4DRYA

The crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from rhizobium meliloti
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
248
structure length
241
Chain Sequence
RIALVTGGGTGVGRGIAQALSAEGYSVVITGRRPDVLDAAAGEIGGRTGNIVRAVVCDVGDPDQVAALFAAVRAEFARLDLLVNNAGSNVPPVPLEEVTFEQWNGIVAANLTGAFLCTQHAFRMMKAQTPRGGRIINNGSISAQTPRPNSAPYTATKHAITGLTKSTALDGRMHDIACGQIDIGNAATTGVLQANGEVAAEPTIPIEHIAEAVVYMASLPLSANVLTMTVMATRMPLVGRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from Rhizobium meliloti
rcsb
source organism Sinorhizobium meliloti
molecule tags Oxidoreductase
molecule keywords 3-oxoacyl-[acyl-carrier-protein] reductase
total genus 82
structure length 241
sequence length 248
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4dryA00
3DHNA 3VPXA 5THKA 4M54A 4ALJA 4E0BA 2QX7A 1DXYA 3QVWA 3NT2A 4YB8A 2DUUA 1R6DA 3F1KA 4NJMB 3H9QA 3RWBA 4BL5A 4DQUA 4Q9NA 4IDAA 4FFPA 2C54A 1Q0LA 4WGGA 3EYWA 1FF9A 2G0TA 1B8VA 3H9JA 4IQGA 4LGVA 3GQVA 1N92A 3EC7A 3WSVA 4XYMA 4F46A 1E1NA 1Y5MA 2PZKA 4NH4A 3SC4A 3RC1A 2O4CA 4B4VA 2C20A 1CRWG 5DCUA 1X15A 3N74A 1X7HA 2HSDA 2PZJA 4C7JA 4JQCA 3I6IA 3ABIA 1DC5A 1U7HA 4CM5A 3H6KA 1X7GA 2Y1OA 2DBRA 4AJEA 4A7PA 4TVOA 2JFHA 2P9CA 1KS9A 3K30A 4NDNE 1LDBA 4RGBA 3E82A 4Q3DA 5EN4A 4NR0A 1Y8QA 1EUZA 3O03A 5IZCC 4M55A 1YQXA 3PHJA 2X9GA 3CIFA 1IB6A 2YW9A 4HXYA 1DEHA 2QRKA 4LCEA 4FPXA 4UAGA 3AY3A 5BNFA 2A9FA 4BNVA 1DAPA 2QIOA 1O6ZA 1Y81A 4EBFA 1YL6A 4CLOB 4P4GA 2O3UA 4PZEA 5H82A 2ILTA 4R1UA 1XU7A 1HYHA 1PZEA 2D5AA 3MJSA 3ZWCA 4E5NA 5L9AA 3WQRA 4QFDA 1KEWA 1ML3A 1PGJA 4A03A 3EW7A 3CE6A 3ROPA 1E7QA 5BR7A 4XA8A 1ZJZA 1DC6A 3Q11A 1U1IA 1T2FA 1M75A 1WAMA 3H5RA 1DIAA 4WOJA 3GNQA 3I9JA 3HDHA 3OF2A 2VRCA 3VH4A 4NFYA 4QTZA 1N1GA 4WASA 3HDQA 3NTOA 3ZH2A 4ONEA 3D4PA 4XCVA 3ZNOA 3W8EA 5CDYA 5ITVA 1H6BA 3H7AA 5JAIA 3K31A 4MVJF 3G79A 4PZCA 1ZZEA 3NGXA 4BQPA 3A9WA 3RIHA 3KTDA 3OJOA 4TRJA 3ITKA 3D5QA 4KOAA 4QT0A 4J16A 2YHIA 1I2ZA 4PLWA 5TNXA 4BO6A 4LSWA 4AICA 4CUKA 1YDEA 2W2LA 1OBFO 3JQ8A 3VZSA 1Y8RA 4MIOA 4EUHA 4YWJA 1PJSA 5JYEA 4L76A 1UXJA 4YCAA 1VE9A 5K0ZA 3W4IA 1V3TA 3I4CA 1PR3A 3ZU5A 1JQBA 2B83A 3F3SA 1B3BA 2NADA 4R5MA 2Q2WA 4EJMA 3DBLB 3GDGA 1GEGA 4YR9A 3OH8A 4RVHA 5JAQA 4U6QA 3BA1A 1FK8A 4TZKA 3GFBA 4LVCA 3DMYA 4FGWA 4CQMA 3MWDB 3ULKA 2NV6A 4D44A 1LRJA 1GUYA 4FOSA 1OFGA 1I3KA 4M8SA 1LNQA 2B69A 4XQCA 4BNLA 4DMMA 3UUWA 4CMCA 1D4FA 2X9VA 5DDIP 4D0SA 3WYBA 3IJRA 1FDWA 3D7LA 3E48A 1I33A 2P68A 2AG8A 1WZIA 4HFNA 1VKOA 3QJ5A 3ANMA 4BO2A 2EW8A 2VRCD 4H16A 4AJ4A 1X0VA 3E9QA 5IDXA 1SC6A 3GGOA 3PZBA 1Z45A 1JKJA 2I6TA 3C3XA 4LRSB 4BKUA 4BNYA 2CF5A 2Q1TA 1NTOA 3L0DA 5EL0A 2DPHA 3PP8A 5CEFA 1FDSA 1U8XX 5GZ1A 2BFOA 1EUDA 1HSOA 4IXTA 2I3GA 4YRBA 1KERA 3B1FA 4PLYA 4BS9A 2ZTVA 4E21A 3ZWVA 1BGVA 5G2OA 3SJ7A 1LLUA 5JAMA 2FHSA 2UUOA 3QVSA 3L4SO 4CR8A 1WW8A 3M2PA 3E9MA 5B1YA 3AOEA 3GEMA 1GZ6A 3F5SA 1E7YA 1NFRA 3ZW8A 1FDUA 1TA4A 4UUMA 5IN4A 4AJLA 1T2CA 1NQAO 5CAEA 3C7AA 2YV2A 5EQFA 1HRDA 2GR9A 4A0SA 5JXWA 1NVTA 2Y1FA 4BNUA 3BMNA 3AUAA 4WCDA 2EGGA 1PJTA 2B4TO 5TT1A 2X9NA 4BO0A 2ZB3A 4FCCA 3LC1O 4PG4A 1AGNA 3LF1A 3ZV6A 3L6EA 2PGDA 4XR4A 2JL1A 1JW9B 1E3LA 2UYYA 4RF2A 1BXGB 2D3TA 5G0TA 1GFSA 5A04A 1H6CA 3DBHA 5ILOA 2E49A 3RAJA 3RJ5A 2HK9A 3H65A 3H5NA 3PTZA 4HP8A 3RUCA 3PWZA 3QIVA 3WYEA 3DZFA 3WGZA 2TMGA 2C29D 1EK5A 3HFSA 4AL4A 5I7SA 4QX6A 3ASVA 4YYZA 5I7FA 1KETA 3FNHA 1ULSA 4YAEA 2E48A 2E6UX 3WWZA 4Y6SA 5L40A 3K2EA 4RVFA 1KVSA 5ER6A 5U4QA 4CM9A 4HWKA 1UH5A 4CMJA 3JQFC 3BMOB 1N2SA 5EINA 1I24A 3R1IA 1U5AA 4Q39A 1LTHR 4YRDA 1C0IA 1P33A 5K6AA 4BNWA 4BMNA 2Q45A 1LSSA 3RROA 3SBOA 1VL8A 1Y9EA 5JO9A 3ZWYA 3I9KA 1IYZA 1LI4A 1W8DA 4DIBA 1G6KA 3GHHA 4RORA 3UW3A 2H1SA 3L4BA 3RI3A 3U0BA 3WLFA 1H5QA 4I1IA 3E18A 3QVXA 4INAA 2BGLA 1EDZA 4DXHA 1G0OA 3EZLA 4OL9A 5CEJA 2X0NA 3S55A 5T64A 4WJZA 5AXDA 5T8KC 4OO3A 1RM5A 3ZWWA 3IJPA 4E13A 1K3TA 1M76A 1PJCA 3DEYX 1DAOA 1XDWA 5A5EA 2Q1WA 1MG0A 1K6JA 3FHLA 3DHEA 1UR5A 1ZSVA 2GN4A 4NIMA 4TVBA 1JA9A 4M49A 5C7LO 4M1QA 1QXSA 3L77A 3GNTA 4WEQA 1TXGA 3T7CA 4AVYA 2NVBA 1N9GA 1SZJG 4YAIA 3DOOA 5FWNA 4W9NC 2OBYA 2QZ9A 4I08A 1Z82A 5CDGA 2HRBA 5FYDA 4BB6A 3S1LA 4AFNA 3K92A 4YRAA 5C37A 3L07A 3X2FA 4ESOA 3JCZA 1KOLA 4UVEA 5C7IO 1T1RA 4DBVO 1PQUA 1VKNA 3ZU2A 4GWGA 1A4UA 1AUPA 1WPQA 1X14A 2JD2A 1O9BA 4H7PA 4HY3A 4WNCA 3AI2A 2CDBA 4DL9A 3I4FA 3H4VA 4GH5A 3H3FA 4BGEA 4F3YA 3BMCB 2VUUA 3OEWA 1LRKA 3EZYA 4CMIB 1PL7A 2J6IA 4BNTA 3OECA 2O3RA 2RBEA 1I8TA 4RQUA 4OYRA 4ZQGA 5G4KB 1ENYA 3CXRA 1GDHA 2YV3A 5CPBA 3U5TA 1JKIA 3E5RA 2DBVO 2IEDA 3ZWBA 5A1TA 1HDGO 5CDSA 1M6HA 3JYNA 4LRTB 2EG9A 3L9XA 2YJZA 2X58A 5AYVA 3BAZA 3P2OA 5IG2A 4WK6A 4ALMA 3I9MA 4GSLA 3S2GA 3VTFA 5IZ4A 1WMBA 3HG7A 3DHYA 2AEMA 4I5FA 1NR7A 3PHHA 4GWKA 3IL2A 4AJKA 4CQMD 4BKOA 1UAYA 2Q4BA 2EWMA 2GF2A 5L3ZA 4PG6A 2FPIA 1E1KA 4PLGA 5MDHA 2QYTA 3OBBA 1YOVB 4CQMB 1C1XB 1QP8A 4MKRA 4FJ1A 1W6UA 4YAKA 5KJFA 1YJ8A 4LN1A 3B20A 3JQ7B 3K96A 3CMMA 4TRRA 1OI7A 4J1TA 2PA3A 2PV7A 1T2EA 4BGVA 1G0NA 1Z7BA 3FSRA 2RH8A 4DVJA 4Y6PA 3A4VA 4Z3KA 4TKMA 3ZW9A 4FGSA 2AE2A 2Q99A 4IGFA 1P74A 4K9DA 2HK7A 3H3JA 4CV3A 4ALKA 5KNLA 3D5TA 4D79A 1NQOA 2PZMA 3RBVA 1Z7EA 5EERA 2C5EA 4RCVA 1R4NB 4P22A 1HEUA 4WKGA 4XYGA 3FD8A 4XZ3A 2JKVA 1P1IA 3RQSA 3WX0A 3G0OA 4RL6A 3NJ4A 5F3RA 4K1LA 4KDEA 3EGOA 5L7TA 1B26A 1UDCA 5IXSA 3PDJA 1D8AA 4W7HA 1O95A 4KZPA 3I9LA 2VT2A 1LLDA 2BELA 2BRUA 4CV1A 6LDHA 1SB8A 2HMTA 2CDCA 4IMRA 1ZJYA 4E4YA 1O94A 3GVCA 2WE7A 3INTA 2HCTA 5KVSA 4BNNA 3DZIA 3QW2A 3RSHA 3TF5A 3F4LA 4W7IA 4A27A 2GYYA 2VZ9A 3GDOA 2GZ2A 3OIGA 2VWHA 3AI1A 2PKRA 3OJEA 5IF3A 3WFJA 1XGKA 1PZFA 3DOJA 5A5FA 1A7AA 4MKZA 1B7GO 2GN8A 4RVGA 5EMHA 1P3DA 3W8DA 4NK4A 3BIOA 4WLFA 1ISFA 1E7SA 4B8WA 5FEUA 4LVUA 4RVDA 1P1KA 1YGYA 4RLHA 3OHSX 4EITA 2ZB7A 1ZFNA 3KSZO 1YB5A 1ZEJA 3KB6A 4JJGA 4YJFA 3WBBA 3JQ9A 4IGEA 3B1JA 1J0XO 3TZQA 4IJVA 3ZHZA 3GG2A 4J43A 4BKRA 2ZTLA 1MA0A 2ZCUA 3F4BA 4ZVVA 3PQEA 3HDYA 1DSSG 1R37A 2JAPA 3AI3A 3FPCA 5IDWA 1HF3A 1DFGA 1F06A 1UXGA 2H63A 1HZZA 2OP1A 3LC2O 3NJ8A 5A3JA 3PI7A 1D1SA 1HDCA 3AOGA 2OMEA 4GVXA 2IYOA 1X7DA 5A03A 4L0QA 2O50A 5HA5A 5KIAA 2DBZA 3AOEC 4HBGA 5CG1A 2CVOA 2W8ZA 5JW6A 2BMAA 2X0IA 3DZKA 3RU7A 3PFFA 2QW8A 5L95A 4KP7A 3WNQA 1Q7CA 2AXQA 1OMOA 3P2YA 1GV0A 4CM1A 1Q2XA 2Y0CA 4GPD1 3GC6A 1FDTA 5C3MA 5L7WA 2NUAA 2OBNA 1LLQA 1OOEA 3FF4A 4IMPA 1JVBA 5BSFA 2E82A 1E7RA 1I32A 4GBJA 3DONA 3LVFO 2VUTA 3GR6A 3IKVA 1EMDA 1P1HA 4CMHA 3V2HA 3WYCA 4EZBA 5JDIA 3HADA 2FMUA 1SEPA 1T26A 1WMAA 4CMEA 3Q2IA 5TX7A 2B5VA 3UICA 1LDNA 2X6TA 2CUKA 3EY4A 3SXPA 1PL8A 2R6JA 1DFIA 2GSDA 4CMGA 1LLCA 5TJ9A 4UEJA 2PWZA 3JV7A 2UAGA 5A05A 2VNAA 1I2CA 4BVAA 2PGLA 3PYXA 4MPDA 1DRWA 3DMTC 3LDHA 4AJJA 1UDBA 4EJ6A 3AUTA 1E5QA 3VAZA 3T7EA 4YACA 2ZQZA 2X5KO 2E4AA 4J2HA 3GMSA 2HJSA 1Y9AA 4P38A 2IRWA 3FBGA 3OFSA 1OZAA 4CLHA 1VL6A 2Y0DA 4Z9XA 2RHCA 1XKQA 3MJ4A 2OO5A 4MVJM 2CZCA 3O26A 1U3VA 4GGOA 1Z73A 3CTMA 4N5LA 2CFCA 2GPTA 4GKVA 4MO2A 1M66A 2VHWA 4QO8A 3VZRA 1F8FA 3O38A 4R1NA 2PNFA 1ENOA 4GKBA 1Y8QB 2W98A 5GZ3A 1GAEO 2AMFA 3WGQA 1V9LA 2A35A 1AHIA 2DC1A 2F1KA 5DOVA 3MWEB 3PYLA 4TROA 4R3WA 4M86A 4XGNA 4MINA 1W73A 5FF9A 4CLOA 3S2IA 3TOXA 4ZA2A 3FNFA 3RC7A 4BO3A 4RZIA 5AQ1A 4A10A 2X86A 3F47A 1E3EA 5BQFA 1HXHA 4BNGA 2E37A 5JAZA 2I66A 2G5CA 3ZGYA 5JDCC 3NT4A 4RDIA 3MOGA 4WOKA 4HFJA 3BYZA 3E8XA 1KBZA 3HQ4O 2UVDA 1LX6A 3ICCA 3MEQA 1PJLA 2IZ0A 4GQAA 4OXNA 4RF5A 4FR5A 2DM6A 2OGUA 3ETDA 1TEHA 4U6SA 2IDZA 2Y0EA 1A9ZA 4QSMA 1VL0A 3W8FA 4XYLA 2X4GA 3R3SA 1PZGA 1GD1O 1F8GA 5IFLA 4GX1A 1JAXA 1BDBA 3SEFA 2O23A 2I65A 5HS4A 2NVUA 5DT9A 5DNAA 1QMGA 1BW9B 7MDHA 1ULUA 1QYCA 2AEFA 3KHUA 1LA2A 2SCUA 3CH6A 3ZHBA 4FFMA 3N7UA 3GZ4A 4OM8A 4PLCA 1PTJA 2DUWA 4YT4A 3DTYA 4TKLA 4E32A 2FZEA 3JQGA 2PY6A 4Z9FA 2IEBA 1HETA 4DGSA 2VYND 2YDYA 2PR2A 5BNTA 1B2LA 2DAPA 1X1TA 3D3EA 1NQTA 1QKIA 6ADHA 3ORFA 4IJUA 3I5MA 3RFXA 2W4QA 1Q0HA 1QR6A 4Z3DA 1ADCA 2Y66A 3G17A 3W4JA 3JQAA 3AJRA 3C85A 1GL3A 3F9IA 3PHLA 1T4BA 4S1VA 4XQEA 1PJQA 4HKTA 2PKQP 1UZNA 3I9OA 4IDEA 2PH3A 3DBVO 3HDJA 4BNIA 5KKCA 3L6DA 3PLRA 4GX2A 3TFQA 4NQZA 4DIFA 8LDHA 3W1VA 2DU8A 4HUJA 4IUYA 4DQXA 5BSHA 3AU8A 3S2FA 1C14A 1H2BA 1IHYA 1IZ0A 3CZRA 5HTOA 1Y5RA 1YL7A 5B4UA 3MOIA 3JD3A 1R66A 3RUFA 2NNLD 2JCVA 2JFGA 1SPXA 1NYTA 2IZ1A 3DR3A 5CDTA 5G4LA 2FPGA 2GLXA 1GY8A 1MFZA 1Z75A 3WGGA 2FRDA 1LDYA 1EDOA 3HB5X 1UXHA 4O59O 1PJ2A 1ZK3A 3KYDA 1NAHA 1LU9A 4RPJA 5GY7A 3VH1A 3MTGA 2JAHA 3Q0EA 5IJZA 3QWAA 4IQ8A 1NWCA 2PKQO 4C7KA 4IIUA 3EVTA 5EQDA 3AY6A 5DP2A 4ALIA 4BKQA 2Z95A 4ZN6A 3DL2A 5LC1A 4R9SA 2WJPA 2ZQYA 1NHGA 1IL0A 4EW6A 1HE3A 4JK3A 3U4HA 4R41A 4NBVA 3KVOA 1PJ4A 2R2GA 4TMFA 3JD2A 5H83A 5JFOA 1BXZA 3NTRA 2HRZA 2Q49A 4R01A 4TZTA 4UVGA 7ADHA 5HWSA 1G1AA 5L4NA 1CEQA 2C07A 5TT0A 1T1SA 3NDIA 3SX2A 5AOVA 3GF4A 1E3WA 2RCYA 2GRAA 2ZK7A 3P7MA 4J3FA 1ZW1A 3TOZA 4ND1A 3NEPX 4CMKA 5TGDA 1NPYA 3Q9UA 3PQFA 2OORA 1ZSYA 1E6WA 2B4RO 4IXWA 4FC7A 3G49A 3JQDA 2NACA 4FN4A 2B37A 4UUPA 5A02A 1XCBA 3MJCA 3LF2A 3VPFA 2AA3A 3NUGA 4FDAA 1MB4A 3FPLA 4NI5A 1NR1A 3RFVA 2H6EA 2X5OA 3K8ZA 3OETA 4N7RA 3U62A 1EVIA 2QQ5A 2G76A 1GUFA 4QXMA 4Z6KA 1QV6A 2VWGA 3ZDFA 1BVRA 4OGWA 1N1EA 4ZRMA 4BO1A 1MLDA 3DBRA 3PJDA 3WBFA 5DCYA 4XDZA 2NVWA 4DRYA 3KLPX 1LSJA 2NU6A 1I3LA 1GR0A 4OOEA 2VYVA 3GA0A 1J4AA 2X23A 1E6EA 1PS8A 3FBTA 3OJLA 4PN3A 2O4UX 3TDKA 4E5PA 1DIHA 2VZ8A 1E3IA 3IUPA 3KO8A 2EV9A 4B79A 1J5PA 3FWNA 3KZVA 3UKOA 3TJRA 3D0OA 2O3SA 3SLGA 5JNLA 1I10A 1PGQA 4DLBA 3IDSA 4OJNA 2HQ1A 3NDJA 1Z6ZA 1O8CA 3CEAA 3GG9A 3M2TA 3Q2KA 1YDWA 1ZK1A 1HLPA 3DZHA 4UUOA 4RF4A 4OIMA 5LCXA 4D7AA 2P4QA 3ZNQA 2EEZA 3MZ0A 5JSFA 3W4KA 4WCFB 4GVLA 3LC7O 4KTTE 2NLOA 3KLMX 1Y7TA 2BGMA 2GGSA 3C7CB 3JQBC 4CM8B 3V2UA 1XWFA 2V6GA 4KUGA 4MJLA 4MP6A 4XDYA 3DAFA 4CJXA 1PR9A 1I36A 1ZMOA 3PK0A 4R1TA 3UVEA 4NBRA 1P31A 3NV9A 4BKPA 2GN9A 1N5DA 3Q6IA 1ZVMA 3GUCA 1EQ2A 4ZQEA 3C7DB 4XKJA 4BV8A 4CMAA 2EERA 1BXKA 4XQ9A 1DC4A 4IDCA 1ZEMA 2CDAA 5DBGA 3RU9A 3VOSA 3H5AA 2ZB8A 4E5YA 1DC3A 4CR6A 2BI7A 3OQBA 4TWRA 3QA9A 3PEFA 4WNIA 3KYBA 4MVJD 4YXFA 3IQDB 1EEHA 5TQVA 1PL6A 4WEOA 4I9UA 1BMDA 3GVHA 1U3UA 3OJFA 4PCVA 1UDAA 2VYNA 5L4LA 1S7CA 1PSDA 3C8MA 3DZBA 2LDXA 4WCFC 2X5JO 1KVUA 1AXEA 1HE5A 2PD4A 1TI7A 2P2SA 3IP3A 5CPFA 3PJEA 4BIIA 4URFA 1BTOA 4E6PA 2X8LA 3PJFA 4IDFA 3D4OA 1MX3A 3BHJA 3HE3A 2GERA 3W6UA 2FZWA 1ZK2A 2IXBA 2C59A 3Q9NA 2DTEA 1E7WA 3EHEA 3BMQA 4UVIA 1ZSNA 2BFAA 1SB9A 1HDYA 4PRKA 3GVIA 1YBMA 2HUNA 3BTVA 1YWGO 1UP4A 1XELA 5JC1A 3EMKA 1SMKA 5EESA 2Q2VA 1ISGA 5BT9A 1E5LA 2WYWA 4J7CA 1XEAA 2VT3A 3H8VA 1PWXA 4YAJA 4XRGA 2ZYAA 3WXBA 3VPGA 4YAGA 2FY8A 2FR1A 1AXGA 4HFMA 3COSA 1U28A 4D3FA 3VVBA 5T6BA 4RJTA 2Y1GA 1YH3A 4ND3A 1ID1A 2Y67A 2Q50A 4CMBA 1UXKA 1IUKA 4MVJI 2GZ1A 3PDUA 4ZQHA 5A9SB 1ISMA 4I5GA 1BW9A 5G0UA 2ZKLA 4DPKA 5IAAA 1LSOA 2BD0A 1FJHA 4CLRA 2YFQA 4YJDA 2C2YA 4D42A 2A4KA 1HYEA 3ANLA 2VUSA 5EPOA 4BO9A 4G5HA 4PVCA 3JQ6A 1V3UA 3WQQA 3I3OA 3TPCA 4WLNA 1GU7A 4RQTA 2GCGA 1LC0A 4PLPA 2BFMA 4GMFA 5IXYA 2P9EA 3G1UA 4E5KA 4W6ZA 1HLDA 3S2EA 1ISJA 2BH9A 2PD3A 5JC8A 1R0SA 4I8XA 1HYGA 3ZCXA 3DC2A 2V65A 1A5ZA 3C1TA 2VN8A 1RM0A 2Q1UA 4W99A 4FIZA 2ZTMA 3GPIA 4RPHA 1NASA 5DN9A 4Y67A 4R51A 3NYWA 1VRWA 1R4MA 1YJQA 3ZHXA 1YVEI 5T57A 4NFHA 5ES3A 4BMSA 1ADGA 5EIOA 3OMLA 3F1LA 5LDHA 3ONEA 4BNKA 4YPOA 4MIEA 1AN9A 2NU8A 2EKPA 1TT5A 4E31A 1VM6A 4WLUA 1V35A 5JCXA 1TVEA 2GNAA 5JCJA 4PLFA 3BTSA 2X22A 3QY9A 4OXKA 4BB5A 5DP1A 3QQPA 2R00C 3UN1A 1PGPA 3KUXA 4OHUA 2ZB4A 2Z1NA 3EAGA 3HHPA 5KJEA 1LC3A 2B5WA 2YYYA 1DPGA 2D0IA 4OKNA 1U3TA 2Y1EA 3GZNA 4RPKA 1Q1NA 4NBUA 4XWYA 2WE8A 3MJVA 1HKUA 3PGXA 3E03A 4JROA 2VHVA 2BI8A 3HZZA 1I01A 4A5OA 3ZWXA 2VOJA 4IJWA 5JLAA 3KV3O 3PHGA 2ZJ1A 3LLVA 2JCXA 4CM4B 1B0AA 4YQYA 4IZHA 5DULA 4GX5A 3VZPA 5KVVA 5CHEA 4XGKA 4PVDA 3ZWOA 1EUCA 1P1JA 4NZ9A 2QRJA 2EJVA 1F17A 2X7HA 3TZ6A 2XXJA 2V7PA 3JD1A 2J3IA 3F46A 3PIIA 1E92A 1NFFA 2O3JA 4L73A 3GDFA 5HRUA 1SCUA 5KCZA 1BXGA 3AWDA 1ISIA 3ROMA 4OXYA 3CMCO 3HJAA 4II3A 4DWVA 4G65A 4FW8A 3GGGA 1UP6A 4D43A 2C2XA 2F00A 4ZU3A 1SNYA 4ITUA 3G1TA 4JBIA 1JU9A 1WP4A 3VH2A 1UZMA 4GLLA 2GD1O 4H15A 2DFDA 1K2WA 1MP0A 3OIDA 1P77A 3GMDA 4J9UE 1I2BA 4ZGWA 2BF7A 1GQQA 1LJ8A 3E5MA 2Y99A 3GK3A 4G2NA 3NT5A 3QVOA 4U0JA 4XX0A 1YRLA 5JCJD 1QRRA 3SLKA 2VNSA 4NBWA 3S8MA 2YUTA 3TN7A 2NVUB 3JQCA 3ZNPA 2NU7A 1J49A 5A06A 1EFLA 4KUHA 4BMVA 1GEEA 2EGHA 2RIRA 3BMQB 4LSMA 3WGOA 1R12A 1H94A 4K28A 1DLJA 5I7EA 5B4TA 1XLTA 3K6JA 1XSEA 2EKQA 3PPIA 1ZH8A 3GLQA 1QYVA 1DHRA 1EK6A 3IAHA 2ZIZA 4WE3A 3IOYA 3GZNB 3QHAA 4N18A 1MXHA 4BO7A 4NJMA 2CVZA 3BHIA 1VJ1A 2C7GA 4E5MA 1B3RA 1HE2A 3W6ZA 2OFPA 4EEZA 5IDQA 1BHSA 4LISA 1B14A 4KWHA 1JN0A 2UV8A 4GAEA 4D3DA 3TL3A 2EF1A 4PGFA 2FR8A 2YV1A 4L8VA 5T5QA 5JPIA 3P5SA 1L1FA 3NX4A 3MTJA 3NAQA 3L6OO 1UZLA 4CV2A 4MP3A 3VPSA 3DQPA 2Y68A 2AG5A 3KXDA 3FTPA 3LK7A 4UVHA 4EUEA 1X0XA 3RBXA 5JYDA 2C0CA 1X1EA 1U2GA 2FSSA 1U2DA 3JQ7A 4RVUA 1RPNA 4CUZA 2A92A 5CP8A 2R00A 4Z0TA 3WS7A 3INGA 4NNJA 2C7VA 4CMEC 3P19A 1GCOA 4X54A 3VPHA 5JO0A 3RCBA 4CQLB 1PZHA 3I1JA 4HX5A 1ZXBA 2J3HA 1WDKA 4I5DA 4OKIA 3WOHA 5U1PA 4L9RA 4YJHA 2NTNA 2PTGA 3QWHA 4CM9D 2POQX 3LLSA 3VKUA 1SOWA 3R6DA 1YO6A 1NHWA 2O3QA 2EHDA 3RJ9A 4GI2A 5L4SA 2NTJA 3GHYA 2YHUA 1E1LA 1EVJA 1OC4A 1PQPA 4GSKA 4WLEA 5TRTA 3ASUA 2WYVA 1R4MB 2B35A 3D3WA 3GN2A 5ICSA 1H9BA 4J0FA 2YFHA 3M6IA 4RPLA 1ZUD1 8ADHA 2YQ5A 3VZQA 4TRMA 3U49A 5HM8A 1E3JA 1ZIDA 3WTBA 3C24A 1YOVA 3I9NA 4IPTA 4KQXA 1C1XA 3AK4A 2WTBA 4E2ZA 4PLHA 2HLPA 4Q3EA 4AJ2A 1ZCJA 2PK3A 2BHLA 1F0YA 1Y6JA 5ENVA 1I3NA 3GGPA 3HFGA 3I83A 1IHXA 3PGJA 1HDZA 4YJFB 2XXBA 4O63O 4J2OA 3CINA 2J8ZA 4CM6A 4D46A 1IE3A 3JQ9C 1A72A 1DO8A 3ETEA 4FC6A 3WWYA 2FSVA 3PLNA 1SO8A 1Z74A 1HZJA 2DTDA 3EVNA 3IIEA 3OA2A 4PG5A 2WYUA 5J23A 1NNUA 2GASA 4CLDA 1V8BA 3LQFA 2Y1CA 4GLOA 1PGNA 3JTMA 3DOCA 3UOGA 1PWZA 4JLWA 1QYXA 3KM0A 4E3ZA 1VSVA 4WUVA 1FXSA 3G3EA 3U09A 4FFLA 1T25A 3EUWA 1IULA 1WDMA 4ZICA 1T2AA 1DIRA 2VTEA 5L7YA 2X0RA 4LCJA 3B1KA 4R1SA 4AJPA 1OAAA 4S3MA 3ZWMA 3VVCA 4YEDA 1LQUA 2NTVA 3OQ6A 3RKRA 5ILGA 3WGTA 2TMDA 4N5MA 4KUEA 4IDGA 3LSYA 1F12A 1ZK4A 4Q3BA 4D3SA 3E6AA 4J91A 2J3JA 3VDRA 2VZ0A 5F1KA 3RUEA 3I23A 3QWIA 1XA0A 3WNVA 3T4EA 9LDBA 4DIOA 3CZMA 2WM3A 1ZXLA 5ADHA 1I3MA 4M89A 3JD4A 3OSUA 4BO4A 1VLLA 1JVSA 1KC3A 2CMDA 5GZ6A 2O7QA 2JJYA 5H81A 1CQJA 1RYEA 2O3TA 5F1OA 4NU6A 4R9RA 1NVMB 3CUKA 4CL3A 3A06A 1PJBA 1QSGA 2I99A 3WTCA 2GZ3A 1ONNA 3BMOA 4L4XA 4A26A 2B4QA 4IS2A 3QVTA 1GCUA 5COBA 5THQA 4BNFA 4DLAA 3U9LA 1WNTA 1EBUA 4I9NA 1E6UA 2YY7A 3UGKA 3OIFA 1EBFA 2UUPA 1ADFA 1GUZA 3B70A 4PRLA 2RHRA 5FI3A 4BGUA 9LDTA 3ANNA 2G1UA 5TJHA 1CQIA 4FS3A 1I5RA 3KYDB 5TLSA 2Q3EA 3PQDA 3ONDA 3TL2A 3UXYA 4Y9DA 4DC0A 3T4XA 4ID9A 1GV1A 3FR8A 3WGYA 3PWKA 4AJHA 4DQVA 1WZEA 4IS3A 2DT5A 1DOHA 3O4RA 4IQ0A 4GGPA 2LDBA 3WIDA 1BRMA 2VHYA 3DMTA 4R3NA 2FPPA 3FI9A 4J7UA 4MVJE 3OM9A 1JWAB 1XQ6A 1V3VA 2B36A 1GTMA 1YB4A 3WLEA 2JD1A 1PX0A 1CDOA 3AUSA 3I6QA 1NP3A 2GN6A 4KMSA 4RPGA 3ZZNA 4G81A 3BZUA 1KEUA 3RBZA 4KTVE 3VH3A 1W4ZA 2VHZA 3LYLA 4GX0A 4XD2A 4WCFA 3V1YA 4WLVA 5JE8A 5G0VA 4MVJH 2D5CA 5TSDA 2OL4A 3NTQA 4JGBA 4QUKA 3QRWA 1NPTO 1PGOA 4CLEA 1ADBA 2O7SA 3TWOA 3VDQA 2VQ3A 1LBEA 1GZ3A 5KJCA 4DBZA 2GUGA 3AFNA 1YL5A 3TFOA 5AXAA 3FCOA 2DLDA 3AFMA 2AHRA 3F5QA 4QO7A 1VJTA 2XAAA 3M1LA 3DZGA 5F21A 2V6MA 5JY6A 4DMLA 4W9NA 4YBZA 4CM3A 4M87A 1QG6A 5G4KA 2EJWA 2GO1A 4PZDA 3FRJA 2VWQA 4FFRA 4J1NA 4QFCA 2Y93A 4E12A 5ITWA 2AQHA 3PRJA 3WDSA 1JWBB 3ITDA 5ER9A 1T4DA 3ON5A 1BDMA 3E9NA 2BGKA 2IYPA 4ALLA 3RD5A 4W4TA 1U3WA 4L74A 3RUHA 3PIDA 2Y1DA 4BNJA 1ENZA 5HS6A 1EVYA 2C5AA 4RDHA 1H2HA 4YTEA 5TIIA 5C5IA 1MC4A 1BVUA 2HMWA 3A28A 2UDPA 1YBAA 5AXBA 4J9VA 4YT2A 4NBTA 1LQTA 3LZ6A 2A94A 4UREA 2PZLA 1QORA 3NGLA 4W82A 1P44A 3NDRA 1KEPA 1Y8RB 4E2WA 3FNGA 1R0LA 1XIVA 3JQ8B 3JYOA 3SC6A 3WGHA 3TZCA 5L53A 1JDJA 3HN7A 3DTTA 3ZV4A 1B16A 2HMSA 1I0ZA 4ZRNA 3CSDA 3KEOA 3GRKA 3V8BA 3JSAA 4GL4A 4N54A 2BLLA 3DO5A 3RUIA 5KWEA 2VOEA 1KY5A 4ZQBA 1U4SA 1FDVA 4R16A 5DOZA 2QG4A 2J3KA 1ZBQA 2XF8A 3UF0A 3FWZA 3FNEA 4UVDA 5TC4A 4U0KA 2PD6A 3A1NA 4ND2A 1SAYA 3V1UA 3UCEA 1UJMA 2EXXA 2GDZA 3OJ0A 4YJHB 4U5QA 1E3WB 4BNXA 1GADO 1PS0A 4ZJUA 3SJUA 4Q3AA 1U9JA 1B8UA 1YXMA 1QLHA 3U4DA 4CPDA 1SBYA 4FB5A 4MVJG 3JYQA 4DLLA 1PJ3A 1D3AA 3ETGA 1M2WA 4EJ0A 4PLTA 4ALNA 1U5CA 2OZPA 4DYDA 2PFGA 1T2DA 3QWFA 5B4VA 4IJKA 1YB1A 3DFUA 4Y98A 2EW2A 3NRCA 4ZD6A 2CNBA 1P45A 1PU2A 4E2YA 4WECA 1H6DA 4XYEA 1CF2O 3GEDA 3GVPA 4WPGA 2I9PA 2X0JA 3ENNA 1S6YA 4OH1A 4J49A 4J0EA 2EKLA 3JQFA 2RH4A 4Y8VA 1YS4A 3D4NA 4E30A 1LEHA 1H93A 3BMNB 2OUIA 5JBIA 1O89A 1N7GA 3INRA 3AUUA 3RKUA 1A27A 2Q46A 3O8QA 5I9LA 3DFZA 1MG5A 5A3VA 1RM4A 1NQ5A 3ST7A 2Z5LA 3KETA 5I7VA 2CD9A 3AM5A 4CLRB 1CYDA 4XB2A 4AJNA 1RKXA 3QP9A 3GT0A 3VC7A 2WD7B 2VCYA 4BNHA 2AEJA 4J4HA 1J6UA 3DBRB 4IDDA 3Q3CA 3AU9A 3LT1A 1LDEA 2VTDA 2JHFA 1MUUA 3DBLA 3ZWPA 1EE9A 1XR3A 3UCFA 1K5HA 4DPMA 3ZNNA 5G0SA 3ZU4A 5I9MA 4EGFA 4Q3CA 4J1QA 5JDCA 4XJSA 1VJ0A 4FSHA 4DA9A 1E77A 4JNKA 4XB1A 5DZSA 2BFPA 4B4OA 2PLAA 3DDNA 1QLJA 3C1AA 1P1RA 2WEKA 4IY1A 3BMCA 1CERA 1EVZA 2NSDA 5BNIA 1H0KA 1KVTA 5KJ6A 1ISHA 1N7HA 3WB9A 4PG8A 4J6FA 3E1KA 4Y6RA 4JBHA 4OSPA 1L7EA 3HNPA 4E33A 4H3VA 5DBIA 1BSVA 1NPDA 1DBVO 2WWRA 4QEDA 3QWBA 3VHRA 1U4OA 4DTIA 3JQAD 1DLIA 1H6AA 5BSGA 2P9GA 4XRRA 1NX6A 4R54A 3WSWA 2FWMX 4UEKA 4Z9YA 2IODA 2PH5A 1XYGA 4N5NA 1EZ4A 1Q7BA 1R4NA 3LT4A 5F5NA 5KVQA 4FD3A 1LUAA 2HKIA 3RUDA 5JDIC 2J5RA 3WG9A 4PLZA 1D1TA 1DFHA 4Q3NA 2NM0A 3JQBA 2QYSA 4XYBA 3STHA 4D0RA 2H9IA 4JP3A 4YT5A 1YKFA 3WJ7A 4BQRA 3K9QO 1B8PA 4JX8A 1WXDA 4LMRA 1P0FA 4CQLA 2ZJ0A 4LMPA 3WJAA 2D8AA 3KBOA 1OC2A 2AQIA 1A7KA 5A9RA 2X1HA 4XQGA 4CODB 2Q4EA 3U4IA 2DPGA 4IM7A 2EP5A 2YDXA 1DIGA 3HUDA 3JYLA 1HDXA 1UAGA 5IDYA 1RJWA 3ADOA 4EDFA 4EYEA 2QRLA 4PIVA 1PIWA 1HDOA 1IPFA 1ONPA 3WICA 2FOIA 4B3IA 2O48X 5JY1A 4NJOA 5KVCA 3PHIA 4XR9A 3V5NA 1XG5A 3RUAA 4MVJA 3ZU3A 4BHTA 1K0UA 2G82A 3WMXA 4UUNA 1E3SA 4YT8A 1GPDG 3D3WB 2B0JA 3GVXA 4ZQFA 4BNMA 1PEDA 4B7XA 2XOXA 3ICPA 4OMUA 1C3VA 5AVOA 2ZCVA 4WLOA 2EIHA 3PJGA 3UH1A 2V6FA 5A4DA 4IDBA 1P9LA 3KOUA 3TNLA 4IIVA 3H9EO 1KC1A 2WDZA 3H9UA 3GAZA 4E2XA 1IY8A 2BKAA 1MC5A 2NQTA 2D4AA 5T67A 4HNHA 4UULA 1DDOA 1GYRA 1KY4A 1WWKA 1X13A 3LT0A 1ORRA 3H2SA 1NWHA 2ZTUA 1UP7A 3RFTA 4BOYA 1LDMA 3LT2A 4J1SA 3GUYA 1KIFA 1C0PA 5HBRA 1GPJA 4CMIA 4ND4A 5K9ZA 3AM4A 1T24A 1JKFA 4JN6B 2P5YA 5KKAA 1DB3A 4PG7A 4F6CA 3U3XA 5CEEA 1DRVA 1DJNA 3IP1A 3PZRA 2AQKA 5KOIA 2DVMA 2I76A 3V1TC 4RZHA 1WVGA 1KYQA 1IZ9A 1JAYA 3DB2A 4XGIA 3H9GA 2YZ7A 4FQ8A 1IPEA 1N8KA 4A2CA 1D7OA 2D2IA 4JBGA 2IZZA 3FR7A 1CIVA 1LRLA 2P91A 3ENKA 3IUSA 5LDGA 3V2GA 3MJTA 4PFJA 4OQZA 2YQ4A 3DWFA 2AQ8A 3ZWNA 1RM3A 4MIYA 5DF1A 5MGBA 3VTZA 2DBQA 5F5LA 5I8ZA 3O8QB 1KVQA 1MFPA 3BTOA 4NMHA 3GPDG 3WQSB 3L9WA 4JXKA 5ENDA 2G17A 3UAGA 3ZWAA 2HJRA 4JIGA 2W2KA 1C0LA 1SEVA 4FOOA 4IBOA 3FN4A 4O0LA 3ROKA 4B8ZA 1MGOA 1N9GB 1V6AA 2CSUA 2NQ8A 3CPSA 3K5PA 3ROQA 2W90A 4D41A 3HSKA 3BTUA 2RAFA 2I3AA 4JCOA 1FMCA 1O5IA 2Y05A 3A14A 1M67A 3ONFA 1P1FA 3H2ZA 3WIEA 1PQWA 2H5LA 5L51A 4OQYA 4CM7A 3IKTA 1QV7A 2CVQA 5JMWA 4D45A 3ADPA 2D59A 4IZIA 3TZHA 4KWIA 2OP0A 4K6FA 2D1YA 3ZV3A 2VWPA 1R15A 3AW9A 4UEOA 4B3HA 4DUPA 4BV9A 3K2BA 2AW5A 3QV1A 1LXCA 5COQA 3JYPA 4HNGA 1M6WA 3DZJA 2HMUA 2OHXA 1CJCA 1HWYA 4NK5A 5GMOA 2VHXA 2HMVA 4MKXA 3GFGA 3R3JA 5I8WA 3EK2A 3FTNA 1VPDA 2I67A 1QYDA 4Z0HO 4YVFA 2QZZA 1HL3A 2Q1SA 4YJGA 1DHTA 2V6BA 3X2EA 2Q2QA 4J90A 1ZKMA 1U7TA 3I52A 5G0WA 4BNZA 4R69A 2C82A 1VI2A 1E0DA 1WLYA 2IE0A 1WDLA 1NFQA 5F1PA 1VC2A 4NFSA 4II2A 4GMGA 4B4UA 4CR7A 3KRTA 4EEXA 1LDGA 5EJ2A 1R0KA 5TS3A 2NU9A 3IS3A 1B15A 1K6IA 2O2YA 3D1LA 3ZN2A 4BO8A 1QYWA 1R16A 1RWBA 2JCYA 5KJ1A 4ILKA 4NU5A 4KQWA 3TQHA 1A4IA 2IXAA 4CM8A 3CKYA 4A73A 3F6YA 4TQGA 4MDHA 1YBVA 1CWUA 1EE2A 4YA6A 4P8RA 1EQUA 2WD8A 3Q1LA 1JTVA 1ONOA 4F45A 4HV4A 1H9AA 3O9ZA 4CUJA 1DJQA 4YQZA 3AY7A 3IC5A 2P4HX 1YE3A 3HWRA 1F14A 2ET6A 3GOHA 4EI2A 3TZKA 2ZATA 4FBGA 1ZK0A 2HDHA 4LW8A 4B3JA 1DRUA 5B37A 4FFNA 1C0KA 3KYCA 4OOFA 2JFFA 2J5KA 3D64A 1KVRA 2P5UA 4NPCA 3DAPA 1ZO8A 4P4NA 3WMWA 3EDMA 3OEYA 5AXCA 4JJIA 1KEVA 1Q7GA 4YDRA 2OXIA 4O5OA 1Y1PA 3UCXA 2FR0A 3M1AA 4MOWA 5A9SA 4Z0PA 1C1DB 4OSOA 3PYMA 3DXFA 4NG5A 4XIJA 4XEHA 1NVGA 2EP7A 1LSUA 3TRIA 1GQYA 1ENPA 5IN5A 1GZ4A 1UXIA 1DIBA 1NM5A 4C4OA 4BO5A 3OP4A 1HSZA 3QE3A 3PXXA 5KTKA 2HO5A 4RVSA 4RLSA 4DPLA 4AJIA 1E1MA 3TSCA 2OOSA 3ZHYA 4RF3A 3UHAA 3BXXA 4CL8A 4HADA 4R68A 3GN1A 3AM3A 4AG3A 3WGIA 1I30A 5B12A 3GNSA 4KDFA 3LU1A 2ZYGA 2VRBA 4J4TA 3GEGA 4HFRA 4J4BA 2VYVD 1ZMTA 4B7UA 4ROSA 1ARZA 4L75A 3U4CA 5I9NA 4IINA 1HDRA 2QHXA 3ZI0A 4PLVA 4RV9A 3KSDO 3SVTA 3RASA 2WD7A 1YQDA 3OQ1A 3HN2A 1MV8A 1AHHA 5JS6A 2DKNA 4DREA 2W2LD 1MXFA 3B6ZA 1SOVA 3GAFA 1UUFA 2JHGA 5TF4A 1PS9A 3OICA 4OAQA 3WFIA 1ZNQO 5DCWA 5L45A 4RO0A 1A71A 4FJ0A 5JMPA 3R0IA 1Q0QA 1HT0A 1BWSA 3KYCB 1XQ1A 3JQEA 3WR5A 5COAA 4CLXA 4J7XA 4P4LA 3DBHB 4R4JA 1HTBA 3NKLA 1XU9A 3QSGA 1P0CA 1U8FO 4QECA 1RYDA 1TT5B 5IZCA 4TSKA 2YHIB 4K6CA 3BHMA 4LK3A 3UFXA 4MP8A 5FI5A 1NBOA 4K26A 1AE1A 3RC9A 4CM4A 1XHLA 4NHEA 1YQGA 1V0JA 4FFOA 3IMFA 2DQ4A 2HK8A 3QLJA 4I5EA 5DBFA 3PWSA 4L4SA 1NXQA 3HB4X 3MCVA 2NWQA 2HAEA 5U9CA 3OA0A 2DTXA 4EUFA 2J5QA 3K73O 5A9TA 3MJEA 2Z1MA 1EFKA 4DYVA 1O0SA 4BUCA 1YONA 1TT7A 2FN7A 5K6AC 2XPCA 4L4RA 1HE4A 4JP2A 4ND5A 2ZYDA 4AJOA 4I9HA 3RC2A 1A9YA 4YJGB 5ICMA 2CY0A 5FFFA 3GY0A 2PGJA 4R5HA 3L4BC 3GH3A 4B7CA 3RVDA 3GRPA 1VSUA 4O6VA 4BGIA 5CFZA 3PVZA 1IOLA 1L7DA 2AE1A 3DAGA 4QQRA 4MVJP 4XJTA 2JD0A 1TB4A 2HU2A 2O2SA 5T8KA 1W0CA 3PFWO 2I5PO 4CV0A 4U8GA 3JQAB 4DC1A 2W2KB 5BSEA 5C7OO 4JJFA 1BG6A 2FP4A 2WMDA 3VKVA 3ZV5A 1NAIA 1K6XA 1TLTA 2CF6A 2WSBA 3JD0A 3KSUA 3JQGB 2DFVA 3KEQA 3C1OA 3N58A 4XIYA 4AJ1A 4B4WA 4TRNA 1GQ2A 1CETA 4ZHSA 5CG2A 1GYPA 4F6LA 5CDUA 1JLLA 4U7WA 4FJ2A 1K89A 1GYQA 4O1MA 1C1DA 1E7MA
chains in the Genus database with same CATH superfamily
2QMEA 4ALJA 2CFOA 4RKFA 1DXYA 1F3LA 1RYYA 4AG5A 1O9HA 2B7CA 1J8DA 3E7FA 3NT2A 4GUAA 4V39A 2I4OA 5ALTA 5HG0A 5KSYA 2DETA 3R75A 3RWBA 3E9ZA 4N3CA 4TUYF 5C35A 4EA9A 5BR4A 4Q9NA 3VTAA 4FFPA 5HKKD 3M5DA 1Q0LA 5I7WA 4JYAB 2QMOA 1FF9A 1KAOA 2QAJA 3QPUA 3KKEA 5HGJA 1B8VA 3LKBA 4IQGA 4B81A 2GCOB 3GGSA 3SHTA 3GQVA 4LGCA 4ZAWA 4ZI7F 1N92A 2V45A 1NMZA 1PWEA 4D82A 4HGRA 1Y5MA 2XCTB 1V45E 1E9RA 3FLMA 2HGSA 4CI0B 1CEXA 3RC1A 5BR1A 4AUKA 4KREA 4W1SA 1JPVA 5DCUA 2PYZA 2AOXA 3PD1A 5CFMA 1X15A 5DB4A 3N74A 1EFRD 2HSDA 2W8BB 3O2NA 4EMTA 3DEIA 4WNAB 4HUTA 2G09A 3E70C 1W1WA 3HVIA 1U7HA 4RTRA 1XK6A 5K1ZA 1X7GA 4QGHA 1XVIA 4HNUA 2GPJA 1WU8A 2HRCA 2Q9BA 2JFHA 3AHJA 3C4QA 2DWUA 3IMCA 3N3BC 4RFLA 1Z37A 2AOVA 2HSJA 4QOIA 3E82A 5EN4A 1EJ6A 1XXLA 5D1HA 1XDUA 1G98A 1Y8QA 2I6XA 3UGTA 2ADOA 2ZJAA 3PHJA 4MULA 2I1LA 16PKA 2ZBFA 5FTNA 4E2FA 2VP9A 4EELA 4TS4A 1DEHA 4K81B 1VYUA 1EJ2A 3ZKAA 3HY4A 2BZGA 2A9FA 2PHZA 2PUTA 1DAPA 1FS6A 2Q8NA 1ZD2P 2QIOA 1O6ZA 4H0NA 3WL3A 1XEWX 3T3NA 1RNLA 2AFVA 4J8PA 4Y2UA 1WQ1R 4O4HF 2XJ4A 2B78A 5REQB 4N76A 2IYAA 4YPVA 1N3YA 1F9EA 1P8AA 4DSUA 5L9AA 3AFGA 4BP3A 4CF5A 1KEWA 3NANA 1TQDA 5J2TB 5CK4A 3EZGA 4PRYA 3RRFA 3UWMA 4FZJA 2ZROA 2IYNA 1U1IA 1VLJA 5CDTA 1FJ2A 4DA6A 1KZ1A 1OPRA 2PSDA 5HW0A 1JJIA 5FLKA 5GAJA 3WV4A 4B2PA 1QX3A 1N6LA 4IJMA 1S1MA 4NFYA 4DA0A 1C1YA 1N1GA 2QMQA 2W6ZA 4WASA 4LV5B 5ALJA 3ZH2A 3SI7A 2CXNA 3D4PA 5TE9A 4XCVA 3ZNOA 2VJLA 4QVGA 1IHDA 1FP4A 4GLBA 1TW3A 3G2QA 1R5BA 1B93A 4GI5A 4XXHA 5DLQC 1W5BA 1FFHA 4DLUA 5E38A 2EKBA 2GM9A 1T1GA 3A9WA 4QULA 3T5TA 4CT5A 3OJOA 4JP5A 3ITKA 3D5QA 3GRFA 3LY7A 1CIPA 5EIBC 4A5SA 1TRHA 3GBSA 1XRQA 1BOFA 1P2SA 1I2ZA 1W48A 4FZ3A 4W8GA 5TV2A 4BO6A 3W3AA 1GZ5A 4GXQA 4YMGA 2BEUA 1YDEA 4KWEA 3ZHRA 2QB5A 3BWDD 1TU4A 1G2OA 1FU7A 3VZSA 1JFSA 4LHEA 4HPWA 1U7WA 1Y3CE 1XPOA 1VBKA 4XPIA 5K0ZA 1OFTA 1KU0A 1V3TA 1Z0FA 2PZFA 3CVUA 3IIJA 1K8RA 1JQBA 3ZU5A 3SE7A 3F3SA 4GP7A 5HVNA 4K9LA 3QEMB 4HZIA 1QH1A 4R5MA 4XVUA 2Q6VA 2YV5A 1SKAA 3GDGA 5P8WA 3AILA 2IYQA 3A2LA 3C8DA 4M99A 3ZGXA 2XBMA 3H6GA 4U6QA 2RI1A 5L3RA 2AUMA 3A1FA 4AX8A 2IPXA 1JMYA 4LVCA 5CJ2A 4NAVA 3D9QX 5CRIA 2AR7A 1GARA 3P2KA 3WGMA 2W2QA 1LRJA 3HU3A 3LYUA 1HUQA 1XTSA 2PMEA 3U5ZB 4YMWA 1AA9A 1KH3A 3K9LA 4DMMA 3UUWA 5LD2B 4C01A 1D4FA 2BFDB 3TX6A 1C8VB 1N2BA 1CUUA 2C4HA 2JRCA 2AG8A 2YIMA 3OPXA 3U7GA 4HFNA 1TKAA 3A1VA 1UADA 3DT6A 2EQBA 1UIRA 3MUNA 4IVRA 1ML4A 2WKPA 1L5KA 3LW8A 4N0DA 4UFPA 4N8DA 4H16A 4W5QA 3DD5A 1X0VA 2IXEA 3DQQA 1GKYA 3E9QA 3HCWA 3M89A 3C48A 4FILA 3GGOA 3PZBA 5CYOA 3QFTA 5H68A 1U8ZA 2DEUA 3OPYA 1XZIA 4BNYA 2WWFA 1BN7A 3CKKA 4INJA 1GPBA 3AVOA 1U8XX 1S9DA 3ELYA 5D6NA 2BFOA 3P9IA 3R8CA 4TTJA 3HWX1 4M38A 4O2RA 4BS9A 2ZTVA 3GEHA 4UPVA 3EG9B 3ZE0B 4IXNA 4DR6B 2CD7A 4U7JA 3TGPA 4EY7A 1KSJA 1X1CA 1XXHA 2XKBA 3JZAA 2GJKA 2QGFA 3X1JA 1II8A 3ENQA 1PLLA 1KP2A 1DKRA 3E9MA 2QSUA 1W19A 4ENRA 4ZEVA 1T0UA 2JIBA 3C41J 4O2AB 5HKAA 4FWTA 2BW0A 2YJGA 1NFRA 3OIUA 1E94E 3KB1A 3O94A 1CZOA 1FDUA 1RHMA 1TA4A 5JS1A 4RAQA 4AJLA 3M83A 3I6BA 1LFDB 1ORHA 2I3DA 2IGTA 3GB9A 3LFUA 4IIDA 5IAJA 3UJCA 4E08A 5CAEA 3O3NB 3MQ4A 4DR2B 2J85A 4JUAA 3NWEA 1GAQA 4YX9A 1GG2A 3BMNA 1ZY2A 2IV3A 4BTVA 2EGGA 1QHFA 3DS8A 2RGNC 2FLWA 4GF5A 3UXEA 1OE0A 3HBFA 4CG1A 2YWJA 4FCCA 3LC1O 2ZYIA 4PG4A 1YR2A 2DKOA 3HGMA 3L6EA 2BHTA 2IYZA 3DW1X 1WP9A 4YAUA 5KTSA 1X1RA 2ZAMA 3EAFA 1E9VA 3QE4A 1VLVA 1YK1A 2HU7A 4RF2A 4OHXA 5JVDA 2I3ZA 3B3AA 4PR0A 4Q4AA 2QN6A 3RSCA 4E70A 1Y1TA 1W4LA 1E63A 3DBHA 4J76A 3RWOA 1QAOA 3HKCA 3W8RA 2E49A 3RAJA 4GP9A 4HP8A 3RPEA 4X41A 3WYEA 4X00A 4BN5A 1MAUA 2TMGA 2FX5A 1JH9A 1AS3A 1EK5A 1RQPA 5K0JA 4P31A 4C7XA 5I7SA 6REQA 3LG2A 3E8SA 3UHOA 5IVPA 3BS4A 2BV3A 1GRRA 4YYZA 3FNHA 3ZV7A 1ULSA 4D4LA 5AW0A 1H3NA 2E48A 3M9LA 2CHEA 3MFYA 2J0QA 4XDHA 5ER6A 1EP1B 2OO5C 1A9XB 2NYRA 4IF4A 4L51A 2FN3A 4M6WB 3ZVRA 1RXVA 1U63A 1KDPA 2AUTA 3T3HA 4TWJA 5CCDA 3AZPA 1VP9A 3IQIX 3SSNA 4F1WA 1TQHA 1YOBA 2H2AA 1O5TA 4KYVA 4MV9A 3V34A 1KWGA 2Q1XA 2E4VA 3LBHA 3M3HA 1D7AA 3BMOB 3LRTA 4BB0A 3JVUA 4MI1A 4DV1B 4NOJA 1KDVA 1U5AA 2JKZA 1OX6A 4YRDA 1LTHR 3B53X 3CA8A 5AW7A 5TPWB 3KG2A 1NVVR 3OY7A 4K88A 2V98A 4TKVA 4CWAA 3QE9Y 2WUWE 4FT2A 5T7BA 3KOYA 4YCLA 3AESA 3EVCA 2WPDD 2XRYA 3TB4A 4RORA 4O4IF 3UW3A 3E3NA 3MB8A 2XUHA 4M1EA 3U0BA 3EIUA 3TEJA 5JWRA 3K9WA 2LP4Y 3PKIA 3Q2OA 3WLFA 1H5QA 2O0JA 4WBSA 1Q6ZA 2NO0A 3NHAA 3SYKA 4RVOA 4DXHA 3BWEA 1IUOA 2X0NA 2J30A 5KBYA 1PR2A 5T8KC 5ALUA 3L8FA 2YOHA 4KVGA 1RM5A 3ZWWA 5FA8A 3PB3A 3BGVA 5E9AA 1M76A 1QV9A 3TQIA 2O2IA 2R68A 2PPVA 3N3AC 5A5EA 1TFUA 2Z56A 3DFKA 3GLIE 2C61A 3QFHA 2A78A 4M0KA 3IP5A 2GN4A 4TVBA 1KAMA 2D6FA 4M1QA 1QXSA 4TKZA 2X2OA 5I9IA 1K9SA 2O8NA 4WEQA 2AK3A 3T7CA 2P0YA 3PIRA 3X44A 4AVYA 1TAUA 1SZJG 5EZYB 1JILA 3SQDA 2WB2A 2HYIC 2I4LA 2O54A 1L7MA 3EODA 2O7VA 4BECA 1B4DA 2GEKA 3Q5EA 3VSBA 3GNLA 4JA2A 4I19A 1G20B 2G71A 3AR5A 4JH0A 4L78A 5FYDA 4RYLA 1PJ8A 4YRAA 1VJRA 2F3RA 2VBGA 3JCZA 1R8SA 4MTCA 1NBAA 4MKHA 4JI4B 3G9TA 5IANA 5B58C 1PQUA 4LF4B 1XNJA 2GFIA 3PCXA 1BE0A 3LD9A 3OCXA 5FPPA 1BHO1 2IA5A 3RU2A 2JD2A 1O9BA 1OIVA 4CF4A 5BXQC 4DV4B 3Q12A 2BBSA 3FGPA 1D6SA 2PSJA 4LS3A 5DYTA 5C0OE 4EECA 2VUUA 2V3WA 3UM9A 1LRKA 3ICWA 2X76A 3H5VA 4CMIB 4OPMA 2J6IA 3LJKA 3O4GA 1PBTA 1STOA 4KQJA 3E58A 4TSFD 1FRVA 4OYLA 3HCNA 5IH3A 3J81A 2BBOA 2WVJA 2IYLD 4DCSA 2YV3A 1ESZA 4JP8A 2RI0A 3L82B 1HFEL 5KNDA 1TC2A 2HW8A 1ZL2A 5DJ5A 2DBVO 5IKEA 1W1IA 3I12A 2ZAGA 3JYNA 5SYAA 4LRTB 1SU4A 1B2RA 2EG9A 3E84A 2IH2A 2FWJA 4BJ3A 4BBAA 5JANA 3BAZA 1L8LA 3BN3A 3GJSA 4F2PA 2IEYA 1Q91A 1DUVG 4G5SA 4OQFA 1A96A 3OFKA 4ALMA 3S2GA 2SICE 2XUPA 5H9WA 4YHHB 1TYDE 1G5RA 2YN0A 1CUCA 1H9CA 3A3PA 2FDXA 4KGDA 1NR7A 1BC5A 4BMOB 2J9RA 3KOWA 3I34X 3VU1A 5BUSA 3IL2A 7AT1A 4RNCA 5IWCA 3B2EA 3FHCB 2GAIA 2ZS9A 1Z4OA 5EWMA 3RRBA 3U49A 5EJFA 5L3ZA 4HNQA 1TD9A 2DQKA 4PLGA 4QYXA 1A1SA 1YOVB 3GRVA 2KLBA 4MKRA 5KJFA 1W6UA 3GGDA 1YJ8A 4OLJA 4EM6A 2P2NA 3I6MA 4NULA 2I9KA 2ZVQX 3PL1A 1AU9A 3ZHUA 1BKDR 5HFJA 1VA5A 2H4WA 1Q74A 4IJQA 3UMRA 1XNRB 1G0NA 1Z7BA 2OKCA 4B17A 3R7BA 4MQFA 1O6CA 4TKMA 3ZW9A 4W8HA 2X19A 5ALFA 3P71T 1XA3A 5CBPB 1PFYA 5DM60 2RFLA 5JRDS 2XCRB 1Z35A 4MR9A 3COJA 1B23P 1SCNE 3SXJA 4CDGA 3D5TA 4YLGA 3OU2A 2XY4A 1YE8A 2JJ1D 3HSYA 1FLNA 4RFSB 5LL6P 2QRPA 2CUNA 5EERA 4N7JA 1EXWA 3OF3A 4P22A 2Y9MB 3WI7A 5K5EA 2CNOA 3SF8A 3C4VA 4D4IA 1Q7EA 3CVOA 4FFDA 5AW3A 2I22A 1AK2A 1KYVA 1YRHA 1KBQA 3M6FA 4OY3A 2WWVD 3CV3A 3MT9A 1XLWA 3TBHA 2ORED 1L3BA 4XSGA 5BV8A 4K1LA 3UJ7A 5J4YA 1B26A 2VPYA 1P7PA 1UDCA 2BTOA 4LWOA 2IS4A 4NC9A 4Z9BA 4CTKA 4X62B 2PH7A 3H1TA 3BREA 3WNZA 2A0XA 3I9LA 4FUQA 1ZN9A 2HF7A 3DJFA 2ZUFA 2HBZA 5EGSA 3ZE7A 2AFIE 3UY4A 4DWOA 3DLIA 4M0DA 4MHTA 4MUAA 3MXTA 4MA5A 6LDHA 2HMTA 5E8RA 1ZJYA 4JL8A 1Q11A 1O94A 1U0HC 2C98A 3GVCA 5H4HA 3WNCA 3OZIA 3JAKA 3CZQA 3L0ZA 3EEOA 1XDSA 3DZIA 3QW2A 5K3CA 4N40A 4JU9A 4W7IA 5A6SA 2GBFA 3OZRA 2FHPA 2HWYA 4PIPA 2PKRA 3OJEA 4WCVA 4ZCPA 3PSHA 4JBLA 1T0HB 3EZ2A 1QGUA 1PZFA 5JZVA 3PGMA 3RSSA 1V1JA 4NYJQ 3PI6A 4AN0A 1P3DA 2PRJA 1CY1A 5AHWA 3S8EA 3MBIA 3BIOA 3ZC3A 1FFAA 1HNXB 1IONA 2PO7A 2FF5A 4M7RA 4YRTA 1N2CB 3Q8KA 4EPVA 4EG8A 5B1HA 1ZEJA 4QJ3A 4JJGA 4LSGA 4ZT7A 1I1OA 1CC1S 1RRMA 4FZRA 4PEVA 3JQ9A 3U4QA 5IUJC 1E2EA 1AQ6A 3U3ZA 4ZXFA 3ZHZA 2JH9A 4BKRA 3DT9A 2ZTLA 4ZGBA 2FUNB 3PQEA 3OFVA 2JAPA 3ZK7A 1JI0A 3UA4A 4O2BB 5FNVB 5IDWA 1HF3A 3QA3E 4N3AA 2RB5A 4AS3A 5A3JA 3FDFA 4Y2PA 3T5BA 4BC0A 1QVRA 3LHKA 5ALWA 5JQGF 4HDCA 5JH7F 4U3JB 2VDLB 3LNCA 1Z34A 3BXHA 4TTRA 2A5GA 2FMXA 1ZDMA 3IAAA 2IYOA 4GVXA 1X7DA 3VO9A 5A03A 4L0QA 2RGCA 3LQYA 1UMKA 2DBZA 4JBWA 4HBGA 1NZDA 4RMHA 4HN2A 4EUSA 2BMAA 2Z2XA 4OBWA 3RU7A 3P96A 4G5OA 4YUVA 1RWQA 2AI1A 3UWKA 3VISA 4ZDJA 4IH1A 2F3QA 3ER9A 1GUAA 3GT3A 1O96B 3PFCA 5IBPA 3S8YA 4ZVLA 4KQKA 3C4JA 3CZ9A 1HQDA 3HACA 1PFWA 1Q2XA 3FMFA 3DUFB 3IUNA 4NSNA 4F3TA 1V5WA 3RFCA 3ZOZA 2FF7A 1QGAA 1O94D 2GRJA 2QX4A 3BL5A 2W37A 3V4RA 3B6JA 3LVFO 3IKVA 3GR6A 1NQWA 1FTSA 2WSSD 1YRWA 3DM9B 4FI3C 3E0XA 4CMHA 4ARCA 2EWVA 3LY8A 3UFBA 3V2HA 4EZBA 5K3SA 5I4IA 4FBLA 3BJMA 1JFFA 5L3QB 3K35A 1IWBB 1SEPA 1T26A 2UVPB 3PNSA 3NV7A 3PA6A 3Q2IA 3E4DA 4CMEA 2RKBA 3RU3A 1LDNA 4LV6A 5B5SA 2GRUA 3FE2A 2R6JA 5A5VA 2XI4A 2BCJQ 1DFIA 2QR2A 2YC2C 3L7JA 1KTIA 1J9GA 1QGED 1VHDA 3O9MA 4M98A 3V4SA 3R0VA 1LLCA 2RGBA 3ZWQA 4CMGA 5TJ9A 5KYXA 4UEJA 2PWZA 3JV7A 1TE2A 4TXHA 3R9XA 3CURA 3F97A 3GRRA 2VH2A 3OLXA 2WYHA 3FUTA 1UDBA 4MMXB 3VAZA 1N3LA 4YACA 2ZQZA 4W5RA 3CY6A 3QPCA 4B85A 3GMSA 4HQ0A 4P38A 2RGEA 3LKDA 4D4GA 5BT8A 4UQLA 3EXEA 4MDYA 5AFSA 2H1FA 4REOA 5HYVA 3TM4A 3GJ7A 3NBYC 3PC3A 2BSXA 2CZCA 1FVFA 1XTVA 3CTMA 4H7FA 4N5LA 5IK2D 5DFAA 4AF7A 4EVRA 5K8UA 5HUQA 4R83A 3LHSA 1VG8A 2I78A 2FCAA 3HKDB 1F8FA 3F8TA 3EQZA 4RVCA 1DEOA 3Q40A 4DC9A 4R71A 4DB4A 4AC9A 2QQFA 4GKBA 1BMFA 3IVGA 5GZ3A 1GAEO 2AMFA 3WGQA 4DN6A 1V9LA 2XITA 2P7HA 3C8ZA 4I50A 1GPWB 2XB8A 2I8CA 2XXAA 3M6XA 3PYLA 2GEDA 3MWLA 5H02A 4CKWB 1WMEA 3SIXA 2NO9A 2VDWB 2ZIVB 2X4DA 5JD3A 5EJMA 2IF2A 3PXCX 2VK2A 1SG9A 4BN0A 5HK8A 1HMPA 1OZ0A 5ICEA 3F47A 2O8DA 1E3EA 3EQ8A 4DLSA 4JELA 2Z98A 3BXFA 3K8OE 2EFDB 3EIQA 4MRMA 1TYAE 2I66A 5FULA 3O4VA 4BNGA 5JAZA 3LT5A 2IUUA 3NT4A 4RDIA 3DLBA 4D9JA 1T8TA 2PRIA 2XVXA 3AV3A 3BD9A 3E81A 4RNDB 3U81A 4GDFA 2QENA 1FMFA 3QTBA 4ZCIA 4LBYA 3FW1A 3EFOA 1KBZA 1NXPA 3LUPA 3PUWA 1LX6A 1S2OA 3IR6A 1PJLA 2IZ0A 4Q34A 2FE4A 1LBTA 1ZMBA 4OHMA 3AM1A 1TECE 2FZ4A 4P7KA 4U6SA 1EFTA 1N7IA 2JZCA 1VL0A 3W8FA 2WINI 2X4GA 3R3SA 3GV0A 4MW9A 1UQTA 3FCXA 3RK0A 5HPYB 5LIPA 5LDDC 1EJBA 4U63A 2I65A 5HS4A 4RMIA 5DT9A 5DNAA 1BW9B 1TGYA 1WUKS 1YR3A 2D54A 1QYCA 2J0EA 2IEIA 1R7RA 1JDVA 1ZXXA 2J07A 3COWA 2GHRA 4OHFA 3ZHBA 2EF0A 5E6SB 3MGBA 3GZ4A 1YZFA 3QFSA 1R74A 1PTJA 1U0SY 3LH5A 4KV7A 1UKEA 2AMVA 3IAS6 3MB5A 3UOWA 1PUJA 2DUWA 2TS1A 4MWGA 4MVWA 3JALB 1XZAA 3EDOA 2FZEA 1Y63A 1I4DD 4HNRA 5JPCA 2P4UA 3HJUA 4O1HA 1GNSA 1YCGA 1J56A 1U1CA 5JBIA 2N46A 3ERCA 4R2WA 4G9EA 4YFVA 4RLFA 4IJUA 4RSGA 4E94A 1U90A 3U3MA 1XRSB 1FXWA 4Z3DA 2Y66A 5EIBD 4O4LB 1ZD9A 3DULA 4RK4A 5FBVB 1K6EA 1JL3A 3HO8A 2GM3A 3JQAA 4I81A 4LRUA 4LYEA 3VSDA 3WWPA 2E6KA 1O95D 3MWKA 1VG1A 4LKRA 1ST2A 1SBZA 5TY0A 1BD3A 2BR4A 1H0RA 2PH3A 3DBVO 5AK5A 2QVBA 3KYJB 5F7XA 1OFHA 5DI3B 4CKEA 1IK6A 4JJ8A 2BY4A 1YZGA 1DINA 1SR8A 3NNNA 3TRFA 1THTA 3GLGB 3TD6A 2V7VA 3N2KA 5BSHA 1DTWA 4WAUA 5DM4A 1AC5A 1GVHA 2IOFK 4FONA 4WKCA 3UK7A 1PWHA 1OFUA 4ETMA 1VYHA 2WTEA 2GMWA 3F67A 1AKQA 3FPHA 3UJ9A 2COEA 3CZRA 3RSOA 3QLEA 3VJMA 3MOIA 1KI9A 1M6VB 1P1CA 1V9SA 4M7PA 4DNPA 3A4IA 4ZKDA 2PSEA 1E4VA 1R1DA 5K4AA 2JFGA 1SPXA 3DBOB 4LJSA 1NBIA 1RKQA 1II9A 1YR6A 2GLXA 4AG6A 1YHZA 4G85A 2Q6TA 4LXGA 5D86A 2PKCA 3R40A 4E5SA 1IATA 3WLAA 3KSRA 4BLWA 1P8JA 4NMMA 4O59O 1ZK3A 3GJ3A 3L18A 3JAWB 3TLMA 3VH1A 2RE8A 5JTUA 4A15A 2JAHA 3QWAA 3KQQA 1FRFS 4G2TA 3VR6D 1JHAA 3EVTA 3AY6A 2ODEA 4NEQA 4ALIA 4ETWA 4ZN6A 5LQUA 5LC1A 2DH6A 4F8JA 4ZVPA 2WJPA 4X8LA 2H1CA 3T3OA 1IL0A 3PUKA 4UHKA 1W35A 5HGXA 3N05A 4INPA 2HX1A 5FL3A 3U4HA 3GFQA 1DQSA 1HORA 1ODJA 1EE1A 2FW7A 2Q9CA 1NBMA 2IT1A 3KR1A 4NBVA 2FRXA 5JFOA 4TMFA 1FY2A 5H83A 2FUCA 4LDQA 4MTLA 2Q49A 1Q14A 3D8TA 1XC7A 2AWNA 2OQ2A 1MAHA 1F4LA 5HWSA 5I4BA 2NP6A 2Z5FA 1T1SA 3A6PC 1V1RA 1JHYA 3W5SA 2EP8A 1WR8A 4FCWA 2L82A 4NH0A 4G0QA 4P7JA 1AUOA 4RABA 1W0JD 3R0ZA 1GKLA 3OO0A 3NEPX 5BVHA 1NPYA 4LJ6A 2WW8A 2BM9A 2OORA 4BXOA 1FSSA 2GETA 4HMOA 5K0TA 1E0KA 4RE5A 2YHBA 1E6WA 1LBQA 4HUQB 3STWA 3TR6A 3G49A 1S2GA 1UCFA 1Y9DA 2B37A 4QRIA 3PBKA 3S4YA 2HR1A 1W0KA 5A02A 1MRZA 1QE5A 3WKDA 2IHUA 2R6DA 3KKKA 5CIQA 3LF2A 5AJYA 1MW8X 2FRVA 1MABA 1NONA 2BGTA 3B7GA 2AA3A 3FM9A 5FA5A 1P2DA 2VF7A 3KE9A 2CL5A 3VNSA 2HFKA 4NZPA 2GTIA 4NI5A 1NR1A 1QB7A 2BBWA 1RTTA 3K20A 2H6EA 4MAFA 4KVZA 1JEQA 1BYUA 4NCJA 4Q1DA 4U2FA 2V6IA 5E9JA 1X9GA 2G76A 1GUFA 2H0RA 4DMGA 4PCAA 4PSCA 2RGUA 4P7GA 4IIJF 2Y1LA 4RD2A 2GK4A 2V7UA 1QMPA 3ZHSA 1BVRA 4OGWA 1H65A 1N1EA 5FAKA 2I2DA 3DMGA 3PJDA 3WBFA 4F1JA 2ACVA 4NU8X 4DRYA 2J0SA 1I7NA 4TYPA 3UMJA 2WIKA 5J58A 5AVUA 1I3LA 2IOYA 1GR0A 3AEKB 4Z86A 1AIPA 3GA0A 1J4AA 3TO5A 2EJBA 3K8QA 1DAIA 4DOMA 5K51A 4EMUA 4MS1A 2O4UX 1BGWA 2CNWA 1MB0A 2MSEB 5K4HA 1DIHA 2YYSA 1E3IA 2VZ8A 3KO8A 2CCKA 2EV9A 4WN3A 4NCAA 3FMOB 3FWNA 2CVPA 1MOSA 3H1BA 3OEHD 2O52A 5GVSA 4E14A 5BN5B 3HPQA 3D0OA 2O3SA 2YWBA 1J7JA 1PAUA 3AEUB 3R44A 1T6NA 2NU8A 1I10A 1Z7GA 3AESB 3UBTA 5EXDA 2WPNA 3DH0A 1XZQA 2I6SA 3TJMA 5CT4A 4N0MA 1FFXA 4R2HA 3GOQA 1ZK1A 4V03A 1HLPA 5EVCA 1YQ9A 4OIMA 4D81A 3T9CA 4AZWA 2P4QA 2NG1A 4ZEWA 1EXMA 2EEZA 3ZNQA 5HZHA 3M9XA 4U2DA 4G5GA 1SCUB 4GVLA 4PQGA 2MYUA 2PUCA 1NL3A 3ND9A 1V8ZA 4PS1A 4D99A 3FPKA 4I6JA 2OWEA 3KT0A 3DE5X 3VYUB 3LWNA 1JIIA 2Y6UA 1SUAA 4PXSA 3V2UA 4Z7OB 3O4JA 1FOEB 3EVFA 4AMGA 5LLDA 3JAKB 3V7NA 4C0JA 2Y9PB 2GYWA 2GFHA 5CFQA 1QP4A 3ACBA 3LP6A 3UVEA 5CCEA 3HTXA 5JH7B 2XWPA 1P31A 1LS6A 1RYHA 5I4CA 1SUWA 4G0UA 5BSTA 3Q6IA 1MTZA 3DF9A 4JEIA 4UUBA 1OR8A 3S5JA 2QUBA 4LF6B 2UVPA 4ZQEA 2QBYA 2VPWA 2C4KA 3IDAA 4HGPA 1POXA 3LA6A 4CMAA 1WEKA 1KY3A 4UM9B 4FE7A 3UJHA 1DC4A 4U9UA 2V8BA 5D5PA 4CF7A 5DBGA 1H1LA 1LVHA 2HPVA 1PVOA 4E5YA 3U6KA 2JCBA 1J1UA 3O84A 5F2EA 3A1UA 1YT5A 5DK6A 5IVIA 3FDIA 3FKQA 2VZLA 3R9XB 2G8NA 2WG0A 3HH8A 3PEFA 4NCIA 1EDBA 4WNIA 5H0IA 3LNTA 3PE3A 3RS9A 3ZUGA 1YS6A 2OY0A 2PVCA 2R751 5BNZA 1ZCZA 3FYUA 1FYDA 2UYCA 2V5VA 1NJGA 3JVDA 4NMWA 1CP3A 4P83A 5TQVA 4C6TB 5I4KA 2FPXA 3OJFA 3WDKA 4MV7A 4MWZA 3L6CA 1LV8A 4TV9F 5K0NA 1DT5A 4X92A 3C8MA 1M6VA 4UM8B 2IYVA 3X1WA 2IPLA 3MJFA 4PSVA 3TSOA 3BSFA 1AXEA 1HE5A 3VV3A 4ZOLF 3A6LA 2AJBA 3HJGA 1JAZA 1JNXX 1UFQA 2I6UA 1DKPA 1R88A 1QIHA 1Y8AA 2X2FA 3JPYA 1LY1A 3P9PA 4E6PA 1EFPA 1ICIA 1XQ9A 1MX3A 4Z4IA 5EI5A 3CW2A 5K3DA 2GERA 2ZIXB 3W6UA 3CSUA 3Q9NA 4IZOA 4D4MA 4F7DA 1RLTA 1ZD4A 1Z6AA 3D2AA 3OX2A 3BMQA 4YREA 1JG4A 4UVIA 2DR2A 3GZTB 1T9DA 3S70A 2PKYX 3QXGA 3QUCA 4MYRA 4MLDA 3RC3A 4ZI3A 3CCFA 2W0MA 1YWGO 1IMJA 3C6YA 3H2BA 3A37A 3PENA 4X8OA 2WJHA 5EESA 2DHRA 4RKQA 5EKTA 5EE1A 2A5YB 1YHYA 3DA8A 1ISGA 1ESNA 5EZQA 5SY4A 1GNLA 4JLMA 2WYWA 4RWZA 4YJ3B 3V6LA 4X65B 4CEIB 3H8VA 4RD4A 3QTLA 3EPKA 1Y1QA 3FJYA 1GLNA 3LDAA 4TMWA 3SM9A 4BBZA 4D5EA 3DR5A 3WXBA 4F60A 2Y6VA 2I2FA 4JMLA 1XTJA 1MEJA 2WKSA 4X1YA 4BPBA 4RJTA 4E5VA 3Q7TA 2G28A 2XA2A 3C15C 3R3HA 5CT5A 4HRAA 4MYHA 4D9GA 3QGMA 3ADKA 3SF0A 1A8UA 3VR5D 1D07A 2GZ1A 2O06A 4QEZA 2FG5A 3MLAA 5SZKB 2JJQA 4I5GA 1BW9A 3GP3A 5G0UA 3D1JA 2BD0A 2FX2A 1FJHA 2ZW9A 2AOUB 4L85A 4B31A 1U9CA 2R6GA 1H4SA 2AB0A 1UDRA 2C2YA 3LMKA 4Q01A 3FZNA 2AZMA 3JZFA 3VC3A 4DBLC 1J24A 2EG5A 3ANLA 4D5GA 2HWKA 3CNOA 1QTIA 1WBJB 3PA8A 2ZOSA 4XWGA 5CIWA 4BO9A 4OX9Y 2XNSA 4PVCA 4ZO8A 4M53A 4L6AA 1GZUA 4AY5A 2O2JA 1IQPA 3QPBA 1OTYA 1Y9ZA 2Q5CA 3QJYA 1EP3B 4RQTA 3PRYA 4LFBB 4P34A 3C6BA 4A0FA 1LC0A 3NBUA 4TUYA 1M9NA 4DUGA 5IXYA 1JF8A 4RZSA 4FK8A 3TLBA 1HLDA 3UXMA 1ISJA 4EUNA 2VVTA 1GAXA 2AJTA 2GVZC 1YA8A 5JC8A 3PLAE 2W00A 4E1BA 2QPOA 3ZCXA 2QD3A 3JWJA 1CQIB 4FDTA 1OX4B 3NTXA 2XUZA 3B7PA 4ZI7A 3CLRC 1G8AA 4AMZA 4CKWA 4FIZA 3DKKA 1Q3TA 1MOPA 2IEAA 3L7LA 1GPYA 2ZBDA 3HI4A 5DYIA 4HF7A 2FEKA 3QW4B 1VRWA 3SHFA 1R4MA 1UODA 4FHZA 1RLJA 2H00A 2Z58A 4NFHA 1Q6YA 2Y1WA 1V3QE 1IM5A 3E05A 1I6KA 3OMLA 3PPVA 3E3MA 3S44A 3MHPA 2C0QA 4B09A 5KNBD 3K5WA 1AN9A 2OEPA 1WKCA 2OTCA 2XAUA 3HABA 1TT5A 1KFBB 3PSAA 4KSCA 2IZOA 4KWTA 3JZIA 4LQCA 4QQKA 1N57A 5CR9A 1TVEA 4L9AA 1PUIA 3AF1A 3QF7A 1A9PA 2OV2A 3BTSA 4G8BA 5HTKA 1E59A 1QYRA 4BLPA 1WNFA 4OXKA 1XNHA 4BB5A 1RAGA 2FMIA 1QFMA 5DN6A 4EENA 5T3UA 3TE6A 4DCUA 4MKGA 3W04A 2Z1NA 2FGJA 4Q9KA 3VC2A 1SFRA 5KJEA 1X9IA 3E4CA 2YYYA 3UV3A 3OLWA 1B73A 1RXUA 4CCYA 4G84A 3R23A 4ILEA 4QAJA 5LP1A 3FG9A 1O0CA 2MU1A 2GYVA 3SR4A 1G2PA 1UF9A 1Z4QA 1KO5A 2HHLA 4XWYA 3NKFA 3MJVA 3L04A 3ESQA 3UT0A 1KRXA 2VHVA 3HZZA 5CW1A 4N41A 1RPJA 2GXUA 3ZWXA 1KI2A 3DO8A 2ZJ1A 1GT91 2AR0A 3G9UA 3IJEB 4R7ZA 3ZQUA 4CM4B 5B30A 4IZHA 5AI9A 4GX5A 5JAUA 3LKZA 1IBCA 2PANA 2WPDA 4XGKA 2PWPA 3U7QA 2O6LA 1NVFA 3CLTC 5F7OA 1UJ2A 2WJGA 4NZ9A 1WB4A 2H1VA 2EJVA 3PX7A 3ILHA 4ENPA 4QG3A 1FSZA 1KU6A 1Z13A 4XWKA 3RGGA 3B1WA 4MS1B 3MMZA 1UWLA 2J3IA 4H60A 1E92A 1APBA 1J0DA 4NP6A 1PV4A 1M7HA 5U4XA 1YZYA 2X2EA 2V9PA 3GDFA 5K8VA 3STVA 4QDTA 4MVXA 2DWQA 3D4LA 3HHEA 4LVOA 3ORSA 2YVLA 3K1JA 3ABQB 4OXYA 3HJAA 3DEZA 2F43A 3H42B 1YTUA 4ZV4A 1QE0A 4G65A 3CS3A 4FW8A 1RRGA 3CUEF 4D43A 2C2XA 3P9YA 3HXPA 2RKWA 2FV8A 5EIHA 1CHDA 1HV8A 4MS4B 1WP4A 3PPXA 4C43A 5FO0A 5KU7A 4H15A 1D9XA 1MP0A 3BWMA 1A82A 1M10A 1I2BA 4XVHA 2VBFA 4CYMA 3PQ8A 2IIPA 1LJ8A 2BVNA 1YVPA 2Q4OA 2NYUA 3ZGNA 3WGLA 3I01M 4RQBA 3CPJB 2HZ7A 2RAVA 4NBWA 1GNVA 2YUTA 3MD9A 1DQNA 3JQCA 1G5FA 3HVUA 3ND5A 1J49A 1QQ5A 1SULA 3JSXA 4UOQA 3ZNPA 4KUHA 4BMVA 1GEEA 1HT1E 3BMQB 5IJ0B 4YWHA 4BBPA 1K8QA 3IV9A 5I7EA 3B9QA 2QLFA 4JSRA 4CIAA 1BVHA 3FZQA 3GLHE 1YUNA 4UU1A 3OQMA 1RLUA 2PUWA 1XSEA 3PPIA 2XE7A 1ZH8A 4M9QA 5IF9A 4FUTA 1DHRA 1WIWA 1VZ3A 3FCYA 3O9VA 1EK6A 1ZMXA 4EB6A 3COPA 3IT0A 4U7DA 4KR3A 2O8EB 1YJ5A 1FU4A 3GZNB 3QHAA 3GZJA 5CNMA 1X8XA 2DKFA 2WWWA 3TBFA 5KTYA 1KP3A 2QMUA 1EGMB 1SCIA 1G2QA 3ZJYA 2WTUA 2G3YA 1CUDA 2OCIA 2C7GA 4YV0A 1B3RA 2P9JA 4UMDA 1RXYA 2OFPA 4JZKA 4R0VA 3LSTA 4LE1A 1IU9A 4ZEMA 1EUCB 2VNKA 4KWHA 5J4KA 1NATA 3V2IA 1REQA 4WD3A 4GAEA 2AD5A 3RYCB 2A33A 2QP9X 4PWYA 2WAAA 3FWPA 4LXHA 4PGFA 2FR8A 2YV1A 1TK9A 2ENUA 3MTJA 3NAQA 5AHOA 4EYOA 4ZZIA 1D2HA 1QO9A 2HSEA 3DQPA 2WI8A 3KXDA 1R3UA 3FTPA 3ZD7A 4QDZA 2IYTA 3P9XA 4X6UA 2C0CA 3WISA 1X1EA 4QEKA 1U2GA 3JQ7A 1ZKDA 3RG8A 3OC6A 2Q0SA 3BC1A 4UE2A 1JDNA 2R1ZA 3QM1A 5AMXA 4CUZA 3GCXA 3S5UA 1CUAA 3WS7A 1M1YB 1ZA1A 2C7VA 4CMEC 1GCOA 1VSQA 1Z2OX 1V4BA 1XCLA 1QKJA 3EXHB 3G2MA 4X54A 3REGA 3VPHA 4JV5B 4GRDA 2FUKA 2L19A 4ZYWA 1CVIA 1NJSA 1PZHA 1Y1SA 2WTXA 3I1JA 1ZXBA 1Z9BA 4OKIA 4RPCA 4UBMA 1YRAA 3WOHA 5HZKA 4ZYYA 4S1PA 3AZQA 1C80A 4L5IA 1OA1A 3FTDA 3QWHA 1CS0B 4YP1A 4CM9D 3VKUA 4RVNA 3N7TA 1SOWA 4A2QA 2AN1A 1M3SA 1YO6A 2VKQA 3RJ9A 1TA0A 1Q1GA 3GHYA 2WFZA 2BMFA 4M1OA 5REQA 5LXTB 3QUSA 1NJ5A 2PM8A 1XKLA 1PQPA 2AOWA 4TLDA 5TRTA 1QH8A 3HJTA 1YA6A 1R4MB 2B35A 1N1DA 3GN2A 3HC7A 3NC0C 1CLUA 4J0FA 3VOAA 1G21A 3KQKA 1YVRA 1PR0A 3HA5A 1ZUD1 1XQXA 1FMLA 3EA4A 2REOA 2HHJA 2QZSA 2ADMA 4H7JA 4QUBA 4LAFA 4DAEA 1E3JA 3TQRA 3I9V6 4ZO4A 3KAJA 3C24A 4IPTA 4KQXA 4W1PA 3WMRA 2OGTA 2PA0A 3AK4A 4E2ZA 2G83A 3F5MA 3LBNA 4PLHA 3W77A 4OHPA 3HLTA 1BHJA 2ORVA 1C8BA 3O31A 1GR1A 3AVVA 1Y6JA 5ENVA 4DLPA 5JD5A 2JAUA 1MOZA 4QU0A 1GPH1 4KFTA 4PO3X 2FN8A 3REQA 2PMDA 3CG0A 2F64A 1M2VA 2IYXA 1J23A 2XXBA 1NKVA 3UAVA 2J8ZA 2R1TB 3N5KA 1IRIA 1JHUA 2CMHA 3F6PA 4ZU6X 4FC6A 5CM2Z 1XMVA 2FSVA 1GPMA 3C5VA 1SO8A 3PLNA 5TMPA 1Z74A 3AHGA 3MK31 3MTQA 4D8WA 3FMIA 1FYXA 1W93A 3OA2A 1CZLA 1UBEA 4BRWA 2JIRA 3I2YX 3W5VA 3MINA 1HZZC 2GASA 1V8BA 1QVAA 2NYVA 3LRPA 5EE5B 1YS1X 2VRWA 5ELMA 3VU8A 1NXSA 3PPWA 4FEAA 2EZ8A 2HADA 3QXCA 7GPBA 3GMTA 4CF3A 1CQZA 1SA0B 3EHDA 3KXKA 4O4IA 3T7AA 3ZXUB 2VDKB 3W0LB 1QPBA 3UG7A 1IULA 1WDMA 1T2AA 3G0DA 3FYTA 5EE3A 4D9EA 3UB3A 2VTEA 1IB0A 2N1MA 2X0RA 5KYVA 2VYFA 2A86A 4GOJA 3S27A 4AJPA 1OAAA 2GCIA 1VIYA 4LZZA 4YEDA 1LQUA 3VPDA 1IC6A 2G9QA 4GS5A 4P3PA 5B57C 4BDSA 5KYKA 1JDSA 1PKEA 1ABBA 3TIVA 1IN5A 1J5EB 1CR6A 4YCNA 4DUZB 3S2YA 3EZ9A 4JOBA 1USIA 1IEXA 1ZK4A 2QUKA 3IIKA 4MYSA 4LCBA 3HEMA 2CLDX 3KPUA 4FOLA 1Z0AA 3VDRA 5GOZA 1M8KA 2IHTA 3EXFB 3RUEA 3EAQA 5HCUA 5C4GB 4RTOA 4UHFA 5IHXA 1PEYA 1ZWKA 5AXCA 3IEMA 4BWVA 5FI0B 3LXRA 3GQBB 4LI0A 5DIFA 3SNKA 4YUZA 4HZUB 5J4LA 1J8MF 2WNHA 4JR0A 1I3MA 3DDHA 3MTBA 1PYDA 4OP2A