4DRYA

The crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from rhizobium meliloti
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
248
structure length
241
Chain Sequence
RIALVTGGGTGVGRGIAQALSAEGYSVVITGRRPDVLDAAAGEIGGRTGNIVRAVVCDVGDPDQVAALFAAVRAEFARLDLLVNNAGSNVPPVPLEEVTFEQWNGIVAANLTGAFLCTQHAFRMMKAQTPRGGRIINNGSISAQTPRPNSAPYTATKHAITGLTKSTALDGRMHDIACGQIDIGNAATTGVLQANGEVAAEPTIPIEHIAEAVVYMASLPLSANVLTMTVMATRMPLVGRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-oxoacyl-[acyl-carrier-protein] reductase
publication title The crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from Rhizobium meliloti
rcsb
source organism Sinorhizobium meliloti
molecule tags Oxidoreductase
total genus 82
structure length 241
sequence length 248
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4dryA00
4J7XA 5JXWA 1RM5A 2E82A 5A9SB 3WWYA 1EVZA 3ZNPA 1E7QA 3ITDA 1HLDA 3UOGA 1Q0QA 3L6EA 4M8SA 4PIVA 2PNFA 2B4RO 4W99A 2ZTMA 4RQUA 3T4EA 1EQUA 3TFOA 3W8EA 2PGJA 1NNUA 4TKMA 4HNHA 3MTJA 1E3WA 3A1NA 4LVUA 4E2ZA 2WE8A 3ICCA 3PJDA 4OL9A 5DN9A 2QX7A 4J7UA 5ILGA 3ROMA 3M2TA 3C24A 3D64A 4BMVA 3I23A 5B1YA 3COSA 1YKFA 1Y5RA 5JCJA 4D7AA 2CVQA 5IZCC 2CMDA 3E8XA 1NXQA 2C59A 1GDHA 3FN4A 4M49A 5IAAA 3DFZA 1Z73A 2I67A 1YS4A 3D5QA 4P38A 4CJXA 1IPFA 2XF8A 3U3XA 3PDJA 4BNKA 1U3VA 2HK8A 3IQDB 1GCOA 4RDIA 3ZV6A 4OM8A 4BNFA 3HG7A 4ROSA 3PLRA 3L9WA 3QW2A 4YAEA 2WD8A 2G17A 4CODB 1R0LA 3JQFA 1LNQA 3LT0A 2G1UA 5ICMA 3GUYA 4FW8A 1A4UA 1PZHA 2V6MA 3H2ZA 1YDEA 3GDOA 2Y0EA 2EKPA 2VYND 2VTDA 3DHNA 3SBOA 3PWSA 1C1DB 2DFDA 3ETGA 4UEOA 2RH8A 4CUZA 2OFPA 2YY7A 2CDAA 3VPSA 3JQDA 2YZ7A 4B4OA 4RVHA 3FTPA 3H3JA 4YWJA 4BIIA 4WNIA 3KRTA 4GL4A 4YQYA 4XRGA 3UAGA 1UUFA 1EFKA 2HO5A 4WOKA 1M2WA 1UDCA 2GZ3A 3RIHA 3W8FA 2RHCA 1Y81A 3JD2A 4EW6A 4EJ0A 5GZ3A 3Q9UA 1Q7GA 3F1LA 4YEDA 9LDBA 4NK4A 3DFUA 2B4TO 3WXBA 4EYEA 2Y1DA 2ZTUA 4RQTA 4A73A 5L95A 1MXHA 2VOEA 2PTGA 4UULA 1EDZA 5BSEA 3MEQA 1RM4A 2DM6A 2HMWA 3HN7A 2EF1A 1Z6ZA 1VKNA 1EK5A 1Z82A 4AJJA 1R4MB 1HDRA 1UR5A 1MX3A 3PFWO 3PHIA 5C7LO 2C07A 1KVRA 2QG4A 3EZYA 3FPLA 1U4SA 2VWPA 2X4GA 3FR8A 1ZCJA 3HHPA 1MB4A 4GH5A 5JAQA 4N18A 3BAZA 1ZVMA 4RF3A 4FFRA 4ZA2A 4BO5A 1PGJA 2DPGA 4ND1A 5T67A 4W82A 1O8CA 4RO0A 3WGZA 4WLVA 3PGJA 4NU6A 3NAQA 4I1IA 1T2FA 3EVTA 5B4UA 3AFMA 1G6KA 4II2A 4XIYA 4D44A 4F46A 3GAFA 3Q2KA 4Y9DA 4ZJUA 4WLUA 2C82A 3VHRA 3AOEC 2JHFA 4ZN6A 3ZV4A 3NX4A 1Y9EA 3JD3A 4DC0A 1ID1A 3I1JA 3NDJA 3ASUA 4YRDA 3EW7A 1ZK2A 3UCFA 1P31A 1YB1A 2NVWA 1V3TA 2CNBA 4JP2A 3UKOA 1T1SA 2B5VA 2ZB3A 1ISIA 3NT4A 1Y8RB 1ZK0A 4INAA 3VVCA 2C5AA 4Q9NA 3QA9A 4J1SA 2E4AA 2A9FA 4IIVA 3V2GA 1SNYA 3PHJA 1UAYA 2G76A 1G0NA 3JV7A 4KDFA 3OQ1A 4UAGA 5JW6A 2HRBA 2OOSA 4AJPA 5BNTA 2EW2A 4M87A 4OSPA 2EV9A 1C3VA 4R9SA 1BTOA 2BD0A 1SOWA 2GERA 2EG9A 3VPHA 3BMOA 1H6DA 1FDSA 1B8UA 4DPKA 2J3HA 1LU9A 2EKQA 3DOCA 2WJPA 3E48A 5IDQA 3EUWA 4N5LA 3PIDA 4YJFA 2GRAA 2Y67A 1P1KA 2NADA 4GGPA 2VN8A 4P4NA 3BMQB 3H9JA 3K5PA 2PD6A 1QV6A 4MVJD 3ZU4A 2JAPA 3E5MA 4FBGA 2X86A 4YTEA 4C4OA 2C2YA 4MIOA 3GPDG 1PR3A 3PI7A 3MJSA 2WE7A 2ILTA 1HDGO 3GLQA 1JWBB 3H3FA 3UICA 5LCXA 2WM3A 4FFOA 3JYLA 3P2OA 2F1KA 2BMAA 1ZO8A 4NPCA 4RLSA 4CLRA 4ALJA 2JCVA 1S6YA 4XB2A 4CR6A 4BMSA 3S2IA 3QLJA 1ZIDA 4LK3A 3WLEA 1V3UA 4LMRA 3WYEA 4PLHA 4YXFA 2P91A 3WSWA 4PLCA 2YQ4A 2PZLA 4Z3KA 4OH1A 4HADA 3TZ6A 4DPMA 2RAFA 3FI9A 1EK6A 3C7AA 3PJFA 3GA0A 1R37A 1A7AA 1B16A 5BSFA 1MC5A 4ND4A 1E3EA 1X7HA 4OMUA 3I6QA 4GLLA 4I9NA 3AOGA 3ITKA 4U6SA 4CPDA 4LW8A 1MFPA 4CQLB 4HP8A 4JXKA 4CM5A 5JAIA 1J4AA 2IE0A 5JMPA 3DXFA 3ZWPA 4R9RA 4FCCA 1LA2A 1ZJZA 5AQ1A 3GH3A 1YOVB 2FSVA 4XDYA 4GX1A 4BB5A 5JS6A 4L4XA 1HF3A 1KEPA 4I5EA 2EEZA 1TB4A 1KOLA 4D0SA 3F9IA 3MJ4A 2X6TA 4H15A 3FHLA 2BI7A 2P5UA 2DAPA 2R00A 4CMEC 4F6LA 2Y0CA 2PR2A 2YV3A 3WNQA 4CR8A 3OSUA 2NSDA 3I9NA 2B36A 3RBXA 2LDXA 3HUDA 3UGKA 1JVBA 2JCXA 4CMCA 3C1TA 3NT2A 3ZHXA 4YACA 2AG5A 4WOJA 1XU9A 5K6AA 1X7GA 3HWRA 4CLHA 4YAIA 3WGIA 1CEQA 2GUGA 3ZZNA 1PTJA 4IZHA 3WQQA 3U49A 3SLKA 2Q46A 3IS3A 1GYRA 5THQA 3GPIA 5JO0A 1BWSA 5BNIA 3KV3O 1JAXA 3K30A 2JD2A 4JX8A 3QRWA 3AU8A 4HKTA 1U8XX 3DZJA 2Q4EA 3KUXA 5A03A 1ULUA 2A94A 1IHXA 3OJOA 2AQHA 4LSMA 1VJ0A 5KKCA 3ZNOA 1XWFA 4ILKA 2C20A 2H6EA 4NK5A 5G4LA 4DVJA 2VYVA 3P5SA 1Z7BA 3GVPA 3X2FA 1TVEA 5CEFA 1X1EA 2DPHA 4W7HA 3TZKA 5G0TA 1CDOA 4WNCA 2WD7A 4IGEA 1ADCA 1HYEA 4DBVO 1O95A 3GMSA 1PU2A 4GMFA 3KXDA 4CLOB 3BZUA 4XJTA 4FJ1A 1BW9B 3GEGA 2JKVA 4HFJA 1XYGA 4P8RA 1JDJA 4MIEA 1A5ZA 3GGGA 4J1NA 3D4PA 5FWNA 4WEOA 2C29D 3TOZA 4HFNA 1BXGB 1ZSYA 1CYDA 2UAGA 3G1TA 5G4KA 2WYUA 5FFFA 1GEGA 3IKTA 1BG6A 3FNGA 4UVHA 2X0RA 3JD0A 3H9GA 4DMLA 2Q99A 1KBZA 3WQRA 1P0CA 4D46A 1E5LA 4EEZA 4CM6A 1ZK4A 1P45A 1U3UA 2WTBA 1O9BA 4J9UE 2Y05A 4Y6RA 1H94A 3RI3A 3C85A 5EQFA 4GSKA 1UP4A 4NJOA 1CQJA 4TVBA 3H9UA 3BYZA 4MJLA 2Q50A 3DAFA 4YAKA 3WJ7A 4YYZA 5DP2A 1PS0A 4PRKA 5L53A 4ZGWA 2D1YA 4IS2A 4N7RA 4YJHB 1VE9A 2UDPA 2ZJ0A 1E92A 1LX6A 2GR9A 1U1IA 4IJVA 5B12A 1T4BA 2VWHA 3WGQA 1Y8QB 3LVFO 3ZWWA 5ER6A 1GZ3A 2NTNA 2YFHA 2PKQO 4JJGA 1IZ9A 2EIHA 4IJUA 1CIVA 4QEDA 1N9GA 3L4BC 1WDKA 1TLTA 1NPDA 4IQ0A 3BHMA 3CINA 2IEBA 4IQGA 1PEDA 4E21A 2OMEA 3F5SA 1EE9A 1T2DA 4EUHA 3I3OA 1A9ZA 2GO1A 2Z5LA 4RPJA 1FDUA 1W0CA 4IZIA 1IZ0A 4P4LA 4FC6A 1H9BA 4YA6A 4GGOA 5CHEA 3MWDB 4N5MA 4U5QA 1E0DA 3FWNA 5KJ6A 1T26A 2C7GA 2I66A 1TT5A 4OYRA 3NUGA 2GCGA 1DC3A 4W4TA 5C3MA 1N1EA 1E6UA 1LLUA 1YL6A 3JCZA 4NBWA 1ZXLA 4GLOA 2QYSA 2O50A 3FCOA 4O1MA 1DLIA 3WS7A 2GD1O 5EESA 1MC4A 3ZWVA 3HFSA 1LRJA 4RVFA 3W4IA 5L3ZA 3GDFA 4ZQFA 4E2XA 3U09A 2QYTA 4R54A 4XRRA 4YB8A 5DF1A 1NFRA 2NU8A 4CQMD 1YRLA 3RJ5A 7MDHA 5JCJD 1MA0A 4S3MA 4YJGA 5A3JA 1WNTA 1QMGA 1V6AA 2BLLA 3RC9A 4GKVA 3OECA 5JDCA 1NQ5A 1PL7A 4Q3EA 4B7XA 4R4JA 3GOHA 4MKRA 4NI5A 5IFLA 3JQBC 2OP0A 2O3SA 1OZAA 4M54A 4TRJA 4OKIA 3HE3A 4Z9XA 5AVOA 1E6WA 2R6JA 4R1TA 2UUOA 4UUOA 1ENYA 2J5KA 4EZBA 1NQAO 1SZJG 3MJEA 4GMGA 2Y1OA 1PJ4A 4IMRA 4NH4A 4Z0PA 3MJCA 3QV1A 4W7IA 1EUDA 3IL2A 4WCFA 2PKQP 1P1FA 2D2IA 3IP3A 1M67A 1I5RA 3PEFA 3ANMA 3ZHBA 4AJLA 1TXGA 1LDBA 1P33A 1DC5A 4NJMB 5I9NA 2G0TA 4L76A 4BO1A 4BNHA 2R2GA 1PJQA 4PLZA 3GNTA 2CD9A 4PLGA 4YQZA 1JWAB 1VJTA 1HZZA 1PJ3A 3QIVA 1QYWA 4JK3A 3K2EA 1D7OA 2DTDA 3AU9A 2IEDA 4PLYA 1ZUD1 1U4OA 5H82A 5TGDA 1HRDA 3GQVA 3RBVA 1H2BA 2P4QA 4S1VA 3NT5A 4OXNA 4BNXA 2X58A 3O8QB 1KC3A 3RC7A 3WYBA 1DRWA 4D43A 3VKVA 4IDEA 1LQTA 5HA5A 4GX2A 3GHHA 4J43A 4ALLA 1LDMA 1J49A 3JSAA 3A14A 2VUSA 4L0QA 2WYVA 5A02A 4IDDA 1VRWA 1DDOA 1M6WA 3ENKA 2GPTA 3QVTA 4KTVE 5CEJA 5K0ZA 1E7MA 3VPFA 1C1XB 3ANLA 5JYDA 4RPHA 1GTMA 3JYQA 3TN7A 3ROKA 5EN4A 2DBZA 2VZ9A 1LC3A 2FOIA 2FZEA 1QP8A 4XDZA 3NRCA 1PQPA 1X1TA 3DC2A 4ZQEA 3RU9A 4WLFA 4NFHA 2Y0DA 3VZQA 1UDBA 3H5RA 2FZWA 1UZLA 4YBZA 4ALKA 5TIIA 3PYLA 2Y1CA 3B70A 3KEOA 4DUPA 2I9PA 2EWMA 5GZ6A 1ONPA 1UDAA 1PJ2A 1I3NA 1K6XA 1XGKA 3U4DA 5L7WA 1O6ZA 2GF2A 5BT9A 4ND2A 4BV8A 3JD1A 4BO4A 4K6CA 1K0UA 1PS8A 1DJNA 4K1LA 3TWOA 1GU7A 1HKUA 3DMTA 3SXPA 4GX0A 1LQUA 4B7UA 1HE4A 3F4BA 3U62A 4H7PA 3CH6A 1F8FA 4R68A 2OP1A 5IDYA 5DCUA 1MG0A 5I8WA 2HMSA 1LSJA 4RF5A 1LSUA 4CLEA 4BGEA 2BELA 2A35A 2I76A 5IXYA 3PVZA 4RVSA 5JY1A 2VHWA 3OHSX 5EL0A 3KSUA 3KYCB 5KJCA 5CDUA 4G2NA 2DT5A 4D41A 5KVQA 3TRIA 4YAJA 4YT2A 1ZKMA 5AYVA 3L4SO 4CM4A 3U4HA 4FFPA 3FPCA 4IJKA 4CM9D 1PGOA 4EJMA 3OQBA 2YFQA 1ISJA 4D3SA 4E12A 1E3WB 4JBGA 4AL4A 4I8XA 5GY7A 4RPKA 4DYDA 3RBZA 1H93A 4NHEA 4WECA 1L1FA 4CQMB 3K73O 5BQFA 2X9NA 3BTUA 2WMDA 2NACA 3JQFC 3H6KA 2H9IA 2YYYA 4MINA 4MP6A 3U4CA 4XYEA 3BHIA 3WGOA 3E6AA 3STHA 2HUNA 1Q7CA 1N8KA 4BOYA 2EW8A 2Y1GA 4YR9A 3UF0A 1ZZEA 2CZCA 4TWRA 1QG6A 3BTSA 4WK6A 1MP0A 4R41A 2HRZA 5CDTA 3KHUA 3WIDA 5JYEA 3FNEA 3LT2A 4HFRA 3GY0A 4BNLA 5IZ4A 5COQA 3AY3A 3IUPA 4M1QA 5I9MA 1NASA 1F06A 2JCYA 4BO0A 3N58A 2HQ1A 1LXCA 1JQBA 2X9GA 1LC0A 3GFGA 3ZWYA 3AK4A 5U4QA 4CMIA 5HBRA 1PGPA 1ENOA 1H5QA 2VZ8A 2I3AA 4UVEA 4AJHA 3PPIA 4D3DA 1DB3A 5HM8A 1DRVA 4R5HA 3H8VA 1E1KA 1WMAA 2CUKA 4ALMA 1QYDA 2PY6A 5A04A 1D1SA 1D1TA 1GADO 5JE8A 3WGGA 1IUKA 2GN4A 4QTZA 5ITWA 3EAGA 1JA9A 1IOLA 1I3KA 2WSBA 1AE1A 3RKUA 4GWKA 4DREA 1BRMA 1NR7A 1I36A 2AEJA 3ZWAA 3IIEA 3PHLA 1CETA 3FF4A 2NVUA 3GG9A 3DBRA 3PQDA 3RAJA 1RM3A 5ES3A 4B8WA 3NKLA 4JROA 1EBFA 4E5YA 2B37A 2X7HA 4CL3A 2D8AA 1R6DA 1HT0A 3GVHA 4O59O 1R66A 4UVDA 1SCUA 4B4UA 4EUEA 3C3XA 3B1KA 3F47A 3GC6A 3R1IA 5JFOA 1VI2A 4J4HA 2DC1A 2P5YA 2VHYA 3O9ZA 3H2SA 3LC7O 2PFGA 3TFQA 3GZ4A 1P1RA 4R01A 1A71A 3EHEA 4FFLA 1H2HA 3C8MA 3FBTA 3ZW8A 2Z1NA 4EGFA 3WQSB 4JNKA 1QXSA 4DC1A 4W9NA 1OOEA 3DR3A 1QV7A 1SEVA 4Q39A 3U4IA 1N1GA 5L9AA 3WFIA 5L4NA 2ZB4A 1AXGA 4XA8A 1I2BA 1DRUA 1PL6A 4PG8A 3EGOA 2Q2VA 4HX5A 2IRWA 4IDGA 5TRTA 3HZZA 4UUPA 2P2SA 3ZHZA 4BNVA 1XCBA 1BMDA 4I08A 3VH3A 2Y1FA 1MG5A 2UV8A 1GY8A 4RLHA 4CV2A 1YL5A 2B5WA 5T64A 3WMWA 5KJ1A 3FWZA 5IZCA 3A28A 5L51A 3IOYA 1GUYA 1OFGA 1LTHR 1ZBQA 1YQXA 5CDGA 3VAZA 5JAMA 3W1VA 2HSDA 5DZSA 3ICPA 1S7CA 4B7CA 1E1MA 2Q1SA 3JQ8A 4DGSA 2HMVA 4ZD6A 3I9MA 4HBGA 4E0BA 2DBVO 3NEPX 4OAQA 4ZQHA 1NPTO 3RASA 2PKRA 3CEAA 4I5FA 4PLPA 5DBFA 2GGSA 3GR6A 4AJOA 1XSEA 5JLAA 2ZB8A 3LQFA 3ZHYA 5JBIA 2B4QA 2X5JO 1Y9AA 2H1SA 4LCJA 4NNJA 1OBFO 4YJFB 4JJFA 4NZ9A 3JYOA 2ZTLA 5F5LA 3D0OA 3V1TC 1NHWA 4Q3BA 3PQEA 4BKPA 3DEYX 5F3RA 2AEMA 4QT0A 1QKIA 4J9VA 4O0LA 1SB9A 2DTEA 1ZJYA 3AM5A 1LLCA 3DZHA 3ZN2A 1FXSA 1U3WA 4J16A 4KP7A 3GFBA 2J6IA 4E31A 3FRJA 2AQIA 5DULA 2FPPA 2I65A 5FI5A 3TPCA 1A72A 2O2SA 3GF4A 4K26A 3X2EA 1AHHA 4XQEA 4J0EA 3OJEA 4PLFA 3VC7A 4XB1A 4MDHA 2AXQA 1K6IA 4CLRB 3A06A 1I01A 4Z6KA 2YHIB 1A27A 1PX0A 3K92A 2NLOA 5JDIA 3QWFA 2NQ8A 5I7EA 3H9QA 4WKGA 4BKQA 2E6UX 4NU5A 4J7CA 1V35A 2WEKA 1DHTA 3OP4A 3L6DA 2HAEA 2Z95A 3PQFA 1YBMA 2FWMX 4PVDA 2ZQZA 2VUUA 1J6UA 3S2FA 3OH8A 4F45A 3Q3CA 1OC4A 2ZB7A 3HADA 4XKJA 3WTBA 2Q1WA 3TZHA 4MVJE 5KJFA 3OIDA 1E1LA 3ZI0A 2AEFA 2Y68A 2EXXA 1W6UA 1DHRA 2R00C 3OIGA 3IMFA 4UEJA 2AW5A 5TJHA 3WGHA 1BHSA 3VKUA 3CMCO 4KUGA 3DZGA 1VKOA 3D5TA 1R0SA 4LCEA 5JY6A 4J2OA 4WUVA 2EHDA 4JLWA 4RVDA 3DBHA 4FIZA 3BA1A 4DYVA 2GN8A 2QIOA 2AG8A 4MP8A 1R16A 4J91A 1Z45A 1I10A 2AA3A 2O3TA 3ZNNA 5MDHA 1ISGA 1LDNA 1ZSNA 5DCYA 4BGVA 3IDSA 5LDGA 1GR0A 5CPFA 3KSDO 4E13A 1PL8A 3FD8A 3H9EO 3GEDA 3GT0A 4WLNA 2Q1UA 4L8VA 3PHGA 3WSVA 3VZPA 3VH4A 4IDFA 3PIIA 4N5NA 2E48A 3SLGA 5F5NA 1X0VA 1IL0A 4I9HA 3IKVA 4FN4A 4RDHA 4XEHA 3FNHA 3SEFA 1I32A 1NTOA 4R16A 4DLBA 4E2WA 1ZXBA 2O3JA 1LLDA 2X23A 2OBNA 4HXYA 4IS3A 4BS9A 2PZMA 2EP5A 1IHYA 1FK8A 3RUHA 1KIFA 4RZHA 2ZATA 5GMOA 1K2WA 4NFSA 1DPGA 4ONEA 5G0UA 4DQXA 1VPDA 4IJWA 4E33A 3CZMA 4II3A 4KQWA 4BNGA 5A9RA 3ONEA 1OC2A 1LUAA 4ITUA 5TSDA 1KYQA 1P44A 3HDHA 4YJDA 1JKFA 2ZCUA 1E3IA 2D59A 1N5DA 4TZKA 1YDWA 2J8ZA 2WD7B 5DOVA 1I3LA 2QHXA 4CMKA 4ZQGA 2JJYA 4BQRA 1B7GO 2JD1A 3HJAA 4GX5A 5TNXA 1RJWA 4H16A 4KDEA 1HEUA 3VDRA 4B79A 3DMYA 1DIGA 3CUKA 4ALIA 1UP6A 1HE3A 2F00A 3TSCA 4NBTA 5TLSA 1UXGA 4R5MA 2Q2WA 4Y6PA 4LGVA 1KVUA 1VL0A 5G4KB 3ZWXA 3RFVA 3QWIA 1EUZA 4FSHA 4E3ZA 1LSSA 1RM0A 3IUSA 1HLPA 1RKXA 2V6BA 5ICSA 2CVOA 1JVSA 1O94A 2BGLA 2IXAA 1WLYA 2HKIA 1O5IA 1JW9B 1VL6A 1B0AA 5L40A 3G17A 4G5HA 1R4NA 3QWAA 1GPJA 1O0SA 2OZPA 1EE2A 3RROA 2X0JA 1LBEA 2IYOA 2GN9A 4NG5A 1K89A 1LSOA 2VNSA 1NM5A 2NNLD 2Y93A 5I9LA 1A7KA 1UP7A 3E03A 5CP8A 4A27A 4CM1A 2BRUA 5BSGA 5CPBA 1EEHA 1NQTA 3EVNA 4R1NA 4AJEA 3T7CA 3LF1A 3H5AA 1DAPA 1HSOA 1TT7A 4DRYA 2P9GA 3QVOA 4KMSA 2E49A 5FYDA 1EDOA 2UUPA 2V7PA 3WLFA 4TKLA 3K31A 3V1UA 3C7CB 3WGTA 3ZDFA 1J0XO 1YWGO 5L7YA 1C0IA 5KIAA 3WX0A 3BMCA 4RORA 4YT8A 4E5MA 3KTDA 3KLPX 3LDHA 3B1JA 4CMEA 1I2CA 1N9GB 2VZ0A 4F6CA 1N92A 1PJSA 4XQCA 3SJ7A 2FMUA 5H83A 2X0IA 5KVVA 3ANNA 3DZIA 1PSDA 3KYDA 4BQPA 2QW8A 4IQ8A 5EQDA 1BSVA 1NFFA 4J2HA 2SCUA 3U0BA 4AFNA 5A05A 3RWBA 5U9CA 5A06A 2AE1A 1R15A 2PV7A 5L45A 3V8BA 3D3EA 4ND5A 3JQCA 1U8FO 4IDBA 3PXXA 4MIYA 3CMMA 1IB6A 1BXKA 1X0XA 1SC6A 1TT5B 5CG1A 5HTOA 1D8AA 2UVDA 5C5IA 1B15A 2CF5A 1SO8A 5JDCC 1EZ4A 3VZSA 5EINA 5T8KA 4MKXA 1R0KA 3NGXA 1T2EA 3LT1A 2FHSA 4FC7A 4NMHA 3GNQA 4AG3A 4BO2A 3DZFA 1VLLA 4CLOA 4DA9A 2D0IA 4DIFA 4A10A 4E5KA 3V1YA 2YV2A 1AXEA 2GN6A 1ADBA 1XDWA 3F4LA 1WDMA 5ER9A 1Y5MA 3AWDA 4YJGB 4HWKA 4Y8VA 4J1QA 4BUCA 1YL7A 4U8GA 4QFDA 1I3MA 4GPD1 4R69A 5ITVA 3LYLA 4YAGA 1U3TA 5BNFA 5LC1A 4B3JA 2O4CA 2ZK7A 3H5NA 2QZZA 1JKJA 1NPYA 3TQHA 4WCFC 1FDVA 2EJWA 1GV0A 3C7DB 4L75A 2DUWA 1MV8A 5J23A 4GI2A 3ULKA 4UVIA 3OEWA 3RKRA 1UJMA 4E5NA 3DOOA 3VOSA 4A26A 5JC1A 4MO2A 3W6ZA 1YB5A 1UXIA 2DLDA 2CDCA 3KZVA 3N7UA 1BVRA 1EVJA 1LLQA 2X5OA 4IY1A 4CMHA 4CV1A 4XYLA 5DBGA 4IXTA 1B26A 4U0JA 2OORA 1OMOA 4WCFB 1XIVA 5JC8A 3E9MA 1YBVA 3QP9A 1ZEMA 2YHUA 4PLVA 1PGNA 4L9RA 3JYNA 3UCEA 1F17A 1NVTA 2UYYA 5G0SA 4RPLA 1CRWG 2A4KA 4DIOA 5BSHA 4OSOA 1OI7A 5EPOA 4C7JA 3L9XA 3ORFA 1DIAA 3E18A 2Q2QA 4KWIA 2VHZA 4CM8A 4XYBA 2ZYAA 2VT3A 2WYWA 1GUZA 3BHJA 3ST7A 2JFFA 4R1UA 4Z3DA 5IN5A 8ADHA 3RSHA 2ZKLA 1PGQA 2RBEA 3WFJA 4RJTA 4ND3A 1EVYA 3W4KA 1IE3A 2CVZA 2JL1A 4WGGA 3G1UA 3ZU2A 3L4BA 4MVJH 5COAA 3M6IA 5DT9A 1DXYA 1Y6JA 1I24A 1LRKA 2O3QA 2HDHA 1HDXA 3JQGA 2FPIA 4JN6B 4DTIA 1NAIA 3EY4A 2VWGA 3SC6A 3VZRA 4B8ZA 4LRSB 3OMLA 3KBOA 2TMGA 2NVBA 5DBIA 1GD1O 2HU2A 3JQAA 1P9LA 2QRJA 1HE2A 1YXMA 4TVOA 3S8MA 3H4VA 4Z9FA 2HJSA 4TSKA 1JLLA 3DQPA 4MKZA 4BNMA 1MXFA 4G65A 3CTMA 3D4NA 2Y99A 1L7DA 3ZU3A 4PZDA 4A7PA 4W6ZA 5COBA 1F0YA 5HS4A 5K9ZA 4JQCA 3I4CA 9LDTA 2E37A 3R3JA 1U2GA 2JD0A 1E3LA 2RCYA 1NWCA 3F5QA 4WJZA 1SB8A 3D3WA 3FNFA 5MGBA 1LDGA 4YCAA 4R3WA 3D4OA 1AGNA 4BB6A 1YQGA 1NYTA 1JN0A 3MOIA 5G2OA 3KSZO 4XR4A 5CDYA 1G0OA 3ZWNA 5HS6A 1T24A 3QJ5A 3DHYA 3EYWA 2DVMA 4J1TA 1C0PA 2I3GA 2PD3A 3EZLA 3NV9A 4MOWA 2CY0A 3WOHA 3ADPA 2B69A 3V2UA 3EMKA 3PFFA 1QR6A 5L4LA 3BMNB 1E5QA 4P4GA 1AHIA 2OL4A 3WB9A 5AXCA 1DLJA 4AJ1A 1XA0A 3LT4A 3WR5A 2CSUA 1U5CA 2GSDA 3FSRA 1LJ8A 4QSMA 1NQOA 1XQ1A 4J0FA 2D5AA 3UXYA 4ID9A 1DIRA 1ENZA 2AHRA 2W8ZA 3DBVO 3I9KA 4Z0TA 2O3RA 4QECA 3DBLA 3GGPA 3Q9NA 1QLHA 3Q0EA 4CM4B 2NV6A 5A1TA 2OUIA 1XELA 1CERA 2FR0A 3ROPA 4PZCA 4QX6A 4BNYA 1SEPA 2C2XA 5I7VA 3DB2A 5EMHA 1KEVA 1YH3A 4XYMA 3CIFA 1HL3A 3QSGA 4DL9A 1NAHA 1WWKA 2PGDA 4EJ6A 3FR7A 3LC2O 4RPGA 1ZSVA 5H81A 4KTTE 1QYCA 2PZKA 3PYXA 3I9OA 3SJUA 1WPQA 2J3JA 4X54A 1LEHA 5LDHA 4C7KA 5JO9A 1YO6A 2W2LA 2I99A 4EEXA 3OEYA 4TRMA 2GNAA 1GCUA 4U6QA 4WLEA 1I8TA 2BGKA 4QO7A 2RHRA 2Y66A 3F46A 4L73A 1DFHA 4CLDA 1DOHA 3GK3A 1PS9A 2O7SA 4UUNA 5TS3A 2QRKA 4FD3A 3R3SA 2CF6A 2O48X 2IODA 3ZWCA 2C54A 3SX2A 3DAPA 1OAAA 1H6CA 3AUAA 3NGLA 3GHYA 4FOSA 1U9JA 3ETEA 5I8ZA 2Q4BA 5T5QA 1YB4A 2PZJA 4BO8A 1V9LA 3HN2A 4PLTA 3DTYA 3INTA 3QQPA 5ENDA 2I5PO 4CMAA 5KTKA 4J6FA 1Q0LA 1XR3A 4CMIB 5JPIA 3QY9A 4BHTA 5TX7A 2C7VA 1QRRA 3QHAA 2V6GA 3ZV5A 1MUUA 1GQYA 3KLMX 3BTVA 3GRKA 1HETA 2W2KA 2VWQA 2X8LA 3VVBA 3WYCA 3ZV3A 4B3HA 3LSYA 4J3FA 3G79A 2JAHA 4DXHA 1HDZA 3JQ7A 2GDZA 2YW9A 1Q2XA 4CM7A 2VRCA 1KEWA 4XWYA 2NVUB 4QFCA 3VTZA 5CEEA 3DBRB 3VH1A 2D3TA 2A92A 3K96A 1B8VA 1U7HA 4GSLA 5AXDA 3I4FA 3DDNA 2Q49A 3HNPA 1WVGA 2GZ2A 1KS9A 2OGUA 2ZYGA 1C0LA 3KB6A 1SAYA 1X14A 4D79A 4W9NC 3N74A 2X0NA 1M76A 4BL5A 2QRLA 2AE2A 4XR9A 1E7WA 1HTBA 2TMDA 4UUMA 2DBRA 3GZNA 1SOVA 1E3SA 1T1RA 1ISHA 3T4XA 4JJIA 4BO9A 1P1JA 1VSVA 2BFMA 2J3KA 2FR1A 1YQDA 2FP4A 1NHGA 3E5RA 2P68A 2PA3A 2D5CA 4CQMA 3SVTA 1Z75A 4NR0A 2GZ1A 2NU9A 4IGFA 2DFVA 3K9QO 3OETA 3ADOA 2YV1A 4KOAA 3AM3A 4RVGA 3JQ9A 4A0SA 4KUHA 3ZNQA 2XOXA 4OKNA 4PN3A 4CL8A 4E4YA 3E9NA 5A9SA 3RU7A 1FDWA 3E9QA 1WMBA 3VH2A 2PLAA 3PZRA 1QSGA 1DBVO 3I9JA 1O89A 4LMPA 3VPGA 5ENVA 4RVUA 3HDQA 5T6BA 4BGIA 5A5FA 2HLPA 2CFCA 3R6DA 3IJRA 3O26A 4FS3A 1J5PA 4AJIA 3OBBA 2IZ0A 3GVIA 3DHEA 1V8BA 3JQ8B 1XHLA 3RJ9A 3P2YA 4OHUA 3WMXA 4A2CA 1FDTA 2WDZA 1W73A 4MP3A 4WASA 4CUJA 1GQ2A 3HSKA 4L4SA 2VHXA 4EBFA 4D0RA 2BFAA 5EJ2A 1RYDA 2FR8A 3KEQA 1PQWA 3HB5X 1D3AA 3ZWBA 2VYVD 4EI2A 2PH3A 5I7SA 4QQRA 1NBOA 2H63A 4FB5A 4MVJG 3I52A 4Y6SA 1WW8A 2HCTA 4WEQA 3UHAA 3JYPA 1BXZA 3TJRA 3RUAA 3TNLA 1EBUA 2NU7A 3H65A 2VTEA 4PG6A 5JDIC 2POQX 3NDRA 4FJ2A 1C1DA 2PGLA 3ZW9A 1DAOA 3SC4A 2G82A 4E6PA 1E7YA 3HDJA 1T2AA 2D4AA 3CPSA 1ZMOA 2FRDA 3DL2A 5JCXA 3BTOA 4HFMA 3L0DA 3LF2A 4YT5A 2LDBA 4BNWA 3ZU5A 4L74A 3LU1A 3BMOB 1MGOA 1JAYA 1PJCA 3WGYA 3W4JA 3AI1A 5A9TA 3AUUA 2IDZA 1GFSA 3GN1A 2HJRA 2EGGA 2O7QA 1KVTA 3WG9A 1TEHA 3Q1LA 1E1NA 1ZW1A 3NTOA 3RUIA 1GEEA 1F14A 5TQVA 2ET6A 3ROQA 2YDXA 4OXYA 4CMJA 5KWEA 2OHXA 1M6HA 1HSZA 3B1FA 3WBBA 1UZMA 1IYZA 4YT4A 4Q3DA 2NQTA 4TRNA 4BNUA 3AY7A 1B2LA 4MPDA 5F1OA 1R4MA 4B4VA 4ZICA 3UUWA 3S1LA 5BR7A 4KUEA 5HWSA 1WDLA 3F1KA 2EERA 2VRBA 3E1KA 3ETDA 5JSFA 3U9LA 2B83A 4BMNA 1B14A 3RCBA 5F21A 4ZRNA 3KVOA 3OM9A 4BKUA 4Y98A 3W8DA 3H7AA 2BHLA 4XQ9A 2NTJA 3GUCA 1K6JA 4NQZA 5JNLA 1CF2O 3HDYA 2O23A 3NTRA 4D45A 1CQIA 3WIEA 4B4WA 3W6UA 3OFSA 4BO6A 2P9CA 1EQ2A 1VSUA 1GPDG 4I9UA 3RUFA 4FDAA 3DBHB 3OJLA 1P74A 2VT2A 3RC2A 1XEAA 2J3IA 3Q2IA 3L07A 4LSWA 1H0KA 4AJNA 3F6YA 3PLNA 3B20A 5HRUA 2NWQA 1PZFA 1NP3A 4RF4A 4AVYA 3HQ4O 3OIFA 1GUFA 4CM9A 1Y8RA 1HYHA 3I83A 3LLSA 4BGUA 4D3FA 1DIBA 3ONDA 3AOEA 2FPGA 3CE6A 4D42A 2J5RA 5B4VA 1Y1PA 5AXAA 1F8GA 3JTMA 3KOUA 1BVUA 5K6AC 5AXBA 3QVSA 2FN7A 5CG2A 2W4QA 3I5MA 1VC2A 4BNNA 2YHIA 3C1OA 1N7GA 1U5AA 3UH1A 3M2PA 4XQGA 4BNZA 2V6FA 4YPOA 3ZCXA 2RH4A 2DBQA 3S2EA 3TL2A 2P9EA 3PRJA 3TF5A 3EDMA 1PZEA 1BDMA 1T25A 5JMWA 1RPNA 3BMQA 1N2SA 5FEUA 3RVDA 5IG2A 3U5TA 1PJLA 1XKQA 1Y7TA 1D4FA 2Q1TA 4GKBA 4KWHA 5KVCA 3RFTA 3AFNA 1HZJA 2NUAA 4NIMA 4BKRA 3UCXA 3QE3A 3WJAA 3JQEA 1GAEO 1FF9A 2VUTA 1GZ6A 8LDHA 3S55A 1F12A 1JTVA 2RIRA 3AJRA 4O63O 3T7EA 3DZBA 1JU9A 3CZRA 1CJCA 1NVMB 1P0FA 1DO8A 3JQAD 4KZPA 4FFMA 1DJQA 4DPLA 1R4NB 3Q11A 4WLOA 1T2CA 1DC6A 4XGKA 4CUKA 3M1AA 1B3RA 2X9VA 4J49A 4BO3A 3OJ0A 2Q45A 2IXBA 2JHGA 1ULSA 3NJ8A 4OOFA 1GYPA 4FR5A 3NTQA 3AW9A 3CSDA 3AUSA 1GV1A 2VYNA 4PVCA 3ABIA 4JCOA 1B8PA 3AY6A 4YRBA 4RZIA 3TZQA 3RUEA 3QVXA 4JP3A 3QWBA 4E32A 4TMFA 4CMBA 4QXMA 4XJSA 1KY4A 1W8DA 4CQLA 4OQYA 1H6BA 3K2BA 3OQ6A 4OIMA 4TZTA 1R12A 4BV9A 4DLAA 5AOVA 3BMCB 3WNVA 3IJPA 2V65A 4CR7A 1ADFA 4OOEA 1MFZA 3GG2A 3AUTA 5TT1A 1HE5A 2PD4A 4OXKA 3IP1A 1YOVA 1UAGA 1TA4A 3MCVA 3GGOA 3PK0A 4XYGA 3KYDB 3OICA 1ZMTA 3R0IA 4JIGA 4EDFA 3UN1A 4U7WA 5T8KC 1EVIA 3AI2A 4CLXA 1KVSA 2P4HX 1ML3A 1XQ6A 4KQXA 3HB4X 5DOZA 5TC4A 4GWGA 2NTVA 4RCVA 1EFLA 4J90A 5TJ9A 1WZIA 1V0JA 1ZK3A 4Q3AA 3VDQA 2C5EA 3MJTA 1HDCA 1HWYA 4ALNA 4WPGA 4E5PA 2AQKA 4DWVA 3DWFA 3JD4A 4OQZA 3FTNA 1NWHA 1FJHA 3P7MA 3RD5A 2G5CA 2NU6A 3MWEB 1A9YA 5TF4A 2X5KO 2EGHA 1M75A 2HK9A 2Q3EA 4PG5A 3V5NA 4EITA 4XD2A 4XX0A 2X1HA 4CM3A 2GLXA 4RL6A 4AICA 3GDGA 4A03A 1AUPA 3UFXA 4YRAA 5A5EA 1LDEA 3BXXA 4BNTA 1WZEA 2VQ3A 2B35A 2W2LD 3NJ4A 4NDNE 4G81A 4BVAA 4TROA 1JKIA 4LN1A 4Q3CA 1H6AA 4PRLA 3A4VA 1SPXA 4PCVA 3IAHA 1I30A 2ZQYA 1ZEJA 3RUDA 3EK2A 4JBHA 3ZGYA 1UZNA 3PWKA 2VHVA 2IZZA 3I9LA 3S2GA 1W4ZA 3GVXA 4DIBA 3FBGA 4URFA 1UXJA 5CAEA 3NDIA 4CMGA 4DBZA 1M66A 4LRTB 1BW9A 4MVJF 4BKOA 1DC4A 3CKYA 4H3VA 4PFJA 1ISFA 5IN4A 4O5OA 5IF3A 4GQAA 2EP7A 4Y67A 4ZHSA 1WAMA 1NVGA 4DMMA 3QWHA 1BXGA 3GAZA 5EERA 3LC1O 4MVJM 1ARZA 1NR1A 4YDRA 1SMKA 4IPTA 3D1LA 1BGVA 1NX6A 2XPCA 4XZ3A 3JQ6A 4CV0A 2B0JA 2IYPA 4NBVA 4F3YA 5CDSA 3KETA 5ADHA 2DTXA 3ONFA 2BGMA 4O6VA 1E7RA 1PQUA 3K6JA 4CM8B 2Y1EA 3TOXA 5DNAA 2VRCD 5F1PA 4E2YA 1GL3A 3LZ6A 3E82A 2ZCVA 2J5QA 1ADGA 3PJGA 4MVJA 4QUKA 3TL3A 3WDSA 4IDCA 4L4RA 5IDWA 2PH5A 1KC1A 2YQ5A 4RGBA 1IY8A 1I2ZA 4YJHA 5B4TA 1V3VA 2HMTA 1A4IA 1CWUA 5DDIP 2VNAA 5T57A 3JQGB 1FMCA 1Y8QA 2EJVA 1KY5A 5G0VA 3WTCA 4R51A 3MTGA 1PZGA 3P19A 2YJZA 2YDYA 3GN2A 1PJBA 3JQAB 4GVLA 3AI3A 4GAEA 1Z74A 2FY8A 2W98A 3PJEA 4IUYA 1GYQA 2BH9A 1PWXA 1C14A 4DLLA 4U0KA 2XAAA 3PYMA 4DQVA 3RUCA 4M89A 6ADHA 3GVCA 1B3BA 2PWZA 2DQ4A 2GYYA 2X22A 2BF7A 3G0OA 1KEUA 3D3WB 5KVSA 3V2HA 4ZQBA 3LLVA 3OA0A 4I5DA 4FGSA 4K28A 1AN9A 4MVJI 3ZH2A 1Q0HA 1PIWA 4IMPA 4GVXA 4N54A 2PK3A 1YGYA 3AM4A 3O4RA 4AJ4A 3PWZA 5KNLA 3G49A 5L7TA 1QORA 1KETA 5L4SA 1UH5A 1YONA 3TZCA 1GZ4A 5B37A 4BO7A 3OJFA 4JBIA 1ZH8A 3VTFA 1YJQA 3ON5A 5C7IO 4NBUA 1GQQA 1QLJA 3PHHA 7ADHA 5ILOA 3RFXA 4ZU3A 4Q3NA 4DQUA 1QYVA 2NM0A 3B6ZA 4HY3A 3DOJA 3NYWA 3CXRA 3PDUA 4M55A 3KO8A 1K5HA 1Z7EA 4GBJA 5GZ1A 1RWBA 1H9AA 2ZYDA 5DCWA 1K3TA 1ZK1A 1I0ZA 1LI4A 5TT0A 1LDYA 1VM6A 3DMTC 3KYBA 2WWRA 1EUCA 3DZKA 1E3JA 2O3UA 3MOGA 4NFYA 2OXIA 3DBLB 1KERA 1IULA 4AJ2A 3KM0A 3K8ZA 5FI3A 4FQ8A 5FF9A 1X13A 2ZIZA 3DONA 1PR9A 2OO5A 3GNSA 1C0KA 1Q7BA 1ONOA 1P77A 2C0CA 3JQBA 3WICA 2YUTA 4FJ0A 5EIOA 2VCYA 4PGFA 3MJVA 3BIOA 1HYGA 5JAZA 4IBOA 1NFQA 2JFGA 4EUFA 5C37A 1UXHA 1DIHA 3UVEA 4K6FA 1ORRA 3GRPA 5G0WA 1U28A 4RF2A 4M86A 4XGNA 4YVFA 3L6OO 1Q1NA 1YVEI 3F3SA 4HUJA 1I33A 5U1PA 3INGA 1ZFNA 4NJMA 4IXWA 4R1SA 5F1KA 1HDYA 3O03A 5A3VA 2DKNA 3DAGA 5KCZA 4LVCA 2BI8A 4XIJA 1VJ1A 4TQGA 1LRLA 1DSSG 2ZTVA 1BDBA 3INRA 4FFNA 4IIUA 4NBRA 2IZ1A 4A5OA 1U7TA 3DO5A 4TRRA 3RQSA 4J4BA 2EKLA 1UXKA 3PP8A 2VOJA 1YJ8A 4K9DA 4UEKA 5THKA 1U2DA 2BFOA 1MLDA 2H5LA 1TI7A 4LISA 1HXHA 5DP1A 1SBYA 4UVGA 1EMDA 2ZJ1A 3ZWMA 4Z0HO 1VL8A 3ZWOA 4PG4A 3G3EA 3O8QA 2W90A 4E30A 1YE3A 5IXSA 2CDBA 4R3NA 3L77A 4XCVA 1RYEA 2O4UX 1P1IA 2BFPA 3QVWA 3D7LA 1ENPA 4WCDA 4OJNA 3VPXA 2HMUA 2W2KB 4BNJA 3I6IA 4PZEA 1T4DA 4AJKA 1KVQA 1X15A 3PTZA 1PWZA 1C1XA 1E6EA 1X7DA 3IC5A 3DTTA 3JQ7B 3Q6IA 4I5GA 3GMDA 2AQ8A 4HV4A 3LK7A 4MVJP 1L7EA 5C7OO 3BMNA 4J4TA 3UW3A 4Z9YA 2DUUA 4B3IA 2OBYA 5I7FA 4HNGA 1YBAA 4FPXA 4OO3A 5CFZA 1E7SA 3C1AA 3TDKA 5KKAA 4ZRMA 1QYXA 6LDHA 3GEMA 4PG7A 2Z1MA 2I6TA 2GASA 4P22A 3HFGA 4WE3A 4XGIA 4UREA 3EC7A 5A4DA 4IINA 3ASVA 4ESOA 4PLWA 3WWZA 3OF2A 1XLTA 2XXBA 1IPEA 3MZ0A 4FOOA 4OGWA 1DFIA 2FSSA 4FGWA 1ISMA 1HDOA 2DU8A 2O2YA 3GZNB 3JQ9C 4QO8A 5IDXA 4BNIA 1DFGA 1P1HA 1XG5A 4ZVVA 3WBFA 1ZNQO 1G1AA 1WP4A 2AMFA 5KOIA 1DEHA 1N7HA 3OA2A 4CV3A 3O38A 2XXJA 3PGXA 3ENNA 5IJZA 3M1LA 1ONNA 2BKAA 3A9WA 1P3DA 3PZBA 2HK7A 4RV9A 3RC1A 5KJEA 2QZ9A 1PJTA 4IDAA 1XU7A 4IM7A 1E77A 2JFHA 3KYCA 4JGBA 2QQ5A 1WXDA
chains in the Genus database with same CATH superfamily
4J7XA 4ERNA 5A9SB 2ZWOA 2QUBA 4XD7D 1VQ1A 2V7BA 3I8OA 4F7DA 3BCRA 5IH7A 5KSOA 3UOGA 1WV1A 2P41A 3BSYA 4M8SA 3TMAA 2PNFA 4BASA 1RSZA 1L4KA 4UFNA 2ZTMA 5B3JA 1EQUA 3TFOA 3DLHA 3WBKA 3FNBA 2FR8C 1NNUA 3O7MA 4TKMA 2IZOA 3MTJA 4E2ZA 1F0NA 2DWCA 5IU6A 2WE8A 2OAP1 2ZUWA 2ZR9A 1NTRA 4JT4A 4KEAA 1QGUA 4K9MA 1GAQA 3AEKA 1J7JA 3M2TA 1E60A 1ZCAA 5ILGA 1TYDE 2HF7A 4TGLA 2G5TA 4ZVNA 4BMVA 5B1YA 5C1DA 4DR2B 5F9MA 1YKFA 3NHFA 1BE1A 4MKIA 4XFDA 3SNKA 1NXQA 4J75A 2PBRA 2A78A 4D8WA 5HUHA 3FN4A 2C2MA 6REQB 3DEKA 2YN4A 1J09A 1E2MA 1RKQA 3Q5EA 1II8B 4JX9A 3UMCA 4P38A 3IALA 4KB5A 1KAQA 3OM1A 4Y0AA 3RFCA 1X9HA 4KXYA 4BNKA 1K7SN 2JIZA 4LF8B 4LZPA 4RETA 3OOEA 1Q11A 3VOBA 4ROSA 1FQJA 3PLRA 1MB3A 5K0CA 2R6CA 4R98A 3H5IA 4X44A 4X64B 2CWWA 5D2CA 5FX2A 4D5GA 2DG2A 4LTMA 3G23A 3PC7A 1H3FA 1R0BA 3DLCA 4GMDA 2NU7B 2VTDA 3W7BA 1SXPA 1CY6A 2HSEA 2G9QA 3EG5A 3UJ9A 1W5EA 3ETGA 3OX2A 1PR2A 3CXUA 3W3ZB 2IP2A 4CUZA 1ZN2A 2OFPA 2YY7A 1TIBA 2KS6A 1O6BA 2YV5A 3AQ4A 4TLLB 5AO9A 3E7FA 1WCWA 3ROTA 5HDBB 3CHYA 3QYAA 3H3JA 4N1AA 3DUFB 2RG7A 4HWRA 1OBCA 3KRTA 1ZRHA 4KE6A 3E9RA 1XDGA 3GA5A 2OPHA 5D1NA 3SJCA 1R5NA 1UK8A 4D8UA 4A23A 1RWOA 2KJQA 5E7IA 2PKYX 3AFHA 3ENWA 5HUJA 5JADA 3OTHA 3H0CA 3UA3A 1NMYA 4TUYA 3Q9UA 1JA0A 2FFHA 3F1LA 4M1KA 4COOA 9LDBA 3DFUA 3EIQA 4DT1A 1ISPA 5CA1F 3NKFA 2ZTUA 4MYSA 4YJ2F 4N0PA 1FQOA 4A73A 5I7OA 1MXHA 2I6FA 4UULA 5EWMB 2VQSA 4ZKEA 3AF6A 3ND9A 4G1CA 3PF9A 3FKJA 1LZLA 3Q6MA 3OURA 4IICA 4Y2QA 4QNNA 5EQJB 2W2VA 2BTOA 4ZCMA 4MQ4A 4Y18A 1EK5A 4DSOA 1MW9X 3LM8A 3U81A 1R4MB 1E6KA 1ML4A 2MINB 3PEUA 3Q5DA 3RT1A 3V8VA 3A25A 4OSEA 2C07A 1KVRA 4G8DA 4HGNA 1H8HD 3CRRA 3FPLA 2VWPA 5IKOA 4UXHA 3WWCA 1IONA 4EZEA 3HJFA 4QJIA 2C7QA 1MB4A 3ZR4B 1UBUS 3BWEA 4GH5A 2AC2A 2DFNA 1CD5A 2Y3IA 4GEKA 4MV7A 5H7XA 3PXCX 4UU8A 1R5BA 2DPGA 1PQ4A 2A4MA 3EEBA 3NR2A 5JS8A 1PWHA 1W88A 4N8SA 1HV8A 4L7QA 2CL6X 3OFNA 2VKTA 2EDCA 3FUVA 4QVGA 2DH5A 4BAGA 1T2FA 3JTEA 3OX4A 1IN7A 1COZA 3EA5A 3EVTA 1NW9B 1KXZA 3OZDA 1ZH4A 5B1HA 4B48A 3HYNA 1G6KA 3OQJA 1BE8A 3UGJA 2IBTA 4IHQA 5EMMA 3OY2A 4F86A 2Q3JA 2PA0A 5CNIA 4F46A 3GAFA 5AW1A 2W6PA 3G59A 4XPZA 4WLUA 2CXQA 5HIAA 5LKRA 2AF4C 2BEJA 3LPCA 1UJCA 3R6LA 4ZN6A 3N07A 3OSZA 4EJSA 3I1YA 1Y9EA 5TMEA 1ID1A 1ADYA 4M7RA 3CNBA 4JC4A 3LUDA 4MQEA 3UCFA 1YB1A 3P32A 4B6JA 5HOQA 4I4TA 1V3TA 3WLOA 1WX1A 2IZ6A 1IOVA 2ZB3A 1DC8A 3TBFA 3NQ41 4QPZA 1ISIA 3NT4A 4TL6A 3S29A 4UFPA 1Z15A 2FSUA 4YUXA 5BSMA 1FNCA 4TQUS 5M04A 1XCPA 2C5AA 4Q9NA 1NUQA 2FPGB 4A82A 4J1SA 2E4AA 2A9FA 2IYAA 2G1KA 2R8EA 3GL9A 5AJXA 3OVMA 2XXAA 3FGZA 5IVKA 4FYXA 3R0XA 1G0NA 3Q7RA 3OQ1A 4XWKA 2HRBA 2DWPA 2JVKA 2PX8A 2Y1LA 2QVCA 1URPA 3GGDA 3H3XA 4AJPA 2AKEA 3IR6A 4F96A 4S35A 1A4XA 4G63A 5EP2A 3SJBA 3MB8A 2XRFA 4MULA 1CQXA 2ONCA 3L8FA 2GRJA 5DK6A 3VPHA 3BMOA 3CT4A 4QM7A 1QPZA 4B3BA 5EEHA 2YXBA 1AKRA 1LU9A 3C3PA 3DOCA 3TJMA 3E48A 1ETHA 4RGVA 1BO6A 4ZZ3A 4REMA 1BC5A 1NBIA 2Y67A 1L5GB 1P1KA 4OG2A 2G70A 2NADA 2JBHA 4P4NA 1IJEA 2JZNA 2Q41A 3PDIB 4BVBA 1K06A 2XB4A 3H4TA 1QV6A 2BKLA 2WJ6A 4MVJD 2JKZA 4MWCA 3UB4A 4JKYA 4LE1A 1CPYA 3KJHA 521PA 4YRPA 1KNXA 3HYCA 5FADA 2BCEA 4P93A 3DBIA 3RSFA 5LBTA 1CVRA 5JSZA 1Q0TA 4EATA 3CN7A 2ILTA 2Z30A 5G3YA 4YAOA 2W5UA 1RCFA 2KM1A 1QIMA 4IMJB 4X85A 5E95A 5C8YF 5IRCD 1VBNA 4FMBB 5LCXA 1YZTA 4NYMQ 4YRQA 3KD2A 2WM3A 3BFXA 2GAJA 7REQB 2OEPA 2FRVA 3ZDZB 5LLTA 2HF8A 2CHUA 2YXNA 2F1KA 3Q3EA 3WLSA 1NI5A 1ZLYA 4NPCA 4RLSA 4OXXA 1XYVA 3G89A 1DX4A 5KYXB 4OU4A 1RWVA 4RZQA 2AX3A 1FJ2A 3PQ4A 3QKIA 3S2IA 1NXTA 3AZQA 2IYRA 2W7TA 2ZSDA 4AY3A 5A6VA 1W7AA 1X2BA 2BFNA 2BISA 2XYRA 3IPCA 4JSTA 1WUKS 3LC0A 4MCHA 1S7GA 4FKBA 4PCLA 1THMA 4KGXA 4UOZA 1U2QA 2IKSA 3WQHA 4ZV4A 2JGJA 1FNMA 3G5LA 2YQ4A 2O2HA 5K0NA 4RMIA 2Z98A 2QUZA 1E9FA 3PX2A 2C2KA 3TZ6A 4G8BA 4Z7QB 2DJIA 2FU5C 2JGLA 3CH4B 4Y6LA 2YJGA 1FMFA 1UZUA 3FI9A 5BVHB 4FYHA 1U0NA 4UU7A 3JYHA 2XQJA 3LGAA 4JQYA 5B55A 3VR1A 1N0WA 1V6SA 4DNPA 3F96A 1AS3A 4OMUA 3B78A 5B1SA 4C0HA 4GLLA 2GM5A 4CPDA 4LW8A 5LJIA 3RHTA 4HP8A 4K6GA 1VMKA 3OFKA 4AUMA 4DCPA 3SFZA 5JAIA 4KPUB 3NGMA 1U65A 3WKEA 2OPBA 1UK9A 3C5HA 3BILA 4YCBA 4NYJQ 2R8BA 3GEIA 1KZ6A 2CL5A 2H9YA 3HV0A 4R9RA 4MVCA 2GPJA 1LD3A 1FFGA 1LA2A 1EHCA 4D25A 3HVRA 3GH3A 4BB5A 1CR0A 4XDYA 2ONYA 3DVQX 4GX1A 1KOLA 4I5EA 2EEZA 1TB4A 1T0JB 2HPVA 1T1EA 4D9MA 2H5IA 1SHKA 2X6TA 1R0CA 2P5UA 1KPGA 1A9OA 4UM8B 1IBCA 1ICIA 4C5CA 4CMEC 3ERCA 4D8YA 1GKLA 1Z5WA 2Y0CA 5KHAA 4CR8A 4F97A 2FZ4A 2NSDA 4JVNA 3LP5A 4QPJC 1FFXA 4WXPA 1IFXA 2OLJA 1WW3A 2Q1YA 4Y0NA 3VR4H 2B36A 3RBXA 4QZVA 3UGKA 1MB9A 4KGZA 2JCXA 4BLWA 2PCLA 4ZAVA 2IPLA 1P0IA 4ENWA 3KS9A 3HACA 2R66A 4QOEA 2NU6B 4RHXA 2HL6A 3SI7A 3SZGA 1Z8HA 2HW8A 1X7GA 2QUAA 3M89A 3W3AA 1DT5A 1E0JA 1FRZA 1FXUA 2E2WA 1Q1AA 5CH5A 4S2EA 2QXTA 3U49A 2CFRA 1CDZA 3FYHA 3HY4A 5B2ZA 5THQA 3GPIA 5JU6A 5JO0A 2PX4A 4KMRA 1U2RA 5BNIA 4ZCPA 3G2IA 3ROGA 4S05A 3P9NA 5BORA 3UWOA 4JX8A 2ZTHA 3O1JC 2GNOA 4HKTA 3MFQA 3QEMA 3V2IA 2RGUA 5A2GA 3I5UA 1UBNA 1M8FA 2Q4EA 4N3AA 3J80A 3R7SA 5A03A 4BV3A 4CKYA 2A94A 3F6RA 3QF4B 5K45A 3RF7A 3DWGA 4LSMA 5BT8A 1U1EA 1Z06A 2GN1A 1W94A 3NVDA 1XWFA 2FOLA 3QFCA 3ZNOA 1I4LD 3I2GA 2XX3A 4Z4FA 1KRWA 4XSGA 4D2IA 3L41A 1OAOA 2J9YB 3P5SA 1L4NA 4KO8A 4Q3OA 3JX9A 4W7HA 2IBSA 3B3FA 3BJRA 4MV6A 1KI4A 3Q7IA 5CNKA 3I0ZA 5G0TA 3DOFA 3TZKA 1SBTA 1AF4A 4IGEA 2RIPA 3GMSA 3LHDA 3WHLA 1UFRA 1CS0B 2PGXA 3TLAA 4DCMA 1RYBA 1XCMA 3BZUA 3C1UA 3TUJC 1XD2B 2DJ5A 4Q7KA 5EJ4A 2JKVA 2VPQA 3NHSA 3WIBA 1CDEA 2ETXA 2QX9A 4P8RA 1T10A 5DU2A 4G36A 3GGGA 3NH6A 5FWNA 1IUOA 4OUKX 4WEOA 1BOOA 3WGKA 2CFOA 3KLNA 3TOZA 2ZDQA 1ZSYA 2A30A 4Y2GA 2UAGA 2WYUA 4N3GA 4Y1FA 2XITA 2LIPA 1XZJA 2HLDA 4BMOB 3U26A 2GK6A 4TKVB 6AT1A 3V55A 1XKLA 4DLVA 1P0CA 1EFVA 3C5WP 3Q9LA 2DFPA 3NOVA 1E5LA 3K6KA 3RK1A 2FFRA 1L3CA 5ALGA 3DCNA 1FUIA 5CK5A 1EIWA 5DTRA 4MV0A 1P4JA 3KSBC 1ZK4A 3E22B 2AW3A 1Y42X 4RHFA 1VBFA 5D8DA 3VR6A 1LZKA 1RI2A 2JI4A 3RHZA 3QOYA 2BKUA 3RI3A 3IVRA 3JAWB 4D6YA 2YXDA 1CXZA 3C3AA 2XCLA 3LHKA 2MR5A 1TADA 4DHEA 3H9UA 3LFHA 1NN0A 3NNSA 4MJLA 1WZNA 4YAKA 4MGYR 2IUSA 3WJ7A 3RYFA 1ZGHA 1A7UA 1PS0A 1Y33E 3I2JA 4MLCA 4PRKA 4ZGWA 1ZOIA 3JVVA 4RYDA 1EX1A 3I53A 1XCGB 1NL3A 1VE9A 1PFKA 2XE4A 2J85A 4KSYA 4L6CA 4CNBA 1NJ8A 1U1IA 4IH1A 3ZTYA 5B12A 3L1KA 4FT2A 1AY0A 1W1UA 1K4MA 3H6GA 3Q72A 1L5YA 1M72A 1QGED 4FKZA 2NYAA 5DLQC 3FY4A 2PKQO 1QC5A 3S68A 5I4CA 2R47A 5K0FA 4QGHA 3BSSA 1L1EA 3ESYA 1TTHA 4JLOA 3P0RA 2QRZA 3CUWA 1C4KA 1TLTA 1ZUNA 1NPDA 2P8JA 1K4YA 3BHMA 4IQ0A 4B47A 4CIWA 5MN6A 4E21A 4EUHA 1B23P 2QL7A 3H1AA 3MINA 2W22A 2Z5LA 1ACJA 4CKEA 5JAPA 1W0CA 1RABA 4IZIA 1IZ0A 2CD7A 4FC6A 4MS4A 1IQUA 2VDOB 4P4LA 4YA6A 3ZCUA 1T5DX 3MWDB 3NVMB 1TZBA 1WSBA 1Z0IA 2MSNA 4MW5A 5KJ6A 3BX1A 3DF7A 4EA7A 5BW8A 5LYJF 2W43A 1AO0A 1N32B 4FEAA 4DCGA 1U63A 1QMPA 5AM0A 1J2RA 3U7EB 3MT7A 2AMJA 4OYRA 1V7CA 1OE0A 1SVKA 2ODWA 4W4TA 4ANFA 5C3MA 2CNWA 3P2MA 1LLUA 3JCZA 2PIAA 1EPUA 4OGKA 1XZGA 2CK3A 4FGKA 4IJ5A 5IP5A 5B3LA 5BQ3A 1YKGA 5HKKA 2QYSA 2ZJAA 1R5JA 3WO1A 3Q3HA 1N4AA 3IEUA 4G8JA 1MC4A 3QNMA 1U8CB 4KNVA 4EHFA 4DARA 1ID8A 3QPCA 4JXXA 2EATA 2VP6A 1P19A 1C30B 1TM3E 3FG9A 2V7TA 1GPKA 4L22A 2VPTA 1M1YE 4XRRA 1NFRA 4KH0A 4IVQA 2IHBA 4BJHB 2NU8A 4CQMD 2DECA 5JCJD 4YJGA 5A3JA 1TMGE 1SPBS 4GKVA 4BATA 4JL8A 1NQ5A 1ZH2A 1ZJ6A 4Q3EA 2HA0A 4UKDA 4DMCA 2P2YA 1WQ4A 3KP1A 1QQTA 1KYXA 1QZ3A 4NI5A 2ZWIA 2R7AA 4R1QA 1XFAA 2FB9A 3AERA 3IIJA 2R1TB 2G7MC 2YJ6A 4ENTA 2H06A 2LTAA 4M54A 4TRJA 4X93A 4OKIA 4V0LA 2EZ4A 1QTIA 3HE3A 4Z9XA 5I7HA 3P9KA 3AV0B 1L5NA 1SU7A 1DQYA 2RAVA 3U19A 5HFAA 2UUOA 2WZBA 2Z04A 4HDRB 4REQB 5TY0A 2IOQA 4V0NA 4EZBA 4KV7A 2I8CA 5DTEA 4N5HX 3PA8A 4FYVA 1AT1A 3IHKA 2QN8A 2H11A 3MJEA 1G9SA 4MMYB 2HWKA 1JG2A 5D1HA 4EARA 1FC0A 5AK6A 1KYYA 3HLYA 1W30A 4O2AA 4F0JA 2J59A 1U2SA 5CLQA 4Z0PA 5H70A 1OI4A 4A92A 3LLMA 4W7IA 1IG0A 4DRXA 4QODA 2Y77A 1XTZA 1P1FA 4PBSA 2W6NA 3LY8A 4F5YA 3SQNA 3PEFA 3ANMA 1M2FA 5H16A 4TL8A 2SBTA 2XYQA 2L18A 1MZPA 4ZOLF 2HI0A 1G2OA 2D8MA 1EG7A 3FWHA 4XCXA 1AKUA 2B8JA 3VNRA 5I9NA 1W29A 2EZUA 4M9SA 4B83A 5KYYA 4BNHA 3QEBZ 5EVCA 4A5SA 1JU4A 2G6BA 2R2GA 3I37X 3AVPA 3FYTA 1P5RA 5HFNA 2MSDB 3F8WA 4TT8A 3TQOA 4CT5A 2BZ0A 4JBLA 2BMDA 2CD9A 4QXRA 1DAGA 4Q5IA 1E20A 4YQZA 4D9JA 1HZZA 5TGZA 3GJYA 4JK3A 3BXFA 4JU8A 4ZOBA 2V55B 4R2XA 3SHVA 1TGVA 1G5HA 1EESA 4PLYA 3FFXA 5SZKB 1JNYA 1ZUD1 1U4OA 5HKOA 1EM8A 1XRJA 4JLVA 3KB1A 5TGDA 3GQVA 2B4YA 2H2FA 2V7XA 1BA3A 1KS2A 1VIDA 4CXMA 4M7WA 4P35A 3NT5A 3WLLA 2QT9A 3NTXA 1M6VA 1WCV1 4M36A 4U39A 3WYBA 5DK4A 1DRWA 4MCJA 3GUVA 2I2BA 3CURA 3N0WA 1LQTA 5CT8A 4Z4CA 7AT1A 4J43A 1LDMA 3AT1A 3IMCA 3PUZA 1UM9A 5F4BA 1GGEA 1WUIS 5AVVA 5JFGA 1II0A 3MJFA 1JR3D 3ZC3A 4AT1A 4EEKA 3FFBA 4HPJB 4IDDA 4L1KA 1VRWA 2UZ0A 3QVTA 5K0ZA 4HAYA 5P21A 3WAGA 4N4AA 5AI4A 3ANLA 3SYTA 5JYDA 4DA4A 1T6YA 4PGHA 2QR2A 3ICQB 2I1WA 5E4JA 4KVZA 1J2JA 4EPWA 4QARA 4ZKDA 4KIUA 2OGZA 1IN6A 1JR3E 3LCMA 3VR5D 3WXMA 2OAQ1 4PRZA 1PFYA 1MN6A 4BX2A 4XLTA 4FQ5A 4ZQEA 4WINA 5KYUA 3ZU6A 2Z4SA 3RU9A 4WLFA 3LUFA 2BMVA 3FAKA 5HJEA 3H5RA 4R7ZA 2FZWA 4P5DA 1UZLA 2FWIA 2HQOA 2QY9A 3I42A 4TV8A 2NUPA 3DMNA 4YONB 4F5EA 1BX0A 5HCIA 1PNRA 3LSTA 1OU4A 2I9PA 5JARA 5EXTA 2HBQA 2JFOA 1PJ2A 1K6XA 5L7WA 1O6ZA 3IMGA 4YP1A 4PY2A 5EXXA 5BT9A 3BIJA 1U9CA 2VQEB 1H2YA 2ZJBA 2ZW9A 3KQUA 1OPRA 4BO4A 1BCRA 4K8RB 3K0AB 4RTJA 1NW8A 1R7RA 3SK0A 4HAWA 4B44A 3NB0A 4HYYA 4N0EA 2O8BA 3FHJA 5EE1A 1HE4A 3GRRA 1RRVA 4HATA 4AN0A 1SXHA 4R68A 3GIDA 5IDYA 2VHQA 4ZDKA 4Q7MB 2GT1A 2RCNA 4RF5A 3WGMA 3TLJA 2QPOA 2YWBA 2BELA 4YPFA 3SSOA 2FUKA 3E58A 1F9AA 1TTPB 2P6MA 3E3AA 2VNKA 1Y6GA 3OHSX 2JFWA 4P84A 3KYCB 4Q4LA 5KJCA 3CNHA 4ZVKA 5I4BA 3PHCA 3VU0A 3IEMA 2Q6KA 4D41A 1SBZA 2IX9A 4UXJA 5KVQA 5AYVA 4DYHA 3CVVA 3L4SO 2HY7A 5NLLA 1GXSA 2KLHA 4CM4A 4JI8B 2VS1A 4E14A 1V41E 2EFGA 3RKSA 4EUSA 4ZXPA 2HJWA 4RHCA 4D4MA 3UJ7A 2AHOA 3HABA 3PEYA 3AP1A 2XD4A 5DI9A 3FJOA 3HUTA 1Z4JA 4FNMA 5E6SA 4DJDC 1DT3A 2YCLA 3RUPA 4AO6A 1RKVA 5I48A 1YKSA 3OZ7A 4P7GA 4TQ9A 5E6RB 2PSFA 2H31A 2ZSKA 1RNLA 1T3GA 1ZIYA 1H93A 2AUMA 3F5DA 4EA9A 3U4QA 2P2ZA 1BS9A 5EWLA 4CQMB 4EFMA 1KYWA 2ODBA 1W44A 3BTUA 5CNMA 2GHRA 2NU9B 1YNOA 3H6KA 3W77A 2H9IA 1UKAA 2YYYA 4ND8B 3EZGA 5LIRA 3IIMA 4XYEA 4G01B 2LRHA 1QCDA 3B7GA 3L7JA 3BIXA 5HK8A 2HUNA 3EQ2A 1SY7A 3O4FA 1QJCA 5F2NA 4B7AA 1U6IA 2O8NA 4QUEA 4ZI7A 4INZA 1WMFA 4TWRA 1MC8A 1T9BA 1MP0A 1QIJA 5BSVA 5JH7A 1PFVA 3KHUA 1JPNA 3EIHA 1XQYA 3G88A 3IBSA 3WIDA 5B36A 1ZDMA 3FNEA 4HFRA 3W9UA 2QG6A 5FWYA 5FPYA 5KBYA 5KYXA 3TR5A 3N76A 4M1QA 5I9MA 3UQYS 3O7WA 4TS1A 4ZANA 4BP9A 1TM1E 4QEZA 4MQLA 1Z5UA 2X9GA 1QR2A 3KFVA 3ZWYA 5U4QA 4ZMBA 2O5CA 1T4CA 1T8RA 5FOXA 1PGPA 1H5QA 2VK1A 3TQRA 2Q21A 2MSEB 4I4NA 4BAZA 2VG8A 1Y1TA 3KLBA 3SXUA 3H8VA 2FMXA 1M6YA 1FJXA 2CUKA 1ZRMA 5AW5A 2PY6A 3B6JA 1GTZA 1RP1A 3UT5A 4ALMA 4DDVA 1GADO 1YULA 3EYAA 3DQQA 4J0JA 4PONA 2PN1A 3ZCQA 5J2TB 1OXVA 3MXTA 1KU6A 2F59A 1RJFA 2GUWA 4IUDS 1IOLA 3ABOB 4TLDA 2X2FA 5FORA 5BW4A 4BP1A 5AVZA 2WSBA 3WL4A 2OQ2A 1CZLA 4UAVA 4PINA 1UKBA 1T8SA 1TKRA 2FRDC 2FWNA 2RGDA 2XAUA 1BRMA 4XQ0A 2WUFA 1WVMA 2AEJA 1KFBB 1N5KA 3BGVA 3PHLA 3EW9A 4QPCA 4V3CA 4DEXA 1A82A 3DBRA 3BDVA 3AF5A 2YXLA 4I1VA 2XZPA 3OOYA 4K88A 4WKCA 3THYA 3A2MA 1WCIB 5EA2A 2B37A 4UOEA 4AN1A 1FVXA 2BE9A 4AI6A 4LVOA 2RBGA 4WOBA 2NXNA 4O59O 3REOA 3T5TA 3EFBA 4B4UA 3L1HA 3IQXA 4IXMA 1QZUA 4J0KA 4EI9A 3INYA 3B1KA 3KKNA 3LT5A 4YRFA 1O96B 3CVWA 2P5YA 3O9ZA 4QIHA 5TQ0B 3GJ3A 4C76A 4EL0A 1XRRA 1D2RA 1P1RA 1WIWA 2XW6A 3TRKA 3ZVNA 5DYTA 1H2HA 3TQSA 5AW8A 4EGFA 2P8SA 1NLZA 1RLMA 2OY0A 4JNKA 3SE7A 3BN3A 2OFOA 5FUQA 1SEVA 1U80A 2PDAA 4Q39A 3WMFA 3L0SA 1UDRA 4DDKA 3IXMA 1IHPA 5L4NA 1RHJA 2PMDA 1BJKA 3AR9A 4G1UC 1YVPA 5ALLA 2NPIA 4JELA 5DTIA 3CWZA 4LXYA 1II8A 4IDGA 1J2YA 3HZZA 1T6ZA 3ZHZA 5KQSA 2FW8A 1KRHA 2FDRA 4CT0A 3TLKA 1BMDA 1CW2B 3C4JA 2A9JA 2Y1FA 3H2KA 1T4GA 5CH8A 1GY8A 2I6SA 4RLHA 4UHJA 1A9SA 1YHZA 2B5WA 2HIGA 1O9HA 3SOPA 3R24A 2FVYA 2VO1A 2X3FA 1NZJA 2P67A 1UOEA 1OFGA 2PSJA 4RKQA 1AMUA 2BKVA 4I19A 3JWHA 2ZLBA 2XUAA 1ZBQA 1F5NA 2A86A 421PA 3VAZA 1NV8A 5DZSA 1KZ9A 1VECA 2AZTA 2GEDA 2OILA 4KH1A 4L8LA 3FZYA 3U7IA 4FVTA 3FOZA 3JQ8A 4AMBA 1BMFA 2HMVA 4PPNA 3SP1A 2PUCA 1L7BA 2CLKB 1GPYA 1KMQA 2LVBA 2WT9A 2XCIA 2XMRA 3DUFA 3IO3A 4PAGA 5LBIA 4CL3A 5DNCA 2DBVO 3DM5A 4ZTBA 2G63A 4ERXA 1RQLA 3CEAA 4MPPA 1O6GA 2ZYWX 3AHCA 1JI0A 1X77A 1Z5VA 1TJ4A 3LQFA 2I55A 3ZHYA 2QMOA 2B25A 3DKKA 3ESDA 2B4QA 2RGRA 1N6HA 4R40A 3BULA 4G5GA 2DQSA 1ZMRA 2ZRDA 4NNJA 3V97A 2PUWA 5IUKC 4LWZA 3Q40A 5CGZA 5T4FA 3TEFA 1IU9A 4BEBA 4YAWA 2ZETA 2E4VA 1YFLA 4HLDA 3V1TC 3AVOA 4QGSA 1N36B 4B9EA 2ODNA 2AEMA 5BR8B 5ELLA 2NAPA 4IIJA 4O0LA 2DTEA 1OXMA 3A9SA 4JUAA 2A7QA 2IHKA 5HFJA 1B6TA 3ANSA 4J16A 5EJMA 2H18A 2OV8A 2P9BA 4CG0A 1CDDA 1XZDA 4L5BA 3FTFA 4FGUA 5MFPA 2H52A 1RRMA 2I4TA 1QH1A 1XXHA 2OC9A 4NOKA 5E7MA 5LP6A 3X2EA 3ZY4A 4A8TA 5CXUA 4H35A 2CHGA 4PNZA 5LN1A 4AC9A 1W0JA 1KAGA 1E3DA 2R44A 2VK8A 2AXQA 3DEHA 3FUWA 3K0CA 3A06A 1I01A 3EDYA 1OFVA 5K1ZA 5AW6A 1XWWA 3PGA1 3MT8A 1ZH6A 1OLUA 1AJEA 1N2GA 2EZTA 1Q1BA 1UBRS 4YCCA 1XZHA 2IPXA 5JDIA 4UBKA 2ERXA 1NSFA 5BN4A 3TD2A 1XRMA 4BKQA 3JPWA 1BN7A 1Z22A 1JDZA 3CA8A 4X97A 2HA7A 3F2IA 4G5YA 2WEKA 1EFRA 1DHTA 2PSDA 3L6DA 2XR1A 4JXZA 5IYZF 4YQFA 2O5EA 5D87A 1XQVA 4B3IA 2J07A 2GPNA 3KZ1E 4RA9B 4BTVA 1D8TA 1JB1A 4PVDA 2H1OA 5EZ6B 2C04A 3W6NA 1XKXA 4U2FA 4OXQA 3OH8A 4OQPA 4OJMX 1A88A 4Z5XA 5DWQA 2IHNA 3HM2A 4EY7A 1ONBA 1OC4A 1JG7A 4YMGA 2FSVC 3HJRA 3B1ZA 4IVPA 1FVFA 4PXSA 2OHFA 4I2VA 4XKJA 1NXPA 5BOSA 4D3ZA 4P0TA 4URVR 2FSGA 3WLQA 1Y8CA 2A9RA 4W5HA 1G4HA 1SC1A 1TVKA 4YRIA 2HNBA 4JC0A 1UBEA 3UC5A 1W6UA 1DHRA 1T3TA 3CLKA 3BZBA 5G02A 4UEJA 3L6CA 4H4EA 3KKLA 3LBYA 4M60A 1XZQA 4B31A 1FQWA 3ND6A 4P32A 5F4ZA 4QDXA 4KR2A 1KAMA 2ILVA 2Y1XA 3DZGA 4LJYA 5JJCA 3D7MA 1JU3A 4OY3A 3TSYA 1X8LA 3QVGB 5AI6A 3P45A 1Y7LA 4HMOA 4U2KA 3LQQA 5IJ9B 2QTTA 3FNRA 1FZQA 5AH0A 2GM4A 3DDWA 4KJZA 5AM5A 1I4EB 2HIHA 3OAAA 4IWXA 1PTJC 3SICE 3T8YA 1EK0A 3BA1A 4JLNA 2V7UA 3NWEA 4WV3A 3RVRA 3IB3A 1NW6A 3H18A 3PFNA 4MP8A 2JBAB 1R16A 3ANYB 2D5BA 1LH0A 2QP3A 5KC8A 2B8NA 1UOOA 2D54A 2ZSEA 1I13A 2O3TA 5MDHA 1AQ6A 1ISGA 2A5DA 3OEEA 3OLYA 3IILA 1Y0BA 4HEQA 1F4VA 4XD7A 5TVGA 1DEKA 1X86B 2QTCA 3CLSD 3PDIA 4M4SA 1ETUA 4JR2A 3IDSA 1MU0A 4XIGS 5LDGA 3RAGA 3U16A 1YCHA 1KEZA 1I9GA 1JX6A 1PL8A 3S1AB 1FDOA 4MV9A 5AVWA 2EJBA 3P0JA 4GI1A 1JQ3A 4OGFA 5BYBA 3P26A 1IEQA 4B3DA 5E3HA 4B76A 2Q1UA 3WSVA 4YXWD 3K7EA 2N75A 1ZUWA 2BLNA 2WQZA 4N5NA 2BM9A 3RM3A 1IL0A 3SEFA 3AR5A 1RI1A 1HFWA 4FN4A 3FNHA 1TEVA 4RDHA 3G8YA 1ZD9A 4XEHA 3ZGOA 4A0GA 4CCYB 3T1QA 2B1IA 1DVRA 5JRJA 5JNRA 1DCTA 4A36A 1ABFA 1EAMA 2REBA 4Y1RA 1M3SA 4CEJA 4PX3A 3K70D 3FROA 5CLIA 4LZOA 4RZHA 4DWOA 4KX5A 5GMOA 3CFYA 4NFSA 4DF3A 4GE0A 4IJWA 2Q6TA 3MAAC 1NN5A 3CZMA 2R0QC 3C3KA 1Y1LA 3KBBA 3ONEA 2GCOA 4ITUA 3X43A 5TSDA 5FV4A 1KYQA 1P44A 4PBRA 4C0LA 1Q1ZA 3NRJA 1E3IA 3RAPR 2ZWVA 2J8ZA 2O19A 4YCLA 2JHAA 2XKJE 3QPAA 1QPBA 4DCSA 1CUUA 3TRDA 4BVFA 4K6HA 5DHFA 2RHOA 1I3LA 2QHXA 3LZDA 4CMKA 4KQJA 4ZQGA 3UGTA 1SUWA 3E2IA 3GLIE 3S40A 1XMIA 2ZWPA 5CA0A 3SNHA 3TSCA 1BEEA 2F00A 3DW3X 5TLSA 2JIDA 1NATA 2DH6A 4CEIA 1PV4A 2Q2WA 1HR0B 3SY8A 1VL0A 4RZ3A 5G4KB 1CUJA 3IAS1 4QBTA 4FSHA 5DNUA 1LSSA 1A1SA 8MHTA 3P0EA 3AJEA 1Q19A 5BRNA 2IXAA 3OQIA 5D84A 3G17A 4LJ5A 4KXFB 1W85A 2D5LA 2W2OA 2ZUTA 1E9RA 3GMTA 5I7UA 1J22A 2X0JA 1LBEA 3HA7A 3QMWA 4MW1A 1QDEA 4KPFC 3V4VB 1KZHA 2OCIA 1OJLA 2QT1A 2Y93A 2ZPAA 4RZXA 1A7KA 4EJ2A 3E03A 1CQJB 2G72A 2GI4A 3V32A 1WXFA 5CX1A 4JSYA 1EEHA 5FFMA 2XGMA 4RHYA 3NW9A 4AJEA 1KMHB 1X8KA 3LF1A 4PAOA 3H5AA 1HSOA 1Q2UA 4FOPA 5JTUA 4GIBA 5DNDA 4B4DA 2OD7A 3U56A 4U7FA 3QVOA 3ZIAD 4I3FA 1FCJA 1EDOA 2UUPA 4ZARA 3UWMA 3K31A 3GA7A 4JI3B 1J06A 3DDUA 1J0XO 4OHRA 5L7YA 1G2QA 3ZXSA 1KSHA 3FE2A 1RZUA 2QVGA 2WP8J 2DRIA 2XEXA 4E5MA 1UPUA 3L8HA 4CWAA 2G9UA 1KH1A 3ZDCA 4CMEA 1I2CA 1N9GB 4CG1A 5CXXA 1M1NB 4TMWA 4ILEA 4F6CA 5EG5A 2Q5FA 1P8JA 2PANA 4B1FA 3KR1A 2CFTA 3KYDA 4BQPA 3DYIA 1A98A 4ZVSA 1XLVA 4IQ8A 3U0BA 1V95A 3QUSA 2GLTA 4J2HA 4AFNA 3PBKA 1LJLA 3RT7A 1H4TA 1QIEA 1PP4A 2PV7A 3DL4A 3M6MD 1JFFA 3PXEA 3JQCA 4KIJA 2FX2A 4MIYA 1IM2A 1C2YA 4QLBA 1BXKA 4YRJA 2HHCA 3IAAA 4OP2A 3WYAA 2P6RA 1GAXA 3VOAA 2OCGA 4YRGA 1B15A 3IV6A 2CF5A 3HUUA 4ZDWA 1C1HA 4QOIA 1ECBA 5T8KA 1R0KA 4TT3D 4E7PA 3PKZA 2Z8YA 3QXJA 4UQOA 2O5VA 4TV9B 4BMZA 4DA9A 3SSMA 3BREA 4U2GA 1XD2A 3UJNA 3H1FA 1TKCA 3CRMA 1W49A 1QANA 1XDWA 4E94A 1PBTA 4NEHB 1Y5MA 4RJIA 1B73A 3EIFA 4HWKA 3AR6A 1P9WA 2CXXA 3QVMA 5FNVB 4J1QA 5C3UA 4ZIRB 4ZYUA 3GRUA 4G37A 3PL1A 5MN5A 2WT4A 4U8GA 3DLAA 3G8CA 1NLYA 5ITVA 1KJJA 4RKEA 3PPYA 1XT6A 2R5WA 4YAGA 2Q7DA 3MT0A 5BNFA 1XVTA 5LC1A 2DQZA 2O4CA 3L8CA 2ZK7A 3PQCA 4LIPD 3FLEA 1ZHHA 1KI6B 3BD7A 3BWBA 1MIHA 1V8FA 4NDAA 1XJCA 2C5SA 3LCUA 4IILA 1ECCA 1FDVA 1IEXA 2EJWA 2VNHA 4L75A 4YUZA 1X7WA 3NBKA 5J23A 3VNUA 3ULKA 2IT1A 1K86A 2R6AA 2QT0A 4YAFA 2IJGX 5ARDA 3JAWA 2AI1A 3GO4A 4LJ7A 3VR0A 3L40A 4PHFA 4E5NA 3S70A 4V0OA 5DM2A 4LS3A 3K70C 1VG1A 1UXIA 1YB5A 2F9FA 3GLHE 4FW9A 4QDKA 1PEAA 2Q27A 4JI5B 3N7UA 3QKWA 1X2EA 2X5OA 2DFKB 2YUIA 4II7A 1KR5A 5FTWA 1F38A 2YVUA 4I9GA 4MQUA 5EP1A 1EUDB 4IXTA 4F4IA 1B26A 3F67A 2OORA 3FUXA 4WCFB 3OX1A 1J9EA 2WTUA 1XIVA 4NVRA 2BHRA 2QS9A 3E9MA 1Y1KE 1YBVA 1R0XA 4GLBA 3X1MA 2I6UA 4ID3A 1PJAA 1T0HB 3JYNA 2OHGA 2OBBA 3N3BC 1AH2A 1CRWG 1DUSA 1JP7A 4NHOA 4P53A 3A27A 4DV3B 1HNNA 4H7KA 4ACAA 4G09A 4OSOA 3QXXA 1OI7A 3EPRA 3THRA 1ZI9A 4I6EA 4WA8A 4UNRA 1PG2A 1FJGB 1X8JA 2VHZA 4MRAA 4XYBA 1NQXA 1N2HA 3G13A 4M8KA 4R1UA 3VPDA 4JI6B 2YY5A 3OO0A 3IMKA 1RPAA 2ZKLA 1PGQA 1UXOA 3RSHA 4BVEA 4POOA 4BX8A 4MS1A 4Z4HA 5JHGB 2CVZA 2JL1A 3R2JA 1NBHA 1UBHS 4HWOA 3TD6A 3ZDQA 1NBMD 2H0AA 5COAA 3SR4A 4BBJA 1DXYA 3ZQJA 1LRKA 2O3QA 4Y1GA 2HDHA 3ZY6A 3JQGA 4HTFB 4DTIA 3GJXC 3SC6A 1RAGA 3HC7A 4LRSB 5KUTA 1XHFA 2C96A 5K8CA 3KBOA 2D1TA 4KRGA 1XPRA 4ZAZA 3C0KA 1G9TA 3LBIA 3JQAA 5J2UB 3TX2A 1YXMA 4TVOA 3HXKA 4A6PA 1NBME 4QKQA 5C8VA 5CB4F 6PFKA 1JLLA 4AW9A 1QQAA 4XTCS 3V4FA 1A5TA 2Y99A 3UV3A 3ZHCA 2AXNA 2GK3A 3MIIA 1P5JA 2XCTB 1JIJA 4AM8A 1SXIA 2COKA 3MMZA 2D6FA 2OCKA 2QK4A 3R3JA 2JD0A 4KODA 1AZWA 3EVGA 2E4YA 3QUCA 1NWCA 3NUZA 1JL3A 5C34B 4JKIA 4WJZA 1SB8A 3D3WA 5EZYF 1DO2A 1RRKA 1E0AA 1JFRA 3GI1A 4U9IS 1AGNA 3MRSA 1JLSA 4UCXA 6CHYA 1YR2A 4LOIA 2IU3A 3N8GA 1JN0A 3PNSA 3CNLA 1K7FB 2FNAA 3MOIA 3RTBA 1U5BA 1WZUA 2ZI3A 4XR4A 5CDYA 2JLZA 3GFSA 1H1LB 4NOJA 1T24A 4RTSA 3BRWD 5IVIA 3F9RA 4Z1OA 2GKOA 2WILA 5TR9A 4ZHQB 1II9A 2GXUA 3EZLA 3QOXA 3WYNA 4FZ3A 5EUQB 4BNDB 1HKHA 4ZJPA 1A1VA 5LXTF 3WOHA 2JFZA 2Q4RA 2VYQA 1JQ5A 1JPUA 2WU1A 3ADPA 3B1WA 3L01A 4L3VA 3PNKA 4LEIA 1ORVA 5CHYA 4EVQA 1B8OA 5F77A 3VO8A 1JVNA 3PFFA 2JS7A 3FOCA 4LCBA 5L4LA 1VKHA 4A6XA 4F3KA 1D5WA 4HUQA 1GRQA 3G2JA 1AHIA 3JWPA 4IFIA 4FFSA 2R9VA 3IEXA 3A4IA 5KOYA 3I6YA 3PFCA 3LT4A 5CCXA 1TYEB 4ENQA 3U4MA 2PU7A 2XBUA 2D74A 2GSDA 5G1OA 3GGJA 4WSOA 1ZJWA 2X6QA 2YZNA 2RGWA 4ID9A 2IK8A 5A3RA 3OOHA 3TPZA 5C4GB 2GBIA 3BH6A 4ZDJA 3CIOA 3SHWA 1QHHA 2YRFA 3DBLA 1JXQA 3Q9NA 2DMRA 2JC3A 1CJSA 2TMYA 3M6UA 3EEOA 3H75A 4YP9A 5JANA 4LRYA 1U81A 5B2FA 3DB2A 5TMPA 4QU0A 4UHBA 3QX8A 2ODAA 4KO3S 4XYMA 4HNUA 4OB7A 4DL9A 2XQGA 3SM3A 3KT0A 5I4IA 4WI1A 1Z7YA 4RTKA 1BDHA 3U1TA 1ZSVA 5H81A 4KTTE 5TPZD 1BWPA 5KCMA 3FGOA 3PYXA 3AVUA 2JFNA 3I9OA 4JBXA 3H04A 1WPQA 5LYYA 5F1YA 3SJUA 2IUFA 4DLZA 2IEZA 4IOKA 1UANA 2COUA 2GTHA 2XLBA 4GR5A 5L3SB 5LDHA 3SQXA 1AB5A 3M83A 5A5GA 2I99A 4C2BA 4O4HB 4Q1EA 2JB9A