 2JE9A 1GV9A 2PHXA 1LTEA 3WHTA 2PHUA 3UK9A 5JDBA 3W59A 4XMAA 2JE7A 1W0OA 4I30A 5KXDA 3RS6A 5EWSA 1U0AA 4YW5A 3KQRA 4XYXA 1JUIA 1Q56A 2PELA 2CWMA 3SLIA 1UMZA 1UN1A 1SLTA 3WDVA 2D7FA 2NMNA 3WDWA 3U4XA 3B69A 3UJOA 2SLIA 1ONAA 3IKWA 1C4RA 4YW4A 1DQ1A 4XXAA 2ZA9A 3POWA 3AP4A 2W39A 3NV3A 1N47A 4M01A 3ZXKA 1CPNA 1DLLA 2EIGA 5DUWA 5GLWA 3AZYA 3Q9OA 5HCFA 3O0VA 5DUUA 4YW3A 4FPJA 4H55A
chains in the Genus database with same CATH superfamily
1DYPA 3AP9A 5DDJ1 2E32A 3H3UA 5G05L 4HPKA 4HPKB 3V65A 2HEVF 3AXEA 2NPIA 1K5MA 3MGUA 3PL0A 1NQJA 1F4AA 5H9RA 3H0OA 3FHAA 1O8SA 1BBT1 3RMYA 5CEHA 3ROUA 1SEFA 4D94A 1JZ3A 1FV3A 2WIIB 4BDVB 4AI2A 3H8RA 2OKXA 1Y9QA 3AP7A 1VB4A 4NIAA 1QDCA 3KV6A 4TLGA 1VE0A 1QQP1 3RNSA 1RUJ2 3S5AA 3WW3A 2BGPA 4KGQA 5FZ1A 3ZYPA 4DB5A 3JD72 5A32B 1J3PA 4B29A 1UZZA 4P08A 4QGNA 1E5IA 1C57A 2DTYA 1KRIA 2PFWA 3H1WA 3MLJA 5FPUA 1W06A 1QMJA 4XZUG 5CKMA 2W91A 2DCZA 4Y26A 3FFQA 3V64A 4YM1A 1RUD3 5BNPB 1UY2A 4FFIA 1PIV3 4QAWA 4IL7A 4XURA 5F9TA 3VBHC 2JB8A 1ASJ2 2DDUA 3ENRA 3BTAA 1DQ2A 4JAAA 4MHRA 1UYZA 2Y33A 4IV3C 1CQ9A 2WLPA 4UXAA 4OI1A 4PF5A 1LEDA 4QPGA 3ZKYA 4QKNA 3C7EA 4YVSB 3EO6A 4AYUA 4QPGB 5FZ8A 2W9XA 4LIVA 4XJ9A 3T4VA 1RUH1 1XYPA 1FPN1 1LGBA 4TLFA 4XBQA 1N1TA 3WNLA 5FK7A 2WZR2 3N7JA 3A4UA 1V6NA 5JOZA 3R6SA 3EJKA 4JTOA 3FBYA 1AL23 1GZWB 1LHVA 4EE2A 1XE0A 2P37A 3B9CA 5DZEA 1CVNA 4AQ6A 1VBB3 2ZEXA 3ZR6A 5HV4A 4EN0A 1MS0A 5LB6A 1L7QA 1C8NA 5J7MA 5LK7B 2FDIA 4AFCA 1DIWA 4RHV2 2BOIA 2J22A 1OA2A 4BQXA 4A6OA 4WVZA 5IK8A 2GMMA 1OF4A 5DPNA 5C4WC 1C1LA 1LOCA 1S0CA 2YYOA 1RUC3 3D4KA 1LOBA 1RVF3 2VCBA 4HONA 3OY8A 1YIFA 4IV3B 2GNDA 3ABZA 3WUCA 4AFAA 2EF6A 3R4SA 3SQOA 2J7MA 1MZFA 1EP0A 1WCQA 1VR3A 5T55A 1CAXB 2YUEA 4QX8A 1OKOA 1QNWA 4OMDA 1GNYA 5J3UA 3ZXLA 1SLBA 5EXOA 3AKTA 4S2GA 2ZAAA 2P3JA 3U11A 5C3SA 1ZM1A 1TEIA 2JDHA 5FK8A 1CJPA 3M3CA 1DGWA 3RFRA 2OQ7A 1X9PA 2BBAA 2JG9A 2VAUA 3H8UA 3WW4A 3I49A 3F95A 4AAPA 4MH0E 1CD3G 3CQOA 1MS1A 4CSWA 1NG0A 4GB31 4QD2A 2VGDA 4I01A 2TNFA 5FYYA 5FZFA 4FOVA 5B4XA 3D0JA 2JDPA 1VBA1 1BLZA 4GULA 3H9AA 1ULCA 2VZUA 5JUVA 1VJ2A 2R043 2QJVA 2WBKA 4GMP0 4PF1A 5FZBA 3D0SA 4NWWA 1RMU1 1ULEA 5IAVA 5KWRA 4XQDA 3O1MA 4MGZE 1HXS2 3OGGA 2PXJA 3POYA 4LO8A 3JBG3 2FZ2A 1UZ0A 3ZN4A 1GOGA 4L97A 4Z2AA 4HK8A 4WM7A 5FDBA 1LKNA 1TMF1 2A1XA 2I07B 4F8AA 3I54A 4DXZA 4IGQA 2JG8C 2C24A 2JKXA 3ZLIA 1PO12 5FO8B 2ES3A 1HV1A 2VW0A 1BJQA 4XHXA 4LBQD 2YROA 1JYWA 2YMZA 2B5HA 4BYYA 2WN2A 4CE8A 3SKVA 4CP0A 5IVFA 2YBPA 4AVVA 3NKTA 2HEWF 2RS13 3W21A 5BNQA 3NAPA 3RZGA 4P02B 2E51A 1Y9MA 3POJA 2J1EA 4QX7A 5C70A 2JECA 4RQPC 1CIWA 1ALYA 2BTVC 5IAXA 4SBVA 2HWE2 3U78A 2XPJA 4YZ3A 4XIOA 2XWBB 1H9WA 1X9TA 2MEV3 4FPCA 4JGYA 4Q0VA 3AX4A 3ZPOA 1S0JA 4Q4V3 2HWD3 4YM2A 5K0UA 1LENA 4F83A 2YZ4A 4BQ4A 2P2KA 3ON7A 4PCRA 1J84A 3R0RA 5I0TA 2GH2A 4DMIA 4BQ1A 4BH9A 2ZGTA 1HDKA 3FBMA 4GA9A 4HLTA 2E53A 2QQMA 4Y1YA 4DXTA 5EHDA 1D4M2 1QOSA 3U07A 1QEXA 3E97A 4JTNA 4K7JA 1EUUA 1H8VA 4MYEA 2DURA 4YZ4A 4J6GA 4XCAA 3WCRA 4ES9A 1WD3A 4XTPA 5A6ZA 1NCQA 5JOYA 2VMEA 5BNNC 1NCQB 1VIWB 3PMSA 2HBTA 4O61A 1UNBA 2XWJB 4E2QA 4LT5A 3IMNA 4RGGA 1W6PA 2Y6FA 1ZRFA 1R081 4AE2A 2R1DA 3T2PA 3BKZA 5LASA 2FQPA 3QH7A 4K1ZA 1IS3A 2A5ZA 3ZN6A 2VCAA 2O0OA 5F5CA 3ZN6B 1ND3C 3HQXA 4IEVA 4I02A 1HW5A 2DF7A 3WXPA 1R1A2 2RM22 4XJZA 3VBFC 4XTMA 2CGOA 5CG9A 2WZR1 2EXIA 5FP4A 1QU0A 1O4YA 2OZJA 2VOXA 2DTWA 5F1RA 5CYYA 4G9SB 5FXZA 1RUC1 1SLCA 2JEMA 5FZIA 2A6VA 3MPPG 5FZ3A 1DZQA 1KS4A 1OUSA 3WY6A 4BE3A 4BA6A 1WW7A 4LE4A 1GQHA 4XF1A 2BNOA 1W8OA 1PK6C 5HV0A 4YVWB 1ZZ7A 3PVOA 1YFYA 4RHV1 5DQ0A 3WLUA 1W6QB 5FYHA 3I59A 5FZEA 5CFDC 1VALA 1ZZ9A 4HKLA 4Q1RA 2XGXA 1W6MA 5T5JA 3PVEA 3ACIA 1U5IA 3AMMA 1MPXA 2EXKA 2J1AA 1ZZ6A 3PHMA 5F39A 2Y6LA 1H2KA 2SBAA 4KWLA 5F3IA 3CF6E 5FMOS 4OI2A 4CDXC 2HBUA 3POBA 4CP9A 4D6RA 2D3PA 5JOWA 1JYTA 2QVSB 1OSGA 1LU2A 1QF3A 4CP9B 2BGCA 4DNYA 4KU8A 4BISA 4OZXA 3KGZA 5KHHA 2X5IC 3QACA 5JR2A 1LOEA 1PGW1 3AYAA 5KC5A 4Y20A 3AYCA 2MPFA 4F7ZA 5KXBA 3H1YA 4MHUA 1PM4A 2YY1A 1D2SA 4ZXEA 3N9NA 1QJX3 5JSOA 5L36A 3JBG1 2OUHA 3IDAA 1SBDA 5JPMB 2WA3A 4FTBA 2VTXA 3CO2A 4JHTA 1WW6A 3VLBB 3PMEA 5GZDA 4N7IA 3I8TA 4AI3A 1GQPA 3WDYA 4G4FA 3WR0A 1NYWA 2AH2A 1R64A 3HNBM 1OOPC 2VZPA 3VZNA 1ULOA 1W8NA 4CP1A 2C26A 1DQ0A 4AVCA 1AL0G 3KHBA 2TBVA 3SNMA 2ZMLA 4HL0A 2RS11 2XL7A 4FOWA 1HRV2 1Q3EA 2WWSA 4N53A 4Q26A 4AI9A 2DUQA 4COVA 4N53B 5C9AA 2OUJA 4KBBA 3I2GA 1L7LA 5C9AB 4OHWA 4L11A 4OHXA 1JOJA 4B4RA 1YJLA 5E8AA 3ACHA 1B35A 2DVFA 2ORXA 2ADEA 4FPEA 1OFNA 1XB9A 3HVDA 3N7LA 3KT1A 2Q8DA 3JZVA 2GALA 3RQ0A 3VBSB 4M3CA 5FZOB 3ZSJA 1ULPA 2HWC3 3HD8B 4H3WA 1UOGA 4M3CB 1HV0A 2TEPA 4C1XA 5GJ6A 1V6MA 4E4DX 3GXUA 4Z82A 4DXSA 5FMBA 3LQCA 4KNCA 1OT5A 4LPLA 2RS52 1LHNA 1CONA 1U5XA 1YO8A 4N43C 3ZXJA 4C0HA 4A44A 5A3NA 4LO5B 3CL1A 3PUQA 2DCJA 1OHFA 4AW7A 3KGLA 4CDUA 3MDPA 2VM9A 4MUVA 2ID4A 1AHSA 4JVAA 4CDUB 4AGVA 1XSRA 3BODA 4XFGA 3WOGA 5LA0A 4A4AA 5AC93 5J48A 2QE3A 2WNVC 2RDQA 2ZX0A 3OJBA 4YG0A 1NA1A 1OI6A 4GIQA 4LHKA 3RDIA 1DGRN 4Y1ZA 2WFF2 2Y6HA 5FTTC 4IV1A 3USUA 1QJU2 4GALA 3USUB 5JCTA 1GU3A 1PVC2 1D4M1 2W46A 4R9CA 5KHJA 4OI0A 3NVCA 3NWKA 5L7OA 4C1WA 4PIYA 1PGSA 3USSA 5FPLA 3ZVXA 3HT2A 2HWF1 4EWDA 5CB7A 3ZKUA 1LGNA 5EV7A 5LATA 2VZTA 2XB6C 3MLLA 4NHYA 3AYDA 1AYN2 2CNAA 4YGEA 3CKHA 2VNRA 4LE3A 2JE8A 1YYNA 1OPOA 1G86A 5CA6A 3NNJA 2RE9A 3NV2A 1IPKA 2IFWA 5DAVA 2X09A 2YG0A 1JYXA 3RRDA 2P5BA 3DYOA 3WF1A 2RM21 1AR73 3AZVA 4L2NA 3KSCA 4LBQA 3C7HA 1O3RA 3LAGA 1FMD2 1CZSA 4LBQB 2BNMA 1XU2A 2NM1A 2VL4A 5A7WB 3VKLA 4Q27A 3ZXDA 3GALA 3GGLA 3GZTB 4ASMB 2C5DA 3GCWA 4L99A 1AR82 4MGYE 2ILMA 1W99A 2A75A 2LM3A 2QBXA 1SBFA 4DUWA 4WV8A 3W20A 3AMPA 4AHWA 1UIJA 4XACA 1NXD1 1OLRA 5JIAA 1JYCA 2A3WA 3IPVA 4N9IA 4Y1XA 3LGRA 1JYNA 3IN9A 3IPVB 4DUVA 1WW5A 4XAAA 3PIGA 4B7EA 2ZGRA 2ET1A 2W2IA 4UFKA 2XJSA 1BEV2 1WCSA 2VVEA 2JX9A 5FQ0A 5IK4A 3ACFA 1PVXA 4AI8A 1LHUA 5FQ0B 2TUNA 2PAEA 3EYPA 1GWMA 1Z7S3 2DWRA 1Q8SA 1OPMA 3VDDC 5FREA 3GHMA 1QJX1 1JTZX 3N7MA 4B1MA 1W8HA 4Y22A 4DPNA 1VBD2 1BVVA 4Y22B 5A3MA 4L9BA 5E88A 3VZKA 1Z0HA 4ZS3A 3VUOA 3MF6A 1XU1A 2F4LA 2X29A 1W28A 1REDA 3RYRA 3PTYA 5FWEA 2JIGA 4LK7A 3GCXA 1SPPB 2BWAA 4CUCA 2VD7A 5C33A 1W6OA 2Z42A 4ONUA 2VH9A 5L19A 1S1AA 1W6OB 1XXNA 1VLNA 3NNFA 3ALQA 1RUE3 3ELNA 4MGKE 5FZLA 3RI8A 1HN0A 1AR93 2VG9A 3OD0A 3KF3A 3MF9A 3LA7A 1GMMA 3VBRB 4WZFA 3VBUB 4JQRA 1OD3A 2G4IA 1CZVA 1QGLA 4BZ4A 1QJZA 2WRAA 2XL9A 1R092 3S7IA 3VBOC 4CEYA 5IVCA 4EV0A 1H1MA 1FT9A 2JE9A 1LOGA 1UKGA 2A6XA 5LA2A 4DEQA 2F6BA 2PHXA 3J7HA 2VMGA 4XUQA 4HN0A 3MO4A 4RGAA 2PHUA 3BPZA 1XNBA 3D82A 2G9ZA 2WZEA 3THDA 3GBGA 4RR3A 1HRV1 2Q4SA 5JDBA 3W59A 4W6XA 2JE7A 4CXWA 5KXDA 1VBC2 1P8JA 2XXZA 2WDBA 3RS6A 5JXIA 3OGRA 2Y0OA 2ADDA 1JUIA 4XUPA 4E9KA 5CG8A 3I97A 1Q56A 4MVTA 3AL5A 3RZLA 4JDMA 4V1PA 2OXBA 2ZCWA 2XR4A 5AC91 4EN8B 2D7FA 4KWJA 2NMNA 1D4VB 3WDWA 3U4XA 3UJOA 4AI0A 2RS32 2SLIA 3IKWA 2RJ2A 1C4RA 2HH9A 4GJYA 4YW4A 3ZYHA 4XXAA 2D97A 3T0DA 3X29B 3AP4A 2GAUA 5FP9A 5A33A 4NUBA 1DLLA 2EIGA 5GLWA 3AZYA 5A33B 3NNGA 3O0VA 5DUUA 1H8TC 4AEDC 5CFCA 3P3PA 1BMV2 4HG6B 4L92A 1V9U3 1HIXA 3L2HA 4LHSA 3ST7A 3UETA 3VBOB 4LKDA 1E5RA 4RD7A 4XW3A 3ZFGC 2FCTA 2IVJA 1NQDA 3GJBA 3I7DA 5F2SA 5FUIA 4ZY9A 4DZGA 1GLHA 5HI0A 3FHIB 2H0VA 3RZZA 4XXPA 4Z92B 3LIHA 1MEC2 4PBOA 1FAYA 1Q8PA 1XNAA 4QPIC 3HIFA 3MW3A 1WA6X 5LBEA 4AL9A 3WCSA 2CGPA 1CIYA 1SLLA 5C5UA 3SC7X 2WLQA 2HYKA 1UMIA 3DPRC 5LRRA 2ET7A 1YQCA 1RXGA 3I3EA 5DDJ3 1KXGA 4ATFA 1J58A 4EQVA 1PO22 1RINA 3U37A 2Q8CA 5IATA 1XSQA 4QX0A 1XYNA 4FI9A 4KG8A 1S0DA 3DYMA 3VDBA 2XQRA 3ILRA 3RZMA 5DAQA 2ZZJA 5HBAA 1WD4A 3MICA 5IW0A 5JXGA 2PLV2 3MBWA 3E6CC 4LQRA 3RGBA 2BBVA 2FBEA 1HB4A 2AACA 3O1PA 4COZA 1QOOA 1UPSA 4FXGB 3U1XA 4K1YA 1IS6A 1EAH1 4QPWA 2RDRA 1QQP3 1RUG2 4RGKA 3WQ1A 4DY5A 1POV1 2I74A 3ASIA 1TVGA 2VJXA 3ZPYA 4UW3A 5A6XA 3KHCA 1AR81 1Z7S1 4NAOA 1JW6A 4QDQA 1GZCA 1UY1A 4A7YA 1DDLA 1CPMA 2CGNA 2Z5WA 2YPDA 3FUOA 5T52A 1AXYA 3VZLA 4BQWA 1F5FA 2QZ2A 2P3IA 2DYCA 2UWAA 4ASKA 2QQKA 5CKNA 1K42A 3B02A 3U75A 5HCAA 1QHDA 2LW8A 4NIHA 4Q4Y2 1BXHA 3RZJA 1FNYA 1CWPA 2WYFA 2FDGA 4L8QA 4QQPA 3SXWA 3MW2A 1V70A 2J42A 2WINB 4CDWA 4WVVA 5ABJA 3UGHA 4CDWB 1W8TA 4GKXA 3SEEA 3ZXFA 4CRQA 4YSFA 1I5ZA 4M00A 5HXVA 1AYM2 2K9ZA 4MX3A 2ZHMA 2A6YA 1JU4A 4XVHA 1ZRCA 3ZFFA 3ZYFA 5F6LB 4GAZA 4N8MA 5CADA 5JSPA 2VXJA 1YCIA 1OH3A 2LRPA 3LCPA 5LA1A 3TYJA 5C6CA 1OLQA 4WM8C 1XE8A 4OYUA 1MS9A 1OVSA 3ZMOA 5L73A 4AFDA 4Q0SA 3B01A 1C28A 1G8WA 2R072 3AL6A 1MACA 2E26A 4S2DA 2VMCA 2PHDA 5JXHA 2QQIA 1DYKA 2ZX2A 3T2QA 4A7ZA 5FWJA 5H9QA 2OQ6A 3ZMNA 2R30A 3EB7A 3H7YA 3NL1A 4ISRA 2R062 1RHI1 2V5DA 5A3LA 2VY0A 5FXWA 5FYBA 1VMFA 2B9VA 2ENRA 5BNOA 3MLKA 4U2AA 3ZFEB 4FBFA 1DF0A 3P3NA 4HKOA 4BMEA 1O3QA 3WNXA 4Q4W2 1AX0A 4LA3A 5F32A 1HLCA 2ZMNA 3LOBA 2D6LX 1YIPA 4QQOA 5ERLA 5A7PA 2D40A 2GNTA 5FUPA 5T50A 2GC1A 4LTAA 3MIFA 3BU0A 1W39A 1ZVFA 1V9U1 2JDUA 4JKLA 3VB9A 4QDRA 2CHHA 1LECA 4CCJA 3ES1A 1MS5A 1ZBE3 1OH4A 2VU9A 3OBZA 3QOPA 1ND2A 2R7EB 4AGGA 3FHQA 4NHXA 1OBNA 3VV1A 4O7XA 2RS31 1WCKA 3H7JA 1H4HA 5TSWA 5A7OA 2BOJA 3WSOA 1HX6A 4YW6A 4FTSA 1T2XA 1YI7A 3OOXA 1POQA 3PUAA 4Q4X2 5BNPC 4I3GA 4A3ZA 5FPAA 4AR2A 1RUI2 1O91A 1UOBA 2WSUA 4AQ2A 1RTVA 2ZABA 2NZ9A 1F2NA 3C7GA 4OCTA 1TG7A 2P3YA 4JKKA 3WP4A 1HB3A 1RMU3 5GALA 4KU7A 5FYUA 5J37A 2QQVA 4YVSC 2R49A 4DS0A 3PTRB 4FPHA 1K5MB 1UY4A 3GHNA 1YXWA 3M2MA 4QPGC 3VZJA 2IXLA 3RJ2X 1SLIA 1XPWA 1MEC1 1TME3 2XQXA 5FY9A 1CGPA 1C3HA 1W90A 3U0ZA 1HQWA 2DBIA 2WNUA 2BERA 2WNOA 3V0AA 4M4PA 2WNUB 1TMF3 1KEXA 3KWVA 1J59A 2W1WA 2C9AA 2XH6A 1QH6A 4PBPA 5APAA 2OX0A 1JS9A 1EV12 1KITA 3M3IA 4S2FA 2AYHA 2PHLA 2K0GA 2C9KA 3BN6A 2BYVE 3AMNA 3GZAA 5FLIA 5EIYB 3MIDA 5K7PA 3ES4A 2FCVA 4ISQA 1UZVA 4TYSA 4CU8A 1K45A 4D7TA 3O0XA 4DEVA 2P6HA 2D6PA 4XFHA 2WQZC 3I3BA 5IJRA 1MS8A 1RUF2 5EJ1B 1BCXA 1UKRA 1YRZA 1UL9A 1UCXA 2PAKA 4CCDA 3OSDA 4XF4A 1RUJ3 3AVRA 1FOD2 3HJRA 5BXXA 3POFA 3JD73 3DN7A 4Z2WA 3DECA 5LEJA 4YZ5A 2WT1A 1AXKA 4C0BA 5ACA1 1DQ4A 3K46A 4OUMA 3LA2A 4AWDA 2PA7A 1VB2A 3FLRA 4XF3A 4CUAA 5C8WA 4CXYA 1WCDJ 5AFEA 4PHZA 4NIDA 3SH3A 1BHGA 1ASJ3 2XLGA 4PDWA 5FJHA 1JI6A 2Y6GA 4FAHA 5EYYA 4Y4YA 4PDWB 2VQTA 3UESA 1R083 3WP6A 2CYFA 4UW6A 1W04A 2L9LA 1QWRA 3ZXEA 5I0RA 2V72A 1KDMA 1VBB2 4QWNA 1AYM1 3AC0A 2VMDA 4LLOA 3K4ZA 2W47A 5FLHA 3L2YA 2B39A 3GBFA 2ZHKA 1DQ6A 1TQ5A 2WZR3 3B94A 1W9SA 3ILFA 3THTA 2W5FA 1OA3A 4E2SA 1ENSA 1GP6A 2GP5A 3PVNA 4IXLA 5DAPA 1YI9A 3K51A 1AR62 4AHZA 4HVOA 3TNPB 4URTA 2ZKNA 5JR7B 2E7AA 2DVGA 3LDKA 3JU9A 2AZ5A 2D43A 3H8OA 3K77A 3OY8B 2GU9A 2OVUA 2PAMA 4GJZA 3LFMA 5F3EA 5KR7A 4QPYA 4Y5SA 1F31A 4CVUA 2JIJA 1UPIA 3M8LA 3TEZA 4FPOB 1GSLA 4LLFA 2WO7A 5IVEA 4RHV3 1AX2A 3IB3A 3OEAA 1CAVA 3N35A 2JDYA 4XILA 2JDKA 2VVDA 4IEOA 3CJXA 5H9PA 3WEZA 4QQ2A 1ZBE1 4HXCA 4MGSA 3VBHA 3LA3A 4UWDA 3KCCA 2G9FA 2JG9B 5FYVA 3HN1A 2XONA 4NO4A 4Q4W1 3AXDA 4P5HA 5FZMA 3P1IA 3S6PA 5EPAA 1K5JA 3LKJA 5FOBB 2VZRA 3TAYA 1J1TA 4CZSA 5F37A 5GKAC 5K4LA 2WZ8A 4Z8BA 3ZM8A 4JC1A 1C8M2 2NP0A 4LHLA 2A73B 2P4EA 2VUAA 3AFKA 5T5OA 1GOFA 1GICA 4XFAA 3LDRA 4HVQA 1F9KA 3RYPA 4W4ZA 1X8MA 3Q8BA 3AKRA 1OQDA 2QDRA 1TME1 2ERFA 3DYPA 4Q5OA 4FPGA 2WQ8A 1HKDA 1YUDA 3U4SA 2B42B 3EQEA 1E5HA 4OVEA 2G9GA 3ZOIA 1LCLA 4WM7B 2ZKLA 3THPA 1QXPA 1NCQC 2ZXQA 5EZWA 2RDSA 1MZ6A 1CAWA 1OFSA 1J1LA 3E5XA 5J36A 4Q0QA 4DRRA 1C5IA 2CU5A 1XYOA 3IWZA 5D8AA 3RYKA 1QXRA 1HXS3 5C4WA 1NLSA 4BQ5A 5D8AB 2ORZA 2D6KA 2Q8OA 1Q8VA 5C3QA 2VQUA 4TN7A 4XZPA 4BMBA 3N9QA 5IVYA 3NAPB 4N90A 1DQ5A 4FPLA 1O7FA 4ZU4A 1G9AA 3LPGA 3VHNA 4LNVA 1PO13 1A6CA 4RN5A 1KJRA 4QU2A 3OUJA 2ZMKA 3OF1A 1UXXX 1RUJ1 3J9SA 1URXA 3KCXA 2R32A 4JGYB 4MGIE 1ZBA2 1AVBA 3J7MA 3WG4A 2RV9A 4QX3A 5FY8A 4BU2A 5K0UB 3JD71 3U10A 2HWD2 1V6OA 3M1HA 1SCSA 2WYSA 5T5LA 1KJLA 3OUIA 1W8UA 4ARYA 4CU9A 1S4CA 3I2HA 4YVWC 4IEQA 1QKQA 4R4ZA 1OF3A 3FFZA 2AC1A 2DCYA 2E6VA 1LRHA 3CEWA 1SFNA 2ZHLA 4LOSA 3RZKA 3SCFA 4CU6A 2HWE3 1EPWA 3NRUA 1QJY2 1V6LA 2QTWB 3FUQA 3MV11 4RS5A 1O3SA 5I0DA 2EAKA 4O9EA 4QXBA 1ASJ1 1FOD1 2A7AA 2DUOA 5F2WA 4OUSA 5AVAA 3VKMA 1H2LA 3K4DA 4P9WA 3HNYM 4XJWA 1W6PB 3JXSA 4QM8A 2W1QA 3PDQA 4KI5M 3LWCA 4RFT0 4XFBA 5GLZA 3WV6A 1DHKB 1OA4A 1DP0A 4FQ4A 3VL8A 3WINE 4CDQA 5IYYA 3WDTA 2RDNA 1D4M3 2JDAA 2WKKA 2BVBA 1UYYA 2XKPA 2Z2SB 5FYZA 4HMZA 3V0BA 3V0BB 2PQQA 1S2BA 4Q8KA 3M4FA 1L3JA 3HN3A 4IEXA 5CNAA 4LIUA 1GNZA 2HWF3 3TBDA 2LTNA 2OPKA 2XHNA 2JG8A 4CEWA 1CX1A 3C8XA 3DKWA 1EUTA 4CEWB 1MR5A 5FV3A 1A8DA 2NLRA 3HQRA 4GH4A 4ES8A 5FXXA 5J1XA 4TTGA 2OYZA 4GH4B 1IG0A 3H42B 3IM0A 5KHGA 3F2ZA 3PUSA 4N7UA 4R9AA 3URFA 2BP6A 2C6SA 2I2SA 2QFEA 4A42A 1R1A3 2RM23 4DXRA 2ZGOA 5FUNA 4COUA 1WA4A 4HANA 1S0GA 3MPBA 4RQPA 3ACGA 1ZA4A 5LBCA 1X8EA 2JICA 3M3OA 3INAA 1BKZA 1S0IA 1AR61 5FJKA 2VR4A 2DV9A 3I59B 3IDCB 1PMJX 3KVAA 1AUYA 2PHFA 3RMXA 1W6MB 4P00B 1NY72 4IE4A 4P9IA 2XJTA 1W2TA 1APNA 1COV2 4N53C 5FCCA 5FPZA 1UMHA 1L7RA 3HBZA 2DVDA 5C9AC 3PVBB 2AUYA 5B4NA 3GDBA 5FY0A 4ZU7A 3B93A 4JX0A 5EJ3A 1F4HA 1S2EA 3D3AA 3GZEA 2A71A 4YG6A 2E7TA 5FLJA 3QCWA 4IE6A 4UT5A 3VBSC 3NW4A 2QZ3A 1ZZCA 3BB6A 4XUNA 3LF7A 4KL1A 4Y20B 3RWNA 2RVAA 3HNMA 3T3YA 5BNNA 2Q30A 4K40A 2ZJCA 4NROA 5FP3A 3WF3A 1WLDA 4MLOA 3TB0A 1HQLA 4XDPA 4RA0A 3OGSA 5C5TA 3OD4A 1GKBA 4B7KA 3WD5A 5LZ6A 2H6BA 4GKYA 1ND3A 4CDUC 3IDEA 5I0UA 4Y5Z0 3VBFA 1VBE2 1JZ5A 2D6NA 1C8M1 1FI2A 4X8NA 2VTXJ 1WMXA 1UO9A 2QUOA 4M0NA 3FL7A 4B4PA 3ZIWA 1LTEA 4LK6A 1HXS1 3WHTA 5FPXA 1SQ4A 3MYXA 5D1IA 3OBAA 1WMDA 4IE0A 4IV1C 4PJYA 3KB5A 2IFRA 3LOIA 3UGFA 3B7MA 1W0OA 2RG4A 2CDOA 4I30A 4Y33A 5EWSA 1U0AA 3KQRA 1PO11 3VZOA 4CPBA 4AVAA 2HWB2 1H2MA 4D6QA 1WZXA 1WCUA 5KHIA 1YLLA 2PN5A 4LOTA 5ANQA 3SLIA 1BK1A 1B35B 1REEA 1UU4A 2IC1A 5FZKA 3WQ0A 4A7KA 4ZONA 2AEZA 1SLTA 3WDVA 3B5LB 3B69A 5DMYA 4MOAA 4PIXA 3CLPA 1HRV3 1DQ1A 3I2FA 3PUIA 3POWA 4XEZA 2BV4A 3NV3A 1N47A 4Z1VA 3ZXKA 3WNOA 2D98A 3PU3A 2EIEA 3KS7A 2QDNA 1MQTA 3LE0A 4QU1A 2HWE1 3TN92 3ZSEA 1W0NA 4CDXA 1CX4A 1MQTB 2VPVA 5FXVA 1H6YA 2Y26A 4OI4A 3VN4A 1F15A 2XDVA 2WS92 4A6SA 3ILNA 2X5IA 1IG3A 3N36A 1X82A 1NUKA 5FRAA 3RPQA 4QXCA 4ATEA 2Q0AA 3BPSA 2VE1A 3MHZA 2RR12 4NOTA 3VHOA 5C3PA 1NA1B 2JDMA 1RYYA 2JXAA 1H6XA 4IV1B 1G6NA 4QB6A 5FZAA 1VMHA 1CN1A 1SMVA 1W9TA 3MEPA 3O5SA 3R4DB 3LEMA 3ZYJB 1V6KA 4EZ4A 5L7OB 4NAMA 2WN3A 3HBKA 3CDZB 4XF9A 3POGA 4MXWA 1IGOA 1PX4A 4NR1A 3RVHA 2HKXA 1LR5A 4QKBA 4NVPA 1OOPA 4FSJA 5T3NA 3KV5A 1M4WA 4AOCA 1OKQA 2VOKA 4B1LA 4XBNA 2B46X 1N1SA 2WFF3 2ZACA 1QJU3 4F3JA 1N3QA 1PVC3 3GNEA 5EYXA 4NIIA 4AG4A 3AFGA 1UAIA 1R1A1 4XPVA 4W6YA 1IS4A 1CR7A 2UYBA 2ZGLA 4QX1A 3LEIA 4SLIA 3W5MA 3BIWE 4QKFA 5AVPA 1GANA 1AR72 1DBNA 4D7YA 1DLCA 3V56A 2B45X 3C3VA 1SG3A 3T0BA 3VBRC 1PZ7A 1AYN3 1V6IA 5FMCA 3VBUC 3BU7A 1KQRA 1MVEA 3CJIA 1LODA 1YQ8A 3CJIB 3T1MA 2OA2A 2H0BA 4JQTA 1XC6A 1HRI2 2BZDA 2VW1A 4NHKA 1X36A 5GLUA 1EAH3 4NHMA 1A78A 2PHWA 3ETQA 1POV3 4XC9A 2IZWA 2CAUA 2EA7A 2UWBA 2Y0IA 3CBNA 4PI2A 1FX5A 1AR83 4HVRA 1OVPA 3E6DA 5T5PA 4IUGA 4AZZA 5IK7A 4XJUA 1COV1 3KZ4C 3VD7A 5JI7A 2J1VA 4MADA 4I2OA 1YC61 3FLTA 3LSDA 3ITQA 4PI0A 2GN3A 3WNMA 4FPKA 2H6CA 1NCRA 3OG2A 1LOFA 5FZGA 4V2WA 1FV2A 1XQNA 4DQAA 2P17A 3T30A 1RUE2 5F5IA 4XABA 1IHMA 1LU1A 2CTVA 3AMQA 2J1UA 2O8QA 4E8CA 5HXMA 3I2OA 3GM8A 4M0HA 3UKTA 4K20A 3TOJA 1VBD3 4J1WA 4JZRA 3KQ4B 5HCHA 1KGYA 1QXJA 1OQ1A 1OUXA 3D6EA 1EY2A 3VHRA 4Q2FA 2WC2A 5CFCC 4DIQA 3A23A 1UW8A 1JN2P 4CEYB 4HZFA 4LO6B 5FPBA 1VBE1 4B8EA 3AK0A 4IEPA 3MIBA 2QQWA 3I2IA 1HN1A 2VULA 2AEYA 2WA4A 3DKQA 4QKDA 5JSRA 2W52A 4UFLA 2ZGUA 4FXKB 1ST8A 3WW2A 2JENA 5DG1A 4AQTA 3ZXAC 1S0FA 1PX3A 4RR3B 3HAGA 1ULFA 4CCLA 3WF2A 5EQUA 2XBO2 1RGSA 2WWUA 3DV8A 5BUVA 1NE6A 1R093 5FOJB 2PTMA 4HK9A 4XE9A 2XUMA 4NRPA 1RHI3 3BTYA 2HWB1 3JCIA 3KD4A 2ZOEB 4PQ9A 1UY3A 1WMFA 4QM9A 3ZYBA 5IK5A 2GP3A 1ZRRA 5DZFA 5CZKA 3WZ1A 1HB1A 1RUNA 1W9FA 5LY2A 4JRLA 2W3JA 3RJRA 3WHUA 2GNMA 5C8CA 2ETEA 2YXSA 5C8CB 3O7OA 1VBC3 5DUXA 2RS51 3OTFA 1WLTA 3KM5A 2A6WA 1Q5OA 4P9XA 3TN91 5IWFA 4AVTA 2Y64A 3ZDVA 4ZS2A 2ZTNA 1GBGA 1RL3A 2W68A 2J1RA 5FZCA 4LBMA 4FTEA 2YBKA 1O8PA 3ZYIB 4OMCA 2RS33 1W05A 3LZZA 5LA9A 4UFHA 4DINB 3QBQA 2GZWA 4KWUA 2NN8A 4KQ7A 3NV4A 2WFF1 1QJU1 5DG2A 1PVC1 1BK0A 1C1FA 2IVIB 1ULGA 2Q1MA 5GM0A 5BYNA 5K8SA 2E9QA 4DOUA 3SMHA 3MI8A 2VOTA 3BTXA 1TE1B 5A3PA 1ULDA 4I09A 4PLOA 4PQQA 5DDJ2 1LOAA 4CDWC 4G3YC 2BFUL 1BQPA 2BGOA 1UIKA 5GZFA 4BHPA 1AYN1 2W94A 4O65A 3HWJA 4D8MA 4HSJA 1VRH2 4XQ4A 1MEC3 4YGBA 1POV0 2XG3A 3S0MA 4QDSA 2NQYA 1E57A 4QHZA 1BBT2 2EICA 3AM2A 4J1XA 2XOMA 4YPJA 5KBFA 1QOTA 1FMD1 2VMHA 1VAKA 4Q0PA 1GWKA 2UY9A 4UAPA 4DRVA 3O1RA 2GDFA 2QQUA 4RL7A 3UV9A 3WNPA 1PO23 4HSLA 5IUQA 2LROA 3HQUA 5J09A 3KV4A 4MO3M 2YV8A 4QQLA 3SHRA 1IKPA 5CKQA 4UI9L 1ACCA 3WQ7A 2VUDA 4BIOA 4E4ZA 3VKNA 2PLV3 5HPOA 3PLQA 3K48A 2KXLA 3KF5A 4IERA 4D6SA 1W8FA 5L9BA 1H0BA 1DZTA 4FQZA 4Y24A 1JZ4A 3KT4A 1BEV1 4AEDA 1N1YA 1RUG3 4YM0A 3ZFEC 1A34A 3ZFGA 2XJUA 3RG0A 3AYEA 2AREA 5A7QA 3SH4A 3WDUA 1OLME 5IT6A 5ABJB 2W95A 4RSUA 2XJQA 3E6BA 4MSVA 1O5UA 3R4UA 4YW1A 2VZOA 3ORJA 4CCOA 5ACA3 1ENQA 2RMU2 1VBD1 2ZS6B 1HJFA 1KFUL 1NLRA 3AZXA 3HOBA 4BB3A 4DY3A 4YZ2A 4TZDA 3GBWA 5JZGA 1QH7A 1RUH2 4Q4Y3 1FPN2 3ZFFB 4ZZ8A 3NJYA 2A6ZA 3GZUC 2XVGA 3DF0A 4XF0A 3IIAA 1SFPA 4P9JA 2EXJA 4HETA 1J3QA 1YFWA 4Q29A 2GC2A 2WAAA 3VL9A 4NWVA 1ND2C 4PLNA 3DPRA 3POIA 2ZGNA 1JZ6A 3VD9A 4FVVA 2Q5TA 4IGOA 4ITCA 2UURA 1NX9A 1UY0A 3NNMA 1AYM3 1NT0A 1GR3A 3DUIA 3FZ3A 1YWKA 4X8PA 4ZU5A 5FZ4A 3BYWA 3RSJA 3RWKX 1W2OA 2E7QA 3K3NA 4CXXA 1R091 3QH6A 1X7NA 2A3YA 2B9UA 1LGCA 5I93A 5FIXA 4D3WA 3VDAA 4BXSV 1K5MC 5BNOB 4LITA 4OLLA 1MZ5A 2W1UA 4I0AA 3O1TA 4XQWA 4INDA 5K9YA 2IUWA 2WNUC 3AB0A 4QHOA 4LBNA 4A45A 2CY6A 2AR6A 1PNFA 1VBC1 3BALA 3D8CA 3MUY1 4XFFA 5FYTA 4C8DA 3BTZA 3B00A 3T4HB 2VMIA 3J8F2 3KT7A 1BYHA 4AGRA 1O3TA 2FDFA 1H1AA 1US3A 4QXKA 3D5OA 5FKBA 5JVVA 3Q8EA 5J96B 5KC6A 2GNBA 3LB9A 3ZN5A 1SFYA 2DFBA 1IQAA 1OC1A 2DCKA 2JJ6A 3NJZA 1ND2B 1JMUB 3WF4A 3HEIA 5ANNA 4Q4W3 4UFIA 2WAOA 3EXUA 4HOOA 4W8JA 4D7SA 3N9OA 4J25A 4JV4A 1UZYA 4ORFA 5A7NA 3QLQA 5LY1A 2BJSA 4S2HA 4GB32 2IWGB 4CP2A 2HJIA 3T2OA 1WUVA 2C1FA 1RJ8A 5A70A 1BMV1 3JB4C 4YFZA 4EZHA 1VBA2 1WLCA 4E27A 2D5FA 3TEYA 1JYIA 5SV8A 2G1MA 2XJPA 3OPTA 5DUVA 3S7EA 3AJZA 1RJ7A 1PGL2 1NZCA 1ODNA 2XLFA 4FPFA 4UYBA 2D3SA 2V4VA 2X8KA 2WQ4A 4CCCA 2QCSB 2FD8A 2ZGKA 2OZ6A 4TWTA 5I8YA 2VUCA 3UT0A 2VCCA 3L9JT 4JGZA 3POEA 4Q4X3 5A3WA 1JZ7A 3ZSLA 1WMEA 4JGZB 3V0AB 1H4GA 1I5PA 1TMF2 1YJKA 2WNEA 3T1LA 3GJAA 4LBLA 2ZHNA 3FX3A 4PDWC 1Q8OA 3JUUA 4ZZ5A 2OS2A 2VXRA 5E6HA 1PO21 1DFQA 2VECA 4WZCA 3N7KA 4EWAA 5LCWL 1WGPA 5BPXA 2JDNA 5FZDA 2YB7A 1W03A 3T2TA 1VRH1 3AZZA 3ZYRA 4LUKA 2VMFA 4C90A 3R05A 4I3PA 3WNKA 1QIQA 4LO7A 1B09A 2PLV1 1WWYA 2XKOA 1O6UA 2BWCA 2VO5A 3J4UH 4GMP3 2CSGA 2PQSA 5FY1A 2JWPA 3ZDSA 4GZ9A 1EV13 2UU8A 1RUD2 2R16A 2KA3A 2VZ3A 4GXLA 1HQNA 4NPRA 1PIV2 1Q8QA 1RUG1 4MZUA 5IVBA 1WBLA 1US2A 2IXCA 1YQ2A 4XHBA 2W08A 4YYOA 1KS5A 1OXCA 3APBA 3ECQA 5A32A 5I8SA 3BGAA 1U5YA 1TNRA 4XAEA 4ZKTB 2D93A 2BRTA 3P6BA 4BWOA 4Y1UA 3VD5A 1JU3A 2R0HA 2KD7A 3WG2A 4NE9A 1W2AX 1RUF3 4Q4Y1 3WG3A 5BNPA 4E8DA 3O1UA 1AZDA 4ZHNA 1S2KA 3I2JA 3OBTA 1NE4A 2WWJA 1XNCA 4BXFA 4XETA 4H7MA 1FOD3 2B7YA 2JG9C 1AL22 3BCWA 3VGIA 1MVQA 3E5UA 3NJVA 5LK5A 1U12A 2BNNA 3M70A 4IEZA 5A7SA 3SEPA 1PZ9A 1R082 4BK4A 5M0TA 3S57A 1PHMA 4YVSA 1VPHA 2RMU1 4GWMA 1VP6A 2HYXA 4W50A 3LEKA 2K46A 5FPVA 5FZ0A 4GWJA 3SISA 5FFOC 4BQ3A 3O12A 4B3NA 3N9MA 1LB2A 1S0BA 4XUOA 3LFIA 4IE7A 4NN0A 4CPBD 2ZGSA 5CAZA 1GZWA 3OB8A 5A1FA 2FZ1A 3AP5A 4OQ8A 5FKCA 2DU0A 3FN9A 5D21A 1RUC2 2XUEA 4QB1A 1G9DA 1RVF2 1DGRA 3IAPA 4D0QA 5FZ6A 2P34A 2R071 1SZBA 3Q8AA 4P9GA 4AXOA 4WM7C 3RZHA 2GMPA 3MFCA 5IFPA 2FMDA 1O5LA 2Y60A 4UBHA 5DN2A 2R061 1CAVB 2CWSA 2VCMA 3JB8A 4AEKA 2YC0A 4LBOA 5A1LA 2P3KA 5IFTA 1AR63 4B4QA 3UKNA 1D7PM 5E89A 5D8AC 1U5ZA 2V4AA 3G7DA 4JCKA 4LUMA 4WVMA 5HCBA 2VNVA 4WVMB 1GZTA 5GLVA 3VBHB 5KXCA 3W58A 1SDWA 5I91A 3BI3A 1UU5A 2VZQA 3NAPC 4IV3A 3DXTA 4FCAA 4AVSA 3MIEA 1CAXA 2DVBA 2XLAA 2YU2A 3SCHA 1F8VA 2X10A 3MFAA 1SACA 3POSA 3J8F1 1YHFA 3B9IA 1X33A 4JGYC 5FZ9A 1RIRA 2BEOA 4Z07A 1VAMA 1ZRDA 5K0UC 2R042 1PGW2 1GV9A 2FCUA 2Y34A 3KMHA 2ZPXA 1ZREA 2XJRA 4XCBA 4AQSA 1LAJA 2VTFA 5A3OA 5I0SA 3JBG2 4XMAA 3DEMA 4Q4X1 4LXLA 2WZPP 2IXHA 3IMMA 1RUI1 3H3ZA 3MV01 4XYXA 1YEWA 4RS5C 2WUHA 5FZHA 1YNAA 2PYTA 5LW9A 1C8M3 2PELA 1DCSA 2CWMA 1CAWB 2YC2A 1TZOA 5CISA 2ZX3A 1UN1A 2F4PA 4JHZA 1PGL1 4IE5A 5C4WB 2Y38A 3EMRA 1ONAA 5F8PA 4CDQC 5F5AA 2RS12 4TSVA 2W39A 4COYA 4LKFA 2OT7A 3OPWA 4LORA 5C3RA 2J1SA 3OUHA 5FBJA 4YRDA 5DUWA 4GMP1 4E4HA 1JYVA 3M7AA 4I0BA 3FE5A 2GC3A 3O14A 3OGVA 1EV11 4FPJA 1NXMA 3ZXGA 3J7NA 4CUGA 4CEWC 5C3OA 3IBMA 1YFUA 3NV1A 2MEV2 4GH4C 1K12A 1WKYA 5H9SA 1LESA 1Y3TA 1C5HA 2UWCA 4LA2A 2E31A 4Q4V2 2O8OA 3BIEA 3C2UA 4TXWA 3ZX7A 1O59A 3H1MA 3ZSMA 3WDXA 4BOWA 5BV6A 1UOFA 4HKWA 5T54A 1IOAA 4A2UA 3PJYA 3I3DA 3O1SA 2VNGA 1RUF1 2IXKA 3A0NA 1N1VA 2YPJA 5JLVA 2YFZA 4MGTA 1RUD1 4XJAA 3GF6A 4RS5B 5LRSA 1PIV1 2ZBJA 4XJ8A 1JODA 4BK5A 1ZBA3 1SDDB 2MHFA 4CCMA 4C91A 1H1IA 4DUXA 3VDCA 3I2DA 5JMCA 2ARXA 5FP7A 4LBJA 5FYSA 4EN6B 5FY7A 5FYCA 3PIJA 2YC4A 4CDQB 4RYDA 1UX7A 5LBBA 4UW4A 2QQPA 2VBPA 2BFUS 1S55A 5JOXA 1F35A 1QJY3 2LALA 4ASLA 4JDNA 4P14A 2YFUA 2HWF2 2JG8B 2EXHA 1AL21 4KH9A 2JD9A 4QQHA 1PMIA 2BU9A 1NLQA 3JQWA 5F7UA 1JZ8A 2IXJA 4XFIA 1LEMA 3DL3A 1JOPA 1LHWA 1VBB1 2Y6JA 4JRAA 3EHKA 4Q0UA 4UFMA 4QX5A 1OQEA 3MIHA 4MXVA 4K3UA 1JOBA 3MW4A 3S5QA 2K2SA 4OHZA 2RJKA 4RQPB 4YFWA 3LEGA 4BM8A 3IAQA 5DAWA 3TRSB 1F5JA 2BVVA 4YZ1A 3A21A 1RVF1 3TEWA 4YWAA 1UYXA 4AAXA 4IESA 3HPNA 4XDQA 1ZA7A 1A3KA 1ZYBA 3FLPA 1LULA 3I3MA 2V5YA 1OURA 2FHRA 5A80A 2A70A 4YVWA 4GQ7A 2R0FA 2D6MA 4IDZA 1B35C 2JDZA 3H3LA 1W6QA 2VZ1A 1NZIA 2D6OX 1O4TA 4QGLA 4EN9B 4AK3A 4NPLA 4AEMA 5BNNB 1ODMA 1COV3 2O14A 3CZJA 4YGDA 1QJX2 3VD4A 4JKMA 4HFSA 4UFJA 5KXEA 1RITA 1OLMA 2ZX1A 3I4IA 5DABA 1MQTC 4D69A 1N3PA 1V00A 1UZWA 4CUBA 4URAA 4CYDA 1ND3B 4AFBA 3VBFB 1I3HA 2VW2A 4LEJA 4P9LA 5G04L 2VBDA 1G9CA 3AJYA 2R041 2WSVA 3OGJA 4E4SA 5JXJA 1UXZA 3O1OA 4XFCA 4DFSA 3IZOA 2VUJA 1J83A 1PMHX 1NA1C 1ZZBA 2ARCA 3ME2A 4IEWA 1AJKA 1MS3A 4CCNA 4O9GA 1M06G 1E5SA 1T6GC 1G9BA 1SHWB 3CNAA 4YM3A 5L7OC 1W3XA 4LHNA 3VKOA 4DO0A 1RXFA 4BQYA 4ZPIA 1PK6A 3Q8CA 1PK6B 5DZGA 1JZ2A 1VBE3 2CAVA 2RJLA 3N9LA 1W3VA 1W2UA 3A22A 5CFDA 4R9DA 3LIGA 5CFDB 2DVAA 3DXUA 2HWC2 3K75B 3WVJA 4Y1VA 2EALA 2GC0A 2W92A 3OBRA 3KVBA 3FC0A 4AI1A 1H2NA 2YHJA 2Z69A 3C7OA 1WW4A 1BZWA 3G6JB 5JPNB 1IQDC 4ARXA 2DCTA 2NYYA 4LR4A 2IXIA 1Y7BA 3CHXA 4CA9A 4CDXB 2HWB3 4PIZA 4IW3A 1JHJA 5CU1A 3JQXA 4IEUA 1UYPA 1W9WA 2ZZQA 2YDEA 1I9RA 2MEV1 2YBSA 4FT8A 1LNSA 1ZBA1 3U14A 2YU1A 3UGGA 1NKGA 2X5IB 3VBSA 4HT1T 4OHVA 5FZOA 2X05A 4Q4V1 1OMIA 2HWD1 2V09A 1DGLA 3CJIC 5AC92 5FR3A 2VQ0A 1AX1A 4YW7A 1LJ7A 2FDJA 3A0KA 1W2NA 4HN1A 3FWEA 4PT6A 4QHBA 4XIKA 4AHXA 4OULA 3WP5A 2CV6A 1CZTA 2RS53 2QQNA 4Y5TA 3OEBA 2R6QA 4MV2A 2WO1A 3TN93 1VMJA 1QJY1 1DG6A 3WQBA 3LD8A 3DGTA 3FMGA 3UNPA 2ARAA 1X50A 2PHRA 1SCRA 2YGLA 5E16A 1AJOA 2WS93 4W6WA 4BPZA 3SKJE 3IDBB 1AF9A 4MXWB 4LKEA 1DYOA 2OIIA 1IS5A 2I45A 2RR13 1IZ3A 1OOPB 1KFXL 3N9PA 1Y43B 3N3HA 2Q1FA 2V73A 3C7FA 3NQHA 1NCRC 1IPJA 3W5NA 5A6YA 2FDHA 2XJVA 4L0PA 5FZ7A 1LOFC 3I2KA 2Z79A 4UBGA 4YGCA 4LJHA 2XHKA 4NHLA 2BQPA 1BVP1 4LO4B 4LBKA 2ZEYA 1D2QA 1XNTA 1NOVA 4R8HA 2BPA2 4FFHA 1LHOA 5C7GA 2ZGPA 3AZWA 1I1EA 1Y9GA 3UYJA 1GNHA 4GWIA 3K4AA 3THCA 4QXHA 3WUDA 3MZHA 1FATA 3AKQA 4FOQA 4RFRB 3SITA 3ZIXA 2Q8EA 4NJ4A 4LMFA 1PM7A 4CEYC 2WT2A 2WR9A 1SLAA 4N43A 1FMD3 1UX6A 3EBRA 5D2AA 5JIUA 2XVLA 1ENRA 3J26N 4N43B 4QMAA 1EAH2 1YQ5A 4IETA 5A7WA 3UJQA 3ACLA 1YQ6A 2OW4A 4M4RA 3T09A 3VD3A 1NY71 3GYDA 1Z78A 1Z7S2 1D0HA 3BOPA 4RR3C 1GYKA 2PHTA 5LWBA 2WT0A 2VZVA 2WNVA 2WO2A 2ZEZA 4IGPA 1FXZA 2WNVB 2GN7A 4OFGA 4YNIA 4BLJA 1HRI3 1V6JA 2CDPA 1KDKA 4K21A 2ZGMA 4UW5A 5I8TA 4Q8LA 1NCRB 1BEV3 2BDRA 3PUHA 2QQJA 4W65A 5F6KA 4ZXKA 4FOYA 5BY5A 3NMBA 1WBFA 3J7LA 1AR92 2Q1ZB 4XDOA 5C8CC 4V2VA 2VC9A 3UL2A 2JB4A 2D44A 3SH5A 4FAGA 1EPZA 2O1QA 3ETPA 3CIHA 1G9FA 3OPZA 1D0GA 2Z4FA 1CESA 2J1TA 4K8RB 2EIBA 2LUWA 2VBBA 3MUZ1 3VZMA 4JDOA 5KHKA 5GZCA 1SPPA 3O0WA 3TWIA 5CBLA 3TNQA 3H8XA 2GMEA 5GZGA 1GP5A 1UD1A 2G19A 5FO9B 1R1ZA 3BOWA 4UOJA 2LS6A 1W8WA 3NO8A 2QQLA 5C71A 3AKSA 2NMOA 4KBZA 4XUTA 3VBRA 4EWEA 4I0WB 3VBUA 2UY8A 3KCYA 3ZO0B 1YFXA 1TNFA 3PJQA 2HEYF 3LDBA 3WX5A 3NNLA 4Q1PA 1RHI2 4KWKA 4NRMA 3TEXA 1XJAA 3ATGA 2N7GA 2QQOA 2VNOA 3OCPA 1DZRA 4EYUA 4FFGA 5A3TA 2KM2A 4BQ2A 1GWLA 2HWC1 4FO9A 4FP2A 3VDDA 2DBNA 1ZZ8A 4R9BA 3VDDB 4QGMA 3T08A 2XBO3 2D3RA 4EROA 5JMOA 1VRBA 1PZ8A 2VQAA 1H30A 2VZSA 1REFA 1ZNPA 1XE7A 1ZRIA 2P1BA 5LEKA 1O4ZA 5F3GA 1V9U2 3BUCA 1HB2A 1CAUA 4IQPA 2WS91 1FYUA 3FJSA 1CAUB 5CFCB 2BUKA 3AKPA 3PURA 5FO7B 1IKQA 1ENXA 2PMWB 2RR11 2VOVA 4FFFA 1MZEA 1XNDA 1QDOA 3B3QE 1W6NA 5FBZA 4HBNA 4AFMA 1W6NB 2FMYA 3O1VA 1STMA 2A3XA 5FYIA 1SBEA 2WFPA 4NPMA 1RUOA 2XVKA 1KD7A 5ISLA 2DUPA 2ZEWA 3VBOA 4P5YA 1A8MA 3M3QA 4AF9A 5A3UA 1GOHA 1JH5A 3OYWA 1VAVA 5FP8A 3ZR5A 4AHYA 5ABJC 3OYWB 3UKVA 2E33A 5EFUA 3WNNA 2R1BA 2MNGA 4BIFA 4OZOA 4QT6A 4META 5J98B 5GLTA 4CCKA 4PLMA 3ZFFC 5JZGC 2P6CA 2UYAA 3LPFA 1PNGA 1W0PA 4E2GA 2F17A 1JHNA 4LULA 4ET7A 5F5QA 1Y4WA 1AR71 5IVVA 3LSEA 3RI9A 1W8ZA 4FPYA 1GQGA 5DAXA 5CIRA 3WG1A 2QKDA 3AP6A 4K9SA 3T0AA 1QQP2 5DXDA 2W1SA 3CMGA 3WT3A 1DU3D 3ZSKA 3S30A 4CTEA 1N3OA 1FNZA 2EIDA 5FMDA 2GSYA 1VRH3 2CL2A 3N4MA 3SCGA 1V0AA 2Y8KA 1IPSA 2Y6KA 1BBT3 3HT1A 1MS4A 1XOYA 3K2OA 2OPWA 1HRI1 4LKSA 4QX2A 3WW1A 4YLZA 2RHPA 4OUEA 1RC6A 2E63A 4Y3OA 1H8TA 5BNOC 2BW8A 4M3CF 2ARBA 1H8TB 4AEDB 2KR2A 3I3QA 4OHYA 4YARA 3ZFGB 4Y4RA 4BLIA 3P5BA 4H2AA 2ZAHA 1EYBA 1UWWA 2QNKA 4U36A 2FDKA 2D5HA 1XRUA 2VOWA 5ACA2 3HMYA 4MG2A 1H9PA 3HR9A 3NSTA 4KG0A 4QPIA 2ZGQA 2EAAA 4QPIB 2AGSA 2DFCA 3A7QA 5JZGB 1I6XA 1G7YA 5L9RA 4NMIA 4QB2A 4WVWA 3MIGA 4H7LA 4MGQA 5FMOL 1QJFA 2VVFA 3AVSA 4R52A 3DPRB 2DU1A 3PNAA 1RUE1 4A3XA 4R4XA 1RB8G 1GZ9A 1AR91 3QD6A 4YG3A 4AVBA 2HLEA 3VHPA 4AEJA 4FP3A 1W9YA 3Q8FA 2RMU3 2WL1A 2WABA 3M3EA 4YW2A 2JD4A 3E5QA 4CU7A 1RUH3 1FPN3 1WLWA 2W87A 1UOJA 1S0EA 2GH8A 5CVRA 4UF0A 3CZUA 5A1AA 5A6QA 4UF0B 4NRQA 4K6BA 4XOGA 3NKGA 3K3OA 5AFBA 3DCQA 4COWA 4KGGA 5JAXA 2C0ZA 4BJ0A 2R073 4GWNA 4XBLA 3VKFC 2WJSA 5JWPA 4JGZC 2WO3A 1AXZA 1GFF2 5EJZB 4KMQA 1JXNA 4GD4A 5F3CA 2XBO1 5IVJA 1CJDA 1UF2C 2JKBA 1OD5A 4WBBA 3PU8A 3WP3A 1UQXA 4K8FA 5GZEA 2R063 4P9YA 1GUIA 4XMIA 2EVXA 4EJRA 1QNYA 5IHRA 4M3CE 3KLSA 3E1F1 2AENA 1DGWX 1JBCA 3IT8A 1UU6A 2B8MA 4A41A 3NJXA 3H50A 5E1RA 4H14A 1ZBE2 3ZFEA 4X6RB 4IEYA 5L9VA 5LBFA 5JI9A 1ZX5A 3UK9A 5SV5A 3CU7A 2C4XA 1GP4A 3J8F3 5FY4A 4YW5A 4N9HA 5EP9A 1K3IA 4EN7B 1HJGA 5FYMA 4CCEA 4BCUA 1UMZA 3KV9A 3W9AA 1Q43A 2ZX4A 1RMU2 4OQ9A 2X53S 2XMLA 4WM8A 4WM8B 4X6QB 5B2GB 1NAEA 3BVCA 2ZA9A 1TME2 2ATFA 2YGMA 3ZYGA 3WF0A 4NIGA 4M01A 1JUHA 3IIIA 1RUI3 5FAXA 1CPNA 4GB33 1XNKA 2W0XA 1QJEA 3Q9OA 5HCFA 3AMHA 1J3RA 5FY5A 1QY4A 1T6BX 1XBFA 2B4KA 4YW3A 4H55A 1VBA3
chains in the Genus database with same CATH topology
1DYPA 3AP9A 5DDJ1 3H3UA 4HPKA 4HPKB 3V65A 2HEVF 3AXEA 2NPIA 1K5MA 3MGUA 1NQJA 5H9RA 3H0OA 1BBT1 3RMYA 3ROUA 1SEFA 4D94A 1FV3A 2WIIB 1Y9QA 3AP7A 1VB4A 1QDCA 1QQP1 3RNSA 1RUJ2 3WW3A 4KGQA 4DB5A 3ZYPA 3JD72 5A32B 1J3PA 4B29A 1UZZA 4QGNA 2DTYA 1C57A 1KRIA 2PFWA 3H1WA 3MLJA 1QMJA 2DCZA 4Y26A 3FFQA 3V64A 4YM1A 1RUD3 5BNPB 1PIV3 4IL7A 3VBHC 1ASJ2 3ENRA 3BTAA 1DQ2A 4JAAA 4IV3C 1CQ9A 2WLPA 4UXAA 4OI1A 4PF5A 1LEDA 4QPGA 4YVSB 3EO6A 4AYUA 4QPGB 4XJ9A 1RUH1 1XYPA 1FPN1 1LGBA 4TLFA 4XBQA 1N1TA 2WZR2 3N7JA 3A4UA 1V6NA 5JOZA 3R6SA 3EJKA 4JTOA 3FBYA 1AL23 1GZWB 1LHVA 2P37A 3B9CA 5DZEA 1CVNA 4AQ6A 1VBB3 4EN0A 1MS0A 1C8NA 5J7MA 5LK7B 4AFCA 1DIWA 4RHV2 1OA2A 4WVZA 5IK8A 2GMMA 5C4WC 1C1LA 1LOCA 1S0CA 2YYOA 1RUC3 3D4KA 1LOBA 1RVF3 3OY8A 1YIFA 4IV3B 2GNDA 3WUCA 4AFAA 2EF6A 3R4SA 1MZFA 1EP0A 5T55A 1VR3A 1CAXB 2YUEA 1QNWA 5J3UA 3ZXLA 1SLBA 5EXOA 3AKTA 4S2GA 2ZAAA 2P3JA 3U11A 1ZM1A 1TEIA 1CJPA 3M3CA 1DGWA 3H8UA 2JG9A 3WW4A 4MH0E 1CD3G 1MS1A 1NG0A 4GB31 4QD2A 2VGDA 4I01A 2TNFA 4FOVA 3D0JA 1VBA1 4GULA 3H9AA 1ULCA 1VJ2A 2R043 2QJVA 4GMP0 3D0SA 4NWWA 1RMU1 1ULEA 5KWRA 4XQDA 4MGZE 1HXS2 3OGGA 3POYA 4LO8A 3JBG3 2FZ2A 3ZN4A 4L97A 4HK8A 4WM7A 5FDBA 1LKNA 1TMF1 2I07B 4F8AA 3I54A 4DXZA 2JG8C 5FO8B 1PO12 2ES3A 1HV1A 2VW0A 1BJQA 4XHXA 4LBQD 2YROA 2YMZA 2B5HA 4BYYA 4CP0A 4AVVA 3NKTA 2HEWF 2RS13 3NAPA 2E51A 2JECA 4RQPC 1CIWA 1ALYA 2BTVC 4SBVA 2HWE2 2XPJA 4YZ3A 4XIOA 2XWBB 1H9WA 2MEV3 4FPCA 4JGYA 4Q0VA 3AX4A 1S0JA 4Q4V3 2HWD3 4YM2A 5K0UA 1LENA 4F83A 2YZ4A 2P2KA 4PCRA 5I0TA 3R0RA 4DMIA 2GH2A 4BQ1A 4BH9A 2ZGTA 1HDKA 3FBMA 4GA9A 4HLTA 2E53A 4Y1YA 3U07A 1D4M2 1QOSA 3E97A 4JTNA 4K7JA 1H8VA 4MYEA 2DURA 4YZ4A 4J6GA 3WCRA 4ES9A 1WD3A 4XTPA 5JOYA 1NCQA 5BNNC 1NCQB 1VIWB 3PMSA 2XWJB 4E2QA 4LT5A 3IMNA 4RGGA 1W6PA 1ZRFA 1R081 4AE2A 2R1DA 2FQPA 3QH7A 4K1ZA 1IS3A 2A5ZA 3ZN6A 2O0OA 3ZN6B 1ND3C 3HQXA 4IEVA 4I02A 1HW5A 2DF7A 3WXPA 1R1A2 2RM22 4XJZA 3VBFC 4XTMA 2CGOA 5CG9A 2WZR1 2EXIA 1QU0A 1O4YA 2OZJA 2VOXA 2DTWA 5F1RA 4G9SB 1RUC1 1SLCA 2JEMA 2A6VA 3MPPG 3WY6A 1DZQA 1KS4A 4BE3A 4BA6A 1WW7A 4LE4A 1GQHA 4XF1A 2BNOA 1PK6C 4YVWB 1ZZ7A 3PVOA 1YFYA 4RHV1 3WLUA 1W6QB 3I59A 5CFDC 1VALA 1ZZ9A 4HKLA 4Q1RA 2XGXA 1W6MA 5T5JA 3PVEA 1U5IA 3AMMA 2EXKA 3PHMA 1ZZ6A 1H2KA 2SBAA 4KWLA 3CF6E 5FMOS 4OI2A 4CDXC 2D3PA 5JOWA 2QVSB 1OSGA 1LU2A 1QF3A 2BGCA 4DNYA 4KU8A 4OZXA 3KGZA 5KHHA 2X5IC 3QACA 1LOEA 1PGW1 3AYAA 5KC5A 4Y20A 3AYCA 2MPFA 4F7ZA 5KXBA 3H1YA 2YY1A 1D2SA 1QJX3 5JSOA 5L36A 3JBG1 2OUHA 5JPMB 1SBDA 2WA3A 4FTBA 3CO2A 1WW6A 3VLBB 3PMEA 5GZDA 4N7IA 3I8TA 4AI3A 3WDYA 4G4FA 3WR0A 1NYWA 2AH2A 1OOPC 3VZNA 4CP1A 1DQ0A 4AVCA 1AL0G 2TBVA 3SNMA 2ZMLA 4HL0A 2RS11 2XL7A 4FOWA 1HRV2 1Q3EA 2WWSA 4N53A 4Q26A 4COVA 2DUQA 4N53B 5C9AA 2OUJA 4KBBA 5C9AB 4OHWA 4L11A 4OHXA 1JOJA 4B4RA 1YJLA 5E8AA 1B35A 2DVFA 4FPEA 1OFNA 3N7LA 3KT1A 3JZVA 2GALA 3RQ0A 3VBSB 4M3CA 3ZSJA 2HWC3 3HD8B 4H3WA 4C1XA 4M3CB 1HV0A 2TEPA 4E4DX 5GJ6A 1V6MA 4Z82A 4KNCA 2RS52 1LHNA 1CONA 1U5XA 1YO8A 4N43C 3ZXJA 4C0HA 4LO5B 3CL1A 2DCJA 1OHFA 4AW7A 3KGLA 4CDUA 3MDPA 4MUVA 1AHSA 4JVAA 4CDUB 4AGVA 3BODA 3WOGA 4XFGA 5AC93 5J48A 2QE3A 2WNVC 2ZX0A 3OJBA 4YG0A 1NA1A 1OI6A 4GIQA 4LHKA 3RDIA 1DGRN 4Y1ZA 2WFF2 3USUA 5FTTC 4IV1A 5JCTA 1QJU2 4GALA 3USUB 1PVC2 1D4M1 4R9CA 5KHJA 4OI0A 3NVCA 3NWKA 5L7OA 4C1WA 4PIYA 1PGSA 3USSA 3ZVXA 3HT2A 2HWF1 4EWDA 5CB7A 1LGNA 5EV7A 2XB6C 3MLLA 3AYDA 1AYN2 2CNAA 4YGEA 2VNRA 4LE3A 1OPOA 1YYNA 1G86A 5CA6A 3NV2A 2RE9A 1IPKA 2IFWA 3RRDA 2RM21 1AR73 3AZVA 4L2NA 3KSCA 4LBQA 1O3RA 3LAGA 1FMD2 4LBQB 2BNMA 1XU2A 2NM1A 3VKLA 4Q27A 3ZXDA 3GALA 3GZTB 4ASMB 2C5DA 4L99A 4MGYE 1AR82 2ILMA 2A75A 2LM3A 1SBFA 4WV8A 3AMPA 4AHWA 1UIJA 1NXD1 1OLRA 5JIAA 1JYCA 2A3WA 3IPVA 4N9IA 4Y1XA 3LGRA 3IN9A 3IPVB 1WW5A 4B7EA 2ZGRA 2ET1A 2XJSA 2VVEA 1BEV2 1WCSA 2JX9A 5FQ0A 5IK4A 1PVXA 4AI8A 1LHUA 5FQ0B 2TUNA 2PAEA 1Z7S3 2DWRA 1Q8SA 1OPMA 3VDDC 5FREA 3GHMA 1QJX1 1JTZX 3N7MA 4Y22A 4DPNA 1VBD2 1BVVA 4Y22B 5A3MA 4L9BA 5E88A 3VZKA 1Z0HA 3VUOA 3MF6A 1XU1A 2X29A 1REDA 3RYRA 3PTYA 2BWAA 5C33A 1W6OA 2Z42A 4ONUA 2VH9A 5L19A 1S1AA 1W6OB 1XXNA 1VLNA 3ALQA 1RUE3 3ELNA 4MGKE 3RI8A 1AR93 2VG9A 3OD0A 3MF9A 3LA7A 3VBRB 4WZFA 3VBUB 4JQRA 2G4IA 1QGLA 4BZ4A 1QJZA 2XL9A 1R092 3S7IA 3VBOC 4CEYA 1H1MA 1FT9A 2JE9A 1LOGA 1UKGA 2A6XA 2F6BA 2PHXA 2VMGA 4HN0A 4RGAA 2PHUA 3BPZA 1XNBA 3D82A 3GBGA 4RR3A 1HRV1 2Q4SA 5JDBA 3W59A 4W6XA 2JE7A 5KXDA 1VBC2 3RS6A 2Y0OA 1JUIA 4E9KA 5CG8A 4MVTA 1Q56A 4JDMA 4V1PA 2ZCWA 5AC91 4EN8B 2D7FA 4KWJA 2NMNA 1D4VB 3WDWA 3U4XA 3UJOA 4AI0A 2RS32 2SLIA 3IKWA 1C4RA 4YW4A 4XXAA 2D97A 3X29B 3AP4A 2GAUA 5A33A 1DLLA 2EIGA 5GLWA 3AZYA 5A33B 3O0VA 5DUUA 1H8TC 4AEDC 5CFCA 3P3PA 1BMV2 4L92A 1V9U3 1HIXA 3L2HA 3ST7A 5CFCB 3VBOB 4XW3A 3ZFGC 4RD7A 4DZGA 1NQDA 3I7DA 1GLHA 5HI0A 3FHIB 2H0VA 3RZZA 4XXPA 4Z92B 1MEC2 4PBOA 1FAYA 1Q8PA 4QPIC 3HIFA 3MW3A 3WCSA 2CGPA 1SLLA 2WLQA 2HYKA 5LRRA 3DPRC 2ET7A 5DDJ3 1KXGA 4ATFA 1J58A 1PO22 1RINA 1XYNA 4KG8A 1S0DA 3ILRA 2ZZJA 5HBAA 1WD4A 3MICA 2PLV2 3E6CC 2BBVA 2FBEA 4COZA 1QOOA 1UPSA 4FXGB 4K1YA 1IS6A 1EAH1 1QQP3 1RUG2 4DY5A 1POV1 2I74A 3ASIA 3ZPYA 4UW3A 1AR81 1Z7S1 1JW6A 1GZCA 4A7YA 1DDLA 1CPMA 2CGNA 2Z5WA 5T52A 3FUOA 1AXYA 3VZLA 1F5FA 2QZ2A 2P3IA 2DYCA 2UWAA 3B02A 5HCAA 1QHDA 4Q4Y2 1BXHA 1FNYA 4L8QA 4QQPA 3SXWA 3MW2A 1V70A 2WINB 4CDWA 4WVVA 5ABJA 4CDWB 4GKXA 3ZXFA 4CRQA 4YSFA 1I5ZA 4M00A 5HXVA 1AYM2 2K9ZA 4MX3A 2ZHMA 2A6YA 1ZRCA 3ZFFA 5F6LB 5CADA 5JSPA 1YCIA 3LCPA 3TYJA 5C6CA 1OLQA 4WM8C 1XE8A 4AFDA 1MS9A 3ZMOA 5L73A 4Q0SA 3B01A 1C28A 1G8WA 2R072 1MACA 4S2DA 2PHDA 1DYKA 2ZX2A 4A7ZA 5H9QA 3ZMNA 2R30A 3H7YA 3NL1A 4ISRA 2R062 1RHI1 5A3LA 2VY0A 2ENRA 5BNOA 3MLKA 4U2AA 3ZFEB 4FBFA 1DF0A 3P3NA 4HKOA 4BMEA 1O3QA 3WNXA 4Q4W2 1AX0A 4LA3A 3LOBA 1HLCA 2ZMNA 2D6LX 1YIPA 4QQOA 2D40A 2GNTA 5T50A 2GC1A 4LTAA 3MIFA 1W39A 1ZVFA 1V9U1 1LECA 3ES1A 1MS5A 1ZBE3 2VU9A 4AGGA 3QOPA 1ND2A 3VV1A 2RS31 1WCKA 3H7JA 1H4HA 5TSWA 1HX6A 4FTSA 1YI7A 4Q4X2 5BNPC 4I3GA 1RUI2 1O91A 4AQ2A 2WSUA 1RTVA 2ZABA 2NZ9A 1F2NA 3WP4A 1RMU3 5GALA 4KU7A 5J37A 4YVSC 2R49A 4DS0A 4FPHA 4QPGC 1K5MB 3GHNA 1YXWA 3M2MA 3VZJA 2IXLA 3RJ2X 1SLIA 1MEC1 1TME3 1CGPA 1C3HA 3U0ZA 1HQWA 2WNUA 3V0AA 2WNUB 1TMF3 1J59A 2C9AA 2XH6A 1QH6A 4PBPA 1EV12 1KITA 3M3IA 4S2FA 2AYHA 2PHLA 2K0GA 2BYVE 3AMNA 3GZAA 5FLIA 3MIDA 5K7PA 3ES4A 4ISQA 4TYSA 4D7TA 3O0XA 2D6PA 4XFHA 2WQZC 1MS8A 1RUF2 1BCXA 1UKRA 1YRZA 1UL9A 1UCXA 2PAKA 4XF4A 1RUJ3 1FOD2 5BXXA 3JD73 3DN7A 4Z2WA 5LEJA 4YZ5A 2WT1A 1AXKA 4C0BA 5ACA1 1DQ4A 4OUMA 3LA2A 4AWDA 2PA7A 1VB2A 3FLRA 4XF3A 5C8WA 1WCDJ 5AFEA 3SH3A 1ASJ3 2XLGA 4PDWA 4FAHA 5EYYA 4Y4YA 4PDWB 1R083 3WP6A 2CYFA 4UW6A 3ZXEA 5I0RA 1QWRA 1KDMA 1VBB2 1AYM1 4LLOA 5FLHA 3L2YA 2B39A 3GBFA 2ZHKA 1DQ6A 1TQ5A 2WZR3 3B94A 3ILFA 3THTA 1OA3A 4E2SA 1ENSA 4IXLA 3PVNA 1YI9A 3K51A 1AR62 4AHZA 4HVOA 3TNPB 4URTA 2ZKNA 5JR7B 2E7AA 2DVGA 3JU9A 2AZ5A 2D43A 3OY8B 2GU9A 2OVUA 2PAMA 4QPYA 1F31A 1UPIA 3M8LA 4FPOB 1GSLA 4LLFA 4RHV3 1AX2A 1CAVA 3N35A 4XILA 2VVDA 4IEOA 3CJXA 5H9PA 4QQ2A 1ZBE1 3VBHA 3LA3A 3KCCA 2G9FA 2JG9B 3HN1A 4NO4A 4Q4W1 3AXDA 4P5HA 3S6PA 3LKJA 5FOBB 3TAYA 1J1TA 4CZSA 5GKAC 4Z8BA 4JC1A 1C8M2 2NP0A 4LHLA 2A73B 2VUAA 3AFKA 5T5OA 4XFAA 1GICA 4HVQA 1F9KA 3RYPA 1X8MA 3AKRA 1OQDA 2QDRA 1TME1 2ERFA 4FPGA 1HKDA 1YUDA 2B42B 3EQEA 4OVEA 2G9GA 1LCLA 4WM7B 2ZKLA 3THPA 1QXPA 1NCQC 5EZWA 1MZ6A 1CAWA 1OFSA 1J1LA 3E5XA 5J36A 4Q0QA 4DRRA 1C5IA 1XYOA 3IWZA 5D8AA 3RYKA 1QXRA 1HXS3 5C4WA 1NLSA 5D8AB 2D6KA 2Q8OA 1Q8VA 4XZPA 4BMBA 3NAPB 4N90A 1DQ5A 4FPLA 1O7FA 4ZU4A 1G9AA 3VHNA 4LNVA 1PO13 1A6CA 1KJRA 4QU2A 2ZMKA 3OF1A 4MGIE 1RUJ1 3J9SA 1URXA 3KCXA 2R32A 4JGYB 1ZBA2 1AVBA 3WG4A 5K0UB 3JD71 3U10A 2HWD2 1V6OA 3M1HA 1SCSA 5T5LA 1KJLA 4YVWC 4IEQA 1QKQA 4R4ZA 3FFZA 2DCYA 1LRHA 2E6VA 3CEWA 1SFNA 2ZHLA 3SCFA 2HWE3 1EPWA 1QJY2