4DRYA

The crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from rhizobium meliloti
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
248
structure length
241
Chain Sequence
b'RIALVTGGGTGVGRGIAQALSAEGYSVVITGRRPDVLDAAAGEIGGRTGNIVRAVVCDVGDPDQVAALFAAVRAEFARLDLLVNNAGSNVPPVPLEEVTFEQWNGIVAANLTGAFLCTQHAFRMMKAQTPRGGRIINNGSISAQTPRPNSAPYTATKHAITGLTKSTALDGRMHDIACGQIDIGNAATTGVLQANGEVAAEPTIPIEHIAEAVVYMASLPLSANVLTMTVMATRMPLVGRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-oxoacyl-[acyl-carrier-protein] reductase
publication title The crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from Rhizobium meliloti
rcsb
source organism Sinorhizobium meliloti
molecule tags Oxidoreductase
total genus 82
structure length 241
sequence length 248
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4dryA00
3PXXA 2POQX 1PJ3A 4KZPA 1MFZA 3D64A 4FFPA 4NFSA 4YAIA 3PGJA 1SB8A 5COQA 4BNNA 3DHYA 1ZEMA 2PH3A 4OOEA 1ZMOA 2Y1FA 3GVIA 3FNEA 1BW9A 4IQ0A 2ZQZA 1L7EA 2ZB3A 3DXFA 1F8FA 3NT4A 3WNVA 4R16A 2EW8A 3QV1A 1I3KA 3UCFA 5KJ6A 1CETA 1NTOA 1OAAA 2D59A 3ABIA 4PLZA 2QW8A 1GYQA 4AJJA 4A7PA 1LNQA 2P9GA 2Q2VA 4FR5A 1GZ3A 1ENZA 1NXQA 3OF2A 1Z74A 4MKZA 4E30A 3AY6A 4RJTA 3I6IA 4K9DA 4XWYA 5DOZA 1O95A 3BHMA 4YA6A 2W90A 1A9ZA 2AQKA 5K0ZA 1EK5A 3H5RA 5A1TA 1BTOA 3K92A 4W9NA 4ZQEA 3W6UA 2C7GA 2D5AA 1CQJA 3NRCA 3LT4A 5JO0A 1GY8A 1LJ8A 1GV1A 3UHAA 1H94A 4J91A 2NVWA 4FN4A 2SCUA 2EP7A 4BO1A 5K9ZA 4MINA 2EGHA 1E92A 4R1SA 1JAXA 2FPGA 2VHZA 1YOVA 3PLNA 4LCJA 1UXKA 3HDQA 3KB6A 1HYGA 4FW8A 4Z9YA 2OBNA 4LRTB 5JLAA 3ICCA 3LT2A 4JP2A 5I9MA 5U4QA 3NTQA 1ISGA 3E03A 3ORFA 4GLLA 1O0SA 4Q9NA 4YJFA 3JQ8A 3BMNB 4RF5A 3TZ6A 3I52A 4PG4A 4EJ6A 3NT5A 1ML3A 1DFHA 1TEHA 9LDBA 1EFKA 4QEDA 2IDZA 1DIHA 2HQ1A 1G0OA 4ZA2A 1Y5RA 3AI3A 4M8SA 1T2DA 4BNXA 2DBRA 3SBOA 4FFRA 4MKXA 3K2BA 3PEFA 4AJHA 1LQTA 1VKOA 3SVTA 2Y0CA 3NT2A 1I8TA 4DYDA 1H5QA 4JK3A 1NYTA 4LSWA 4AG3A 2IZ1A 3EY4A 4W7IA 1M76A 3OQ1A 5J23A 3AK4A 2EG9A 4XIJA 3DBLA 5LCXA 5IN5A 4NBWA 4BQPA 1ISIA 4QUKA 1P45A 4ALMA 4PG5A 2X9VA 1W8DA 1IZ9A 2OP0A 4M86A 1VJ1A 3ZW8A 2JJYA 3PHIA 5C7IO 4W7HA 5TRTA 2D2IA 1JKFA 1R12A 1GCOA 4MVJM 4MVJE 2YY7A 2WE7A 4J0FA 5CEFA 1PR3A 2P68A 2PZLA 1LBEA 4L75A 4UVDA 2QX7A 3O03A 3AUUA 4IDCA 4IZHA 1QLJA 4OKIA 1LXCA 5DCWA 2VYND 4BV9A 4NNJA 5DF1A 3LZ6A 4PLWA 2EJVA 2AMFA 2X9GA 1LI4A 1DAPA 3T4EA 3R6DA 2C07A 3OMLA 3DHNA 3CZRA 1QR6A 5A9SA 3ROKA 1U3TA 2W2KA 3GH3A 3AM3A 4FFLA 4A26A 4CM8A 4TKMA 1YH3A 5DP1A 4A10A 1P1JA 4MVJI 1RJWA 4O5OA 1E3EA 1SPXA 3ADPA 4BNMA 4FJ1A 4YJHA 1WAMA 1D8AA 4CMGA 2AG5A 1P1KA 5BNIA 2I3AA 3UAGA 4AJKA 1ZSYA 1SO8A 4ID9A 3FNHA 4OXNA 4Q3NA 2NU9A 2PFGA 4AFNA 3WGTA 1B16A 2BRUA 2YJZA 4A73A 2PKQO 1B8UA 4J4TA 3NX4A 4PLGA 2B36A 1G1AA 3S2IA 2FHSA 2AEFA 1JW9B 4NJMB 1I36A 5T57A 7ADHA 1X0VA 2C5EA 5G0TA 3SEFA 1VPDA 3AU8A 4GSKA 3NJ4A 3IP1A 4XRRA 5IN4A 1Y1PA 1NVTA 3TOZA 2F00A 4ZN6A 4YAGA 3NTOA 4LVUA 3JQFC 2X5JO 4BHTA 1PQUA 4ZICA 4J0EA 4UAGA 4CM7A 3DBHA 3HADA 3JQCA 3RC9A 4BVAA 1SBYA 4E6PA 5KJ1A 4XYBA 5HTOA 1OMOA 3GGGA 3HQ4O 1Y8RA 2CDCA 5GMOA 2NQ8A 3ZNOA 4AJEA 3AW9A 4P4NA 4NK4A 2Q99A 1NASA 1IULA 2R00C 4CR8A 4Y9DA 1M2WA 5I8ZA 4QQRA 3R1IA 4HUJA 1Q0HA 5LDGA 3ZW9A 3PHJA 3C24A 3RC1A 2RAFA 3Q9UA 4O6VA 1ZJYA 1NWHA 3JV7A 2GSDA 3TRIA 4C7JA 2I76A 3O9ZA 4XR9A 3HDYA 1GYPA 4EITA 4K26A 2D5CA 3QHAA 1UXGA 5COBA 3H9EO 1Z82A 1HLDA 1QSGA 4KUGA 1KVUA 1UZNA 1V0JA 3RU9A 1DSSG 3M2PA 1V8BA 3FPCA 3HSKA 3D3EA 3EVNA 4YDRA 1WMBA 3GHHA 4CM6A 1Y5MA 2FSSA 1JWAB 1NHWA 2WD7A 1DB3A 4D79A 2Q4EA 3I4FA 2VWQA 1VL8A 4QXMA 2VHXA 4PVCA 1EEHA 1LDBA 5HWSA 4CLXA 1WZEA 3KTDA 4E5YA 3JQFA 3SX2A 1DBVO 3PHGA 4NBUA 1FDTA 2DKNA 1Y9AA 5L95A 4XQ9A 4P22A 3NDRA 4A03A 1T1RA 2G1UA 2JFHA 3W8FA 4EW6A 1PWXA 4JJFA 2E49A 4WNIA 1CWUA 1DLIA 4GL4A 4P4GA 3GRPA 1HWYA 2ZYDA 1ADCA 2R00A 4EEZA 3DDNA 2C5AA 4FFOA 5IDXA 5JO9A 2ZYGA 4BNTA 2J5QA 3RQSA 1A72A 3E48A 4TZKA 3MTJA 5JBIA 1NQOA 1DRWA 5JS6A 1FDVA 1K6JA 2V7PA 1RM3A 1VSVA 3L77A 3U4DA 2YHIA 1HDRA 1X14A 1PS0A 3DHEA 2VZ9A 3O8QB 1FF9A 4H15A 2EWMA 2HUNA 1TT7A 3DMTA 4L74A 2ZTLA 2Y99A 1KY5A 1SB9A 2O2SA 3OEWA 4MVJG 3VTFA 2CVZA 3IAHA 1TB4A 1I5RA 1DJQA 1NX6A 5AXCA 1VLLA 2VQ3A 1S7CA 3KLPX 4E13A 2BFMA 2FWMX 5JMPA 3UGKA 4Z9FA 3ZU5A 1QRRA 4WEQA 4XDYA 4XGKA 3JYPA 2J5RA 3PFWO 5JAIA 2Z1MA 1T4BA 4DA9A 4PZEA 2VT3A 4JQCA 2Y1GA 3ROPA 2GZ3A 3JQAB 1CF2O 1LDGA 5L7WA 4RPKA 4FC6A 4ALLA 1E6WA 2WYVA 3RBZA 4CM4B 3KYDA 1QYXA 4RZIA 1PZFA 2XAAA 3UF0A 1U8FO 2UUOA 4URFA 3X2EA 1LA2A 4XRGA 1K3TA 4RVHA 2DUUA 3DTTA 1ADFA 4QO7A 4E2XA 2D3TA 4IDDA 1T2AA 5GY7A 1XCBA 1X1EA 4WGGA 3KM0A 2NWQA 4BNVA 2X4GA 4DUPA 4ALNA 4E21A 4YPOA 3H5AA 4NG5A 4RPHA 3C85A 4NPCA 2BGKA 3JSAA 2NU7A 2BI8A 1B7GO 2FSVA 3B1FA 4OXKA 3WSWA 1LSOA 1ZK0A 2RHCA 3HN2A 1R15A 3ENNA 4XJSA 4Y8VA 5A5EA 2H5LA 4FDAA 1ZZEA 2VCYA 4E12A 3GNQA 4UEJA 4E2WA 4J2HA 4BKQA 4B79A 3BTVA 1FXSA 1PJTA 1BSVA 5EMHA 3L4BC 3QE3A 3W8DA 2RIRA 4E33A 5A05A 4I5FA 2YW9A 1KVTA 2ZJ0A 3KYBA 3ZU3A 1R0KA 5KJFA 2DBVO 1XGKA 1GCUA 3LT1A 1T4DA 2H9IA 1JKIA 2OOSA 2IEBA 3EYWA 1YL5A 4ZRMA 1MG5A 4WASA 2J5KA 4OKNA 2UYYA 3FR7A 4CPDA 3ROMA 4Z0TA 2E4AA 4PN3A 5DCYA 1XKQA 4HFNA 3L07A 2OGUA 3U4IA 4L8VA 4Z9XA 3SJUA 1T24A 4RLSA 4TROA 3I9LA 3KBOA 1MLDA 2B35A 1E6EA 1H93A 4BNHA 2PKQP 3HNPA 5LC1A 3KOUA 5B4UA 1TT5A 3GFGA 4OOFA 1XELA 5IFLA 3TL2A 3N58A 3WR5A 1IE3A 1PJSA 5B4VA 3EGOA 3RUEA 4CMIB 1YQGA 3ZWVA 3GF4A 1L7DA 1PTJA 3FSRA 3L0DA 1BVRA 3OIGA 4YTEA 3TOXA 4R1TA 3VTZA 4ALIA 4GVXA 2I3GA 3TL3A 1Z75A 5I8WA 1UH5A 1RM0A 3ICPA 1FJHA 3CH6A 3ZNQA 2Y66A 1GEGA 3BYZA 3GEDA 2AEMA 4QECA 2ZKLA 2FZWA 4GWKA 1PGQA 3L4BA 4ITUA 4NDNE 1A4IA 1X13A 3ZZNA 1EDZA 1ZK4A 5TGDA 1B26A 1OZAA 2I6TA 4YRDA 4DC1A 4CV2A 3IC5A 1P31A 4B4VA 1H2BA 3BTUA 1N9GB 3WMXA 3JYNA 3QW2A 1ADBA 3WG9A 4Z3DA 1XG5A 4WPGA 1E1LA 1LQUA 3GK3A 3WSVA 3HUDA 1LDMA 2D1YA 2NADA 4B8ZA 1LSUA 4EJMA 1NP3A 2PD3A 3BMCA 4JROA 4CMKA 4J49A 2OL4A 1A71A 3GY0A 3GNTA 4D3FA 1Y9EA 5TSDA 1UP4A 4J3FA 5JYDA 1B8VA 4Q3DA 4GLOA 1SEVA 3DB2A 2FR8A 4OIMA 2DTEA 5G4LA 2QRLA 3H2ZA 3GPDG 4KWHA 3H3JA 4D7AA 4BQRA 4LK3A 4DREA 1QYWA 4BGUA 3KEQA 3RWBA 2G5CA 3FR8A 1FK8A 5B1YA 1N2SA 4NIMA 1GDHA 4TZTA 5I9LA 1ENOA 3JD3A 3PDJA 1YONA 3DBLB 2GO1A 2Q50A 3KSZO 3E6AA 3C7DB 4XA8A 2V6GA 3GN1A 4P38A 5CEJA 3WYCA 1D4FA 1D7OA 4G65A 2PD4A 1R37A 2AQHA 3DAGA 3I23A 4ZGWA 1C1DA 4XIYA 2I66A 3F46A 4RORA 1HT0A 1XHLA 1AXEA 3MTGA 3I9JA 2X8LA 3NAQA 4QTZA 4XQCA 3P19A 5FI3A 2PA3A 4DMLA 1ULUA 1H6BA 2CUKA 4Q3CA 5G0WA 1ZBQA 2GCGA 2Q4BA 2UVDA 3JQEA 4GVLA 1WNTA 2PGJA 4DC0A 1LUAA 2G82A 4GAEA 2NV6A 6LDHA 5KNLA 3RU7A 3DAPA 4UEKA 4L4RA 4PGFA 2HCTA 4CQLA 1YL7A 2ZB7A 1IZ0A 4MVJF 4ZQFA 4CM1A 2W2KB 4CM8B 1P44A 2PKRA 3P2OA 2IYOA 1UDBA 4WECA 3IKTA 3G1UA 4FFNA 4IPTA 3EDMA 4BNYA 1VM6A 4IDAA 4YRAA 2EERA 4YJHB 3ROQA 3T7EA 4P4LA 3TFOA 3LVFO 3E9NA 3NGLA 4BKOA 3WGQA 3QP9A 4AJ2A 4IDBA 5CEEA 4FGSA 2R2GA 3F1LA 1HDXA 3ZHXA 5JNLA 5F5LA 4XR4A 3FTPA 5EJ2A 4MIOA 1QYVA 3RBVA 4ROSA 5BT9A 4ZQBA 1F06A 1RWBA 1XDWA 1ZVMA 2XF8A 1YB4A 3V1TC 1V6AA 3KZVA 3IQDB 4XQGA 5DBGA 3ZNPA 4B3IA 5K6AC 5EL0A 1GV0A 2IODA 1MGOA 2DUWA 4KMSA 4IUYA 5IG2A 2CDBA 1RPNA 3PRJA 4GH5A 1YO6A 2GPTA 3P5SA 1T25A 1PJQA 4CQMA 5KKAA 3V1UA 1NAHA 1UDCA 3OJFA 1S6YA 3U4HA 4AJ1A 1HZZA 4J7UA 4CM9A 2NLOA 4AICA 2VRBA 1E77A 2P4QA 3PZRA 4OAQA 3TZHA 4DBVO 5TT0A 2C20A 4IS2A 3QQPA 1E3LA 4II2A 2YDXA 2NTJA 5JAQA 4DPLA 3WLEA 1I33A 3S2GA 2NNLD 5ITWA 2Y05A 2YZ7A 3CTMA 3EMKA 3FI9A 4JBHA 2FRDA 3LDHA 1P74A 2C0CA 2DFDA 5C3MA 5C7LO 5C37A 2C82A 3ANNA 1TXGA 4CQMD 3PDUA 3G1TA 3TDKA 4CM9D 3K31A 4UVGA 5DNAA 3X2FA 2DBQA 4AJ4A 1LSJA 3FWNA 2QYTA 4RQUA 4IINA 4NBRA 3H9UA 1ZSVA 2WEKA 2JAHA 2IZZA 2UUPA 1HRDA 3WYEA 2VOJA 3GVXA 2PH5A 3KSDO 5TJ9A 3GEGA 3KUXA 4B8WA 3F4LA 1ZXLA 2BH9A 1J5PA 1RM5A 1Y8QB 5K6AA 5KJCA 3IMFA 1KC3A 3BTOA 1PJLA 4BUCA 5AXBA 2JCXA 3INTA 2WM3A 1AHHA 3RCBA 4R9SA 2BGLA 3WQSB 4LCEA 1NNUA 3A1NA 1V9LA 4DVJA 3F4BA 2B4TO 3UVEA 4CR6A 4KDEA 5TLSA 1ZSNA 4DIBA 1U7HA 4PLVA 1GPJA 4W9NC 4WK6A 2DFVA 3TPCA 4IQGA 4RL6A 1U9JA 2A4KA 3I3OA 3OP4A 4R41A 3RSHA 3ZV5A 1PL6A 3FTNA 3L4SO 4U7WA 1HSZA 1DIRA 4H16A 4WUVA 1GPDG 1HF3A 5ADHA 4Y98A 1WW8A 1PR9A 1GUZA 3CKYA 3KV3O 2I67A 3L6DA 3QJ5A 4CL8A 4E5MA 1JAYA 2HK8A 5U1PA 1PGPA 2AG8A 3HDJA 4J90A 2JD2A 4L4XA 1W0CA 4OQZA 3WBFA 3DBVO 2EW2A 4GPD1 1UXHA 4JJGA 4LISA 5EQFA 4CL3A 3PHLA 3EZYA 1M66A 1MB4A 4KP7A 2YHIB 1UAYA 5U9CA 3EW7A 3GZNB 2X9NA 1MX3A 3G79A 5JE8A 4FB5A 1HZJA 4RGBA 4D43A 4F46A 4DYVA 3E5MA 3V2HA 4F3YA 2E37A 1XA0A 4N54A 1XYGA 3F9IA 2ZCUA 4MIEA 3W4KA 4IJKA 4RVDA 4JP3A 3DZIA 2ZB4A 3JQGA 1TI7A 4JBGA 1NQTA 2C54A 2B83A 5EINA 1YB5A 1Y7TA 4L9RA 1NPDA 4MVJH 4YCAA 1D1SA 4PLTA 1P1FA 3B70A 3F5QA 3I6QA 4F6LA 3DOJA 4NMHA 1RKXA 4B4OA 3RFTA 2ILTA 3VZRA 4I5DA 1XSEA 1EE2A 2UDPA 5F3RA 3U9LA 3KYDB 2GZ2A 3WWYA 3LC2O 1ARZA 1GD1O 3LLSA 3NKLA 1AN9A 1B0AA 2V6FA 4PLCA 3VC7A 2Y1EA 2PTGA 3SJ7A 4DL9A 3W6ZA 5A9RA 3DO5A 1PQWA 2GDZA 5IJZA 1U5AA 5IZ4A 2CMDA 3T4XA 4CLOB 5CHEA 1VI2A 2YFHA 2NVBA 4KWIA 2BELA 4GX2A 4MP6A 3WGIA 4FFMA 2NVUB 2B0JA 1Q1NA 3VH2A 1NPYA 1QV7A 5HM8A 2GLXA 4HY3A 1N1EA 3JD0A 5CDGA 3QWFA 2VWPA 5I9NA 1K5HA 1K6IA 3VZSA 1YL6A 1NVMB 2W2LA 1E3WA 3C7AA 4FBGA 3PYMA 4OSOA 1EZ4A 1PGOA 3ZHYA 1LC3A 4WOKA 5G4KB 4L4SA 1ENPA 2VYNA 2PZMA 4FPXA 1SCUA 5H83A 1YDEA 1VE9A 4WLNA 5COAA 2A35A 3GT0A 4M87A 4IJUA 4ZU3A 5TC4A 3I4CA 2AQ8A 2Y1CA 1MUUA 3H9JA 4OMUA 3RBXA 4EJ0A 2HLPA 3LYLA 4E5NA 2B37A 3ONDA 1WDLA 1DRVA 2JKVA 2C59A 2W2LD 2AE1A 4FJ2A 5DCUA 2FPIA 1O94A 3JD1A 3VVCA 2VTDA 5ITVA 1JA9A 1JTVA 1YB1A 1ZEJA 4H7PA 3IS3A 5HRUA 3D4PA 1I24A 4J1TA 4KDFA 1K2WA 4R51A 4GKBA 5JAMA 3P2YA 3WJ7A 5HS4A 4RF4A 3IDSA 4YACA 4ILKA 3PVZA 4YAJA 2Q1TA 2FR0A 3E8XA 3DFZA 1U3UA 5KVVA 1F0YA 4YB8A 2D4AA 4I08A 2JHGA 3AY3A 4YWJA 2X0RA 1EVIA 5L4LA 3KYCA 4RVGA 3EHEA 1NPTO 5A04A 5CDYA 5I7EA 4DGSA 3E9QA 1XWFA 1N8KA 4R4JA 4U5QA 2DM6A 4WCDA 2GD1O 3SLKA 1X7HA 3BMCB 1GZ6A 1Z73A 3WGHA 1H6AA 4J1SA 1HYEA 3V2UA 3MCVA 4MO2A 2HJRA 4BO2A 4O0LA 3UH1A 4BGEA 3G0OA 1CYDA 4N5MA 4XGIA 3KRTA 1IOLA 3WOHA 5DBFA 4R54A 4PIVA 1O89A 1DC6A 4LN1A 2NACA 4TRNA 3C1AA 2EXXA 4GGOA 1R4NB 3GHYA 3LC1O 3GLQA 3WIDA 5JAZA 2IXBA 3ZWCA 1HETA 3HB5X 3TJRA 1ISFA 1LEHA 4D44A 3RUHA 1ZK1A 3PP8A 5TF4A 1K6XA 2B5WA 3DWFA 1ZK3A 1EVYA 2BLLA 2X0IA 1UJMA 5EN4A 5CFZA 3H5NA 3TSCA 4WKGA 5FYDA 1HKUA 3VAZA 3DAFA 5KWEA 4HFMA 4WJZA 2Y0DA 3U49A 1PQPA 1V3UA 4UUNA 1ZNQO 4H3VA 1GTMA 3DMTC 1IPFA 1PJ4A 3WGYA 3S2EA 3JQBC 1N7HA 3K9QO 3IIEA 1HDCA 1P77A 4GKVA 1G6KA 2PR2A 1HXHA 2TMGA 2P5YA 2VHVA 2GRAA 5L9AA 3LQFA 1V3VA 4HWKA 1EE9A 4ZVVA 1WLYA 1AUPA 3QVSA 2I9PA 3TNLA 4BNZA 3NEPX 3VPFA 3GOHA 3VVBA 2Q3EA 1VJTA 3ZH2A 4GX5A 3ZWYA 5GZ6A 4XB2A 1I30A 2E82A 4RV9A 4LW8A 3ASUA 2XXBA 1YBMA 1KEPA 1Q0QA 3FNFA 3LF1A 2CSUA 2QYSA 1BXKA 1EUDA 1B3RA 2YQ5A 4TQGA 4U0JA 2DU8A 1R4MB 2DPGA 4FQ8A 1PJ2A 1MA0A 3HFSA 4R68A 2Y0EA 1C3VA 1XQ1A 2WSBA 5DZSA 2X0NA 4BO4A 5TJHA 3UN1A 1HDZA 3AU9A 4J4BA 1JWBB 4INAA 4E32A 1NQAO 3ETDA 1BXGA 4IBOA 3OHSX 3M1AA 2A92A 1YKFA 3NGXA 3N7UA 3D0OA 3PPIA 3QWBA 4NU5A 2JD0A 3D3WA 1DC4A 3JQBA 3HB4X 2DPHA 2YQ4A 4GMFA 2C2YA 1YBVA 3MEQA 3QIVA 2JCYA 3G3EA 4GMGA 3ZU2A 2V65A 4CQMB 3GGPA 2GN9A 3FN4A 4J7CA 5DT9A 3VH4A 4EUEA 3WTCA 1HDGO 4BS9A 2WTBA 3K30A 2WMDA 4YT8A 4LGVA 1GFSA 3GUYA 2JCVA 4BKRA 1UAGA 3PJFA 4YQYA 4B4WA 2Q1SA 4FIZA 4CMEC 1JVBA 3WGGA 5ES3A 3WWZA 1ZCJA 5L40A 3RAJA 2FMUA 2O4UX 4UVHA 4J1NA 3SC4A 3GNSA 1IY8A 2J3IA 4W99A 4BB5A 2FN7A 4NFYA 5AXDA 2JHFA 3MJCA 2YFQA 3PYLA 3QWIA 3HHPA 4HNHA 3KO8A 3WQRA 1YVEI 4J7XA 2X7HA 1GQYA 3F5SA 4QO8A 3JTMA 4J6FA 3GMSA 4J9VA 4ZHSA 4LVCA 3JD2A 3VZQA 1DXYA 1HE3A 1D1TA 4O59O 5CPBA 4BGIA 1A4UA 3H8VA 9LDTA 3R0IA 4WCFC 2Z1NA 1DHRA 5LDHA 1F17A 1KEWA 3STHA 3FF4A 3AM4A 3WBBA 1KVRA 3ULKA 5JCXA 4BIIA 1AHIA 2AW5A 2GR9A 3L9WA 1ORRA 4M1QA 1DC5A 4BMSA 4PLFA 5JC8A 1PZHA 4HADA 2V6BA 1DIGA 1H6DA 4YEDA 4I1IA 3WJAA 4GX1A 4ZRNA 1KVQA 1GYRA 3QVWA 4E3ZA 3QVTA 3NTRA 4L0QA 3IP3A 4WLVA 4B7CA 3ADOA 3GZ4A 4CMEA 2X6TA 4LSMA 3MZ0A 2GNAA 5IXYA 3MJSA 1BG6A 3LT0A 5DBIA 2HAEA 1Z45A 4OO3A 2Q1UA 4O1MA 5EESA 4EBFA 3QRWA 4R3NA 4RF3A 4D0SA 1BW9B 2CZCA 4OQYA 2X1HA 4DWVA 3I9OA 1D3AA 2YDYA 2H6EA 4PZDA 3TZCA 1J49A 2AEJA 3BA1A 2NUAA 2BKAA 2X5OA 2PNFA 4MKRA 3ANMA 4WE3A 1EFLA 1J4AA 2GERA 1PZGA 4WCFA 2RHRA 4QSMA 2JFGA 3FD8A 1PEDA 1E3SA 1YJ8A 3RUCA 4JX8A 3RASA 5L7TA 4D45A 4YQZA 1AXGA 1C0LA 3VKUA 1UR5A 2AHRA 5JW6A 2Y1DA 2P5UA 2EEZA 5T67A 3GC6A 2VHYA 3E18A 1ADGA 1XIVA 3A28A 3OQBA 2X0JA 4W82A 3RUDA 3TF5A 1Z6ZA 2YYYA 3UXYA 3PJGA 3L9XA 1I01A 3Q6IA 1I2CA 1SZJG 2HRZA 5H82A 1QYDA 4J1QA 2E48A 1LU9A 4XB1A 1PWZA 1YOVB 3PI7A 2HMUA 3WFIA 5BSHA 3UUWA 3EC7A 4WOJA 4XX0A 3ZI0A 4BB6A 1T26A 1VKNA 1O9BA 3WS7A 4HNGA 4BNLA 4D46A 5FF9A 1BMDA 1KC1A 1MC5A 2DTXA 3WFJA 4TWRA 4B3HA 4Z3KA 4BNJA 3NV9A 2B5VA 1A5ZA 1SEPA 4YJFB 4FD3A 3JQ8B 3AOEC 2J3KA 3Q9NA 4JXKA 4BMVA 3AUTA 1A7KA 1TA4A 1JQBA 3PGXA 3VPGA 3O4RA 1ZXBA 5EERA 4BNIA 2BD0A 5KIAA 4OL9A 1B8PA 3HZZA 1ISMA 2Q49A 4C4OA 1WDKA 4FJ0A 5CAEA 4IDFA 1E3WB 4CV3A 1XLTA 3I5MA 4E2ZA 5ER9A 2X86A 5TS3A 1ZIDA 4II3A 3U4CA 5JC1A 5IDYA 1QORA 4J4HA 1ONOA 1I0ZA 1IHYA 3FBGA 4DLAA 4WLEA 1O8CA 4GBJA 3LF2A 2W98A 5F1KA 3D5QA 4M89A 2GUGA 4YT2A 3A06A 4JLWA 4RVFA 4ZQHA 5CG2A 1EQUA 4M49A 1OC4A 3F47A 4R5HA 1BGVA 5JDCC 4KTTE 1YGYA 3JQ7A 4IS3A 3QWHA 5L4NA 4XCVA 2CF5A 2YV3A 4CUJA 5A5FA 4R9RA 1R0SA 4PLHA 4IIUA 4I5EA 1ZUD1 1HDYA 4J16A 3U0BA 1NAIA 1EVJA 2HK9A 4BOYA 4LRSB 4Y67A 2YUTA 4IDEA 1QP8A 5THQA 4DLLA 3MWEB 2WJPA 3W8EA 3ETGA 2VOEA 4R3WA 5T64A 5HA5A 3AOEA 3ONFA 3MJVA 1FMCA 3RC7A 2CDAA 4AJNA 1R16A 1UXIA 2JFFA 5A9SB 4CUZA 4IDGA 1PJCA 4N18A 4DPMA 1M75A 2B4QA 2BFPA 1Z7EA 2XOXA 3NDJA 1DRUA 2EP5A 4B7UA 3ST7A 2VT2A 5L53A 3OECA 5DULA 4CMBA 5JXWA 1SMKA 3GN2A 1WVGA 3Q0EA 4I9NA 1DEHA 1BRMA 2NTVA 4CLRA 1PX0A 2QG4A 1H9AA 4IQ8A 2PWZA 4W6ZA 4XJTA 1YWGO 2FPPA 1ENYA 1KIFA 4KUEA 1J0XO 3FWZA 4K6CA 2Q1WA 2GN6A 3DZFA 3EAGA 5IDWA 1XU7A 4MVJP 2FP4A 1VRWA 3CMMA 1JN0A 2IXAA 2OO5A 2BI7A 5JDCA 4KQXA 1SC6A 1YS4A 2QQ5A 3F3SA 3GPIA 5ICSA 5FEUA 1K0UA 2GZ1A 5F1OA 3EUWA 2O48X 3RI3A 3IKVA 4IGFA 1NQ5A 4FC7A 5ILGA 2ZIZA 4DQUA 2O3SA 1DPGA 2GYYA 4XGNA 3BTSA 4N7RA 2P2SA 4BO6A 1R6DA 4FS3A 1DJNA 4XYLA 3AJRA 3E9MA 2RCYA 3DBHB 5C7OO 1JU9A 3PYXA 4OSPA 2FZEA 1G0NA 1HE5A 3RJ9A 5JDIA 1VL0A 1MXHA 2EJWA 4XKJA 1U1IA 2HMSA 4IXTA 4BMNA 1Y8RB 1NBOA 2A9FA 2Y93A 1E1NA 4GSLA 3SLGA 2ZB8A 3DTYA 4DQVA 3JYOA 2ZK7A 3PIIA 4N5LA 3A14A 3OSUA 4IMPA 5DDIP 2IYPA 3OBBA 1ZJZA 2I99A 4J2OA 3RKRA 3G49A 2P9CA 3NDIA 3MJ4A 1M67A 1MP0A 2VHWA 1ZH8A 4CLEA 1U4SA 2BGMA 3K8ZA 1SOVA 5TNXA 4BO9A 3ITKA 3FRJA 4YR9A 1DFGA 2JAPA 5BNTA 1YBAA 3ETEA 3JQDA 1T1SA 3DZGA 2UV8A 1P9LA 3F1KA 2WD7B 4CM4A 1WZIA 3WNQA 2X23A 1E5QA 1QMGA 3E1KA 4YJGA 4BNUA 3KSUA 5A3VA 2ZATA 5T8KA 4AJOA 3ZU4A 3Q2KA 1IB6A 1LC0A 3DMYA 3VZPA 4F6CA 3H2SA 3JYLA 5L51A 1GZ4A 1P0CA 5KTKA 1N5DA 3GAFA 3DBRA 4E4YA 4MVJD 1EBUA 5KVQA 3GUCA 1LDYA 5TX7A 4ALKA 3CSDA 4TRRA 3G17A 4D0RA 2VUUA 3VH3A 1A9YA 1ULSA 2JL1A 4XZ3A 3JQAD 1GUFA 3COSA 2P4HX 7MDHA 3BHJA 5JFOA 3NJ8A 1PU2A 4DIFA 4S3MA 2AE2A 2I65A 4IY1A 3WQQA 5DP2A 4JBIA 4CMAA 1LLQA 3KEOA 3IOYA 1KEVA 2O2YA 3IL2A 1SOWA 4O63O 4WEOA 3W4IA 4KUHA 1T2FA 3GRKA 3R3SA 1ISJA 1IYZA 4HX5A 5ER6A 3HE3A 5A9TA 4IZIA 1U3WA 3DZJA 1CRWG 3OQ6A 1WWKA 2QHXA 4FOOA 3D3WB 3GQVA 4Y6PA 1E7QA 3MOIA 1UZLA 1ZK2A 1B2LA 4ND3A 4NK5A 5DOVA 2DVMA 1N7GA 4IJWA 4LMPA 1LLUA 3AFMA 5A02A 4XQEA 1WXDA 2TMDA 3K5PA 1TVEA 4YBZA 4A5OA 3D4NA 1XU9A 3I9KA 5IF3A 4UREA 1NWCA 1Q2XA 4XYMA 5BQFA 4KOAA 1GQQA 4EUFA 2BF7A 4CMIA 5I7VA 1M6HA 3S2FA 1YJQA 3GVPA 3WYBA 1HLPA 3M2TA 1O5IA 1ZW1A 2VUSA 2Z5LA 4KQWA 5F5NA 3IJRA 1QYCA 4RDIA 4DPKA 3ZWNA 3AY7A 4IMRA 4R1UA 4TVBA 3AOGA 2P9EA 4AJPA 3V1YA 3GDGA 1HEUA 5KKCA 5JSFA 2PV7A 3UOGA 1N9GA 5A03A 1I10A 3KXDA 3ZWAA 1GUYA 1OI7A 6ADHA 3EK2A 1Y6JA 4HFJA 3VH1A 3BAZA 2IZ0A 4Q3BA 2VTEA 1N1GA 1IPEA 3JYQA 1ID1A 1PGJA 5CDUA 1NFFA 4TMFA 2QZ9A 3W1VA 3WGZA 1A27A 4BO8A 4BGVA 1C1XA 3N74A 2O3RA 4MIYA 1ONPA 1U28A 3NUGA 3QLJA 3PIDA 3U3XA 2W8ZA 1EQ2A 4PCVA 4RZHA 4JCOA 3GDFA 3ZDFA 1W73A 1A7AA 1NM5A 2Q2QA 1T2EA 5JPIA 5IDQA 3BMQA 3B20A 1LX6A 4MJLA 1E7WA 2EIHA 1Q7BA 3TZKA 3PK0A 3QWAA 3L6OO 5TT1A 3INRA 1P1IA 5F21A 1C0IA 3O38A 2C7VA 4YT5A 3KHUA 3ONEA 1YDWA 4RCVA 4YXFA 1TT5B 1KY4A 2R6JA 2GN4A 2HMTA 2HU2A 1X1TA 2Q2WA 3GVHA 5G2OA 2Q46A 1DIAA 1TLTA 3LLVA 3FNGA 3E5RA 4CUKA 5KCZA 4WCFB 1DAOA 3DOOA 4PZCA 2O4CA 4ONEA 3C8MA 5IAAA 1UP6A 4BNKA 2HSDA 2OFPA 4GX0A 3ITDA 4IGEA 2VYVA 4FGWA 2VZ8A 1Q7CA 4NJOA 1FDUA 3UW3A 1O6ZA 2LDBA 3ZWXA 4C7KA 2QRJA 3MOGA 1RM4A 2X58A 4PVDA 3Q11A 1C0PA 3QY9A 3SC6A 3UCEA 3ZNNA 1MC4A 3OEYA 4BKUA 4ESOA 4ZJUA 5BSGA 2PD6A 5JY1A 4J9UE 4YT4A 5IZCC 5JCJA 3CUKA 5BNFA 4TRJA 2YV2A 2C29D 3NYWA 3S8MA 3WDSA 2DLDA 4DLBA 2G76A 2CVOA 3MJEA 5KVSA 3I83A 4QFDA 5BSEA 2VYVD 2B69A 1KETA 3AI2A 3HDHA 2WYUA 5B37A 3PFFA 3SXPA 2ZTMA 2NU8A 1GL3A 1KS9A 4NI5A 3DOCA 1PL8A 2HRBA 1ZFNA 2GGSA 3DR3A 4ND5A 3PJEA 5EQDA 1FDWA 4EI2A 1P3DA 1U3VA 4XYGA 1GR0A 3F6YA 3UFXA 3WXBA 4CR7A 4QX6A 1PIWA 1PS8A 5JCJD 4CLDA 4RO0A 2ZTVA 4JIGA 3CIFA 3OICA 1GADO 2O50A 3H3FA 5I7SA 3AUSA 1LLCA 3GG9A 4OM8A 2IRWA 4J43A 1E3JA 4GGPA 4UUMA 3ASVA 1ONNA 4XDZA 2BFOA 4UULA 1M6WA 3WMWA 1SNYA 1KVSA 1P0FA 4UUPA 1J6UA 2HO5A 2B4RO 3GG2A 4I9UA 3PHHA 1H0KA 3WTBA 2OMEA 3GMDA 3PQFA 2Q45A 3EVTA 3KLMX 1F8GA 4GI2A 3VPSA 1VL6A 1E7SA 2OBYA 1W4ZA 2YHUA 3C7CB 1C1DB 4IIVA 8LDHA 1BDBA 4RF2A 3RD5A 3JQ7B 1EMDA 1KBZA 4UEOA 4N5NA 5IZCA 3LSYA 2A94A 3WX0A 4PFJA 4FCCA 2PY6A 1E6UA 1GQ2A 4PLYA 2JD1A 3OJ0A 2DAPA 3RROA 2PZKA 2EKPA 4WLOA 2EGGA 4Q3AA 1CIVA 5ENDA 1P1HA 1PJBA 3VOSA 1V35A 4DBZA 2GASA 3H4VA 3BMOA 4NU6A 4UUOA 4GQAA 1WMAA 2PK3A 4TRMA 4CQLB 3ZCXA 4DRYA 4WLFA 1U5CA 5FI5A 2PGLA 4CODB 4IJVA 2OORA 2J8ZA 4R5MA 3UKOA 4CM3A 1Y8QA 1I3LA 2VUTA 3OM9A 3AUAA 1EK6A 1XEAA 3OFSA 4UVEA 4CLRB 4EEXA 3RFXA 4BNGA 1LLDA 4A2CA 4AL4A 3U5TA 1DLJA 3D1LA 3W4JA 4JJIA 4HBGA 4YRBA 4Y6SA 2WWRA 4XD2A 2EKQA 3D5TA 4GWGA 1AE1A 3BHIA 3GEMA 5KVCA 4RPGA 3K73O 5L4SA 1E0DA 1DIBA 2O3UA 1C0KA 2EHDA 4IM7A 3CE6A 1CEQA 3WLFA 2FOIA 2HK7A 3U62A 3H6KA 4ND4A 1Y81A 5CP8A 3RC2A 2RH4A 1GAEO 5C5IA 4S1VA 3QVOA 5ENVA 4CLHA 1F12A 4CM5A 1T2CA 3ZWWA 3LK7A 1P1RA 1I3MA 4OHUA 1EDOA 3AFNA 4EUHA 3GZNA 5ICMA 4I9HA 3KVOA 1Z7BA 3ZHBA 1F14A 5HBRA 5MGBA 4HV4A 3M1LA 1PS9A 4BO0A 1H9BA 1B14A 4EZBA 3RUFA 1DDOA 8ADHA 3GVCA 4QFCA 3B6ZA 2RH8A 2CY0A 4NHEA 3RVDA 1PL7A 4RLHA 1PZEA 2YV1A 1PGNA 1HTBA 3Q2IA 3PLRA 4PG6A 1EUCA 1ZMTA 4BNWA 4ALJA 1DFIA 3LU1A 3U09A 1E1KA 4MPDA 3AM5A 3I9MA 1NVGA 4ZD6A 3TN7A 4L76A 5JMWA 1X15A 3OJLA 3HN7A 2E6UX 2H63A 1EBFA 4UVIA 4W4TA 4YJGB 4OGWA 3ZWOA 1NHGA 1N92A 2QIOA 4BO5A 3ZGYA 1BXZA 3DBRB 1EVZA 1K89A 4YAKA 2QRKA 3D7LA 3DFUA 4CMJA 5CDSA 4CLOA 1U8XX 3PJDA 3BMNA 5T6BA 1KERA 2IE0A 2GN8A 2NVUA 3OH8A 5G0VA 5A3JA 4OXYA 2FY8A 2J3HA 3CXRA 5L45A 1NFRA 2AXQA 4FSHA 4K1LA 4Z6KA 3OIFA 2NU6A 2VNAA 1JLLA 4EDFA 3I1JA 1DO8A 3ZWBA 2X22A 2O7QA 2HJSA 3ANLA 3IJPA 1GEEA 3DC2A 1MXFA 1LRLA 3OJOA 1QXSA 3VDQA 4P8RA 3UICA 3DZKA 1U7TA 5G4KA 3OIDA 1IL0A 4YAEA 2OUIA 3TFQA 4E31A 5ILOA 3FCOA 2CVQA 5B12A 1NR1A 1DC3A 5EIOA 3MJTA 3CINA 4ND2A 3JD4A 3PWSA 3CZMA 4PRLA 3EZLA 1YRLA 3QA9A 4CMHA 1Q0LA 2X5KO 3HG7A 4B3JA 3JCZA 5DN9A 3Q1LA 4JN6B 3JQGB 4R69A 2DC1A 1UZMA 3IUSA 3VHRA 1X0XA 2G0TA 5TQVA 4BV8A 1LDEA 1CQIA 2NTNA 1GU7A 3H7AA 2DBZA 3AWDA 1UXJA 1QV6A 1LSSA 1WP4A 2FR1A 3PTZA 2D8AA 3K96A 3ZV3A 1HL3A 3Q3CA 2DQ4A 3WICA 1JDJA 4JNKA 2OXIA 3GDOA 1E5LA 4Z0PA 1VJ0A 3M6IA 4G81A 1LDNA 3PWZA 4BKPA 3INGA 2J3JA 5HS6A 3ZV4A 3JQ9C 4A27A 1U2DA 3BIOA 1KOLA 4D3SA 3HWRA 2VRCA 1U4OA 1VC2A 4K28A 4NZ9A 3LC7O 4HXYA 3VPHA 3MWDB 4Q3EA 1R66A 4YJDA 4WNCA 2F1KA 4DQXA 1DOHA 2NM0A 3GGOA 1MFPA 3OA0A 4I8XA 2CD9A 1NR7A 3ZN2A 4AJIA 4U6QA 1KEUA 1ISHA 4YYZA 5AQ1A 3S55A 1LRKA 1CERA 2XPCA 1OBFO 5G0SA 2V6MA 5THKA 3K6JA 2WYWA 4G2NA 4D41A 3IUPA 4NJMA 1E7RA 2VRCD 3HFGA 1FDSA 2O23A 4CJXA 4PRKA 1BVUA 4XYEA 5L7YA 3V8BA 1HYHA 1MV8A 3VKVA 3WGOA 1C1XB 3KETA 5AXAA 1OOEA 4L73A 3ON5A 4X54A 4I5GA 3OETA 1HDOA 2XXJA 3V5NA 2HMVA 3H65A 4MDHA 4Y6RA 4B4UA 4CV0A 4EYEA 2I5PO 4U8GA 4CMCA 4NBVA 4TKLA 5FWNA 1HSOA 4U6SA 5FFFA 5H81A 4K6FA 1E7MA 3WB9A 1R4NA 3BMQB 2Y1OA 5GZ3A 1RYEA 2EV9A 4MP8A 1VSUA 5AOVA 3ZWMA 5GZ1A 2G17A 2P91A 3GAZA 2WDZA 3JQ9A 3S1LA 4PLPA 1JVSA 4OH1A 5CDTA 3JQ6A 1X7GA 5MDHA 4Q39A 2IEDA 3RFVA 3I9NA 4MP3A 3RIHA 2C2XA 1R0LA 3C1TA 5AYVA 2O3QA 4R1NA 2AA3A 3H9QA 3VPXA 5F1PA 3TZQA 3GR6A 3GFBA 4E5KA 5EPOA 3RUIA 3PZBA 3DZBA 1PSDA 3C3XA 3DQPA 5JDIC 4RVSA 3B1KA 1NFQA 4G5HA 4DMMA 1XR3A 3QVXA 1YXMA 5KOIA 2ZTUA 2DTDA 3PQEA 4AJLA 4TSKA 1AGNA 1DHTA 1UDAA 2Y68A 4M55A 3H9GA 4ND1A 2EKLA 3WIEA 2DT5A 4NH4A 3O26A 4OJNA 1MG0A 1H6CA 4RQTA 3D4OA 1H2HA 3C1OA 1U2GA 1JKJA 1B15A 3ZWPA 5BR7A 2PLAA 3KYCB 4F45A 2HDHA 1E7YA 3R3JA 3FHLA 2O3JA 3ENKA 3GA0A 4QT0A 1I2ZA 2AQIA 2PZJA 4D3DA 2VN8A 5CG1A 1X7DA 2NSDA 1YQXA 4LMRA 4CV1A 1BWSA 1B3BA 4KTVE 3A9WA 1CDOA 2NQTA 1LRJA 1IUKA 1ZKMA 5BSFA 1ZO8A 2HKIA 3DONA 1YQDA 5T8KC 5G0UA 2J6IA 1OFGA 2O3TA 3BZUA 3ZV6A 1R4MA 3AI1A 2BHLA 1Q7GA 1C14A 1RYDA 3QSGA 2PGDA 2O7SA 2QZZA 3E82A 4PG8A 2BFAA 4BL5A 4PG7A 1WPQA 2ZCVA 1YE3A 3UCXA 5A4DA 5IXSA 2WD8A 5KJEA 3O8QA 2VNSA 1I2BA 4E5PA 1V3TA 3CEAA 1W6UA 2D0IA 1UUFA 1SAYA 3RKUA 5I7FA 2CF6A 1LTHR 4BNFA 2GF2A 2Y67A 4YVFA 3TWOA 5CPFA 2VWGA 4RPLA 4MOWA 4ZQGA 4JGBA 2RBEA 3DZHA 1QG6A 4A0SA 5L3ZA 1BHSA 2W4QA 4MVJA 2BMAA 4U0KA 5AVOA 4BO3A 2LDXA 4R01A 4BO7A 3RJ5A 1BDMA 3JQAA 4IXWA 5TIIA 3A4VA 3DL2A 3K2EA 4FOSA 3OA2A 4EGFA 1HE4A 2Z95A 3CPSA 4NR0A 5A06A 5JY6A 2EF1A 2CFCA 2VWHA 1XQ6A 3BMOB 4RVUA 4E0BA 1I32A 1OC2A 1I3NA 4Z0HO 4XEHA 2OZPA 4AVYA 3HJAA 5T5QA 1IHXA 2CNBA 4HP8A 4TVOA 4DXHA 3L6EA 4HFRA 2HMWA 1QLHA 4NQZA 3P7MA 4OYRA 5JYEA 1UP7A 3OJEA 4WLUA 3FBTA 4RDHA 1CJCA 3BXXA 4NFHA 3V2GA 3T7CA 2OHXA 2UAGA 2OP1A 3B1JA 4M54A 3DEYX 3PWKA 3RUAA 4E2YA 2ZJ1A 4B7XA 1KYQA 1E1MA 1HE2A 3TQHA 2VZ0A 3FPLA 4DIOA 3VDRA 4D42A 1L1FA 2ZQYA 1E3IA 4NBTA 1BXGB 4DTIA 3CMCO 3PQDA 4HKTA 2ET6A 4RPJA 2ZYAA 3ZHZA 1P33A 5B4TA 1QKIA 2H1SA 1WDMA 1EUZA 2WE8A
chains in the Genus database with same CATH superfamily
4BQNA 3PXXA 4DG8A 1V1RB 2GAFA 2POQX 2Q3DA 3ABOB 3VJLA 1OGIA 1OZGA 4WXHA 1UT5A 2QD1A 2GOYA 1VP9A 3EVFA 1SB8A 3OZWA 3M6XA 3PGJA 4GBMA 4DFDA 1ZCBA 2XGSA 1HORA 3DWIA 4F71A 3U48A 3RT1A 1TJ4A 3C48A 2ZAMA 2WSIA 2XBUA 4OFZA 4K9QA 5FI1B 1BCSB 1E0JA 3D6HA 4R16A 2EW8A 4CCYB 4U7TB 3UCFA 4BQSA 2D59A 1M0WA 1SCNE 4MI9A 1MDBA 4HAUA 4UAUA 1P72A 2Z6VA 1F6WA 1LNQA 1Y3AA 2Q2VA 4LRXA 2FLKA 3S1AB 3U26A 3QE4A 4KGDA 2QX6A 4YGYA 1OXVA 1NXOA 4RU1A 3CLTD 3HU3A 3UWDA 3F9CA 2PJZA 3E84A 4E30A 1P2FA 1CF9A 3WRYC 1G9TA 4XWYA 4B76A 1USIA 2J9ZB 3ENQA 5EE0A 4FKMA 3ZK9A 1RJDA 5HBGA 1D6SA 2AQKA 1UBOS 1EK5A 2DP4E 1PW7A 1ID8A 2FMTA 4LXGA 1V4NA 3K92A 4W9NA 4ZQEA 4P0PB 5EMKA 4FCWA 5HG0A 3PNSA 3SS8A 1HE1C 1T8TA 1TCAA 3KB8A 3NRCA 3QU2A 2HYDA 3B38A 3TTUA 4FT2A 3OPYI 4GXNA 3H5OA 3KT3A 2TMKA 2EBHX 1H94A 2Q3FA 1PP4A 4J91A 4B6OA 4JB2A 4YREA 1JAXA 3C70A 4X62B 3IR5A 4Q4HA 1SKUA 1YOVA 3PLNA 3BS4A 3NVDA 4HDRA 5A3QA 3G85A 1E62A 3KB6A 1KOJA 5ERXA 3ICCA 1QHNA 3H1FA 2RI6A 4R1PA 1KOGA 1O95D 1VG9B 4A8TA 1Y6ZA 1E2IA 5I9MA 3DB1A 5U4QA 3NTQA 3OIWA 4NWIA 3F9RA 1O77A 2Z2IA 3TZBA 1T8RA 3HFJA 4CKEB 1MX5A 1FL9A 2ZJ8A 3VO2A 3CCBA 4AROA 4Q9NA 3AVPA 3CWQA 3EQ2A 1QPZA 4MIKA 3ISJA 4D02A 1BX1A 5AJHA 2OXFA 4PG4A 3F8SA 1DAKA 3ZHVA 3I0NA 1ML3A 5IK2D 3QEBZ 2P7IA 2PMWB 4QEDA 2JEOA 3RANA 1G0OA 2NU6B 1Y5RA 5DM0A 4ZA2A 4B9AA 3ZK7A 1TM2A 3VDNB 5JJKA 4KPUB 3FOAA 3T3MB 4BNXA 2DBRA 5ITZB 4JIMA 2J7PA 3QMWA 2Q21A 3PCXA 2BM0A 2AWOA 2ZYIA 1YZVA 3PEFA 4KVAA 2Z8YA 2ID8A 3HUEA 1OW3B 3GRUA 5HILA 5HF6A 3ZBTA 1T5SA 5EIBC 3RRXA 4ETNA 3SVTA 1ZJWA 1BMFD 2KPOA 4IVPA 4H1VA 1HFKA 2ODPA 2PANA 3OQ1A 1UDWA 4Y2YA 5DNVA 3VYTB 2GAOA 3CUUA 3DYBA 2W2XA 3DBLA 2FJ0A 2PU7A 4JBLA 4LXUA 5E0OA 4MV8A 4H7IA 5BSTA 3N39C 4BZQA 1KMNA 2P30A 3HVKA 3T4UA 1UF9A 2CNDA 4IXNA 4PG5A 2IYTA 5EHIA 5J2UB 3IUMA 5J9FA 1JFSA 1B00A 2B25A 2OP0A 4WHMA 3A9CA 4LDJA 4M86A 4NICA 3OKCA 3ZW8A 1H2WA 3PHIA 1CY6A 4UFPA 4ZQIA 3R9XB 4WBSA 3EFOB 1KYWA 3DE7X 2QK4A 1GILA 2C7PA 3RK0A 2VXCA 1B93A 1R12A 4C2BA 2YY7A 3EGEA 2LTAA 1PR3A 2PZLA 1MH9A 1LBEA 2PNJA 4I4LA 3Q5DA 4IDCA 1DEOA 5BN5A 1XXHA 3FBWA 2YWGA 2IH2A 3HB7A 4R8SA 1QOZA 5FOTA 3HBLA 3MWEA 4NNJA 1XRNA 2W0SA 2GZRA 3LZ6A 3MSXA 5DF1A 1NU8A 1CK4A 1L5HA 4PLWA 2P6UA 3NG1A 4AZ0B 4AY4A 3B2EA 2C4UA 1GN9A 4HMOA 3PPXA 1GG2A 5I48A 2C07A 2II6A 2OOKA 4WFJA 3CZRA 1QR6A 1RXCA 5A9SA 1WMDA 5JXIA 4DUYB 4BZZA 4BQIA 3LL4A 1RP7A 3IKLA 4L7QA 5BW5A 1H3EA 4A26A 3UAXA 5AKKA 4EI9A 1AB5A 3OTIA 4M98A 2QB5A 4C05A 3TSWA 4QZVA 4IOJA 1AC5A 1DE0A 1KYIA 5TGTA 2QRPA 3ND8A 5HZGA 4X3CA 3L7JA 4O5OA 1IZZA 1WXXA 3FCXA 3PNOA 5K2MA 1UIRA 5C4GB 4YJHA 4C89A 2JJQA 3PLAE 3W1WA 2AG5A 3TVTA 1EK0A 2PSSA 2VT6A 2Q2OA 1L7AA 4GSYA 1U0JA 5EYPA 1C81A 4WZAB 4ID9A 4CGZA 5BOVA 3Q3EA 5JYCA 5ARDA 3WMGA 3L0CA 4OQEA 4Q3NA 4G4JA 5BR8B 1WM1A 1XZBA 2J0QA 1VLMA 4TT3D 4DLPA 1E9DA 3GA7A 2EFEB 2PKQO 3RGGA 3DTVD 3SR4A 2XUJA 1T91A 1QUFA 2O8CB 4ARVA 5CT9A 4YFVA 3BXEA 4Q9DA 2AEFA 5CAEB 3GCDA 1WETA 4C6HA 5JS7A 1I36A 2IY8A 1MABB 2C5EA 3SEFA 1J97A 3KT6A 1L7MA 3M81A 1FFXA 2V98A 2RHDA 3IP1A 5EIBD 1T0JB 4WTOA 5IN4A 3F6BX 4Y2RA 1NVTA 3FLBA 3IXLA 3ENVA 4PR3A 3NTOA 4RGVA 4YAGA 4ZN6A 1THTA 4ZZ0A 4BHTA 5JECA 2YXDA 2RGWA 2R7MA 2R2AA 3GLIA 3QUAA 4JZKA 4RM2A 1N8NA 1B23P 5GOTA 3JQCA 3HADA 3AUXA 1ESDA 3OE4A 4NXNB 1NSTA 2QRVA 2X15A 4IV8A 4XYBA 4PYLA 2KHZA 4KJZA 1JR6A 1R0RE 3EVZA 2IHNA 3A6GA 4CTOA 4AJEA 1B6RA 4OXIA 2R84A 2CHFA 4WI1A 4LY9A 4NK4A 1NASA 3NXKA 1IULA 2C9OA 3U17A 4JLJA 1J22A 3KKKA 4ZT7A 2R8OA 3SE7A 4URZR 1XL1A 4P54A 2IITA 4D56A 5J4LA 3U31A 2WAMA 4ARZB 5JJCA 2AI3A 2H1HA 3M5DA 5BMOA 1AGRA 2OXCA 5JROA 2I76A 1A2KC 3M89A 4KBFA 6REQA 4QARA 1GYPA 4M1OA 4EITA 1VE7A 3SOPA 4KIGA 3SKXA 1Z82A 2W48A 1QDEA 4JLVA 3REOA 3W5UA 1Y8CA 3X1YA 4EKGA 2HPZA 2VUIB 3WQHA 4F5EA 2XIQA 4AKHA 1QNLA 1V8BA 4OTZA 4B44A 2COEA 1Y6FA 2E4YA 3KK0A 4YDRA 1WMBA 2OSVA 3GHHA 4WN9A 1KK3A 1Y5MA 1NHWA 3R3WA 4RW0A 2IV2X 1ULZA 2HGZA 2WD7A 3ROZA 2VWQA 4QXMA 2G77B 2XUHA 4RTOA 4PVCA 3X1KA 4MW7A 2P2DA 1YUBA 1JKJB 2ODQA 2YMMA 3QVGB 3RSQA 3G9UA 5AKGA 3PQCA 1O03A 1WZEA 4DXHA 4E5YA 2IBSA 3JQFA 3SX2A 1DBVO 1KFBB 4K3UA 1Y9AA 3ORYA 2WJZB 3CZ9A 1KF0A 4UXJA 2VJKA 1I7PA 4BBZA 1FNBA 4A03A 5J4VA 4KXLA 1FQJA 1T1RA 2G1UA 1YA4A 2Y4OA 3I2FA 3R0VA 4EW6A 1PWXA 4JJFA 4LMAA 1Z5NA 4K0RA 5IJWA 4KYUA 5CM2Z 1U3FA 1FFDA 1Z2CA 2P9YA 2Q0QA 5IM4A 5TMDA 1L5ZA 4C20A 1HWYA 4CF5A 2BAGA 2I1WA 5M29A 2C5AA 5LYJF 1EDEA 4WVFA 3F3MA 5KINB 1NUTA 1EH5A 1WZNA 3HB1A 3RQSA 4MW5A 3P0RA 2NUPB 1KZHA 1HPLA 3D8SA 2FMIA 3AV3A 3E48A 3EHDA 3OCVA 1DRWA 1U2RA 2OQ2A 3V1LA 5JBIA 1JHXA 4GNKA 3HCCA 4UUQA 1X1QA 5BYJA 1K6JA 3NC1C 2OHVA 3BWDD 4ZEXA 3USCS 3ZE6A 4LYYA 1QJ4A 4LHSA 5CVVA 1GZSA 4MGIR 3TKAA 4ECEA 2JI6A 1FF9A 2EWMA 2BE7A 2FSVC 2O7NA 4B17A 5H8WA 1SRRA 1SG0A 5EG5A 1KY5A 5DRYA 1SB9A 2O2SA 3M82A 3RAPR 4YO7A 3TIVA 3X1XA 1E1QA 4DR2B 2CVZA 3IAHA 5AVYA 1INLA 1VHDA 1C1YA 1L5MA 2QP4A 2RKWA 4P98A 4DV4B 3HO1A 2YJ3A 4IIBA 4QEKA 1ZJ5A 1W36C 1DQNA 1BC5A 1Z47A 2G4VA 1Q92A 5H59A 5IVHA 3C5CA 1HC7A 2BBSA 1FYWA 2JRLA 3DZCA 3UGKA 1OFTA 1S3GA 3R7NA 3JYPA 2J5RA 5JNVA 4DV5B 2Z1MA 1M83A 2VT3A 4JQCA 1KJIA 2NV2B 2AGVA 2XOKD 3FE2A 3HB0A 3JQAB 4IX1A 4QA9A 4YRTA 3FNQA 5HW0A 1H05A 1FVFA 3EGWA 1XXHE 4FC6A 1MHPA 2XW6A 3TRKA 3K3PA 1Q57A 3RBZA 5K3OA 4CM4B 5K8UA 1IVSA 4GI7A 4JVNA 5JZBA 1D2EA 5CJJA 1PZFA 2H8KA 3D4BA 4IDQA 1U8FO 1KKMA 2XWPA 3QF4B 4HYTA 4NENB 3W5JA 4XRGA 3BL6A 1XZGA 4CE6A 5CBPB 3DTTA 4P0QB 4NECA 5M04A 2D3TA 4HI0E 4M1MA 2Q0HA 4GMXA 4BRUA 4BJ1A 2OCXA 3VKHA 1XTTA 3QI2A 1BEZA 4X1KA 4ZO9A 5E8JA 4MJ7A 4BNVA 3GU3A 5BV7A 1Q0SA 3TR5A 4PPNA 1H4TA 4BP9A 2WHYA 2GUWA 4WD3A 5IHXA 1PYOA 2PCLA 1K8ZB 3S68A 4BECA 4ZHQA 5HKKD 5LU9A 2CUTA 4BRWA 1U5BB 3C85A 3DOFA 2BGKA 1E94E 1KP2A 2AJTA 3NBKA 3JWJA 3PPVA 4QICA 5FWXA 2NU7A 2BI8A 4I50F 3B1FA 3LDAA 4OXKA 1LSOA 1W25A 2FXVA 4K9KA 1XTPA 4LY0A 2ZVQX 4ER3A 3U44B 3QV2A 3RKSA 2DFTA 2J4CA 5A5EA 4JLSA 1MDFA 2PUJA 2PVSA 4E12A 4KODA 4A6EA 2JLVA 1T9DA 2CXHA 2JBAB 4ENPA 4U3JA 2H4WA 4BKQA 3RYTC 1PJTA 1BSVA 3IBYA 5NULA 1G59A 3IESA 2WU0A 4FDMA 3W8DA 4DV2B 2RIRA 3GELA 4R8VA 4XM0A 4I5FA 3FOWA 3AUYA 1E6CA 3B2NA 1O96A 4TWAA 5KJFA 4LF7B 1XGKA 3LT1A 3U3ZA 3EYWA 2BE9A 3BE5A 4M22A 4TL7A 4N3BA 4D5GA 1TNDA 4R71A 3UJNA 4IKPA 1MG5A 2VDOB 4WASA 1A82A 5JAOA 5LWHA 3H42B 4OKNA 5JCOA 2Z09A 4G4GA 3GLIE 3PFNA 3UJHA 2F1OA 3C0KA 3HXQA 3FR7A 2C7OA 3PQ5A 1TVMA 1QHHA 3E2PA 1Z5GA 2CNLA 5DCYA 3GQBA 3T0FA 1CY8A 4UDXX 2OGUA 5FA5A 3O9MA 3SJUA 3MWLA 3EMVA 4D1YA 1T10A 4QXAA 1XO1A 2A1TR 2UZ1A 4LZZA 4BNHA 4KHPB 2FCAA 3ZBPA 3PQ7A 5B4UA 3DDOA 3PEYA 2IIQA 1ZI8A 3CH7A 3BWBA 3MBOA 5D3KA 1TVCA 3OEHD 3V55A 5DYTA 2FR8C 4H0FA 4JQZA 3N58A 3TL2A 1IE3A 5A1JA 5K01A 5DGTA 4AS1A 2C4VA 1DDGA 4CMIB 4P32A 3BF7A 3FCUB 3BUSA 1Y6QA 4LXYA 4TXNA 1BVRA 4AIIA 1TMKA 2WM8A 1T3GA 4R1TA 3VTZA 2HLHA 3UMVA 5DHPA 3UWMA 3ICPA 1IH8A 2EQAA 3CH6A 2G9VA 3ECAA 3TIXB 4UTRA 1WCV1 3ZZ0A 5HJ7A 3ZNQA 2FRVA 3BH7A 2QMUA 3Q6MA 1G38A 2IGTA 4M1WA 4E1BA 2D00A 2WWVD 3HEBA 4NDNE 2VEOA 4KDCA 4C03A 1QKJA 2QBYA 3NCHA 2DSNA 1B26A 1OZAA 2FQWA 3IPXA 4DC1A 3NNDA 3ZK8A 1UEIA 3IP8A 4B4VA 1H2BA 1K27A 3O21A 3BTUA 4H0CA 4N0PA 4RK5A 1CR6A 3QW2A 2E4UA 1ADBA 3TEMA 3ZZMA 4WPGA 1E1LA 2QL7A 3GK3A 4RMNA 3WSVA 3FMOB 4MWBA 5EY5B 5KNDD 3GV0A 3HUDA 5EUQB 3OWXA 3X2SA 4CRWB 1QFZA 4B8ZA 2H1FA 4FHCA 2XQIA 2RK4A 2UYGA 5IEJA 4L5IA 4EJMA 2H2DA 4Q05A 2FGJA 4J0KA 3C15C 1OB2A 4Q7EA 5EXSA 4BZPA 5AT1A 2NO5A 2CFSA 3GY0A 2DB3A 2R5NA 3DD5A 3VSDA 3CX6A 2VNKA 5JYDA 2PKYX 1B8VA 1DV1A 1GR1A 1HM5A 3THWA 4P5DA 2WINI 3IJ5A 4G26A 4UMEA 1ODCA 3GPDG 3C3EA 5K8VA 1X9HA 4IWYA 1DTWA 2QTMA 4BGUA 1KQGA 3RF7A 1P60A 1Q77A 3FR8A 1AZTA 2O6LA 2ODBA 2ZYSA 3FZNA 3NKVA 5D7BA 1JGTA 1BX3A 4KLAA 3JD3A 4EJSB 5EUBA 4Q34A 4BYMA 1R27A 3A7DA 3DBLB 2Q3BA 2Q50A 3I1YA 1WPXA 1F5SA 1ZY2A 3MT8A 3MW8A 3C7DB 5ALNA 4C43A 5MN4A 1XD8A 2E87A 2H2AA 2QM8A 3IERA 1VSTA 3WYCA 2JHAA 4ZGWA 3NHSA 1H2XA 3FCSB 1WB6A 4RORA 3V8VA 1AUXA 1HT0A 1XHLA 3R40A 4NZZA 3SKYA 2JAXA 1YUMA 1U1GA 3FAKA 3PFCA 5AK3A 1YFLA 2MDTA 4P9NA 1O6GA 2HSZA 4TUYA 4Q1CA 5KKNB 3RADC 3I9JA 3TM5A 4NMMA 2HU8A 1VDZA 2ORWA 1DRKA 4FTWA 2EKBA 1ZN2A 2X8LA 5B2EA 3E1GA 4QUEA 4EJSA 3LPAA 3O9VA 1SCIA 5AJWA 2PA3A 2GM9A 4EQ6A 4US1R 5LLTA 3PGMA 4DUZB 1H6BA 1NIPA 4BFZA 3VXKA 3WGJA 3ZY3A 1AVTA 5E4FA 4Q1FA 5G0WA 1C80A 2MMCA 3K0BA 5JIBA 2HF7A 4DC0A 2UVPA 1MCZA 4Q93A 2IHBA 1MMFB 3DFKA 1XUOA 2CEKA 2J6CA 2NV6A 4GAEA 1CFZA 4LAFA 3B1ZA 3RU7A 5HZKA 2XXAA 1XVVA 2ZUFA 3QG1A 2M2IA 1JUDA 1IZ0A 4U4AA 4ZQFA 5L3RA 5BWOA 1RKBA 2FDXA 3EXEA 5LMNB 1SHUX 2PKRA 1R1DA 1Y3CE 1UDBA 2W5UA 1NBWB 3RYHA 5ENZA 2VPQA 2G9QA 4O4IF 3GJRA 3AIMA 2WUFA 4YRAA 4YJHB 1JWLA 3LVFO 2JHPA 2X2PA 3E9NA 4NYMR 4Q3OA 1TEZA 1K5GA 4BKOA 2FYTA 4AJ2A 3QP9A 4IDBA 1UJ6A 1A69A 2D1SA 3I6MA 4FGSA 1HURA 4YP7A 1ZGGA 5JNLA 2OQVA 2QDKA 5F5LA 1W35A 5GINE 2WKSA 3RBVA 1XVUA 1UK7A 2WF5A 2XF8A 3V4SA 4XQGA 3URKA 3CURA 5A71A 3ZVNA 4LWPA 2CT8A 2IODA 3DEFA 1MGOA 3BJIC 4HWRA 1GL6A 1X2BA 2B1IA 5DTRA 4YXWA 5LZ2A 5CFRA 3KKLA 4KMSA 1E79D 1XJCA 1D6MA 1ZOLA 4Q1VA 1RPNA 4AZWA 2RHJA 5SYMA 3LWZA 2GPTA 1T25A 3ZG6A 2Q6LA 4ZYVA 1P62B 3R7AA 1KKUA 4ZCLA 3NHYA 3U4HA 4CM9A 4YECA 4RIEA 4HOYA 3U6KA 2NLOA 4HNQA 4BN5A 4WCVA 4ETWA 1E77A 2QRVB 4KQCA 3O31A 3AT1A 3PZRA 1CVIA 4JJ7A 1QM5A 3TLGB 1N3IA 3C6ZA 4PZZA 1IM2A 3UPUA 2YDXA 2GXQA 1EHIA 3BWVA 1T8YA 7REQA 2B2NA 1I33A 4RHTA 5FJIA 5KTYA 1CCWA 2JIZA 3N53A 4YUWA 3UYKA 4W5WA 5AM4A 4ZARA 4EHNA 2GN1A 2YZ7A 3A4YA 1K9VF 4L3OA 3V8MA 5JHGB 3LX4A 4KQ2A 3A3PA 5C7LO 3HZHA 2HV9A 4J07A 4V3CA 5AW1A 1V8ZA 1OLOA 4KEAA 4QYXA 4CQMD 1TXGA 1T5LA 1BWQA 2XMPA 3ZHQA 1G20A 3N2GA 2DBQA 5KYGA 2R9VA 4PZAA 2QLLA 2QYTA 1MN6A 4IINA 3RO7A 5WRFA 1EGMB 3R4VA 1I0LA 2ONJA 1EESA 4B82A 3KSDO 1J0DA 1XCJA 3TQIA 1R0ZA 4RD1A 2C5LA 4G5XA 1J5PA 1RM5A 1Y8QB 4JB3A 4WN9B 5D00A 1KC3A 1JZQA 5KJCA 1SXPA 2PUCA 2OAQ1 1P5ZB 3DP7A 3RS8A 4DLWA 3INTA 4LTMA 1I51A 2ORIA 2B5OA 3UK2A 3N2YA 5BR4A 1NNUA 4GKJB 2QJTA 3F4BA 1PN3A 2B4TO 3UVEA 5TLSA 3Q7PA 2OK7A 4D80A 5H68A 2E5WA 2XNDD 1WF3A 3BICA 3DEJA 3EWSA 4RAQA 4W9NC 4WK6A 4UOQA 2DFVA 2P9HA 4LS3A 2FSFA 2O1XA 3HCBA 4IQGA 1NDHA 3RYFA 1Z8DA 4XVCA 4C0QC 3WLHA 5JD4A 2A4KA 3HL4A 3I3OA 5LZ5A 3RSHA 3GT3A 3L8FA 1II0A 3CBGA 1OBHA 1NZJA 1T8SA 1U0TA 1UPCA 1ZCZA 3Q0IA 3L4SO 4HJXA 5I7AA 1O1YA 1VRCA 1D5WA 1NL3A 2R47A 3M5PA 4YJ2F 2O8BA 5CVEA 5EP2A 1HF3A 3AF3A 5ADHA 2FUNB 5BXQC 4KE7A 5FUXA 2I67A 2NNWB 2XMZA 4CL8A 5U1PA 1JP7A 4MS1B 1PGPA 2AG8A 2DJIA 2EYUA 5I4KA 4BRZA 5JI2E 3I73A 3U1BA 1W0CA 5FLXA 2F17A 2FGKA 2V7BA 2O2JA 2EW2A 3DBVO 4JJGA 3CKKA 5KCMA 3CNHA 1Q5PA 2DRIA 3EZYA 1JFRA 4EPXA 4KP7A 3IQXA 1JHVA 2QN1A 4B75A 2JI4A 1G64A 3G79A 5H9WA 3C87A 5JJ5A 4FB5A 1HZJA 4D43A 2JLBA 4F46A 4L16A 5FCDA 1AKQA 1KR2A 4MZXA 4Y0AA 4F3YA 4KQ9A 2JBWA 3HV2A 4HNSA 2D8MA 3F9IA 3G2IA 2YXPX 4MRRA 4AY6A 3W4KA 5MN6A 3PVCA 4OFXA 4JP3A 3ILVA 4RVDA 1YQTA 3DZIA 4X71A 1SA0A 2ZGVA 4BE7B 1DPFA 4JBGA 2C54A 1M8KA 5AW4A 2B83A 5EINA 5LQUA 3NWPA 4B4KA 4L9RA 4G0XA 1EUCB 1IY2A 5ALEA 3TVYA 3CRQA 5A7FA 3VJRA 2AZTA 4PLTA 4CZ2A 2PL5A 4NMHA 4QQFA 3FOEC 4ZYYA 3ZBQA 1Y3DE 1T36B 1JDBC 3EIXA 1AZSC 3RFTA 2HFJA 4NLLA 5DSTA 5IXJA 1O4VA 1V47A 2F8MA 4U9HS 4I5DA 4AN0A 2OEPA 4WXEA 3DQQA 5EP1A 2XCRB 5KTMA 3O4VA 4GRDA 5ADWA 1KAEA 1NQWA 1N1MA 3WWYA 1XZMA 2OFXA 1GD1O 2GK7A 2OM6A 1GITA 1OWNA 3G68A 5EE5B 4C29A 2P0EA 3NKLA 4QLOA 1B0AA 2V6FA 5EKTA 1K97A 1FP4B 1OFVA 3G2QA 4PLCA 4ZEOA 2Y1EA 3HLTA 3W6ZA 4XQ0A 2OLEA 5FPPA 3DO5A 4IG9A 1J9ZA 1U5AA 5IZ4A 1JH9A 3T4XA 5TE9A 1SY7A 3MWDA 1COZA 2NVBA 4KWIA 4QGAA 1HFWA 4ETIA 1VMKA 4MP6A 3T34A 1ODKA 5AI6A 1I4WA 3VH2A 1CZNA 1NPYA 1L8OA 1QV7A 5FWXB 2NU7B 2GLXA 2YZNA 4G67A 2PZBA 2LXNA 3QHQA 1N1EA 3F6PA 3JD0A 4IIGA 5EJ5A 4CHTA 1EIWA 2O2IA 1PLKA 1V2GA 1QH8A 2CSXA 4L50A 5I9NA 3SD7A 4PC7A 1K5HA 1MORA 1YL6A 5FNVF 1RQNA 1PSZA 2W2LA 3C7AA 4FBGA 3KAKA 4D9KA 3BSWA 3PYMA 4U3JB 4Y9SA 4OSOA 1EZ4A 3R4CA 4LYHA 4LNUA 4RGQA 5CLIA 2POCA 4S2EA 3UENA 5DB4A 2H00A 2QZSA 7ABPA 2O2GA 2ZT8A 4A3SA 3LPCA 3ZCUA 2Z57A 1YDEA 1YB7A 3KVYA 5AI0A 2YOFA 4WLNA 3KKQA 1ZI6A 5COAA 4AULA 2QAGA 3R76A 5JRDS 4C2AA 2JGLA 5TC4A 4ZMBA 3LYUA 3FPJA 4LJ8A 4FI3C 1ACLA 3RYCA 3MJRA 4HQNA 3LCJA 2R4TA 3BIWA 3ZDAA 3LYLA 2P40A 2VYCA 4Q82A 1DRVA 2IFTA 4GP6A 1H2AS 3WLOA 4YAIA 2AE1A 4FJ2A 1EKXA 2EW1A 1VLZA 4FFSA 5DCUA 3BIXA 3AFGA 1VGRA 2QT1A 2VTDA 5ITVA 2GN2A 3ISVA 2UZ1B 1EU1A 2CV1A 3RT9A 2ZUDA 2BTQA 3IS3A 5L3SA 5FTKA 3E7DA 2DUJA 2QPLA 2EHJA 3NRJA 1N0UA 5CM9C 5K09A 5DLDA 5CW2A 1Z2PX 3D4PA 5LXTB 4Y1GA 1U4NA 2D62A 4J1TA 5BY2A 1P3JA 1K2WA 4TT3A 3CLKA 1V96A 2F8LA 4RDXA 8MHTA 1SUWA 2BBOA 3GCWA 4R51A 3DTVA 1IZYA 3MPOA 4GKBA 5JAMA 2O59A 3WA6A 3H17A 4TSFA 3N2ZB 1G20E 1M2JA 3A7EA 5FOXA 1YCFA 4BB0A 1I80A 2P4SA 3E0XA 4XVUA 1A04A 2BR4A 1NNSA 5I3CA 4CDMA 1LKZA 1O94D 4TS1A 4YACA 1O6BA 2AOTB 3TI9A 5I4BA 1U3UA 3L49A 1W5EA 1JJVA 3FWPA 5DLPA 4S05A 3RDPA 3EGDB 2FG7C 2HC9A 4I08A 4IWXA 4O29A 2NO7A 4YWJA 5KAPA 1FUUA 2VJDA 3HR7A 4P35A 1HH4A 4A92A 2BGIA 2Q3MA 5DBEX 1VSQA 5HUHA 4Q9LA 3AR3A 3AP2A 3W2IA 3EPLA 2PX6A 5CNKA 1R8JA 4YRKA 2CNNA 1NLMA 3E9QA 3U80A 1M2NA 2I1LA 3S70A 4DXDA 1SQ5A 5JATA 1Y48E 1N8KA 3O6VA 4R4JA 1PK9A 2AYYA 1JHMA 1TYAE 2GD1O 3T7IA 2J41A 3OJCA 9ABPA 3WGHA 5HQJA 1U9YA 2JFPA 4J1SA 1M2HA 3V2UA 1J2YA 1CJUC 2CV0A 1P6UA 3G9QA 4O0LA 4EG5A 4RD2A 1QWOA 3ONWA 4WFIA 3L7DA 2H07A 1P39A 1HG1A 2CB9A 3PUJA 3WL3A 1QHXA 2MSLA 3E3LA 2JEZA 3T9CA 1QX3A 1TYCA 1WG8A 3THWB 2VHJA 4K0KB 1IXKA 2FDCA 5C1DA 1V6CA 3LC0A 4TRNA 3QVLA 1Y7HA 3PNLA 2PRJA 3C6YA 1P2BA 3D3NA 9GPBA 1UBHS 4X90A 1HETA 2GD6A 3HB5X 4I2NA 2X0KA 1AO0A 1J33A 1LEHA 3UUFA 2D5IA 4ZPJA 5T3YA 2VXYA 4FNMA 1GUBA 3UOAB 1QHGA 2CHQA 4CCAA 2C4HA 1IM5A 2HNBA 1JKMA 3KWLA 3C8ZA 2V96A 1C9JA 3MJHA 2G06A 4OQLA 1UJMA 3ZI7A 2QN2A 3KWFA 3HM9A 2O5CA 4L4UA 3MS4A 1S3IA 4XSVA 5KTRA 4LY3A 3W7AA 3U49A 2P2YA 1PQPA 3FVWA 3H05A 5AW8A 1KI6A 4ZVUA 1V3UA 4UUNA 2AB0A 1U1EA 3G5LA 1CY1A 4U2BA 3OCXA 1PJ4A 2XDQA 2Y8EA 3SZLA 3NFRA 3ND6A 4Q6WA 1BX0A 1TZKA 3JQBC 1U3CA 1HDCA 1GFZA 3QE0A 3OBIA 5TPZD 1QCYA 2BISA 1G6KA 1Q19A 2NOAA 2P9JA 2XYVA 2ZWIA 5DTQA 1PSWA 2IW3A 1G5IA 3B48A 2P5YA 2AUTA 2J9FA 1UJ4A 1MJHA 3RHFA 2Y71A 2Q3LA 3BGOS 3IEXA 3LQFA 3INYA 1EE9A 3PC6A 1ESCA 1XRMA 3ZKWB 3AV0B 5EZYF 3AF0A 1K98A 4ZCPA 2J07A 3ZLVA 1DOZA 4KWEA 3LV8A 5AK0A 3VVBA 2H4YA 4O2AA 3MTIA 3MXOA 5AHOA 4F7WA 2Q3EA 5A62A 3F97A 3FAZA 4BTLA 4XB2A 4FYYA 3LSTA 4NU8X 5BXYA 2E82A 1XJ0A 3BXOA 4LW8A 4RV9A 4J0HA 1KEPA 2H31A 4G9GA 4PAGA 5ABPA 3GCXA 4EHIA 2D06A 2QYSA 1EUDA 1VGQA 3K20A 3C16C 2CZQA 2DPGA 5G53C 1V1JA 5H80A 4BASA 3CNLA 2XSZD 1C3VA 3KVNA 2YASA 3RGWS 1I4DD 2J31A 5EMLA 5DZSA 1HFJA 3SP1A 2X0NA 3AU9A 1JWBB 4INAA 2R1VB 3HXLA 4E3WA 3ETDA 4QRDA 4BATA 3MBIA 1ODLA 1MD9A 2KI5A 1OFIA 5AWFC 3SFVA 1RRKA 5BW8A 4C08A 1YS9A 1CLUA 1YKFA 3D8TA 3NGXA 3N7UA 4OHXA 5ALSA 2ISCA 1RRCA 4NU5A 3R44A 3IBTA 1VIDA 4UM7A 2XMQA 3R6LA 2DPHA 2OE2A 4GMFA 2C2YA 1YBVA 3MEQA 1K4YA 2YHBA 4GMGA 5BYBA 2J5XA 5D6OA 3FN4A 1UZUA 3AEKA 3RVKA 3AXTA 5EP4A 1IWOA 1HDGO 5CX4A 1DIOB 2WTBA 2WWWA 4LGVA 3PFKA 5EKUA 3GUYA 2AX3A 4G01B 4F3KA 3EYAA 5KSWB 1BQ3A 4KYVA 1XL0A 1V4VA 4EHHA 3PJFA 3GLRA 1XFAA 3EF0A 3CLRC 1J5EB 4X1YB 1XZEA 4DR6B 4CT5A 2Q1SA 3LHFA 3NOQA 4Y6OA 1DI0A 3DW1X 4CMEC 7REQB 2ZRBA 5IJ9B 1N0IA 4Q37A 3P0JA 3AHFA 3GMTA 2H1CA 2FPWA 4HQRA 4RKFA 5ES3A 5JCOC 1DXQA 1O7JA 1ZCJA 1COWA 2IOFA 2O5VA 2PO7A 2VDWB 3QKSA 4QTXA 3V48A 5L40A 4REQA 2DERA 5EJ6A 2J3IA 3H19A 1OKKD 1RW4A 1G17A 2AT1A 1DMSA 1W47A 1ZJJA 1G20B 2CWDA 2JHFA 3N2GB 3QWIA 4HNHA 1JKXA 3C8HA 1J42A 2X7HA 1GQYA 2X7JA 4URWR 4QO8A 2O8EB 4TV9F 4J6FA 3AR2A 5JOQA 4MLZA 3EASA 2A5JA 2FFBA 3VZQA 4O59O 1D1TA 5CPBA 3H8VA 3O74A 1G7RA 2WWXA 1M2KA 3H2KA 2R7AA 3ESZA 9LDTA 2AK3A 3Q8KA 4ZEMA 2BC9A 3L5OA 1UMKA 2ZSFA 3FWHA 4MWZA 4HZUA 3KBBA 4IV5A 1E0AA 3AM4A 4PWZA 4ZVKA 3NHAA 4BCCA 3W5DA 2C84A 3VHQA 1AUOA 4JT8A 4N1AA 4BMDA 4AG5A 5LQMA 2FN3A 2VF8A 4G4SO 4WINA 2V6BA 4YEDA 4I1IA 3RYFB 5JPDA 1C7JA 4EB8A 2N1BA 3L8DA 1QF9A 5ECWA 3QVWA 1I9CA 4BLUA 4M7RA 4K9OA 1AK2A 2O20A 4O2BB 1GZHB 1RS0A 3DLCA 3FWYA 3GROA 3SC3A 1T15A 4US0R 2X6TA 4LSMA 2W6ID 1I1NA 2IDJA 2GNAA 3K0FA 4GU5A 4DCUA 2QE7D 3LYAA 3FGNA 4KCGA 4B0OA 5IXYA 3QFTA 3MJSA 2HA5A 3O2SB 4JSRA 3LT0A 4OLHA 4ABYA 4OO3A 3UATA 4P08A 1T5TA 3EIOA 2HD4A 1UMDA 4R3NA 1FQWA 3GOQA 4OVKA 4TMTA 1RLIA 1BW9B 2CZCA 4ESEA 3E05A 1UBFA 4IDPA 1FMJA 1O97D 2ON6A 2V6IA 5PNTA 3B82A 3GIDA 3DOIA 4JLBA 1J99A 3QLUA 2IWHA 1J49A 2AEJA 1Y33E 3BA1A 2QY6A 4KO2S 1J0EA 2ZR8A 2BKAA 1CXZA 1TOAA 1L6RA 3D59A 3DFFA 4GM1A 4PC1A 5HM6A 3ZWKA 2NSLA 3H0CA 2DQKA 1QDLB 2ZW9A 2GERA 4BAZA 4C3ZA 4EL5A 1YBHA 4LHVA 5FFNA 2A58A 1XLTC 4JV5B 1SA0B 2X42A 2I62A 3RASA 5L7TA 3A4TA 4YQZA 1C0LA 2AHRA 3HS3A 2YNMA 2P5UA 1U65A 4Q21A 3A31A 4B74A 2XD9A 4G5RA 1ADGA 1XIVA 2QRGA 3NW9A 3OQBA 3GFFA 2W43A 4MUHA 4W82A 2YYYA 1MB3A 1S01A 5EMJA 1CUJA 3FGZA 3RUDA 5CVUA 1V5WA 4DCPA 2YIJA 1NG9A 3GGSA 1FX0A 4HRYA 4IIFA 3ZQ6A 2IS4A 1SZJG 3PEUA 2HRZA 2XJ4A 5H82A 4J1QA 2NO6A 5JSUA 2X4IA 5FR2A 2FPGB 2BL4A 2ZAOA 1JBEA 2ZRQA 4KWCA 2EIXA 3UY4A 1CR0A 4UJ5A 3T7DA 4BB6A 2WYHA 4XX0A 2Z9DA 1VKNA 1B41A 1O9BA 3WS7A 3X44A 4D46A 2WQZA 3V7YA 3KHTA 2X4DA 1PNRA 3L82B 1VI5A 4EY8A 4GP7A 5CNIA 5D3ZA 5BYAA 4Z3KA 2VJLA 1Y4UA 4BNJA 5C5DA 1KWKA 2ZM5A 4HEA1 2XZLA 1CJSA 4MLPA 1QUEA 3T95A 1XZAA 4YJFB 4ENVA 4ZYZA 4JYZA 3JQ8B 4YCDA 3AOEC 4PGGA 1TZBA 2Z4RA 1AGYA 5I47A 1POWA 3HN6A 3KDAA 1E2EA 2Z4SA 1YDFA 4MJXA 3MC1A 1ECPA 4BNIA 1J56A 1DKOA 1VLJA 1ZH2A 1NI4B 1UPBA 2CKMA 5TEWA 4Q4DA 4EX6A 5KIAA 5DRTA 1JR2A 2CXUA 3HZZA 5AICA 2OYCA 4BEJA 1RJGA 1ISMA 1MAAA 4YLYA 4A36A 4FYVA 4B5LA 2A5LA 5EE3A 3MILA 3TNYA 4F2DA 1J2JA 1RMQA 1DU4A 3G2JA 4JSTA 1VIMA 4X6LA 4CV3A 2ZE6A 3M3DA 4BTVA 4C21A 2ZBRA 4B6RA 5JQWA 4AUKA 2IS2A 1XZCA 1Z2AA 1JYSA 1QORA 1XK7A 4LNUB 5DHSA 4DLAA 2C2OA 3Q4GA 1PVDA 2B6HA 1O8CA 2GK4A 3DWGA 4GBJA 2W2OA 2VNJA 4WLEA 4W5QA 2R97A 1DWOA 4M89A 4NCHA 1IN6A 2K2QB 4JLWA 3WYGA 2WWTA 1QYRA 2CLEB 2WIAA 2JB9A 3BB3A 3ZDBA 4XCQA 1ZXXA 4M0EA 1Q1ZA 4M49A 3F47A 4R5HA 5H0IA 1BGVA 1SU7A 3C3WA 4G2TA 3NM5A 3DJFA 3JQ7A 4XWAA 1ZR4A 5DGHA 1AD2A 1TW3A 4FYXA 2QA5A 2Y1XA 1NURA 1XVLA 2CF5A 3FY4A 4PLHA 4IIUA 1E6LA 2RGDA 2NT4A 1ZUD1 3ZOKA 1NLZA 4EPTA 3D6AA 4F85A 3QHPA 3QVVA 4N8SA 4HT3B 2HK9A 4BX0A 3NFYA 4BOYA 1L4UA 1P5RA 1XDDA 2QTFA 2J87A 2RGBA 2BTQB 2ZSUA 4MB6A 5EWJB 4DJDC 4DLLA 2JGNA 5L3SB 2WJPA 1DBIA 3W8EA 2CNKA 4HVCA 2NGRA 4MKFA 3WC4A 2Y76A 2WT9A 1BE1A 1N2CA 2V7QA 3H8SA 3IBGA 3ONFA 4DJTA 3S8YA 3HK2A 1FMCA 4UBIA 2CDAA 3B2QA 4AJNA 1R16A 1NY6A 1IU9A 3DTVB 4I4IA 4IO0A 1JJIA 4LEIA 2C04A 3SSNA 3VJKA 4CUZA 5KOYA 3KKZA 2GRJA 4LIPD 1DRUA 2YR0A 2WICA 3FSJX 2W0MA 4WA7A 4ZAYA 1P7PA 4JB0A 1W1UA 2VT2A 4WK2B 4Y2VA 5DULA 3ST7A 3BXFA 4MGZR 1GNRA 4UHHA 4KQFA 1QVAA 4DA7A 2R3SA 2QW0X 2ZJOA 3Q0EA 2JJ1D 4PQEA 1NYRA 2NTVA 3FZYA 4JEMA 4IQ8A 1X94A 2R87A 4UXHA 4HLUA 5J43A 1DBRA 2XDAA 1NXPA 3FWZA 1P4SA 3G2MA 5AKJA 5FUQA 2Q1WA 3DZFA 4NCJA 4ZANA 3EAGA 4LC9A 1Z6TA 2C7QA 1XU7A 1C7RA 4GM4A 4O4HA 2FP4A 1VRWA 1Y42X 1JN0A 2I6GA 3OCWA 1MU0A 4FDVA 1TU3A 2GCPA 3L0SA 4YCJA 2XNJA 4LK2A 4PPYA 1UCFA 2BI7A 4Z1MD 4KQXA 1YS4A 3F3SA 3QPDA 4DDVA 5DTJA 5FEUA 4EO7A 4MRVA 4N76A 2ILVA 2GZ1A 4JVLA 1OIWA 4PC6A 4PNPA 2CLIB 2Q7XA 3EUWA 3SQLA 2O48X 1UPXA 4UM9B 4JH0A 4ZKEA 3VO9A 1SVMA 5ILGA 1V11B 2ZIZA 4CQMB 2O3SA 3A6KA 5KNCA 2ADOA 3O1HB 5E1OA 2G07A 4XGNA 1B8NA 3BTSA 3LHIA 3N70A 4HGOA 1OXKB 2BJHA 4PO1A 4FS3A 4QULA 1DJNA 1YU9A 1HYQA 3E9MA 2HIGA 3DBHB 3JZMA 1JU9A 3PYXA 2IYVA 2FWIA 1O0CA 1QQAA 2FEMA 3RJ9A 5JDIA 5K20A 4XKJA 4GR9A 4IXTA 1XLUA 3L04A 4J0JA 3SLGA