4DS0A

Cell attachment protein vp8* of a human rotavirus specifically interacts with a-type histo-blood group antigen
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
163
structure length
163
Chain Sequence
GSTLDGPYQPTTFNLPIDYWMLIAPTQIGRVAEGTNTTDRWFACVLVEPNVQNTQREYVLDGQTVQLQVSNNSSTLWKFILFIKLEKNGAYSQYSTLSTSNKLCAWMKREGRVYWYAGTTPNASESYYLTINNDNSNVSCDAEFYLIPRSQTELCTQYINNGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cell attachment protein VP8* of a human rotavirus specifically interacts with A-type histo-blood group antigen.
pubmed doi rcsb
source organism Rotavirus sp.
molecule tags Viral protein
molecule keywords Outer capsid protein VP4
total genus 36
structure length 163
sequence length 163
ec nomenclature
pdb deposition date 2012-02-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ds0A00
2YZ4A 1Q8SA 2AYHA 3C2UA 5EWSA 1N1VA 2Z42A 1N1TA 4BMEA 5LK5A 1AZDA 4LBJA 5H9PA 1G9FA 1LENA 3LSDA 3D4KA 2EF6A 3AYAA 4YFWA 2D6PA 3O5SA 5H9RA 5FREA 1UL9A 5DZFA 1SFYA 2HYKA 3B69A 1BJQA 2D6NA 1DQ2A 1IKPA 2SBAA 1LHUA 2VW0A 4D69A 1DQ6A 4Q8LA 3T1LA 5KXEA 3WVJA 1OFSA 1LOBA 2ZMKA 4TYSA 3WDTA 4FPHA 3MPPG 4AVSA 5DUXA 2FHRA 1SBFA 3AZXA 4LBQD 5GZDA 2I2SA 3V0BA 5JOWA 1Z0HA 1CIWA 1W6OA 2A6ZA 4LBKA 1WCSA 4UW3A 4WV8A 3O12A 4YM3A 3ILNA 1G7YA 1JYCA 1YRZA 4Y22A 1LOEA 4Y20A 5HCBA 1LGBA 2GN7A 1AF9A 1A8DA 4FPCA 1S0EA 2A6YA 2ZGLA 1MACA 3AP7A 2AR6A 2P37A 4CTEA 5F9TA 4U36A 1HQWA 2GDFA 1MVEA 4XJ9A 2A3XA 5IUQA 3IPVA 1MS4A 2CWSA 2JE7A 5DUUA 2V73A 3WUDA 3W58A 4K1ZA 2PHTA 1QDOA 2YV8A 5T5LA 2RHPA 1UMZA 1I1EA 4K21A 2GALA 2GMPA 4JC1A 2AUYA 3AXDA 4SLIA 1GLHA 1VAMA 1SLLA 3JU9A 4YW1A 1RIRA 4LBQB 4R9DA 4WVVA 4YGBA 3WG4A 2P3IA 3ZXFA 3SH5A 1S0IA 4FOQA 5GALA 1V6IA 1IKQA 2D6OX 3OY8A 3RG0A 4FPFA 1CN1A 3N7KA 5JOZA 3AP9A 3OYWB 2JD4A 1S0CA 3N35A 5JDBA 4UW4A 4ATFA 1OKQA 2CYFA 1O4ZA 2W39A 1BYHA 1YIFA 1AJOA 1B09A 1N3OA 3AFKA 5E8AA 5GLWA 3WDUA 3WDWA 2DYCA 1R1ZA 2ZGUA 1G86A 1JUIA 3AYEA 4YGCA 4BLIA 2VW1A 4XHXA 5DG2A 3PVNA 2C9AA 5EYYA 2D6KA 2JECA 5T55A 3R4SA 2BQPA 4RL7A 2DUPA 3FUOA 2CY6A 2ZABA 3USUB 2E7QA 3FLTA 4AVTA 2W08A 4YG0A 2NM1A 3A4UA 1QGLA 2CNAA 5GZCA 4YZ1A 1KJLA 3ZXEA 1HLCA 4XIKA 5GZGA 1V6OA 2DTYA 2WJSA 3L2YA 2ZGRA 3RQ0A 3WV6A 1KJRA 1QOSA 4BPZA 4Q26A 4NO4A 4HANA 1ULFA 1LOFA 1FAYA 1GANA 2OUJA 4ITCA 1J1TA 4P14A 2PHFA 3M1HA 3MW3A 4FOWA 2EIGA 4YW4A 1MS0A 4XMIA 3ZSJA 3DGTA 3M3QA 3WLUA 2ZMLA 3V0BB 1HQLA 3KM5A 1DQ1A 1EPWA 3T1MA 4XJUA 1GKBA 1DYPA 2JE9A 3NWKA 1SLIA 2D6MA 2WT2A 5GZFA 1WD3A 2A6XA 1S0DA 2DU1A 5GLVA 1GSLA 1VLNA 4MYEA 2ZGOA 2PELA 4AGRA 1WW6A 2NYYA 3O0XA 4Y20B 3WZ1A 4M3CF 4YW5A 1NXD1 1D0HA 5JOXA 3WDXA 4R9CA 2PHWA 3ZXKA 2PHXA 3ZSMA 3AP6A 2A71A 2VH9A 3VKOA 3N7LA 1U0AA 2D3RA 2E7TA 3IPVB 2P34A 2E6VA 1DFQA 2AGSA 4H55A 4C1XA 1MS8A 4U2AA 3AYCA 4LBOA 1S0FA 3WDVA 4Q1RA 4XJ8A 2ZGPA 4Q2FA 1LECA 1V6KA 2SLIA 3VKFC 1DGLA 1LJ7A 3WCRA 4HL0A 1DHKB 3OY8B 5H9SA 3MEPA 5IK4A 1N47A 1LOCA 1SLTA 1V6MA 2UWAA 4PBPA 3PVEA 1MS1A 5JLVA 5T5PA 1LU2A 1SCSA 1WLCA 2VU9A 3ENRA 1MS9A 2ZGMA 1PZ7A 5KXBA 5GM0A 3ZYPA 1UX6A 4M3CA 1Z78A 1GICA 3AZVA 4IQPA 3LCPA 4GWMA 2ZAAA 3TAYA 3NV3A 4YGEA 2R0FA 1WUVA 4R9BA 1XQNA 3BODA 4XZPA 4AVVA 1LGCA 4XILA 4YG3A 3POYA 1DZQA 1QOOA 1C4RA 4RA0A 3USUA 1IS6A 4YW2A 1C1FA 1F31A 5AVAA 2DVFA 4AGVA 4GWNA 2ZBJA 2R1DA 2YXSA 1GYKA 3AZWA 4BMBA 1QF3A 1LEMA 3D5OA 4PCRA 4XJZA 4FPKA 2NN8A 5EYXA 2DUOA 1N3PA 4NOTA 3N3HA 1W6QA 3OPZA 1IS5A 3HN1A 3VKLA 4FOYA 2A6VA 1PZ8A 2EAKA 1RITA 5F5QA 3B3QE 2YROA 1QNYA 2FMDA 3DUIA 4XBLA 3RS6A 2NP0A 3WHUA 3AP5A 4Y1ZA 2C5DA 4DPNA 4XJWA 1IOAA 1SBEA 1AX0A 1ULCA 3PVOA 4I30A 4Y1UA 2DVGA 1LEDA 1ENQA 1QDCA 1WBFA 1N1YA 1JYIA 5GLTA 4OZXA 3PMEA 3FFZA 2E53A 4GALA 4PQ9A 3B00A 4AWDA 3AYDA 3OGGA 1WW4A 2WSVA 1KITA 1W6PA 1ENRA 3RMYA 1UKGA 1Q8PA 3POSA 4XIOA 1LOFC 4YZ3A 2UU8A 4FPEA 1FNZA 1V00A 2A75A 1ULEA 4GKYA 5T52A 4AYUA 1W0OA 2XB6C 1DLLA 4XXAA 1G9AA 3V65A 1I3HA 5DZEA 2UWCA 4JCKA 5T5JA 3ILFA 3ZVXA 2ZGKA 3BTAA 1F9KA 1WW7A 1H9WA 1Q56A 2P2KA 3WHTA 1FV3A 4XYXA 2R0HA 1C1LA 1G8WA 2D3SA 3BOPA 5CA6A 1QOTA 2A70A 3VKNA 1AX2A 1DQ5A 1FX5A 2UURA 5DZGA 2ZZJA 3O0VA 1DIWA 3QCWA 4YZ4A 4DQAA 1SLBA 1CVNA 4P9XA 2ENRA 4W65A 3SISA 3M3CA 4YLZA 3R05A 4M3CB 3AX4A 2ZHNA 3POWA 2H0BA 1RINA 5IT6A 2E51A 2LALA 5CNAA 2A3WA 4L8QA 3AP4A 2GNMA 1LGNA 3OJBA 4KBBA 1LCLA 5DG1A 5H9QA 1SACA 5CB7A 3ATGA 1CR7A 3RSJA 3ZPYA 1LHWA 1QKQA 2R1BA 3O0WA 4FVVA 4P9WA 5BYNA 2ZHKA 1G9CA 5JOYA 4ZXKA 1Q8VA 2V5YA 4UW5A 3D6EA 2DURA 3FLPA 3SITA 1S0BA 1AX1A 5T5OA 3WOGA 1FNYA 1JN2P 3GALA 3CNAA 1WLDA 4FP2A 1AXKA 4M00A 3NV4A 3WDYA 1SCRA 4P9YA 5T50A 3SH4A 5FRAA 4FPOB 1UPSA 1GNHA 5GLUA 1A3KA 1JBCA 4WZFA 4Y1XA 1BXHA 4XHBA 2VUAA 3W59A 1QU0A 1C57A 2VXRA 4FOVA 2CTVA 1AXYA 3WCSA 1W6QB 2EXJA 3UJOA 2DWRA 2Q5TA 1FYUA 5IK8A 2GMMA 2D6LX 2KM2A 2DTWA 3N36A 1WD4A 4M3CE 1LHVA 2JKBA 3BIWE 3VV1A 2P3JA 3ZXLA 1N3QA 3VKMA 1GBGA 5HCAA 4XBNA 3NV1A 1SBDA 1ZA4A 1JOJA 2WSUA 5GJ6A 2YY1A 4XDQA 5GZEA 2B7YA 3ILRA 1LHOA 1D2SA 2D43A 4XBQA 2ZHMA 1CJPA 1KQRA 1Y7BA 1GZWB 3I4IA 2AREA 1LESA 3IN9A 2ERFA 3V0AA 1NLSA 4GXLA 1ZM1A 3A0KA 1W0PA 2D44A 2CL2A 3I8TA 1N1SA 4XTPA 2WKKA 1W6PB 4GKXA 4BM8A 1MS3A 2ZHLA 1YI7A 1OQ1A 5E88A 1JXNA 2NZ9A 3U4XA 1CONA 5IK5A 3R4UA 3AJZA 3T2TA 4LBNA 3LSEA 1UZYA 1VAVA 2EXKA 4XJAA 1MZ6A 1F5FA 2A5ZA 2JJ6A 3ASIA 2DVBA 3AZYA 3OBTA 3WUCA 5JMCA 1W6NA 1DYKA 1MZ5A 1MS5A 4LBMA 4XXPA 2WLQA 1MVQA 2NMOA 2PHUA 3IM0A 4GA9A 4YG6A 1W6MB 1ULDA 3WG1A 4C1WA 1KRIA 3PJQA 2DUQA 3APBA 3WG2A 2DVDA 1IS3A 1GZ9A 2EALA 3UK9A 2A7AA 4YW3A 5IK7A 3N7JA 2ZA9A 3ZSKA 4BQ1A 3IKWA 2UWBA 3AK0A 2TEPA 4YFZA 2AH2A 3FBYA 4FPGA 1GNZA 1HKDA 3V64A 2D7FA 1V6JA 4M01A 3RMXA 1V6NA 3A0NA 4FQZA 1PZ9A 2ZKNA 4BOWA 4DRVA 1UZZA 1LTEA 1WLWA 2JDZA 3H0OA 3OBRA 1AJKA 4Y1YA 2ZGTA 4FPYA 3N7MA 1CQ9A 1SLAA 3HMYA 2YMZA 2WT0A 1DBNA 4R9AA 1S0GA 1SLCA 5E89A 1LODA 3IMNA 1G9BA 5HCFA 1KDKA 1KDMA 1S0JA 5DUWA 3WNXA 4Z8BA 4PF5A 3ZSLA 1Q8QA 3HR9A 3WG3A 1H30A 4ZKTB 2WT1A 3KQRA 4AGGA 1S1AA 3B9CA 4YM0A 3M3OA 2GNBA 2R16A 1WBLA 1UN1A 4FPJA 1G9DA 3ZXJA 4TZDA 3SH3A 1CPNA 1YO8A 2OUHA 3SNMA 3MW2A 1VALA 1Q8OA 5DUVA 3M3EA 3AJYA 2WNEA 1TEIA 3VUOA 4Y24A 4Q8KA 2EXHA 3AXEA 4WVWA 1FATA 1GZWA 4XOGA 1LOAA 5KXDA 4XMAA 1MR5A 2DU0A 2P3KA 3V0AB 3SLIA 1X50A 1UAIA 2ZGSA 1YXWA 2ZMNA 3B01A 4XTMA 1AVBA 3GNEA 4YM1A 1WW5A 4YM2A 2WQZC 2A3YA 2R49A 2OVUA 2W52A 1W6OB 3MW4A 3JUUA 1YYNA 3Q9OA 3ZYRA 4FPLA 2ES3A 2XG3A 3AZZA 1LOGA 1APNA 2VY0A 1GV9A 2ZACA 1DQ0A 1HDKA 4Y22B 4ASMB 1JW6A 2DVAA 4JRAA 2PHRA 1ONAA 2NMNA 2W68A 4YZ5A 1AXZA 1CESA 1W6NB 4K1YA 4UW6A 5SV8A 3UJQA 4BLJA 4YZ2A 5EXOA 3INAA 4FP3A 2OW4A 2ZGNA 2GN3A 3RRDA 1W6MA 1LHNA 1VIWB 1BKZA 2GMEA 1BZWA 4LBLA 5GLZA 1JHNA 4DFSA 1FV2A 2GNTA 5CAZA 2ZGQA 2CWMA 1IS4A 3UL2A 4CZSA 1LULA 4DRRA 4LBQA 3NV2A 2DV9A 1URXA 2AENA 5DXDA 1ULGA 3FLRA 3TB0A 4YGDA 4CRQA 2A6WA 3M2MA 1O4YA 4F83A 1LU1A 1DQ4A 1QNWA 4Q1PA 5T54A 4ATEA 2EXIA 4ISQA 1GZCA 4PBOA 1H9PA 1QMJA 3OYWA 2D3PA 4XE9A 4K20A 4Y26A 5L73A 4DS0A 1ENSA 2GNDA 3QLQA 3FUQA 4Q27A 5CBLA 1V6LA 1A78A 2ARXA 1CPMA 2ARBA 5KXCA 5JVVA 1BQPA 2G4IA 4FQ4A 2VW2A 2LTNA 4Y1VA 4ISRA
chains in the Genus database with same CATH superfamily
3C7FA 5EWSA 4Y5SA 4WM7B 2QCSB 4PI2A 4Z1VA 2CHHA 1AZDA 4Z92B 1M06G 3H42B 4H7MA 2Y8KA 1NAEA 3CZUA 3VHRA 5JUVA 3LSDA 4TXWA 2DCJA 3MFCA 3AYAA 2ID4A 4W6XA 1C8M1 4Q5OA 5H9RA 1EAH1 5DZFA 2HYKA 4XEZA 4AQ2A 5FZGA 4A7KA 2D6NA 4NAOA 4P02B 4PIZA 1DQ2A 4AFDA 4DXRA 4K6BA 3WQBA 3T09A 2W5FA 5JR7B 4D69A 1NCRA 3JCIA 1JYVA 3WVJA 1OFSA 1LAJA 4CDQB 5I0SA 5FZLA 2G9GA 2FHRA 2PMWB 4CDUA 5CFDA 1CWPA 1F5JA 4LBQD 2WRAA 2IXLA 4E2SA 5JOWA 1KFXL 3ZYGA 3BB6A 2XJTA 1CIWA 2HEYF 1UZWA 2A6ZA 2WFF1 4AEDC 4WM7C 4XAAA 3ZFEC 4QHBA 1RUE2 4XFHA 4FFFA 1JYCA 1YRZA 2XPJA 2XKOA 5HCBA 2GN7A 2QQWA 3UKVA 1AF9A 2JB4A 3MUZ1 4P9LA 3PHMA 2R7EB 2QQJA 1ASJ1 1EV11 3WT3A 4QU2A 5FZ3A 3AP7A 2GZWA 5C8CA 5HCHA 2W1WA 4CU6A 1OD5A 1HQWA 2CAUA 1MVEA 2RS12 2YGLA 4FI9A 2JICA 4UOJA 2R041 2JE7A 2O8QA 2V73A 3MDPA 1U12A 2WZ8A 3POEA 4AVAA 3TNQA 1RUF3 1QDOA 4UFJA 4E27A 4J6GA 1C3HA 2WWJA 3JU9A 1SLLA 1GOGA 4CEWB 1RIRA 4KGQA 4LBQB 3WG4A 2XKPA 5GALA 1V6IA 4RR3C 3OY8A 4YNIA 1YLLA 4B1MA 2OQ6A 3FMGA 3PUSA 4LE4A 3OYWB 4AZZA 2JD4A 1GQPA 3KHBA 3KS7A 3ZX7A 4BZ4A 5FZFA 1ACCA 1US2A 4GMP1 2B39A 3I54A 2W39A 1BYHA 1EP0A 4N43A 3AFKA 4QU1A 5FLJA 3ZMOA 3T3YA 4NHLA 2PAEA 3FX3A 3WDWA 2DYCA 1AYM1 4AR2A 1R1ZA 5C3QA 1HXS1 1JUIA 2FDKA 4EN6B 5J37A 4XHXA 2XLAA 3I2IA 3NNMA 2C9AA 3WEZA 5JR2A 2JECA 3OF1A 3R4SA 4IEUA 2BQPA 1YUDA 4XAEA 4XC9A 1PO22 1GUIA 1GNYA 3FLTA 4FFIA 2WINB 2Y38A 2GU9A 3ZFFB 3NJVA 4FXGB 3DCQA 1HLCA 3H7JA 2WZPP 4A6OA 5F2SA 2PLV1 3JD72 4QMAA 5I0RA 4IGOA 4E4DX 1PGL2 2FD8A 3RQ0A 1OH4A 5FCCA 3WV6A 1KJRA 2BBVA 4Q26A 4NVPA 1VBC3 3N9MA 1WCUA 4HANA 2WS91 4AG4A 1UYXA 2XJRA 5A33A 1J1TA 3EB7A 3M1HA 2DBIA 4FOWA 4YW4A 3ZM8A 3SEEA 1MS0A 1DGRA 2BFUL 3OBAA 1UY2A 5CU1A 4JKLA 3S6PA 2JDPA 5C33A 4WM8A 1HQLA 1HV1A 1DQ1A 1EPWA 2F4LA 4OZOA 4TLGA 4XJUA 2IWGB 4A2UA 2HEVF 1U5YA 1WD3A 1AR71 3WF2A 1VLNA 1WCQA 4OI2A 1XNCA 4P5YA 4AGRA 4JZRA 4Y20B 3CLPA 3WZ1A 4M3CF 5E16A 4Z2WA 1IPJA 3O1TA 5FY1A 1AYN3 2WIIB 3S0MA 3ZXKA 3UNPA 2VG9A 3AP6A 4QX3A 2ATFA 4QHOA 3OGSA 3T4VA 1U0AA 2D3RA 3DYOA 5F8PA 1O8PA 2XJPA 1RUE3 2WR9A 4LQRA 3DXUA 1XNKA 2IC1A 3LGRA 3K46A 2QJVA 4WZCA 5A3OA 3PMSA 4ZHNA 4MXWB 1V6KA 4CDXB 2SLIA 1DCSA 2GP3A 2BFUS 5F1RA 5KWRA 1XBFA 1RUE1 3ZO0B 1BEV3 3MEPA 1S4CA 3CJIC 1K5MC 4PBPA 1BK1A 4Y3OA 1FT9A 1SCSA 3LZZA 1PIV2 1XNTA 3S30A 3U11A 1NA1A 4M3CA 3WNMA 1OPOA 1GICA 1RUH3 1LKNA 2HWB2 1BEV2 3ALQA 3AZVA 4IQPA 4QX5A 3N4MA 4NRMA 5BNOC 3C7OA 3NV3A 1QXRA 3FBMA 4CPBA 4YGEA 2WS93 3KVBA 2WN2A 1XQNA 5FYUA 4B29A 5FY4A 4O9GA 2VNVA 4PJYA 4BQYA 1VMJA 2V72A 4GH4B 4MSVA 1W2NA 1D4M3 1QY4A 2JKXA 4YW2A 3VZMA 2WLPA 5AVAA 1OUSA 3ZYHA 1UMHA 2VJXA 5JXJA 4LO6B 5BY5A 5FO8B 2YXSA 4JGYA 5IWFA 4BMBA 4K8FA 1RUC1 4IDZA 4NWVA 5EP9A 3IDAA 5FZ9A 4G9SB 3UV9A 1O3RA 4N53C 2NN8A 1DGWA 1FMD1 3HN3A 1N3PA 2CDOA 1UMIA 3MUY1 2RVAA 1W3XA 1UCXA 3DPRC 4IERA 4QQHA 1UZ0A 1O59A 1RITA 2VO5A 4ZY9A 5LA1A 1EY2A 2YROA 3B3QE 2FMDA 1FMD3 3B9IA 4GD4A 3WHUA 2PA7A 3AP5A 4Y1ZA 4LJHA 3LIHA 2MHFA 2WS92 4XJWA 4Y1UA 5K0UB 2VZOA 3JBG3 3FE5A 3EXUA 4NWWA 1LEDA 2VULA 4E9KA 1ENQA 3IIAA 1UOFA 1OQDA 2Y6FA 2ZX2A 2E53A 3H7YA 4GALA 4HK8A 4JHZA 4AWDA 3C7GA 4QX1A 2WSVA 3BU0A 1DZRA 4XDOA 2Q8EA 1W6PA 4QWNA 1Z7S3 3POSA 3KCCA 4E8CA 1NUKA 3I2DA 5F3CA 2A75A 5ANNA 3ZIWA 4WVMB 4AYUA 2BP6A 2X10A 3PUIA 4I01A 1I3HA 5AVPA 3V65A 1JZ2A 1QJY3 1D2QA 1CAWB 4CU9A 3HQUA 3RGBA 2ZGKA 4NR1A 1F9KA 2Z79A 4NRPA 4RQPC 4QD2A 3ST7A 1UWWA 3WHTA 1W8OA 1FV3A 2R0HA 1C1LA 1YQCA 2VMIA 2D3SA 2RJLA 3I2GA 4KWJA 1QOTA 1DGRN 4XF4A 4AAXA 1DQ5A 3O1SA 5JSOA 5DZGA 2PN5A 3QCWA 4YZ4A 1F35A 4CDWC 4W6YA 4DEVA 2LW8A 5I8TA 1OF3A 5DAVA 3AX4A 3RI9A 1W8HA 3PUAA 4CXWA 3E6CC 1UYYA 3AKSA 5FWEA 1NCQA 4EN8B 4KBBA 4E4ZA 5FP8A 4B7KA 3I2OA 1CD3G 2OZJA 1MQTB 3UT0A 1WMDA 4DXTA 2W91A 4QPGC 3LOBA 3VBOB 1AYM2 2V5YA 4D7TA 3BPZA 3D6EA 4B8EA 4QPIA 2DURA 1TNFA 4IE6A 1HN0A 2WNVB 2YYOA 1AX1A 4LKFA 5T5OA 4RS5A 5HPOA 1FNYA 3GALA 5IW0A 4FP2A 4FFHA 2I74A 3QD6A 4JDMA 4V2WA 1X82A 4CCLA 1RUH2 1Z7S2 3C8XA 3K4AA 3K75B 4S2FA 5FMCA 1VJ2A 4WZFA 4Y1XA 2XUMA 4XHBA 5KHGA 2VUAA 1B35A 1QU0A 1RUI2 3GZAA 5J96B 3SKVA 2VXRA 1AR61 4XW3A 5F5IA 4LIUA 4GJZA 2CTVA 1RUG3 3LWCA 4CA9A 1ZRCA 5LWBA 1VBD1 1OA3A 2ZX4A 2Z2SB 4DY3A 1KEXA 2KM2A 4MX3A 3CU7A 1XU1A 4BHPA 2DTWA 4YYOA 2YBPA 1QJU1 1WD4A 3DECA 1TMF1 1YJLA 1JOBA 3QACA 4PLNA 3RWNA 5J48A 4IESA 3VV1A 2VZQA 2XJVA 1N3QA 2UY9A 4LHSA 2GC2A 4XBNA 3P3PA 1SBDA 4XUTA 2FZ2A 5GZEA 4Q4X3 1ZBA1 4JGZC 5A1FA 2B7YA 3VBOC 4N8MA 3CF6E 1EAH3 1RMU1 4XBQA 3LEIA 5F39A 3MHZA 5FV3A 1H1AA 2PXJA 3IN9A 4PIXA 5FZOA 4GXLA 1FPN3 1HJFA 3A0KA 4Q4Y3 1RUC3 3I3BA 3LD8A 4LORA 4GKXA 4QXHA 2JIJA 1MS3A 2ZHLA 4YW7A 5E88A 4IV3B 3D8CA 1XOYA 1CONA 5IK5A 3VL8A 2VOXA 1RUD3 4LBNA 2BZDA 1VAVA 5ACA2 1O5LA 4K8RB 1MZ6A 3ETQA 5FMBA 4XABA 3ASIA 4FCAA 5JMCA 2J1RA 2JDHA 4IEXA 3JB4C 5FMOS 4PDWA 2QQLA 1UKRA 2RV9A 4XXPA 2BOIA 2NMOA 2PHUA 3IM0A 5F3EA 2B42B 4AQTA 1COV1 2JWPA 1ASJ3 1EV13 3WG2A 5ABJC 4EN7B 5IK7A 4YW3A 2BNOA 3N7JA 4BQ1A 4CEYA 3RNSA 4IW3A 2VZTA 4OMCA 1ENXA 2AH2A 3FBYA 1AL22 3V64A 1SG3A 3Q8FA 3RMXA 2IFRA 2NLRA 3MIEA 1BK0A 3A0NA 2YBKA 1LTEA 3H0OA 1W8FA 1C5HA 2XJSA 4GH4C 4MH0E 2HWF1 4Y1YA 5A1LA 4FPYA 3AMPA 2R073 3GHNA 2J1AA 5BNNC 5CEHA 4BK5A 3NW4A 2YMZA 2WT0A 1VB4A 1OH3A 3I49A 5E89A 3PIGA 5D8AC 1LODA 1BBT3 4COYA 1GOFA 1RC6A 1S0JA 1V0AA 1W06A 2JG9B 3PTRB 3P3NA 1IG3A 1T2XA 4QPGB 4PF5A 5DUWA 3WNXA 3IDEA 3HR9A 4GQ7A 3U75A 1H30A 4F7ZA 4ZKTB 5A1AA 1GP4A 1S1AA 3B9CA 4YM0A 3T2QA 2GNBA 2VOKA 4X8NA 4FPJA 1G9DA 3SH3A 3SC7X 4DNYA 3SCFA 1YO8A 3G7DA 1U5XA 5FBZA 5DUVA 4QQOA 4QB2A 4R8HA 4S2DA 1JU3A 3AJYA 3ON7A 4CDWB 2WNEA 1TEIA 3I2JA 4FFGA 4EN0A 4Q8KA 1MZFA 2EXHA 2X5IA 4HVRA 4OVEA 4Q0PA 4WVWA 5EFUA 1GZWA 1GQGA 2JDKA 5LA9A 3BTYA 2RS51 2DU0A 2P3KA 3OOXA 5FQ0A 3SLIA 5CFCB 2ZGSA 1UAIA 1OUXA 3ABZA 1D4VB 4YM2A 1UU4A 1AVBA 3GNEA 3MF9A 4XPVA 4NJ4A 1CZTA 5C4WC 2W52A 2OVUA 4JVAA 3GBWA 3ZYRA 4OHVA 5KC5A 3IWZA 5EJ3A 4IETA 2XG3A 3LDKA 1APNA 2ZACA 1DQ0A 4HVOA 3VZLA 4MGIE 4C0HA 1XPWA 2DVAA 2W3JA 3S7EA 1PMHX 3KVAA 1OBNA 2NMNA 4F8AA 1PGSA 1ZBA2 4JKKA 5SV8A 3HBKA 1OSGA 3KGLA 4K3UA 4KI5M 2JB8A 2GN3A 3UESA 1W6MA 5JAXA 1BKZA 2XBO2 4IEPA 4QB6A 2C9KA 3FL7A 4MHRA 1JHNA 3J8F2 4AI8A 1IS4A 2IXKA 2XONA 3NV2A 4QM9A 4CP9A 5DXDA 3VBRA 3VD7A 3DKQA 4IEQA 1IZ3A 2O1QA 2A6WA 4YGDA 3TB0A 3ZIXA 3M2MA 4BIFA 2Y60A 3MYXA 3ES4A 1VMHA 5T54A 5C7GA 4ISQA 2VMDA 4KWLA 1RUI3 3J7LA 1YFXA 3WW4A 3ZFEA 2XJUA 2E32A 4Y26A 4HXCA 1ZZ7A 3HIFA 4FO9A 2Y6KA 3FUQA 4DO0A 5CBLA 5LCWL 5JZGB 4NN0A 2XVLA 4B7EA 3TEZA 2LROA 1ZRIA 4O65A 2XOMA 2ARBA 5KXCA 4LHKA 4FQ4A 2E26A 1O91A 1BLZA 3FFQA 2WDBA 4NHMA 1ODNA 2PLV3 2ZEWA 4LNVA 2YZ4A 1NE6A 4RGGA 5A3TA 5BNOB 3DYPA 3VDCA 1N1TA 2DF7A 5BPXA 4LBJA 5H9PA 5J7MA 5FR3A 2VXJA 3WD5A 1LENA 3HNYM 1PVC2 2VUDA 1OF4A 5FZMA 2R6QA 4HZFA 4YFWA 3W21A 1VBD2 2D6PA 5FREA 2RM22 3K4ZA 5A7PA 2GAUA 3GBFA 1NQJA 1OHFA 2OA2A 3L2HA 3POIA 3HT1A 1HRI2 3DYMA 4OI0A 3VBSA 4Q8LA 5EIYB 3AC0A 4META 3TBDA 5JI9A 1YNAA 4ES9A 1Y9MA 4EYUA 4YVWA 4DIQA 1XXNA 3VBUA 2Q8OA 4AVSA 1X33A 2HWF3 3MIDA 2HWC3 4MGQA 3IAPA 2YUEA 1TQ5A 3POGA 3M70A 4IUGA 5GZDA 3CKHA 5AC91 5C9AB 3DN7A 3N9QA 3BIEA 4NPLA 1XE8A 4R52A 1IPKA 1W6OA 3PVBB 2WNUA 1WCSA 2RS11 2HWC1 3ELNA 3LDRA 4UW3A 4WV8A 4RR3B 3KMHA 2XL9A 4LKEA 1G7YA 4H3WA 3ZPOA 4YM3A 5K0UC 2DFBA 1M4WA 2J22A 3PU8A 3NNGA 3LKJA 4YWAA 3WINE 2JD9A 4ES8A 4GWIA 3RZKA 1BMV2 4KWUA 1ULOA 1H6XA 1MACA 2XUEA 4CSWA 5A7SA 1JS9A 2Q1ZB 3POFA 4CTEA 2VZ1A 4XJ9A 5FAXA 2A3XA 4N9HA 5F3IA 5IUQA 5BNPA 1PO13 2CWSA 3VHNA 1T6BX 3QOPA 3VBFB 4CPBD 4HN0A 1DU3D 5T5LA 2YV8A 5JIUA 1JTZX 1SDWA 1UMZA 4BCUA 5FPBA 1SQ4A 3GZEA 5I91A 1GLHA 1VAMA 4OUSA 1RMU3 4XFCA 5FZAA 4YGBA 5FZBA 4OULA 3BTZA 2BBAA 1S0IA 1YIPA 4FOQA 3ZN6A 4JGYC 2D6OX 1CN1A 2Y64A 1UY4A 3N7KA 5JOZA 1XRUA 2P4EA 3AP9A 4NPRA 3UYJA 4PDWC 2VTXJ 1S0CA 1XYNA 1SPPB 5CISA 1B09A 2C24A 5C3OA 3M8LA 1CAUA 2JDMA 2PFWA 3VHOA 1REDA 5A6XA 1KD7A 1RXGA 2XHNA 3AYEA 5C5UA 5CG9A 3QBQA 2ZX1A 4KU8A 3VBHC 3K3NA 3HJRA 3LIGA 3ZLIA 4LPLA 2QVSB 4WM7A 2VQTA 5ISLA 4IEYA 5FYCA 4L9BA 2P17A 2BV4A 2ZABA 2XLGA 3KF3A 2E7QA 4AVTA 2W08A 4YG0A 5A7WA 5GZCA 2FDFA 2BERA 1KJLA 2BYVE 2GH8A 2HWB3 4XQWA 3W20A 4XIKA 1V6OA 2I07B 3I97A 2W1QA 1O4TA 3L2YA 4LLFA 3PLQA 1BBT2 5BNNA 1VBE2 5JCTA 3D3AA 3CMGA 2XLFA 4EN9B 1NCRB 1RUG1 1I6XA 1AR91 4A7YA 3J7HA 4E4HA 1O7FA 3AKQA 2QQOA 5FZEA 1TZOA 3HNBM 3S57A 4YPJA 2IXCA 1R083 5LBBA 2PHFA 2Q1FA 2EIGA 4NUBA 5CFDB 2D5FA 1W05A 4D6SA 3M3IA 2PQSA 4UFLA 2H0VA 1UU6A 3M3QA 3WLUA 3ZN4A 4AHWA 3KM5A 4Q4W1 1TE1B 3PDQA 4DMIA 1R081 2VCMA 3MIBA 5LATA 4E2GA 3BALA 1SLIA 2WT2A 3HT2A 5GZFA 5LY2A 5B4XA 4AEDA 2ZX3A 2YG0A 2ZGOA 2ARCA 4YW5A 3NAPB 5JOXA 3NNFA 3WDXA 2X53S 2QQVA 2PHWA 3W9AA 2L9LA 2PHXA 2FZ1A 3AVSA 3VDDB 5C8CB 1H1IA 5FMDA 5I0TA 5L7OC 4IV1B 2VH9A 3VKOA 3WXPA 4IE0A 2E7TA 2JG8A 3IPVB 3A22A 4TLFA 1R1A2 3OG2A 4E8DA 4GJYA 4H55A 4R4XA 1MS8A 1FOD3 4AHYA 2ILMA 3LFMA 4LITA 4LBOA 4COUA 1S0FA 5G04L 3WF1A 2MEV1 1ND2B 3WDVA 5A3UA 3MLJA 4Q2FA 1LECA 1NXMA 3E5XA 2LRPA 3GHMA 1KGYA 1W04A 4QDSA 5IK4A 1DLCA 1RUC2 1V6MA 1SLTA 3KSCA 3PVEA 1MS1A 4DUWA 5BUVA 1POQA 3ENRA 3NJYA 3DPRB 4X6QB 2NPIA 3RYRA 4Z07A 4HKOA 1UX6A 4P9IA 1OVSA 4QX2A 2VBPA 3WY6A 2OKXA 1NQDA 3KV5A 1PIV3 1PHMA 3TAYA 2VTFA 3HD8B 5GKAC 4XFBA 2Q0AA 1UXXX 4AQSA 5IVEA 4YG3A 2V09A 3VLBB 1DZQA 1QOOA 3W5NA 1HRI1 1W2TA 3KGZA 5F37A 3VB9A 2OT7A 4QHZA 1S55A 4NIDA 1QJY1 3KV6A 1F31A 2VOWA 4Y33A 4AGVA 1RUNA 5FYVA 5C3SA 4RQPA 3MLKA 4OI4A 2NQYA 3DKWA 1EUTA 1JU4A 1QF3A 1UOGA 4BISA 1Q3EA 5FUIA 4MGKE 1YHFA 4O61A 4PCRA 3WW3A 1FPN2 3MV11 3NMBA 1S2BA 2GC0A 4MGTA 4NOTA 1W6QA 3VBHB 4TTGA 1XNDA 4CVUA 5A33B 4FOYA 3VD9A 1ZX5A 1YFUA 5F5QA 1BBT1 4AEKA 4XBLA 3FC0A 1DF0A 3Q8EA 2R061 4LEJA 2EICA 1J3PA 3JBG2 1V9U1 4Q4W2 2YFZA 1MPXA 4O7XA 4WM8C 4DPNA 1SBEA 1TG7A 3WW1A 4I30A 3JZVA 1LB2A 3POJA 5FYMA 2YGMA 2DVGA 3WP4A 1PO23 2VQ0A 3AMQA 1QIQA 3TNPB 1QDCA 3ZKUA 1RUD1 1VE0A 5HXMA 2QQNA 1JYIA 3E5UA 2WC2A 4X6RB 4XACA 3FFZA 4QB1A 3ZFGB 2XVKA 4PQ9A 2X8KA 5KHJA 3VBUC 4DY5A 3OGGA 1JZ4A 4XQDA 1S2EA 5CKMA 1OC1A 5JPNB 1ENRA 2UU8A 3OGJA 4ARXA 2BW8A 1ULEA 4GKYA 5T52A 3I2KA 5FP3A 4XXAA 1G9AA 3T0DA 1UD1A 2ORXA 5T5JA 5EPAA 4BH9A 3ZVXA 3BTAA 4KL1A 3CHXA 2DBNA 3GJBA 5JSPA 4XYXA 3BOPA 3FHQA 3THTA 4CDXA 4JQRA 1AX2A 4IGPA 2BTVC 1W8NA 2ZJCA 3CJIA 2O0OA 2LM3A 2RS33 1VR3A 5LA2A 3SISA 4YLZA 4RGAA 4M3CB 5APAA 3W5MA 1MEC2 1YCIA 2WL1A 2H0BA 3O1VA 3LEMA 2LALA 3ZMNA 3AP4A 5DG1A 3OJBA 2BVBA 4FAHA 3IT8A 1A34A 3JQWA 1CR7A 4NHKA 5JIAA 2FCUA 3ZPYA 1LHWA 2R1BA 5F3GA 1NG0A 2JG9C 2EIDA 4I3PA 3C7EA 5FOJB 5BYNA 3VBFC 5DDJ1 3PIJA 5JWPA 5LZ6A 2WYSA 2R063 4TN7A 5AFBA 4YARA 1PK6A 4A41A 3SITA 1X7NA 2HLEA 2OQ7A 4GH4A 4D6QA 1WLDA 1H8VA 1RJ8A 5DDJ3 3NV4A 4XCAA 1SCRA 5M0TA 4FPOB 4M0NA 4AF9A 1GNHA 4CUGA 1UOJA 4W4ZA 3KZ4C 2WZR2 3N9OA 3NRUA 3W59A 1C57A 2P6HA 2FQPA 4FOVA 2W1SA 3P1IA 1VBC1 1YFYA 1NKGA 4V2VA 4YVSA 5FYTA 5IK8A 1QQP2 1QXPA 3MGUA 2RM23 4BU2A 1UYPA 3N36A 4KH9A 1LHVA 1OLMA 2JKBA 3BIWE 3VKMA 4P9JA 1PX3A 4AEJA 2JDYA 1ZA4A 2IXIA 2VMCA 4NE9A 5FYZA 5GJ6A 4D0QA 1W03A 3Q8BA 2R32A 3S5AA 3ILRA 4TSVA 2D43A 4CDQC 1Y7BA 2MNGA 4RYDA 1ZREA 3I4IA 2Q1MA 3U78A 1O8SA 1XSQA 2ERFA 2ZTNA 2V5DA 4IGQA 4XUQA 5LBEA 1K12A 3V0AA 5L7OB 3ACHA 3LDBA 1OOPA 2VZ3A 4FAGA 1N1SA 2WKKA 5F5CA 2JXAA 1GMMA 2CGPA 1OQ1A 4OI1A 2NZ9A 5E6HA 4WVMA 1NYWA 1W9WA 3AJZA 4FTBA 3T2TA 4GIQA 3J4UH 4RS5C 3V0BB 5LY1A 2EXKA 4XJAA 2WUHA 4OFGA 3RZJA 2A5ZA 3OBTA 4XUPA 3WUCA 1W6NA 1MZ5A 1MS5A 4LBMA 2XVGA 4QDQA 5FY9A 1ALYA 2WLQA 2XBO3 1MVQA 2MPFA 4OMDA 4JGZB 1ULDA 1NLRA 3WG1A 1PO11 2HBTA 2RS52 4GB31 4AL9A 1CGPA 4EWAA 1IS3A 1GZ9A 3NKTA 1C8NA 2VOTA 1GOHA 2W92A 1W99A 4K40A 5FZCA 2VMGA 1RVF3 1X8MA 2DCKA 3IKWA 3MIGA 4W8JA 4N7IA 1NCQB 3AK0A 2WNOA 3OUIA 4NIHA 4PIYA 3VBRC 2D7FA 3M4FA 4ZU7A 5C4WA 1V6JA 3IZOA 1MQTA 2E63A 2JDUA 2X05A 5A6ZA 2WA3A 4XUNA 1H8TB 3VBOA 4FQZA 1QEXA 3H1MA 3T2OA 2JDAA 2JDZA 5FY0A 3MFAA 2VZUA 4PT6A 3GCXA 1CQ9A 1W8TA 4ZPIA 3ZXGA 4Q4Y1 5A3LA 4FSJA 1DBNA 5L19A 3ZYIB 5G05L 5FIXA 1B35B 1VBC2 2VPVA 2MEV3 5IATA 1F4AA 1KDMA 3A23A 4I02A 2WNUC 3WQ1A 2WT1A 3KQRA 2BOJA 2J1TA 2IZWA 3PUHA 2AZ5A 4QXBA 3D82A 4AGGA 1QH6A 1RUF2 2VMFA 3M3OA 2R16A 3OPTA 5HI0A 1UN1A 2K2SA 3PTYA 2EIEA 5A7NA 3ZXJA 3RZLA 1HN1A 4XF3A 3EQEA 1FMD2 3MO4A 2P5BA 4HG6B 1RYYA 1VALA 3MW2A 4QM8A 1AR63 4YW6A 3JBG1 3HQXA 1NLQA 3K2OA 3O14A 1JZ5A 3VD4A 4NMIA 4UF0A 5FK8A 2VCBA 2HBUA 5CADA 1LOAA 1EAH2 5KXDA 1RUJ3 1GZTA 4DUXA 1YXWA 2ZS6B 1B35C 4XF0A 1CX1A 2ADDA 5T3NA 2A3YA 2UYBA 1YYNA 3Q9OA 3LA7A 4FPLA 5F6LB 2OPKA 3AZZA 1C8M3 3RWKX 4IV3A 4XF1A 4EWDA 1QQP1 2W94A 1GV9A 3EO6A 3AMNA 1O3TA 3LAGA 1HB4A 1JW6A 4JRAA 4XDPA 3FN9A 3SEPA 1NZCA 3VHPA 3ZOIA 1YQ2A 3OPWA 2XL7A 2BNNA 1AXZA 2FMYA 4Q0UA 3UJQA 4YZ2A 5EXOA 4B4PA 4AHZA 1C5IA 2VM9A 4QX8A 3DV8A 4FP3A 2OW4A 2QDRA 2ZGNA 4RFRB 1VIWB 3GM8A 2AACA 2W0XA 3ETPA 2QBXA 2RR11 4HKWA 5ACA1 4YVWC 3HQRA 3LEGA 1FV2A 4DFSA 3OGVA 2VVEA 4MGYE 3UL2A 4CZSA 4LBQA 2V4VA 1VRH2 1URXA 1CAVA 1ZVFA 2YPJA 1ULGA 2YPDA 3AM2A 3CEWA 1FI2A 3FLRA 4CRQA 2TBVA 1I9RA 1XE7A 3AL6A 4UBGA 4XE9A 1QMJA 3RVHA 4K20A 2Y26A 4HPKB 1U5IA 1ENSA 5JMOA 1X8EA 1UPIA 3OUJA 4G4FA 4I0WB 4JTNA 4N43B 4Q27A 5I93A 2VZSA 2JENA 4EV0A 2ARXA 5C9AC 1SFNA 3OEBA 1BQPA 1E5IA 2ZEZA 4N53A 1GP6A 2AYHA 3C2UA 5IAVA 1N1VA 3GBGA 5FY5A 2Z42A 4I0BA 4QKBA 5TSWA 4BMEA 4BJ0A 5LK5A 3RYPA 2JG9A 1EYBA 1KS5A 5CZKA 1G9FA 1VBD3 4P9GA 3D0JA 2IXJA 3VDBA 1Z7S1 2BGOA 2EF6A 4PQQA 2VZRA 5K9YA 3JB8A 1WKYA 3B69A 4BA6A 4COWA 1BJQA 2SBAA 1X9PA 4QPWA 3S5QA 3BI3A 1UY0A 2VW0A 2JEMA 3I59B 4C91A 2AEZA 3U37A 5KXEA 2YC2A 2X5IB 2IFWA 2ZMKA 3WDTA 3RYKA 1BVP1 4FPHA 2P1BA 1POV0 5DUXA 3DF0A 1QJFA 1SBFA 2VGDA 1ZBE1 1OLRA 2JX9A 1V9U3 5D8AA 4WM8B 5I8YA 1WMXA 1ZYBA 4HT1T 5FZ0A 2GH2A 4I3GA 5FTTC 3WNOA 3N9LA 1AR82 2QNKA 3ILNA 3O12A 3WR0A 3KT1A 1NX9A 4Y22A 3I3QA 5D1IA 2RS53 2YB7A 1PNFA 1A8DA 3SKJE 4D6RA 3H9AA 4INDA 3ME2A 3GF6A 1JZ3A 3NJXA 1S0EA 2A6YA 3AMHA 2OX0A 2AR6A 4EZHA 3KT4A 1ZRFA 3H8XA 2P6CA 5DAQA 3T4HB 4UFIA 1PX4A 2VNOA 4HOOA 1MS4A 1COV3 1HIXA 2W9XA 4KMQA 5DUUA 3WX5A 4FTEA 4JDNA 3W58A 1W2AX 2YU2A 1W9SA 2PHTA 3ZN5A 2RHPA 1I1EA 4K21A 2GALA 2GMPA 5DABA 4JC1A 4I2OA 4YW1A 5FZ4A 1R091 3UETA 4R9DA 4WVVA 3NSTA 3SH5A 4NROA 3AKTA 4Q4V3 4OQ9A 1DP0A 2Z5WA 3RG0A 4QX0A 4QPIC 2B45X 4FPFA 3VBSC 1H8TC 1HXS2 4JX0A 4DXZA 5J3UA 3TN91 1D0GA 3N35A 4UW4A 1O4ZA 4LLOA 2B8MA 1U5ZA 1YIFA 1RGSA 2D98A 1N3OA 5JZGA 3WDUA 2J1EA 3TOJA 5CFCC 2EIBA 1HW5A 3JXSA 3O7OA 2RDSA 4ZS3A 2VUJA 4BLIA 2VW1A 4MXVA 5DG2A 3PVNA 5FY7A 5EYYA 2TNFA 2VECA 5CKQA 3J26N 1ZNPA 1YWKA 2JG8C 1J1LA 5CKNA 4RL7A 3FUOA 4LK6A 4Y5Z0 2CY6A 1J59A 3USUB 3IB3A 5CYYA 5FPAA 2WFF3 2RJKA 2CNAA 4UFHA 4YZ1A 2YC0A 4GB33 4JGYB 1REFA 1YJKA 2QZ2A 2WZR3 4S2GA 1STMA 5FYSA 4WBBA 4CCJA 5GZGA 2DTYA 2WJSA 5A80A 2ZGRA 4HSLA 1QOSA 1KXGA 3ITQA 3VZOA 3PU3A 4BPZA 5F7UA 3L9JT 3BU7A 1VBB3 4BXFA 4B1LA 3RZMA 1GANA 2OUJA 3AMMA 1IHMA 5FK7A 3ZR6A 3VBUB 2R062 4KGGA 3ROUA 3J9SA 4CDUB 3GCWA 4XMIA 3IDCB 3ZSJA 2WO3A 3DGTA 3E6BA 5FYIA 3WF3A 2ZMLA 2BGPA 1OI6A 4MLOA 5LW9A 3T1MA 4MHUA 1DYPA 3NWKA 4IL7A 4M4PA 3EJKA 3JQXA 4C90A 2A6XA 1S0DA 2DU1A 4FT8A 4HMZA 3I2FA 5GLVA 2HWE3 2E31A 4IE5A 4MYEA 4NHXA 1WW6A 3O0XA 5ABJB 1COV2 2XQXA 5FJHA 3WNPA 5FPXA 2QUOA 4R9CA 3FWEA 4QAWA 3C7HA 3ZSMA 1JYXA 3H3ZA 4P08A 4IV1C 4D7YA 3CZJA 2P34A 2E6VA 3VBFA 3VGIA 2AGSA 4C1XA 3J7MA 1UOBA 4IV3C 1AR83 1WCKA 1ZBE2 4U2AA 3THDA 1ZA7A 2JE8A 3HBZA 4Q1RA 4XJ8A 5A32B 3K48A 4UBHA 2ZGPA 3RI8A 4CEWA 2B4KA 4MV2A 1H4HA 5FZDA 1DGLA 3ZN6B 4HBNA 1UXZA 1GU3A 4HL0A 1Y9GA 1AR81 3OY8B 4LUMA 2FBEA 1N47A 1K5MB 5FKCA 1L7LA 3VL9A 5JLVA 5LA0A 3AL5A 4MGSA 4LOSA 1WLCA 5FQ0B 2VU9A 1MS9A 2ZGMA 1PZ7A 3EHKA 2PAMA 2BGCA 3ZYPA 3BN6A 4ASLA 4OUEA 1SPPA 1Z78A 4IEZA 2YU1A 3LCPA 4Q0QA 4GWMA 4YVSC 4P5HA 4NIIA 2GSYA 2QQKA 2ZEYA 5CG8A 3NNLA 1H2NA 4R9BA 3VDDC 2WQ4A 3BODA 3EMRA 4XZPA 1LGCA 3WSOA 2YFUA 5LASA 3HWJA 5C71A 4IE4A 3UKNA 5A6QA 1IS6A 1IQAA 1C1FA 3ORJA 5F32A 4QXCA 3SXWA 1HV0A 4GWNA 3ZFFA 2VZVA 2R1DA 3ACIA 3P5BA 1GYKA 3VD5A 3E97A 1LEMA 1ST8A 3D5OA 4KG0A 3KD4A 4QQPA 2GP5A 3QH6A 4FPKA 5EYXA 1JUHA 2PTMA 4BE3A 2PYTA 1VBE3 3OPZA 5LRRA 1IS5A 5AC93 4DEQA 3RPQA 5F2WA 1FOD1 1W28A 2VL4A 1AR72 4QQLA 1X36A 4PLMA 2ZPXA 5C8WA 2NP0A 5A3WA 3BCWA 4L92A 1G6NA 2RDNA 4PI0A 1VMFA 1POV3 5LEJA 1ULCA 1AL23 1OURA 3B94A 3PVOA 4RFT0 1RL3A 4UYBA 4JKMA 4AEDB 1LNSA 3HVDA 3RZGA 4JAAA 1UNBA 5JXIA 4CUBA 1PK6C 5BV6A 3I3EA 5GLTA 2VOVA 3PMEA 3NAPA 1J84A 5FP4A 3VDAA 5E1RA 5LEKA 3GYDA 4NIGA 4BQXA 3B00A 3NKGA 1OOPC 1WW4A 2WO2A 4HK9A 1OT5A 1SZBA 2CU5A 1UKGA 1Q8PA 2Y6JA 4XIOA 1LOFC 4H14A 3I2HA 4FPEA 1FNZA 4PLOA 1UY1A 3MPBA 1TMF3 3SCHA 4OQ8A 3TEWA 4L11A 4COVA 1FXZA 1DLLA 2XB6C 4DUVA 3TN92 2C0ZA 1SMVA 5DZEA 1R1A3 3E1F1 3ILFA 2WWUA 2QDNA 1WW7A 2X29A 1ND2A 1WA6X 2G19A 1JZ8A 5IYYA 3NVCA 2A70A 1JMUB 3VKNA 4CCMA 2UURA 3PURA 3O0VA 1DIWA 2I45A 1SLBA 1X9TA 4RD7A 4W50A 4LULA 5FZ7A 1TNRA 2BWAA 2ZHNA 2KA3A 4UAPA 1WGPA 2FDJA 1RINA 4LO8A 2E51A 5CNAA 1I5ZA 1WMEA 4L8QA 5H9QA 3WNKA 1LCLA 4AI9A 1MEC1 1SACA 5CB7A 1OVPA 3A7QA 5D2AA 3RSJA 1JZ6A 1QKQA 1XU2A 3O0WA 4FVVA 4P9WA 2ZHKA 1CAXB 4ORFA 4ZS2A 1Q8VA 3QH7A 4UW5A 4ZXKA 3RJRA 1RXFA 3J7NA 2WNVC 1S0BA 4AAPA 2BDRA 4GWJA 4FBFA 3WOGA 3MV01 3CNAA 1AXKA 3WDYA 1CJDA 4P9YA 4QKNA 5KXBA 1RVF2 4AI2A 3USSA 3SH4A 5FRAA 1J3RA 4EROA 4BIOA 4O9EA 1JBCA 3ZDSA 1TMF2 1BXHA 1RHI1 2PAKA 2XDVA 1HRI3 2A1XA 4C0BA 2EXJA 2WN3A 1VBA3 2DWRA 3UJOA 2WFPA 4AOCA 4LTAA 4LXLA 3T30A 2Q5TA 4HONA 1UY3A 1UF2C 2GMMA 4A44A 1OPMA 4A6SA 4CP0A 3WNNA 4KWKA 1MZEA 4Y1VA 5FZ8A 1GWMA 1W9YA 3LPFA 4M3CE 3WP6A 4CU8A 2JIGA 3ZXLA 5HCAA 1GBGA 2B9VA 4CDXC 4IEVA 3NV1A 2GC3A 1JOJA 4JHTA 4UFKA 1AR92 2YY1A 2R071 5K0UA 1EPZA 2C26A 1QJU3 4DZGA 2WQ8A 2W46A 1D2SA 1CJPA 1KQRA 3LA3A 4LMFA 1GZWB 4LOTA 1LESA 4LHNA 1V9U2 4MGZE 2BNMA 1ZBA3 3ZFGA 2ZZQA 1WZXA 3LF7A 1W0NA 2D44A 2CL2A 3U07A 3ACLA 1W6PB 5EHDA 4YRDA 1F8VA 3K51A 1JXNA 2HWE2 3LPGA 2OZ6A 4ZU4A 3U14A 5FJKA 5FZ1A 2Z69A 3PUQA 2TUNA 1W2UA 2ET7A 4RHV1 2YC4A 1H0BA 1LR5A 1YEWA 2RG4A 2BVVA 4OHWA 4Y4YA 3O1MA 1K45A 1W3VA 1F5FA 1RUJ2 2JJ6A 3K77A 3SCGA 4CCNA 5AFEA 3VZNA 1DYKA 3U0ZA 1AUYA 1POV1 1UQXA 4A4AA 2PQQA 4A3ZA 3P6BA 4GA9A 4C1WA 1E5HA 2RR12 2DUQA 2HWB1 2DVDA 3SMHA 3IMMA 2A7AA 3KWVA 3D0SA 3ZSKA 2QQUA 2H6CA 5EZWA 4QKFA 3HAGA 5FXVA 3H8UA 4YFZA 1F15A 1GNZA 1HKDA 1L7QA 3THPA 1ND3A 3VBRB 3O1UA 4M01A 4MOAA 3RZZA 1HRV2 1AL0G 4HVQA 1PMJX 3EBRA 4LHLA 4DXSA 5L9RA 5IVFA 2ZXQA 3GDBA 2ZKNA 3ZFEB 3J8F1 1UZZA 1QQP3 4QX7A 1WLWA 4BOWA 4DRVA 3OD0A 1AJKA 3WP5A 5C3RA 4EJRA 2ZGTA 1RUG2 4Y4RA 4Q4X1 5C3PA 4CYDA 1PM4A 4H2AA 4MO3M 5A3MA 1SLAA 3HMYA 4R9AA 5BNOA 4GMP0 1SLCA 5FPLA 4IEOA 2WO1A 4A3XA 1SEFA 3IMNA 5L36A 1I5PA 4LE3A 2DCYA 1KDKA 3KF5A 1PGW1 5DAPA 4Z8BA 3ZSLA 1Q8QA 1D4M2 2BWCA 3BVCA 5JXGA 4N9IA 4JTOA 2IVJA 1XNBA 4CCCA 3Q8CA 2F4PA 1Q43A 2G1MA 2RDRA 2VE1A 3GZTB 4LA2A 4CUCA 2OUHA 2GC1A 2D40A 3SNMA 3MLLA 2N7GA 1UO9A 1ZZ8A 3M3EA 4K9SA 1NCRC 5FZ6A 1GQHA 3POBA 3VUOA 4Y24A 4ZXEA 1NT0A 4Z82A 4CDQA 3AXEA 1YQ6A 1FATA 3IAQA 5FLIA 5IVYA 4AQ6A 1IQDC 4J1XA 4QGLA 2RM21 4UT5A 4XMAA 1MR5A 2RMU2 2K0GA 3V0AB 2R072 5C9AA 1X50A 3AFGA 3B01A 5L7OA 1OOPB 2IUWA 2WQZC 1DGWX 1MQTC 1W6OB 2VCCA 3MW4A 3JUUA 4QGNA 2ES3A 4RR3A 4BK4A 1LOGA 1OA2A 2VY0A 1HDKA 1GR3A 1TME2 3I3MA 4ASMB 3NNJA 1WA4A 1Y43B 1GWLA 2Y6HA 3CDZB 2OPWA 2PHRA 3ZSEA 4N43C 1ONAA 5JZGC 2W68A 1BCXA 1CESA 4K1YA 3KQ4B 4UW6A 5FMOL 4LO5B 4BLJA 1C28A 3U10A 4PDWB 1QJX1 2VR4A 4Q0SA 3ZXAC 2BU9A 1LHNA 5IAXA 2RS31 1BZWA 4OUMA 4LBLA 4B4QA 4CEYB 2GNTA 1VPHA 4DINB 2ZKLA 1LULA 3H1WA 5CFDC 2Q4SA 4LA3A 5K7PA 2DV9A 4RSUA 2JDNA 5LK7B 1UX7A 5J98B 3TRSB 5CIRA 2F6BA 2FDHA 1HXS3 4XFGA 3ECQA 2XBO1 3OTFA 1LU1A 1DQ4A 1QNWA 3K4DA 4AE2A 1H8TA 4ATEA 4PBOA 2VVDA 2LUWA 2D3PA 1DG6A 3OYWA 2WAOA 2XXZA 2EVXA 4DS0A 5L73A 5IHRA 2E7AA 1SDDB 4CXYA 3OCPA 3QLQA 2D5HA 4RHV3 1RUJ1 1V6LA 4SBVA 4NHYA 4BB3A 1A78A 1BEV1 2ADEA 3CIHA 1RUI1 4GZ9A 3KLSA 2LTNA 4DRRA 5DDJ2 1DDLA 4A45A 1Q8SA 2V4AA 2KD7A 5FWJA 4AI1A 4QPGA 3TWIA 4HETA 1BVVA 1QJU2 4KG8A 3D4KA 5FY8A 5A7OA 3CO2A 4HLTA 3OBZA 3U1XA 3TEXA 1J83A 3O5SA 4E2QA 1UL9A 1HRV1 1SFYA 5DAXA 5LBCA 4ONUA 2RMU3 4NPMA 1CX4A 5HBAA 1IKPA 1LHUA 3WQ7A 4AXOA 1DQ6A 2VBDA 1US3A 5JXHA 3T1LA 1AR73 2HWE1 1LOBA 3MBWA 3N9NA 2CSGA 4TYSA 3MPPG 3N9PA 4QDRA 2O8OA 1J58A 4GAZA 4RHV2 2J42A 4AVBA 3M7AA 2W1UA 3AZXA 4UWDA 3RJ2X 3WNLA 4BQWA 5CFCA 2ZAHA 4NIAA 1JYTA 2I2SA 1AYM3 3KV4A 5FYBA 3V56A 3V0BA 2FCVA 1RUOA 1Z0HA 1WLTA 2A73B 3MIHA 2YDEA 4XETA 1UYZA 4JDOA 1YFWA 2ZEXA 4LBKA 3WQ0A 4ARYA 5HV0A 4R4ZA 4B3NA 2O14A 4BQ5A 3KV9A 1LOEA 4P00B 4Y20A 4RGKA 1ASJ2 1EV12 1LGBA 4MADA 1JODA 4WVZA 5DQ0A 1RB8G 5IFPA 1OKOA 2RS13 3CQOA 3IDBB 4FPCA 4DB5A 2ZGLA 2Y0OA 4URTA 5I0DA 2P37A 4OYUA 1JH5A 5F9TA 2AC1A 4U36A 2GDFA 5KHHA 2C4XA 3IPVA 1XSRA 3WUDA 3KCYA 4K1ZA 5KBFA 3LEKA 2QTWB 5IFTA 2QE3A 3HOBA 3VZJA 5L9VA 2AUYA 3AXDA 4Q4V2 1RTVA 1TME3 4SLIA 5I0UA 2VTXA 2WFF2 5IVCA 4Q4X2 1XYPA 3UGHA 4MXWA 4CP9B 3ZXFA 2P3IA 1CAVB 3ZYBA 3BPSA 3C3VA 4EZ4A 1NY72 3GGLA 1VRH3 2ET1A 1IKQA 5LRSA 4NAMA 3GXUA 3LA2A 4D7SA 2RR13 5JDBA 1P8JA 1OKQA 1NA1B 2XWJB 1NA1C 2CYFA 2QFEA 4HPKA 1L7RA 4ATFA 3MI8A 1AJOA 3RDIA 1VRH1 5GLWA 5E8AA 2CAVA 3U4SA 3EYPA 4CDUC 2WA4A 4CEYC 1AYN1 4ASKA 1O6UA 4N53B 2ZGUA 1G86A 1JI6A 2IVIB 2K46A 1GP5A 4HN1A 4YGCA 3ES1A 5K8SA 2ORZA 3SQOA 5IVJA 3H8RA 2RS32 2D6KA 4W6WA 1UIKA 3DL3A 1QH7A 4TWTA 1QXJA 5T55A 1VBE1 2XH6A 1O5UA 4MVTA 2DUPA 3A21A 2VMEA 3B93A 4V1PA 1NOVA 1ZZCA 5FYYA 3TYJA 3WF4A 4OHXA 1JYNA 2NM1A 1BHGA 1QGLA 3A4UA 4KQ7A 4RQPB 1QWRA 5FPVA 3ZXEA 1KFUL 1A6CA 5C8CC 2VNRA 5KHKA 5A3PA 1C8M2 3OEAA 2W95A 4IEWA 2ZOEB 4LO4B 2J1VA 5AC92 2G9FA 2B46X 1ZZ9A 3FZ3A 3I59A 4IXLA 4NO4A 1XC6A 1K5JA 1ULFA 3LE0A 1LOFA 3VBSB 1FAYA 1RUF1 2R30A 2WWSA 2BUKA 2VQAA 4LUKA 5FDBA 1RHI3 2B5HA 4ITCA 4P14A 4FTSA 1QJEA 3HEIA 3MW3A 1VBB2 5FLHA 2QZ3A 1AR93 2OYZA 4C8DA 4CP2A 4L2NA 4CE8A 4ET7A 5FZIA 3BKZA 5DMYA 1GKBA 1ZZBA 2JE9A 1WMFA 2D6MA 1L3JA 5FUNA 3O1RA 3MIFA 1GSLA 2PELA 3FHAA 2NYYA 3H50A 4XVHA 4Q4W3 5C6CA 1NXD1 1D0HA 1PO12 1R1A1 2HEWF 2CGNA 4NRQA 1PMIA 5FYHA 1HQNA 3TEYA 2A71A 3GZUC 2HWD3 4XFIA 1YC61 3LFIA 3N7LA 4UFMA 3ZYJB 5BNPB 1DFQA 4KNCA 2WBKA 5ACA3 4QXKA 1CAWA 3AYCA 1S2KA 1O3QA 1HB3A 5FXZA 2HWD1 4OHYA 1JZ7A 4CCOA 3LB9A 1W39A 4LIVA 3VKFC 1LJ7A 1NZIA 3LQCA 3WCRA 4D3WA 1AL21 1DHKB 1XE0A 5HXVA 5H9SA 2Y34A 2PLV2 3JD71 4Q4Y2 1LOCA 2UWAA 1PNGA 2YHJA 5T5PA 1LU2A 5IVBA 2WO7A 3LOIA 3OB8A 5GM0A 4N7UA 1EUUA 4GB32 1W8UA 1E5SA 4Y5TA 2XR4A 2J1UA 2ZAAA 4AI0A 1CAUB 1UW8A 1J3QA 2B9UA 2R0FA 1VP6A 1WUVA 3H1YA 2DDUA 5FXXA 1VAKA 4AVVA 2BEOA 4YSFA 4XILA 5C70A 3POYA 1PIV1 1W2OA 4QPIB 4LR4A 1PK6B 4AFMA 5B4NA 2WNVA 4HFSA 3WP3A 1C4RA 4RA0A 3USUA 4RS5B 5JSRA 2XWBB 2DVFA 1FOD2 4HKLA 1HB2A 2CGOA 2ZBJA 5A7WB 5B2GB 2VVFA 3AZWA 1RHI2 5LB6A 3UGGA 4AW7A 2ZX0A 3AB0A 1K3IA 5DN2A 2C1FA 4XJZA 4A42A 3F95A 5BNNB 5J36A 1AHSA 2DUOA 3N3HA 5LBFA 4YVSB 2XQRA 3HN1A 3VKLA 1T6GC 2A6VA 2EAKA 1PZ8A 1RMU2 1AYN2 1QNYA 2D97A 3DUIA 4Q0VA 5EV7A 1F4HA 5FP9A 3RS6A 4Z2AA 2LS6A 4HSJA 1KS4A 2C5DA 2UY8A 1IOAA 1ULPA 1AX0A 2HJIA 4M4RA 3ZYFA 2VUCA 4OLLA 1PVC1 4LT5A 3SHRA 3ACGA 1VBB1 2OIIA 3KT7A 5F6KA 3CL1A 1WBFA 2DCZA 3VD3A 1N1YA 5ABJA 5DPNA 1VBA2 2KR2A 5KR7A 4OZXA 4MUVA 4UI9L 4BQ4A 5FZOB 5BXXA 3ZDVA 4XZUG 3AYDA 2W87A 4L99A 4UXAA 1OD3A 3RFRA 3AKRA 5A6YA 1GFF2 1KITA 3VDDA 2Y6LA 3RMYA 4YZ3A 2WABA 2VZPA 4IV1A 1V00A 1RUD2 2RDQA 5EJ1B 1Y4WA 2JG8B 1HRV3 3R4DB 5FFOC 1W0OA 1Y9QA 2UWCA 4JCKA 4QQ2A 4XFAA 2Y0IA 1W8WA 3ZFFC 4GULA 1H9WA 1Q56A 2P2KA 3TN93 4A7ZA 5A32A 1PM7A 1G8WA 4JV4A 4PHZA 4X8PA 5CA6A 2QQMA 4Q4V1 3PNAA 1HX6A 3B02A 2WYFA 3G6JB 1FX5A 3VZKA 4AVCA 2OXBA 2ZZJA 4JGZA 1O3SA 1XB9A 1K5MA 4M0HA 2VD7A 4XURA 4DQAA 4BXSV 1NY71 1CVNA 3J8F3 2ENRA 2XHKA 4L97A 4P9XA 1OLQA 1REEA 1OFNA 3DPRA 4W65A 3M3CA 5BNPC 3R05A 5HV4A 1R092 2E9QA 1JYWA 3POWA 1QJX3 5FBJA 5IT6A 3NJZA 1G9BA 3ZFGC 2A3WA 4IE7A 4CCKA 2GNMA 1LGNA 5C5TA 1GWKA 1HJGA 1ND3C 3ATGA 3OSDA 3OUHA 3CBNA 5IJRA 1HB1A 1Q5OA 4OHZA 3URFA 1G9CA 5JOYA 3DXTA 5J09A 2FDGA 4D94A 3RZHA 2WZR1 1ZBE3 3FLPA 2G9ZA 5FZHA 4XCBA 2VQUA 4J25A 2BJSA 1RUH1 4G3YC 2C6SA 4QPYA 4CEWC 1JN2P 2OS2A 4AI3A 3AVRA 4M00A 1UU5A 2Q8DA 3H3UA 3K3OA 5T50A 4XUOA 4S2HA 1UPSA 3E6DA 1A3KA 1SHWB 2Y33A 5CVRA 5GLUA 1RVF1 2Z4FA 1PGW2 3NQHA 3ZXDA 1AXYA 1H6YA 1W6QB 2DCTA 3VBHA 3WCSA 1V70A 2EAAA 4E4SA 3MZHA 5K4LA 5FUPA 1FYUA 2D6LX 3X29B 4PF1A 3F2ZA 3B7MA 3GJAA 3WW2A 1IGOA 2R043 2P3JA 5FO7B 2PHLA 2Q30A 5A70A 2WSUA 4BDVB 4XDQA 3I3DA 1CZVA 4CDWA 1W9FA 1SFPA 2P3YA 3ACFA 1W90A 1LHOA 3BOWA 4UF0B 1R093 4ZONA 2X5IC 2XMLA 2ZHMA 4OCTA 3DEMA 4ZU5A 1E57A 4AEMA 2HWC2 4D8MA 4MG2A 2RJ2A 2AREA 4J1WA 2ZCWA 1NCQC 3NAPC 1NLSA 2Q8CA 5KC6A 1AR62 1ZM1A 1CZSA 1W0PA 3KB5A 1H2LA 2XGXA 3I8TA 2D93A 4XTPA 1XJAA 1ZRRA 4BM8A 5FO9B 2E33A 4XQ4A 4AHXA 1YI7A 3BTXA 3U4XA 3NL1A 3AKPA 3R4UA 4B4RA 3ZR5A 1E5RA 4BQ3A 4JRLA 3OD4A 3LSEA 5IVVA 1UZYA 2WZEA 3OGRA 3MF6A 1YQ8A 2AEYA 4H7LA 3KHCA 2DVBA 2VNGA 3AZYA 2X09A 2R042 4LO7A 4DOUA 1ZRDA 1QJX2 2HWD2 2J1SA 4I09A 4YG6A 4JQTA 4KBZA 3E5QA 4CUAA 2K9ZA 1W6MB 3CJIB 4CU7A 2FDIA 1KRIA 3PJQA 1VBA1 3APBA 3FHIB 3UK9A 3VN4A 2EALA 3ZKYA 1CIYA 2ZA9A 1QJZA 4N90A 2VAUA 3R0RA 2WAAA 2UWBA 2TEPA 4FPGA 3S7IA 4Q29A 5FXWA 3HPNA 5SV5A 4L0PA 3MICA 4QT6A 1JOPA 1LRHA 1V6NA 4LKSA 1CAXA 5A7QA 1TME1 3H3LA 3H8OA 1PZ9A 3T2PA 1H4GA 2RE9A 1A8MA 3R6SA 3OBRA 4K7JA 4ZZ8A 3O1OA 1D4M1 2VBBA 1ND2C 4AFAA 2VC9A 3CJXA 1VB2A 1OQEA 3N7MA 1ODMA 2FCTA 3THCA 1MEC3 1FPN1 2QKDA 1W9TA 1S0GA 2RMU1 5FP7A 5HCFA 5FKBA 1DYOA 2ARAA 3WG3A 3BGAA 4ZZ5A 5FPZA 1ZZ6A 1NE4A 1PVXA 4XF9A 2QQIA 1PGL1 5BNQA 2F17A 1WBLA 3T0BA 4EQVA 1WWYA 4LK7A 5ANQA 4AK3A 4TZDA 4QGMA 1CPNA 3BYWA 1H2MA 1QHDA 3PL0A 5EJZB 1Q8OA 5KHIA 2HH9A 2W2IA 3HNMA 1OA4A 3T0AA 4BYYA 1QJY2 4CCEA 1D7PM 1H2KA 2BPA2 1R082 3NO8A 4AFBA 5D21A 1UIJA 4YVWB 1XYOA 1OXCA 4XOGA 2CV6A 2QQPA 2BRTA 1IG0A 1IPSA 1YQ5A 4FXKB 5JI7A 2UYAA 2ZMNA 4MZUA 4XTMA 2VMHA 4YM1A 5D8AB 1XNAA 4CCDA 1BMV1 1WW5A 4EE2A 5FOBB 2R49A 2DFCA 2HYXA 2WNUB 2XJQA 5L9BA 4CXXA 4KU7A 2VCAA 4QKDA 3B5LB 4GMP3 4Y22B 5DAWA 4BWOA 4LKDA 3WF0A 3I7DA 3IIIA 1Y3TA 3FJSA 2HWF2 5FZKA 4YZ5A 5J1XA 1W8ZA 1UZVA 1W6NB 4I0AA 2MEV2 4RN5A 2KXLA 3INAA 3RRDA 3O1PA 1YI9A 1VRBA 2GMEA 4BQ2A 5GLZA 5ERLA 4XFFA 5EQUA 5JPMB 5CAZA 1PVC3 2ZGQA 1H1MA 1RJ7A 2CWMA 1PO21 3UGFA 2H6BA 4AFCA 4CP1A 4URAA 3Q8AA 2AENA 3T08A 1R64A 4F3JA 1ND3B 3PJYA 2Y6GA 2ETEA 3IBMA 4EWEA 5C4WB 1JHJA 3BUCA 1O4YA 4F83A 4Q1PA 2EXIA 5FPUA 1GZCA 5I8SA 1H9PA 2PHDA 2IXHA 2HKXA 2EA7A 5A3NA 2GNDA 2W47A 1OLME 3UKTA 1K42A 1F2NA 1TVGA 1WCDJ 3JD73 1DZTA 5F5AA 1CPMA 4COZA 5JVVA 2YBSA 2G4IA 2VW2A 2J7MA 3KCXA 4ISRA 2CDPA 1OMIA
chains in the Genus database with same CATH topology
5EWSA 4WM7B 2QCSB 4Z1VA 1AZDA 4Z92B 1M06G 4H7MA 3VHRA 3LSDA 2DCJA 3MFCA 3AYAA 4W6XA 1C8M1 5H9RA 1EAH1 5DZFA 2HYKA 4XEZA 4AQ2A 4A7KA 2D6NA 4PIZA 1DQ2A 4AFDA 4K6BA 5JR7B 4D69A 1NCRA 3JCIA 3WVJA 1OFSA 4CDQB 5I0SA 2G9GA 2FHRA 4CDUA 5CFDA 1F5JA 4LBQD 4E2SA 2IXLA 5JOWA 1KFXL 3ZYGA 3BB6A 2XJTA 1CIWA 2HEYF 2A6ZA 2WFF1 4AEDC 4WM7C 3ZFEC 4QHBA 1RUE2 4XFHA 1JYCA 1YRZA 2XPJA 2XKOA 5HCBA 2GN7A 3UKVA 1AF9A 4P9LA 3PHMA 1ASJ1 1EV11 3WT3A 4QU2A 3AP7A 2GZWA 5C8CA 1OD5A 1HQWA 2CAUA 1MVEA 2RS12 2YGLA 2JICA 2R041 2JE7A 2O8QA 2V73A 3MDPA 1U12A 4AVAA 3TNQA 1RUF3 1QDOA 4E27A 4J6GA 1C3HA 3JU9A 1SLLA 4CEWB 1RIRA 4KGQA 4LBQB 3WG4A 2XKPA 5GALA 1V6IA 4RR3C 3OY8A 4YNIA 1YLLA 3FMGA 4LE4A 3OYWB 2JD4A 3KS7A 4BZ4A 3ZX7A 4GMP1 2B39A 3I54A 2W39A 1BYHA 1EP0A 4N43A 3AFKA 3ZMOA 5FLJA 4NHLA 2PAEA 3FX3A 3WDWA 2DYCA 1AYM1 1R1ZA 1HXS1 1JUIA 4EN6B 5J37A 4XHXA 2XLAA 2C9AA 2JECA 3OF1A 3R4SA 4IEUA 2BQPA 1YUDA 1PO22 3FLTA 2WINB 2Y38A 2GU9A 3ZFFB 4FXGB 1HLCA 3H7JA 2WZPP 2PLV1 3JD72 4QMAA 5I0RA 4E4DX 1PGL2 3RQ0A 5FCCA 3WV6A 2BBVA 1KJRA 4Q26A 4NVPA 1VBC3 4HANA 2WS91 4AG4A 2XJRA 5A33A 1J1TA 3M1HA 4FOWA 4YW4A 1MS0A 1DGRA 2BFUL 5CU1A 3S6PA 3V0BB 5C33A 4WM8A 1HQLA 1HV1A 1DQ1A 1EPWA 4XJUA 2IWGB 4A2UA 2HEVF 1U5YA 1WD3A 1AR71 1VLNA 4OI2A 1XNCA 4AGRA 4Y20B 3CLPA 3WZ1A 4M3CF 5E16A 4Z2WA 1IPJA 1AYN3 2WIIB 3S0MA 3ZXKA 2VG9A 3AP6A 2ATFA 1U0AA 2D3RA 2XJPA 1RUE3 1XNKA 2IC1A 3LGRA 2QJVA 4WZCA 3PMSA 4MXWB 1V6KA 4CDXB 2SLIA 2BFUS 5F1RA 5KWRA 1RUE1 3ZO0B 1BEV3 3MEPA 3CJIC 1K5MC 4PBPA 1BK1A 1FT9A 1SCSA 3LZZA 1PIV2 3S30A 3U11A 1NA1A 4M3CA 1OPOA 1GICA 1RUH3 1LKNA 2HWB2 3AZVA 3ALQA 1BEV2 4IQPA 4QX5A 3N4MA 5BNOC 3NV3A 1QXRA 3FBMA 4YGEA 2WS93 1XQNA 4B29A 4O9GA 4PJYA 4GH4B 4MSVA 1D4M3 1QY4A 4YW2A 3VZMA 2WLPA 5AVAA 4LO6B 5BY5A 5FO8B 2YXSA 4JGYA 4BMBA 4K8FA 1RUC1 4NWVA 4G9SB 3UV9A 1O3RA 4N53C 2NN8A 1DGWA 1FMD1 1N3PA 1UCXA 3DPRC 4IERA 4QQHA 1RITA 1EY2A 2YROA 3B3QE 2FMDA 1FMD3 3B9IA 3WHUA 2PA7A 3AP5A 4Y1ZA 2MHFA 2WS92 4XJWA 4Y1UA 5K0UB 3JBG3 3FE5A 3EXUA 4NWWA 1LEDA 2VULA 4E9KA 1ENQA 3IIAA 2ZX2A 1OQDA 2E53A 3H7YA 4GALA 4HK8A 4AWDA 2WSVA 1DZRA 1W6PA 1Z7S3 3POSA 3KCCA 3I2DA 2A75A 3ZIWA 4WVMB 4AYUA 4I01A 5AVPA 3V65A 1I3HA 1QJY3 1D2QA 1CAWB 2ZGKA 4NR1A 1F9KA 2Z79A 4RQPC 4QD2A 3ST7A 3WHTA 1FV3A 2R0HA 1C1LA 2VMIA 2D3SA 2RJLA 4KWJA 1QOTA 1DGRN 4XF4A 1DQ5A 5JSOA 5DZGA 2PN5A 3QCWA 4YZ4A 4CDWC 4W6YA 5I8TA 3AX4A 3RI9A 3E6CC 3AKSA 1NCQA 4EN8B 4KBBA 4B7KA 1CD3G 2OZJA 1MQTB 1WMDA 4QPGC 3LOBA 3VBOB 1AYM2 2V5YA 4D7TA 3BPZA 3D6EA 4B8EA 4QPIA 2DURA 1TNFA 2WNVB 2YYOA 1AX1A 5T5OA 4RS5A 1FNYA 3GALA 4FP2A 2I74A 3QD6A 4JDMA 1X82A 1RUH2 1Z7S2 4S2FA 1VJ2A 4WZFA 4Y1XA 2XUMA 4XHBA 5KHGA 2VUAA 1B35A 1QU0A 1RUI2 3GZAA 2VXRA 1AR61 4XW3A 2CTVA 1RUG3 3LWCA 1ZRCA 1VBD1 1OA3A 2ZX4A 2Z2SB 4DY3A 2KM2A 4MX3A 3CU7A 1XU1A 4BHPA 2DTWA 4YYOA 1QJU1 1WD4A 4PLNA 1TMF1 1YJLA 3RWNA 3QACA 5J48A 5J96B 5LEKA 4IESA 3VV1A 2XJVA 1N3QA 2UY9A 2GC2A 4XBNA 3P3PA 1SBDA 2FZ2A 5GZEA 4Q4X3 1ZBA1 4JGZC 2B7YA 3VBOC 3CF6E 1EAH3 1RMU1 4XBQA 1H1AA 3IN9A 4PIXA 4GXLA 1FPN3 3A0KA 4Q4Y3 1RUC3 4GKXA 1MS3A 2ZHLA 5E88A 4IV3B 3D8CA 1CONA 5IK5A 3VL8A 2VOXA 1RUD3 4LBNA 1VAVA 5ACA2 1O5LA 1MZ6A 3ETQA 3ASIA 4FCAA 5JMCA 4IEXA 3JB4C 5FMOS 4PDWA 1UKRA 4XXPA 2NMOA 3IM0A 2PHUA 4AQTA 2B42B 1COV1 5ABJC 1ASJ3 1EV13 3WG2A 4EN7B 5IK7A 4YW3A 2BNOA 3N7JA 4BQ1A 4CEYA 3RNSA 1ENXA 2AH2A 3FBYA 1AL22 3V64A 3RMXA 2IFRA 2NLRA 3MIEA 3A0NA 1LTEA 3H0OA 1C5HA 2XJSA 4GH4C 4MH0E 2HWF1 4Y1YA 4FPYA 3AMPA 2R073 3GHNA 5BNNC 3NW4A 2YMZA 2WT0A 1VB4A 5E89A 5D8AC 1LODA 1BBT3 1RC6A 1S0JA 5DUWA 2JG9B 3P3NA 4QPGB 3WNXA 4PF5A 4F7ZA 3IDEA 3HR9A 4GQ7A 1H30A 4ZKTB 1S1AA 3B9CA 4YM0A 2GNBA 2VOKA 4X8NA 4FPJA 1G9DA 3SH3A 4DNYA 3SCFA 1YO8A 3G7DA 1U5XA 5FBZA 5DUVA 4QQOA 4R8HA 4S2DA 3AJYA 4CDWB 2WNEA 1TEIA 4EN0A 4Q8KA 1MZFA 2EXHA 2X5IA 4HVRA 4OVEA 4Q0PA 4WVWA 5EFUA 1GZWA 1GQGA 2RS51 2DU0A 2P3KA 5FQ0A 3SLIA 5CFCB 2ZGSA 1UAIA 4BOWA 1D4VB 4YM2A 1UU4A 1AVBA 3GNEA 3MF9A 4XPVA 5C4WC 2W52A 2OVUA 4JVAA 3GBWA 3ZYRA 4OHVA 5KC5A 3IWZA 5EJ3A 4IETA 2XG3A 1APNA 2ZACA 1DQ0A 4HVOA 3VZLA 4MGIE 4C0HA 2DVAA 3S7EA 2NMNA 4F8AA 1PGSA 1ZBA2 5SV8A 3KGLA 1OSGA 4K3UA 2GN3A 1W6MA 5JAXA 1BKZA 2XBO2 4IEPA 1JHNA 3J8F2 4AI8A 1IS4A 2IXKA 3NV2A 4QM9A 5DXDA 3VBRA 4E4ZA 4IEQA 3TB0A 1IZ3A 2O1QA 2A6WA 4YGDA 3ZIXA 4BIFA 3M2MA 3MYXA 3ES4A 5T54A 4ISQA 4KWLA 1RUI3 3ZFEA 1YFXA 3WW4A 2XJUA 4Y26A 1ZZ7A 3HIFA 4FO9A 3FUQA 5CBLA 5JZGB 4NN0A 2XVLA 4B7EA 2ARBA 5KXCA 4LHKA 4FQ4A 1O91A 4NHMA 3FFQA 4Y1VA 2PLV3 4LNVA 4RGGA 2YZ4A 1NE6A 5BNOB 1N1TA 2DF7A 5BPXA 4LBJA 5H9PA 5J7MA 3WD5A 1LENA 1PVC2 2R6QA 4HZFA 4YFWA 1VBD2 2D6PA 5FREA 2RM22 2GAUA 3GBFA 1NQJA 1OHFA 2OA2A 3L2HA 3HT1A 1HRI2 3VBSA 4Q8LA 4META 3TBDA 5JI9A 1YNAA 4ES9A 4YVWA 1XXNA 3VBUA 2Q8OA 4AVSA 1X33A 2HWF3 3MIDA 2HWC3 2YUEA 1TQ5A 5C9AB 3M70A 5GZDA 5AC91 3DN7A 1XE8A 4R52A 1IPKA 1W6OA 3PVBB 2WNUA 1WCSA 2RS11 2HWC1 3ELNA 4UW3A 4WV8A 4RR3B 3KMHA 2XL9A 4YM3A 1G7YA 4H3WA 5K0UC 2DFBA 1M4WA 3LKJA 4ES8A 1BMV2 1MACA 2Q1ZB 4CTEA 4XJ9A 5FAXA 2A3XA 4N9HA 5IUQA 5BNPA 1PO13 2CWSA 3VHNA 3QOPA 3VBFB 4HN0A 1DU3D 5T5LA 2YV8A 5JIUA 1JTZX 1SDWA 1UMZA 4BCUA 1SQ4A 5I91A 1GLHA 1VAMA 4OUSA 1RMU3 4XFCA 4YGBA 4OULA 1S0IA 1YIPA 4FOQA 3ZN6A 4JGYC 2D6OX 1CN1A 3N7KA 5JOZA 1XRUA 3AP9A 4NPRA 4PDWC 1S0CA 1XYNA 1B09A 3M8LA 1CAUA 2PFWA 3VHOA 1REDA 1KD7A 3AYEA 5CG9A 3QBQA 2ZX1A 4KU8A 3VBHC 2QVSB 4WM7A 4IEYA 4L9BA 2P17A 2ZABA 2XLGA 2E7QA 4AVTA 2W08A 4YG0A 5GZCA 1KJLA 2BYVE 2GH8A 2HWB3 4XQWA 4XIKA 1V6OA 2I07B 1O4TA 3L2YA 4LLFA 3PLQA 1BBT2 5BNNA 1VBE2 5JCTA 2XLFA 4EN9B 1NCRB 1RUG1 1I6XA 1AR91 4A7YA 1O7FA 3AKQA 2IXCA 1R083 2PHFA 2EIGA 5CFDB 2D5FA 3M3IA 2H0VA 1UU6A 3M3QA 3WLUA 3ZN4A 4AHWA 3KM5A 4Q4W1 1TE1B 4DMIA 1R081 3MIBA 4E2GA 3BALA 1SLIA 2WT2A 3HT2A 5GZFA 4AEDA 2ZX3A 2ZGOA 4YW5A 3NAPB 5JOXA 3WDXA 2X53S 2PHWA 3W9AA 2PHXA 3VDDB 2FZ1A 5C8CB 1H1IA 5I0TA 5L7OC 4IV1B 2VH9A 3VKOA 3WXPA 2E7TA 2JG8A 3IPVB 4TLFA 1R1A2 4H55A 4R4XA 1MS8A 1FOD3 4AHYA 2ILMA 4LBOA 4COUA 1S0FA 2MEV1 1ND2B 3WDVA 3MLJA 4Q2FA 1LECA 1NXMA 3E5XA 3GHMA 5IK4A 1RUC2 1SLTA 1V6MA 3KSCA 3PVEA 1MS1A 5BUVA 3ENRA 4X6QB 3DPRB 3WINE 2NPIA 3RYRA 4Z07A 4HKOA 1UX6A 4P9IA 5KHKA 3WY6A 5KXBA 1NQDA 1PIV3 1PHMA 3TAYA 3HD8B 5GKAC 4XFBA 2Q0AA 4AQSA 4YG3A 2V09A 3VLBB 1DZQA 1QOOA 1HRI1 3KGZA 1S55A 1QJY1 1F31A 2VOWA 4AGVA 1RUNA 4RQPA 3MLKA 4OI4A 2NQYA 3DKWA 1QF3A 1Q3EA 4MGKE 1YHFA 4PCRA 3WW3A 1FPN2 1S2BA 2GC0A 4NOTA 1W6QA 3VBHB 1XNDA 5A33B 4FOYA 1ZX5A 1YFUA 5F5QA 1BBT1 4AEKA 4XBLA 3FC0A 1DF0A 4LEJA 2R061 1J3PA 3JBG2 1V9U1 4Q4W2 4WM8C 4DPNA 1SBEA 3WW1A 4I30A 3JZVA 1LB2A 3WP4A 2YGMA 2DVGA 1PO23 2VQ0A 3AMQA 3TNPB 1QDCA 1RUD1 1JYIA 3E5UA 2WC2A 4X6RB 3FFZA 3ZFGB 2XVKA 4PQ9A 2X8KA 5KHJA 3VBUC 4DY5A 3OGGA 4XQDA 5JPNB 1ENRA 2UU8A 3OGJA 2BW8A 1ULEA 4GKYA 5T52A 4XXAA 1G9AA 1UD1A 5T5JA 4BH9A 3ZVXA 3BTAA 4KL1A 5JSPA 4XYXA 3BOPA 3THTA 4CDXA 4JQRA 1AX2A 2BTVC 3CJIA 2ZJCA 2O0OA 2LM3A 2RS33 1VR3A 3SISA 4YLZA 4RGAA 4M3CB 1MEC2 1YCIA 2WL1A 2H0BA 2LALA 3ZMNA 3AP4A 5DG1A 3OJBA 2BVBA 4FAHA 3IT8A 3JQWA 1CR7A 4NHKA 5JIAA 3ZPYA 1LHWA 2R1BA 1NG0A 2JG9C 4I3PA 5FOJB 5JWPA 5BYNA 3VBFC 5DDJ1 2R063 5AFBA 4YARA 1PK6A 3SITA 1X7NA 4GH4A 1WLDA 1H8VA 1RJ8A 5DDJ3 3NV4A 1SCRA 4FPOB 4M0NA 4AF9A 1GNHA 3KZ4C 2WZR2 3W59A 1C57A 2FQPA 4FOVA 1VBC1 1YFYA 4YVSA 5IK8A 1QQP2 1QXPA 3MGUA 2RM23 3N36A 4KH9A 1LHVA 2JKBA 3BIWE 3VKMA 4P9JA 4AEJA 1ZA4A 2IXIA 5GJ6A 2R32A 3ILRA 4TSVA 2D43A 4CDQC 1Y7BA 2MNGA 1ZREA 3I4IA 2Q1MA 2ZTNA 2ERFA 3V0AA 5L7OB 1OOPA 4FAGA 1N1SA 2WKKA 2JXAA 2CGPA 1OQ1A 4OI1A 2NZ9A 4WVMA 1NYWA 3AJZA 4FTBA 3T2TA 4GIQA 3J4UH 4RS5C 2EXKA 4XJAA 4OFGA 2A5ZA 3OBTA 3WUCA 1W6NA 1MZ5A 1MS5A 4LBMA 2XVGA 1ALYA 2WLQA 2XBO3 1MVQA 2MPFA 4JGZB 1ULDA 1NLRA 3WG1A 1PO11 2RS52 4GB31 1CGPA 4EWAA 1IS3A 1GZ9A 3NKTA 1C8NA 4K40A 2VMGA 1RVF3 1X8MA 2DCKA 3IKWA 3MIGA