4DSFA

Ternary complex of bacillus dna polymerase i large fragment f710y, dna duplex, and rctp (paired with dg of template) in presence of mn2+
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
580
structure length
546
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRNYGGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase
publication title Structural factors that determine selectivity of a high fidelity DNA polymerase for deoxy-, dideoxy-, and ribonucleotides.
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
total genus 188
structure length 546
sequence length 580
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4dsfA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4dsfA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dsfA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4dsfA01
3KLIA 4W5NA 3V9WA 1JLQA 1BQMA 4RPXA 3S3OA 3QIPA 2AQ0A 4ECRA 3OJUA 3AU2A 4CHOA 4QOZB 2VANA 4UB1A 2Q0ZX 3AVNA 3CFRA 3QETA 1H38A 3AVCA 3QE9Y 1N6QA 4KB0A 1S0VA 4RU9A 3V7JA 4NM2A 3K5MA 4BGDA 1DGSA 3ZDCA 2C2RA 4F3OA 4KTZA 3GV5B 1T8EA 4B8AB 3MFIA 2VA8A 1RDBA 3BQTA 4KLUA 2M9NA 4FXDA 4HCBA 4ECQA 7ICUA 2JEIA 8ICVA 3L8BA 5CHGA 3KHLA 1RT7A 2BCSA 4I2GA 4QZDA 5J2NA 4CHNA 4EEYA 4FJ5A 2Z1JA 4FLYA 3PW2A 5KRSA 1T05A 1HYZA 1WN7A 1NK7A 3SQ2A 8ICEA 3AVGA 3OYCA 3GFKB 2AGQA 4RQ2A 1QSYA 3NAEA 3ZDBA 4ECSA 5DG9A 1IKYA 1LWCA 2XC9A 4CJPA 1S6PA 4QZIA 3QIOA 2W42A 4FM2A 1COOA 4O3QA 5HRSA 3UXOA 7ICLA 2ZD1A 4DTUA 1VRUA 1XHZA 5TZVA 2UVRA 4F8RA 3L3UA 3LDAA 3EPIA 4UAWA 1S10A 4RQ6A 3L3VA 3OYGA 4KLOA 1RBRA 4FJXA 3S9HA 1NJZA 4DL7A 1NK8A 1WSFA 4PWDA 4IRKA 4K8ZA 2ZUCA 8ICUA 2BCRA 3NFAA 1C1CA 4ED8A 4DQSA 9ICIA 4ICLA 1NOMA 3GIIA 1ZETA 4RQ5A 4NYNA 3HSTB 1R0AA 4I2IA 7ICPA 4CJQA 4QZHA 5KG7A 4YMMA 1RXWA 2DFEA 4M3WA 1XU4A 4M2YA 4FLVA 5CP2A 4F4ZA 3VQ5A 1REVA 5L1KA 5J2FA 4IKFA 8ICCA 4E3SA 3PMLA 1BPZA 4RW6A 3IM1A 4DSIA 3QZ7A 1N5YA 5DBAA 3CFPA 4UAYA 2A1JA 5DLGA 1DLOA 4K4IA 3DLBA 3VQPA 3BJYA 3QNOA 3DI6A 4DS4A 5DGBA 4F92B 4DTNA 3QEBZ 2PYLA 1KVBA 3MGHA 3B6OA 4CE9A 8ICWA 3OHAA 1ZJNA 7ICHA 4F4WA 2BE2A 9ICJA 4HVJA 3Q8LA 3RMAA 2XHBA 4P4PA 5KFKA 3QERA 7ICRA 4CF2A 3DRPA 5EU7A 3RJHA 5IIJA 1FXXA 2FPKA 1UWBA 1ZBFA 3LP0A 4E0DA 1RBTA 2WONA 4J2BA 2FPLA 9ICKA 4OKJA 4EBCA 3PVXA 5CWRA 4BDZA 4R64A 1VK0A 2NRZA 4ED2A 1KDHA 2ZJ8A 4KAZA 5J2AA 5KFMA 4QZEA 5J0RA 2AGOA 9ICNA 4QWBA 2DY4A 4RNMA 4X5VA 2BR0A 1QSSA 8ICBA 2VWKA 2PI5A 5DB9A 3LP1A 4M9GA 2FMQA 3PV8A 1X2IA 3MR2A 2NRXA 2J6SA 4M3TA 5L9XA 4OKEA 3RB3A 3DLRA 1HUOA 3M9OB 1XSLA 3SPZA 4KHWA 2ATQA 4O55A 4AHUA 1ZQUA 4FJLA 3NHGA 3SPYA 1X9SA 3IG1A 3DLGA 1TV9A 5HHIA 4YMNA 4GMJB 2PZSA 1HQUA 1ZQDA 2E6LA 2BHNA 4DL3A 2O4GA 3C1ZA 5HP4A 1Z25A 9ICPA 3QO9A 1B43A 3PR5B 2ALZA 3AA3A 4CK2A 1VSHA 4CFDA 1ZQEA 4JUZA 2VG5A 3C5FA 1RBVA 1C0TA 2IBKA 4I2HA 3AA4A 2E4LA 1UAXA 5J0PA 4I2CA 1S97A 4RQ8A 4F50A 1WSHA 2IMWP 1RCHA 4JLHA 3HPOA 3SUNA 4RQ3A 1D9DA 4DSEA 4CJTA 4BE2A 4ZHRA 4MFBA 1S0NA 2RPIA 3H8SA 3SYZA 4CIEA 1WCLA 3M8RA 9ICWA 1O1WA 4DTJA 1KFSA 1CEZA 1CZ9A 5E41A 3B6PA 1ZQTA 3LANA 4ZTJA 1WSEA 4F5QA 5J0OA 4Q43A 3O3FA 4TUPA 3UIQA 4CJRA 3P5JA 1JXEA 3G6VA 4CHZA 2D0CA 3LAMA 4RUCA 4J9KA 3MEDA 4H4OA 4I2QA 2XY7A 1NOYA 4K4HA 1A76A 4GC7A 5J2BA 1WAFA 1D8YA 4DSFA 1EKEA 2HHVA 4OKKA 2NRTA 4FO6A 5C25A 1BISA 4ECYA 4I9QA 1GOAA 1TK8A 4FZXC 4FLZA 3HPGA 3CFOA 3ZSWA 5HROA 1BIZA 4DOCA 2IC3A 4DF8A 3B0XA 2HHXA 4MFCA 3ITHA 5KT7A 4LSLA 3NF9A 3AVMA 4IBNA 3KHHA 2GUIA 1EX4A 3ORYA 1VSFA 1ZBUA 2PY5A 1L5UA 2R7YA 4CJUA 1CXUA 1U48A 2OPQA 4TQSA 1S0MA 3Q8MA 3KD5E 1IG9A 3VQCA 3H4DA 5KI6A 4FJMA 1TL1A 1ZQVA 2RKIA 3FYHA 3OYMA 5J2EA 4KLTA 4YR3A 4FBTA 4KLSA 4KPYA 4DLGA 2IGIA 1C6VA 2QXFA 4I2JA 4CF8A 4YMOA 7ICIA 4EP4A 4HUEA 5KFFA 4CF9A 2DFFA 3ZSXA 2BQRA 4ECUA 4OLBA 4RW4A 3AVIA 3NF8A 4KTWA 3PW5A 1S9GA 4YN4A 4CEQA 3HJFA 3OYJA 9ICGA 2QKKA 1ZQXA 4FBUA 1X9WA 1JXBA 4O3PA 1S9EA 2A1SA 7ICTA 1ZQOA 4DFJA 4G1QA 3WNGA 4UB3A 5J0TA 1BHLA 3TAMA 2HNYA 3I0RA 1JL2A 4HHTA 3KLEA 2DFLA 1ZQLA 4DWIA 3O4NA 5KFTA 4QAGA 1BPBA 3JSMA 4NM1A 3LPUA 5J0XA 1J5OA 3V72A 1GOBA 3L2WA 4F4XA 1MU2A 1VSKA 2G8VA 2O4IA 2JEGA 4FJJA 5BOLA 1ZQMA 3OY9A 5IIOA 2W8KA 3K2PA 3HPHA 3OYBA 1HQEA 3JPOA 3Q8QB 5IIKA 4CEFA 1IM4A 3L2UA 3JPNA 4DTXA 4M0AA 4CJFA 5D4BA 3DLEA 3ULDA 4NCBA 4Z4GA 1TL3A 4PUOA 4Z6CA 3H8WA 3QNNA 3UXNA 4YXJA 5J0SA 4UAZA 4DTMA 4C8LA 4E7IA 5J2CA 3C23A 3EZ5A 3PX4A 4MQ3A 4C8MA 1VSJA 4YR0A 5KG5A 2ISOA 3AO3A 4XQ8A 4DTOA 7ICFA 5KFEA 3VQQA 4OPKA 3OYNA 7ICGA 4QZ8A 3GV8B 5J2HA 2G8HA 4I28A 1RNHA 3MGIA 4DG1A 3AVBA 5HMMA 5DDYA 2ZTCA 1ZBHA 5KRTA 3IRXA 5KFIA 1ZQCA 1RILA 1RPLA 3OSNA 4HUFA 5KGWA 4AHRA 1HJPA 2BPCA 5D49A 3C95A 3C2KA 4DFKA 5CYQA 5J29A 2NRWA 5SWMA 4CJLA 2QK9A 4OPJA 5DLFA 3KK1A 4JS4A 2XGPA 3SI8A 3PO4A 8ICZA 4P2HA 3T5KA 3SQ1A 4CJ4A 4UQGA 4LZGA 4XRHA 1S6QA 4KLHA 2RDJA 1LAWA 1UA1A 1LW0A 2G8KA 3G0ZA 4OGCA 1CLQA 4Q8FA 2R8HA 4PHPA 1JX4A 3UQ2A 4BACA 4DU3A 4CGHA 5T7BA 3PW4A 3T3FA 3OS2A 3KHGA 4PPXA 1ZQNA 3NGIA 1HYVA 4O3NA 3NCIA 3HO1A 2PYJA 2GV9A 2MAXA 4ID5A 4BXOB 1K1SA 5CJ7A 3V9SA 4KHQA 5HP1A 4CJSA 2G8WA 4M42A 2VA2A 3TAEA 1MC8A 4GLXA 3H08A 4JS5A 4B9VA 4BE0A 3KJVA 1GOCA 3TFSA 2LYHA 2Z1IA 3T1AA 5KG4A 5CA7A 4FJ8A 3JYTA 3E01A 3RBDA 3RH6A 1NK0A 4DTPA 3MBYA 3K4GA 2HNZA 2BQ3A 1TAUA 3RAQA 3QEIA 4QWDA 4B9TA 1KRPA 3SUQA 5D3GA 1KTQA 4JK1A 3QESA 1IKWA 2F1IA 1AROP 3V9UA 1B9FA 5KFJA 1VSIA 3V6HA 5KG3A 5KFWA 5HLFA 2W9MA 4O5KA 4B9MA 4B9LA 2PFPA 3ZT2A 4FJGA 4N76A 1QE1A 4N56A 3TI0A 9ICVA 4KHNA 2VWJA 1JL1A 1UA0A 3U3YA 3AVLA 1Q9YA 2JGUA 8ICHA 4CGDA 5J2QA 2P5OA 1A5VA 1TKZA 2P1JA 3MR6A 4O3SA 4GC6A 3C2LA 4MF2A 4RPYA 3P1GA 2B6AA 4DQIA 4F4KA 4DO9A 2OWOA 2YHAA 1U45A 1RT4A 2FBXA 3V9XA 3OYAA 4B8CA 3V7LA 1RZTA 1VRTA 3NH0A 2BGWA 2Y1JA 4Z4HA 1FKPA 5IIMA 1RT2A 1WNSA 4Q5VA 1XO1A 4F5OA 4OVLA 1TGOA 1EETA 3RRGA 4M3UA 1HRHA 1QLNA 3AO1A 1JN3A 3EW9A 2ISPA 2UVUA 3LPTA 2I1QA 4O5EA 4CIGA 4FJKA 4J2DA 2YKNA 8ICMA 1XSNA 1U9LA 4EBEA 4GXIA 1S9FA 4R8UB 2C2EA 1BIUA 4PY5A 4PQUA 3ZCMA 1X1PA 3QLHA 4E7KA 1HUZA 4M9HA 4CJEA 4DL4A 2UVVA 1W9HA 4F93B 3GV7B 9ICQA 1MSWD 4ED1A 4DQRA 4OLAA 4RW9A 1RT6A 5CY4A 3T5HA 4R66A 8ICQA 4C8KA 4BDYA 4YXMA 5HBMA 5KFSA 1D8LA 4M9LA 3KKRA 3K5LA 9ICXA 3RBEA 1ZQGA 4DOAA 4CJWA 4J9PA 3L2QA 2FLNA 4E1MA 1KEJA 1U49A 5J2JA 4R8UA 2R8IA 3VQDA 5HNKA 3RB4A 2IS3A 3GIKA 1C1AA 2D0BA 3ZSYA 2HHTA 5KT5A 4FLUA 4TQRA 2NUBA 1XC9A 3NE6A 4XUSA 1KSPA 2PFOA 2XY8A 3QEVA 8ICFA 3PX0A 4EYIB 2ZJAA 3ISDA 9ICBA 3AO4A 5EWEA 1SUQA 3JPSA 4I2FA 3RJJA 4CK3A 4Q8EA 5BOMA 1BPEA 4KFBA 3NGYA 3U3GA 3BGRA 3GDXA 3DOKA 9ICCA 8ICXA 4MFAA 2KFZA 5JS2A 3Q8KA 5KG1A 2XCPA 3SQ0A 4IQTA 1L3SA 3NF6A 2P51A 3ZT3A 1RYSA 2Z1GA 5C24A 3TAPA 3HL8A 3LAKA 5KFLA 2F1HA 4JV0A 1S1TA 4CEBA 3SI6A 9ICOA 1SKSA 1S1WA 2HNDA 4F91B 4O44A 2ZTDA 4PHDA 1ZQPA 2X6NA 4IQUA 3ZSZA 4BE1A 4YD2A 1RDCA 3AVHA 3PO5A 4RW8A 4NCAA 1A77A 4Q45A 1S1UA 1NJXA 3G10A 3HW8A 1S1VA 3SUOA 2H5XA 4RUAA 3HYFA 1SZPA 3HVRA 1L3VA 1CZBA 5DB6A 2FLLA 2WOMA 4HUGA 4CFBA 4M04A 3PR4A 1QSLA 3OYFA 1BI4B 3CM6A 4O3RA 1RBUA 1BVSA 1J54A 4FZYA 3RMBA 3DRRA 1ZBLA 3HVTA 3H7IA 2D5RA 4FCYA 3RJGA 4G3IA 5DG7A 4DSJA 3ZSOA 4KB1A 4E1NA 4J9QA 7ICSA 4CIFA 2HVIA 5EWFA 4FM0A 3LZIA 3UQ0A 3NDKA 4N47A 4W5QA 4FZZA 2W9CB 4JWMA 3C1YA 3GILA 2OYQA 7ICJA 3C6TA 1BI4A 3FFIA 3ETLA 3EYZA 2ITGA 5FRNA 2YKMA 2Y1IA 1IH7A 4M6WB 1C0UA 3TQ1A 5EWGA 2ATLA 3KD1E 1J9AA 3AU6A 1Z26A 3HM9A 2I5JA 4CGFA 4B9SA 3K75D 1QS4A 2FC0A 2EHGA 4LH5A 1RTIA 1YTAA 1HNVA 2FPMA 3OYHA 3VA0A 1S5JA 3HP9A 1BPDA 1WAJA 5FROA 4DU1A 2LSNA 5HRPA 4UBBA 5BPCA 1TK0A 2AU0A 1KLNA 5KG0A 1ZJMA 4KN4A 4E7HA 2BQUA 3AVJA 1LWFA 4M6WA 4Z4EA 3PW7A 4B08A 3JPPA 4IQVA 4OJRA 3LP2A 4KLIA 5J2MA 9ICFA 4F4YA 4YG2A 3K5NA 5KFNA 4Z6EA 3TWHA 1HYSA 1S0OA 1TK5A 4ELTA 4R63A 1RYRA 3AA5X 4GXKA 4AHVA 4CESA 1RT1A 3UPQA 5HMLA 3PUFA 8ICJA 1NKCA 4JRPA 5J0YA 3K58A 3OHBA 4CEZA 2OZMA 1TVAA 4NY8A 3BDPA 1TKTA 2XRIA 2FBTA 2J6TA 1U4BA 4M9JA 3RR7A 7ICNA 4CGGA 3D0PA 4QZCA 1ZYQA 1QTMA 1RDAA 4CJKA 4DSLA 1IO2A 4YQWA 1LB2B 4DF4A 4CK1A 4F5PA 1QQCA 1WLJA 2GWSA 4EZ6A 4RZRA 4CHYA 3F9KA 2BGGA 3RH5A 4PGXA 4MF8A 4J9RA 3MEEA 3DMJA 2HHWA 1TKXA 4FJ7A 3O3GA 2PI4A 4CJVA 3C2MA 4CGJA 4FK4A 5KFYA 3WNFA 1J53A 2XGQA 1RTHA 5J0QA 8ICAA 1I39A 4MEYA 4QZ9A 4CHPA 1Y88A 3SZ2A 3ZT0A 3CQ8A 4ED6A 4HTUA 3SV4A 2HHQA 3DYAA 4PHAA 3MXJA 2ASDA 5JS1A 2P6RA 2J6UA 1DOQA 3TAQA 2BCVA 4O5CA 4JWNA 4B9UA 3BQ1A 4M47A 3EPGA 2X6SA 3PX6A 9ICUA 1JXLA 4ECZA 4DL6A 4KREA 3OYDA 4KLEA 4DTRA 5KT2A 4JRQA 4M3ZA 3AUOA 3VN5A 2P66A 4GW6A 1EXQA 4UBCA 3OSPA 3Q8PB 2EX3A 1ZBIA 5HHHA 1LW2A 4IR9A 1T3NA 4EZ9A 3HP6A 1ZQQA 1X9MA 4DLEA 3DLKA 2XCAA 1JKHA 1ZQFA 3MDAA 3LP3A 4FK2A 3SV3A 1NK4A 4KLQA 1BPXA 3O4QA 5CZ1A 3VQ4A 2ZJ5A 4EYHB 1KVCA 1T03A 3OS0A 4TUQA 1VSLA 2HB5A 3C94A 3CM5A 3ZT4A 3NGZA 4CJ5A 3TAFA 1ASUA 3PNCA 3PY8A 1ITGA 2I9GA 3ZT1A 4FS2A 1UOCA 1ZQHA 3ZSRA 5DB7A 3NH1A 4M3RA 4F5RA 3AV9A 3DM2A 4O4GA 1NKEA 4AH9A 1Z3EB 1NJWA 2FBVA 4AILC 1ZQRA 5KTQA 3PW0A 4N41A 1BPYA 1XHXA 3IHQB 3KK2A 2JZBB 3SQ4A 2HW3A 3FDSA 4J2AA 3KHRA 4F2RA 4QZBA 1B22A 4L8RB 4O3OA 2X78A 3M9NB 4B9NA 2JLEA 2XY6A 4CJ3A 5KFHA 3MXMA 4LSNA 2PFQA 2HHSA 3AO5A 3M8PA 1NKBA 4GXJA 4YFKA 4F5NA 5F9LA 4CF0A 5CZ2A 7ICOA 4FJIA 4B3OA 4Y1DA 4EBDA 4DFMA 4CECA 8ICKA 1N56A 4NLGA 4M3YA 3V1OA 4RT2A 1SV5A 3GIJA 3RMDA 9ICRA 5KFDA 4UB4A 3OYIA 2G8UA 4IRDA 2FMPA 3SJJA 3IAYA 4K8XA 4RG8A 1EP4A 2ASLA 1NJYA 5L1IA 3C21A 4I29A 4QCLA 5KFRA 4RQ0A 4FS1A 4BXOA 1WSGA 1TVRA 2IHNA 4QWCA 1DTQA 3UXPA 1VSMA 3JPTA 1ZQYA 2AJQA 3A2FA 3KTQA 2KZ3A 1YVUA 3Q8SB 4I7FA 2A1RA 3AVKA 4Y1CA 1EXNA 4KLMA 3ZSVA 4KHYA 3QEWA 3TANA 2W9AA 2IDOA 2Z1HA 2B5JA 1XI1A 3C6UA 4H8KA 5KFOA 3PMNA 1D9FA 3HX0A 1FKOA 4E7JA 1CXQA 3P83D 4KLJA 7ICVA 4FJ9A 5IINA 3RTVA 3QEXA 3HK2A 3M8SA 4P4OA 1L3UA 1BL3A 1W0HA 4QZFA 4KRFA 5CYMA 4KI6A 1JLFA 5IIIA 3LK9A 2XY5A 3VQ7A 1XSPA 4CEAA 7ICMA 5J1EA 1SL0A 1T4GA 1KCFA 4M3XA 4KHUA 4O9MA 3L2RA 4FW1A 3QEAZ 4DFPA 3GIMA 4YD1A 4R65A 4K4GA 2KZZA 4IG0A 3ISCA 7ICKA 5J2PA 4RT3A 4YVZA 3S3NA 1G15A 1WSJA 4FJHA 1JLEA 3SUPA 4IDKA 4DQQA 4PHEA 2P6UA 1ZQKA 4KMUA 1WSIA 4PA1A 4Z4FA 2R8GA 3H40A 3AO2A 3HXMA 1N48A 1DTTA 3MR3A 2A1JB 5F9NA 2JEJA 3M8QA 4E7LA 3V6DA 1NK5A 4RQ1A 3DRSA 4Q44A 3MDCA 2NRVA 3ZD9A 4YCXA 2ZTEA 1KFTA 2HHUA 4I2AA 4FLTA 9ICSA 2DTUA 3HT3A 2BCQA 5IILA 2RF2A 3NTUA 4IQWA 4Z4CA 2V4QA 8ICGA 4P4MA 3RJFA 2DPJA 1I3AA 3V4IA 4MEXA 4O0JA 5J0WA 3KLGA 5FRMA 4KLDA 3Q8RB 1U04A 3T5JA 1QHTA 4I2EA 4NXZA 4IRCA 5KFXA 3GQCA 1HJRA 1RTJA 1K6YA 4HYKA 2ETJA 3C5GA 2ZE2A 5SZTA 3MEGA 4KITB 1ZQSA 3ZDDA 4ZTFA 5C5JA 3LWLA 2X74A 2FMSA 4I27A 1C7YA 4E89A 3B0YA 3ZDEA 4F2SA 2KFNA 4J9MA 1B92A 2B4JA 5KFAA 4Z0UA 1S1XA 2P5GA 5DBCA 3V9ZA 4FLXA 3SNNA 5DQHA 3RJKA 4DL2A 4CGIA 4E19A 2KN7A 2BPFA 1C1BA 3L2VA 3RB6A 4J2EA 1JMSA 8ICNA 4IFYA 3S3MA 4ED3A 2D0AA 5L1LA 1U47A 9ICEA 3G6YA 5J2DA 5KFUA 4J9SA 3AVAA 2IOCA 3OYKA 3K59A 1WCNA 2IHMA 2F8TA 3H4BA 2KQ2A 4QZAA 1MQ2A 4J9NA 1LV5A 4FVMA 2JEFA 5D46A 4AHTA 5J0UA 2OA8A 3OVNA 4BDPA 4YP3A 5KT3A 1IXRA 3KKSA 4TSXA 3E2EA 2YV0X 2YNIA 2VA3A 9ICAA 1HNIA 3NH2A 2BANA 1CUKA 3RJEA 4BWJA 4PGQA 2UVWA 3VQAA 4W5RA 4CEOA 4ED0A 1V9PA 2VG6A 3NGDA 1Q9XA 1ASVA 1UT5A 2E6MA 2OZSA 5DG8A 2W8LA 4CFCA 2B21A 3TARA 4CERA 4UB2A 4KHSA 4RQ7A 4KTQA 2DFHA 3LDSA 3LZJA 2HMIA 2HVHA 3I8DA 5DQGA 4XA5A 1YTUA 5KT4A 3KK3A 4QWEA 4RW7A 3NF7A 3VQ6A 4FM1A 3MR5A 4RPZA 1RDDA 4FK0A 4YNQA 3AA2A 1ZQIA 9ICLA 3V1RA 3TR8A 2W9BB 1BCOA 3SCXA 2KTQA 1BQNA 1MQ3A 5DK5A 2ASJA 2C2DA 4NLZA 4NYFA 4DEZA 2PFNA 4Z6DA 3MXIA 4KN7A 2YHBA 5KFBA 4CFAA 4CF1A 3BQ2A 2FBYA 1S77D 3DLHA 2KZMA 2ZQBA 4O5BA 4I2DA 1RBSA 5KFGA 1TAQA 3AVFA 9ICHA 4DOBA 3ZD8A 3MFHA 4KLGA 3V1QA 3H8JA 5KFCA 1Q8IA 1JLCA 3V81A 4DU4A 4IR1A 4Q0BA 2W9BA 4NLNA 1TFRA 1JLAA 4NLKA 4J9OA 2W9CA 4JV1A 4NCGA 3RRHA 2IAJA 4AHSA 2F1JA 3VQ9A 4KKOA 2BCUA 1BCMA 8ICTA 1HPZA 4J9LA 4EP5A 4QWAA 3ISBA 4LD0A 4DMNA 4BWMA 2FLPA 4DS5A 8ICYA 2R8KA 4C8OA 4ZH4A 2PXIA 4TURA 4XIUA 1ZQZA 4W5OA 2KW4A 4R5PA 2DPIA 4C8NA 4M45A 3OJSA 4CEDA 4TUSA 3EY1A 3WNHA 8ICSA 3CG7A 2C22A 3LALA 3K57A 3F73A 1A5WA 3CYMA 2BKEA 5J2GA 8ICOA 4N5SA 1SKWA 3ISNC 5DB8A 3ALYA 5DGAA 4CHQA 4PGYA 4DQPA 1RT5A 2WTFA 2V4RA 2Q3SA 1VSDA 2YNGA 3TAGA 3OYLA 5L1JA 4KLLA 1S76D 1ASWA 1Y97A 2YNFA 3RH4A 1ZQBA 4FLWA 1LWEA 8ICLA 1XWLA 4IG3A 4I2BA 5DBBA 8ICIA 4KV8A 4YFUA 3V6KA 1L3TA 3OYEA 3VA3A 4UB5A 4OGEA 4QW8A 1RXVA 3JPQA 1VSEA 2ZUDA 3LWMA 3KIOA 1SKRA 3DOLA 5J2IA 1LAVA 4YR2A 2G8IA 5CR0A 2C28A 4KLFA 4ECVA 3MABA 5CB1A 1HMVA 2V9WA 1NOZA 7ICEA 1YT3A 2VG7A 3VQ8A 2R8JA 5HRRA 3OGUA 4FW2A 9ICMA 1T7PA 3QZ8A 1UT8A 3QINA 1JIHA 2F8SA 4CEEA 1KLMA 3THVA 4DSKA 3QEPA 4ED7A 4PH5A 5KFQA 2YNHA 1SL1A 4I2PA 1XS9D 3T5LA 3TFRA 4RNOA 7ICQA 2BDPA 1JLGA 1A5XA 3RJIA 2OPSA 5KGXA 3T19A 5KG2A 3MAQA 4M41A 4ECTA 4ECWA 5C42A 4LZDA 4LY7A 3O3HA 3RR8A 4LH4A 1KVAA 3VQBA 1NK9A 4FYDA 1Z00B 4F3TA 2IA6A 2AQ4A 1RTDA 1FK9A 5DMRA 4ELUA 5HRNA 2AGPA 1F21A 2MUTB 8ICRA 3KLFA 1NK6A 4H4MA 5KFPA 3G6XA 1ZQJA 4DL5A 3U6FA 2RN2A 4I9LA 1RT3A 2QKBA 4ID1A 4DTSA 1IKXA 1KFDA 1C0MA 5KFVA 3D45A 2G8FA 5J2KA 1JLBA 2RDIA 1K1QA 3KLHA 3EWAA 1SL2A 1TV6A 5K14A 3RB0A 2BPGA 1BGXT 3HWTA 4LVSA 3V6JA 3ZDAA 4AHCA 1Z00A 5JUMA 1PZNA 3N97B 3RWUA 4RNNA 5KG6A 3ASMA 2MUTA 4W5TA 4QZGA 3RMCA 5I42A 9ICTA 3WNEA 4GVMA 3K5OA 1TKDA 1ZQWA 1IKVA 2OPPA 4IFVA 4QW9A 2ZUBA 1B9DA 4HCCA 4O0IA 5KT6A 4KO0A 2F96A 2XO7A 4MFFA 5DQIA 3ZSQA 3NBPA 3V7KA 3I0SA 4ECXA 5I3UA 4ELVA 2GBZA 5EOZA 3OS1A 4KI4A 3TABA 4WE1A 3RAXA 1D5AA 4CCHA 2JZBA 5KFZA 2OPRA 5FDLA 4M9NA 3N4MB 4JV2A 3BQ0A 8ICPA 4Z4IA 1ZQAA 3VQEA 5DDMA 4Z6FA 4RQ4A 3IS9A 3M9MB 4FJNA 3JPRA 5DKWA 3MECA
chains in the Genus database with same CATH superfamily
3GZ7A 4OMFG 4YHHK 3MAHA 2DB1A 2QA1A 3QU2A 1PAUB 1BQMA 2HRTA 3LDOA 1K73T 2X1FA 4ECRA 4BROA 2BRLA 4QOZB 1UEUA 4URGA 3CCSN 3MMVA 4CRXA 3QE9Y 1T05B 1M5OC 2Q1NA 3OFGA 2FPHX 1KQSR 3LVVA 2N7CA 3Q89A 3V7JA 4MTPA 4LC9B 4NM2A 4BQZA 4BGDA 2ZH2A 1VIOA 1WEYA 1S6PB 4FDFA 2N82B 4PEOA 1ZH5A 1RDBA 3BQTA 1OH6A 5J1NA 4HCBA 1YGYA 1DQ9A 1E4FT 3PG9A 5CHGA 2YWKA 2FJDB 2BCSA 4FJ5A 1F60B 1HYZA 1EO1A 2RHKA 1S6UA 2YXLA 3OYCA 3W2WA 3GFKB 2AGQA 3WK7A 3NAEA 2OFHX 2DY9A 3DGVA 1RU1A 2V4JB 4M5JA 3IMQJ 1FKAF 2DHSA 1F1BB 3CJ8A 4NLXA 2ZOGA 3U9DA 4KIAA 3UXOA 2CN1A 4CNQA 1B0PA 1VRUA 4X4RA 3KKAC 3IWLA 4FXWA 4RQ6A 2WBMA 4HHHA 5A8WA 1N5YB 3NMRA 1WSFA 4K8ZA 2ZUCA 3ENAA 2LYBA 2QWOA 1F9FA 3QFPA 4ED8A 2JV3A 9ICIA 4ICLA 5LMUK 5ETVA 3OPKA 3NVYA 4Y2RA 4Y28C 2DT9A 3TX8A 5K8PA 1ZETA 4RQ5A 3HSTB 2AT1B 2ESEA 2E1AA 2MQNA 5CZXA 3KNGA 4YMMA 1RXWA 4S0MA 2D1CA 2Q66A 2HQCA 2YPZA 4PL2A 2KNJA 2FIUA 5L1KA 5J2FA 1RGIA 4E3SA 4J91A 4RW6A 3IM1A 2N3OA 4ED5A 4DSIA 4MKAA 4UAYA 5CQGA 2ZNYA 4K4IA 3DLBA 4P0QB 2KT2A 4P10A 1GLBG 1YITN 3BO4A 2F44A 3QEBZ 3U7JA 1BUXA 4CE9A 3THYB 3OHAA 5C7PA 5JVGQ 4I6MA 7ICHA 2QE5A 4F4WA 2X7IA 1IV0A 1YRTA 5GAEU 2XHBA 4P4PA 5KFKA 4A8WA 3QERA 3LYSA 4QBUA 5GTHU 1N36K 2ES6A 2D3OR 2HG4A 2FVPA 1PBAA 2RUGA 4E0DA 4KGZB 4J2BA 2LXUA 3IG1B 9ICKA 3IMXA 4OKJA 5MLCQ 2R2RA 2HOQA 1NZAA 2NRZA 1G3OA 5BR8K 2EFPA 3QFUA 4IWVA 4CZEA 3H45C 9ICNA 2RQKA 3UMGA 1ZBSA 4QWBA 1HBOB 4HL9A 4PHTX 4M9GA 2WHEA 1VHXA 3W5ZA 3ETOA 4DV5J 2J6SA 2NRXA 1OKJA 4M3TA 5L9XA 3M9OB 1XSLA 1WC1A 3SMZA 2WOMB 4O55A 5H9EJ 1X9SA 2D3DA 4ZHRB 4LF7F 1J27A 4YMNA 2PZSA 5G0RA 3KWIA 1ZQDA 1FFSB 3KG4A 3ILOA 5HP4A 4FOIA 1Z25A 9ICPA 2ALZA 3ILLA 3AA3A 1HARA 1VSHA 5ALWA 4JUZA 5LT5A 1YJNN 1ZTWA 1DURA 1NPRA 2P9KA 1MN9A 2LA6A 3C5FA 1C0TA 2HHHK 2VGNA 3AA4A 4I2HA 1TE2A 4IO9L 3U8XA 2F8HA 1WSHA 2R2TA 2IMWP 2UUCK 2WF7A 5HAOA 1FD8A 3OTOF 2LVWA 2RD5C 8ATCB 4I2QB 4NL9C 3FCWA 4WJ3B 3A4TA 4AD6A 4DTJA 5AXKA 1SC4B 1S7HA 4LR9A 1S8OA 5C25B 3AFGA 1NHUA 4Q43A 5U47A 1SQEA 1QZ5A 4LF6J 4QU7A 2ZM6J 4DV2J 4UASA 3AN1A 2IC3B 3P5JA 4CJRA 3ITHB 1U1MA 4RQNA 2PAVA 4FZLA 3BREA 2ZH4A 2D0CA 1B7FA 3MEDA 5HJXA 4ZPVR 2FDRA 1NOYA 3B4DA 1A76A 1WEZA 1WAFA 1D8YA 2IHR1 4DSFA 1LK7A 1QVFM 5ALVA 4FO6A 4LFCF 4FLZA 3NG8A 3HPGA 3J81U 1BIZA 2VONA 2KM8C 1OY9A 2NZTA 2D3ZA 3AVMA 1RWOB 1QVFR 4RWXA 1HFEL 3ELHA 3CJ9A 1X6IA 4GMKA 1L5UA 4LF5J 3RYLA 1CXUA 1GMVA 4PZOA 2ABYA 2FSKA 3F5EA 4F25A 1FTCA 2GO9A 3QT7A 2SXLA 3VQCA 2ILYA 3H4DA 1C2PA 1TL1A 2V9KA 3Q8VA 3I0RB 1ZQVA 4GKJJ 3KLEB 3CEDA 3OYMA 4ZJQA 3CGIA 2CPYA 1SXLA 4RPFA 2YN4A 4KLSA 1XMOF 4JKBA 3LO3A 3MEEB 4ZVPB 4HUEA 3JAMU 4OI3A 4CF9A 2QG9B 3PFEA 3THPA 3CCVN 1S6OA 3NF8A 2VJ4A 5F0WA 4KTWA 3PW5A 1NLVA 4ISGA 1X9WA 3PZPA 2D6FC 4ZCMA 7ICTA 3ZI4A 1N32J 3H6EA 4DFJA 2GS8A 4MKBA 3PXGa 3C16B 4JI0K 2V8DA 1JL2A 2V94A 3HSGA 2CNLB 3O4NA 2UXBJ 1N63A 1R8CA 3VV2B 3MWTA 3IRWP 2CGKA 3V72A 1BXNA 1GOBA 2WCXA 4Z2XA 1MU2A 5A2QU 3EDQB 3R8YA 3EWGA 2IDLA 5BOLA 4OO1J 2VC0A 5GMDA 1RWXB 3HHLD 5IIOA 2K4EA 3T1YJ 2MZRA 3POTA 1HQEA 3DLKB 3JPOA 3EM1A 3GYXB 4OL8A 5IIKA 1PVQA 4CEFA 5D4BA 5J8YC 3DLEA 4NCBA 3MC1A 3FRYA 4U8YA 3T79A 1VQ7S 4YXJA 5AHXA 5J0SA 3TEHB 2XMVA 1GTEA 1O5JA 5J2CA 4EHUA 3EZ5A 2H3QA 2CQGA 4DZ6A 2G0CA 3PX4A 4MQ3A 4AF1A 5FPNA 2ISOA 4XQ8A 2DGXA 4OHYA 1S72S 5KFEA 4ZPCA 2RS8A 4PWUA 4QZ8A 4N77A 3GJTB 2W6LA 1HNXK 5J2HA 1KAZA 3G82A 3CCRN 3WKAA 1VGYA 2EPIA 8AT1B 5DDYA 4M7XA 3IBFB 2V7YA 3OSNA 1FDAA 2R3VA 1HJPA 3L4PA 1R59O 4L3QA 3C95A 1Z1BA 4X65F 1N5VA 1M1GA 4JK8A 3BBBA 2QK9A 3ZEUB 1YI2N 3KK1A 1MLAA 3SI8A 1WJ9A 3BKUA 4CLLA 4X4PA 8ICZA 5HP1B 3CERA 4FWLA 3I31A 4DCHA 2XVTA 2CZVC 4QPXA 1YJUA 2IOHA 2VKRA 4RR5A 2X1BA 1LAWA 1LW0A 3QB0A 4OGCA 1CLQA 2NXEA 3ENHA 2R8HA 4PHPA 1JX4A 5FD1A 2MU2A 4P2XA 3JYTB 4BACA 3I4HX 4NLBA 4M5KA 3HCXA 3OQ2A 3PW4A 3PYFA 3HKWA 3KHGA 4PPXA 1AB8A 1ZQNA 4PG4A 1U2RA 1NBWA 4YOWA 1VQ8S 3M2VA 2PYJA 3GFXA 2HRUA 4ID5A 5T14A 2KOBA 2G8WA 3TSUA 3KDNA 4M42A 1LVHA 3TAEA 1MC8A 3VCBA 2B7BB 4B9VA 3FZFA 1GOCA 5EE3A 4FSVA 3CP8A 2HWTA 5IZHA 4LQ9A 1RG6A 3NRBA 4EHTA 4OX7A 5JXSA 1ZM2A 4UW9A 1U8WA 2Z1IA 4USVA 3THXB 3CJ3A 1YTYA 1OQ6A 1PJ7A 2N1RA 2E5SA 3MBYA 2HNZA 4WYLA 2BQ3A 1TAUA 4B17A 3ET6B 1F3FA 2GZOA 1KRPA 1KTQA 1TKZB 3IP4B 4CYUB 1KQQA 3QESA 4OZ2A 4NLQA 1IKWA 2F1IA 1AROP 1N61A 3SFGA 2K4PA 2EZXA 3QGHA 3O2IA 3V6HA 2OELA 5HMYA 3GBTA 1YZ6A 1V6HA 2HFUA 2W9MA 5C10A 3ZC4A 4CTAB 3MTJA 1FFUA 1M1KT 4HDGA 1HNWJ 2V5HG 4N56A 5BN9A 1RAJA 5D77A 1VRTB 3O4WA 3KOAA 2IYIA 2HGLA 2VBYA 3U9ZA 1JL1A 1X4GA 3VERA 2OTLS 4E8UA 2KH9A 2XQCA 3EZUA 1RT2B 3QWUA 1Q9YA 2W24A 3L3CA 2ZJRQ 2JJ4D 4CZJA 4PPDA 4IG0B 1I94F 4O3SA 5ALOA 4USUA 2P9SB 4JD2B 2W2NP 2Y8YA 1FCAA 4A8FA 3R5BA 2VQEJ 1RT4A 3I5CA 4JI3K 1TELA 1FEZA 1NNLA 2UXDF 4PQUB 2GTDA 1OYDA 2BGWA 3MMBB 2CJYB 1FKPA 3O6WA 4LT6A 3KBBA 1H2UX 2O01C 3GB0A 3ENBA 2GQCA 2Q1LA 1XO1A 4OVLA 1BNPA 5FLXY 4MMOA 3OXGA 5JVGL 1X66A 2G08A 1MA9B 3R5CA 3AO1A 4IEEA 3CIMA 2RF2B 1XO0A 2UVUA 3LPTA 2I1QA 4CIGA 1XNRK 2YKNA 4GXIA 1U7LA 1S9FA 2VC1A 4R8UB 2F65A 1Y00A 1BIUA 4PY5A 2OIHA 3ZCMA 1X1PA 4K43A 3O0FA 3MPYA 5LM7E 1IBLJ 4B3MF 1NDKA 3CXCM 4K4WA 1IV8A 2H3ZA 5H2FU 1VJWA 3NCPA 4F93B 3GV7B 2C2NA 4PL7A 1LKYB 3B8AX 4ED1A 2LMIA 1CS4A 1B7YB 4RW9A 2IIHA 4OLAA 1RT6A 4R66A 2XWXA 4BDYA 4C3KA 3BZQA 1RHUB 1IJFB 5HI7A 1W2IA 4DOAA 3VENA 4CJWA 4B3TJ 4E1MA 1HIWA 3J7YU 1GLFO 3CXCR 4JYAJ 5J2JA 2R8IA 3BB5A 4NPOA 2Q43A 3GG4A 3CPEA 4UZCA 2IS3A 3A8YA 1FFWB 3GIKA 1C1AA 3ZTQA 2D0BA 3GCWP 2GO8A 2AJ4A 4ZA1A 2HHTA 4RNFA 5AJ3K 1B0VA 2AEFA 3Q2TC 2FLOA 4CDIA 4Y6IA 3OBWA 1HKCA 3WHIA 9ICBA 1UHUA 1SUQA 3CE8A 1HIYA 2BE9B 2HQFA 3GDXA 3R5GA 3DOKA 2O6KA 2KFZA 3Q8KA 2MYFA 2H4WB 3DN9A 3PHEA 2QRRA 3I5BA 1L3SA 5E79U 1SJQA 4FZNA 2E2NA 3NF6A 1E3MA 5EY4A 2CG8A 4KPCA 2BANB 4OQJA 5BXIA 1BLUA 3LAKA 4FWMA 2E5JA 4DR6F 1ZD5A 4ZP7A 4KH5A 2CPJA 4CEBA 2HAIA 1TL7B 1KKXA 2QARB 5HO4A 1SKSA 2Z57B 3G8QA 4O44A 4C48A 2ZC4A 3ALRA 3CCTA 3D2FB 1ZQPA 3S41A 2X6NA 2KHOA 2ALYB 4JKEA 1GH8A 5EVZA 3TSPA 4RW8A 3U02A 1A77A 2QFIA 4Q45A 1S1UA 3HW8A 1JXVA 3BSCA 4Y00A 1BA1A 4CP5A 3SUOA 5CYJA 1RA7A 3EE8A 4CO5A 3HYFA 1N88A 3R3TA 3TJ9A 3WIVA 4HI2A 3R9KA 1C0GA 5DB6A 4AQYJ 2LYVA 3MK6A 4MDBA 2DGWA 1ELOA 2O66A 3QBCA 2BX6A 3S1TA 1FWLA 4E2FB 3OYFA 3MPWA 3CM6A 3N4WA 3L3FX 2H65B 3DRRA 2EFVA 4OZ3A 2QI2A 1AZSB 1Q46A 3EGZA 3RJGA 2F40A 4YOVA 4IOCQ 4OYZA 2HVIA 2G0IA 3W9IA 4CBUA 2QA4N 3AAPA 3W5YA 1CI4A 3LZIA 3GG1A 3NDKA 2G09A 1RTIB 2MLXA 1PJ5A 2OH2A 1HBUB 4W5QA 2F4VF 2ZFHA 1HX1A 5ALDA 2CYYA 4DV7F 3C6TA 4M63A 4X64J 1NNEA 3AARA 4UOCA 1IH7A 1X5SA 2BJEA 4DQ8A 5CRXA 3LF0A 3KD1E 4JI1F 5GAHP 4C11B 1Z26A 4B9SA 5BR9A 1WORA 3ZX3A 3B4MA 4H5WA 1Q5VA 4YB7A 3OTDA 4K42A 3OXFA 5AQRA 4CH1A 4K0KJ 5FROA 1GXUA 4UBBA 5L38A 4AM7A 2IJRA 3L4QA 4HT7A 4E7HA 1GLEG 3AVJA 1J97A 2BJ3A 4B08A 3RF9A 4IQVA 1T9WA 4EI2A 4KLIA 5AQFA 1CJTB 5J2MA 4DCJB 3MDFA 2F8MA 4F4YA 3K5NA 5KFNA 4Z6EA 1NXIA 4R63A 3N4PA 2CZ9A 2FZKB 3M5RA 4JV5J 1N34F 1VAZA 1BE4A 2YMQA 2ZG6A 2PO4A 1F5AA 3KOOA 1NKCA 2A40A 3K58A 4CEZA 2O8DB 5AQOA 1TVAA 2YJEA 3KUGA 3Q22A 2FVQA 2V8GA 3VEYA 3RR7A 7ICNA 4CGGA 2LDIA 2NPIA 2DR9A 1Y4ZB 1TYQA 1R27B 1ZYQA 1QTMA 1RDAA 5KL1B 2HIQA 4C8ZA 1BUPA 4CJKA 4DSLA 4DF4A 1WLJA 2YQEA 4FWQA 4CHYA 3F9KA 1N5QA 1IBLK 2RHSB 4JBCA 4E98A 4QYRA 2GIFA 2OPSB 2OHFA 3DMJA 2HHWA 3ZTRA 1TKXA 1X4AA 5D0GA 5C42B 3KZIU 3WNFA 2LKYA 4DUYF 1RTHA 1KL9A 1I39A 1S3XA 1UL3A 4ED6A 1O13A 1EQ0A 4PHAA 3MPVA 2Z8QA 3MXJA 5JS1A 5BPMA 5AI9A 4UOGA 1TMJA 1B64A 1DOQA 2BCVA 4CVNE 3HHKA 3K9JA 4B9UA 5L39A 1S72N 1IBKJ 1M5HA 1T44A 3OYDA 1IIPA 3C14B 4HHUA 5M2PA 4N7TA 4GW6A 3OSPA 3UN2A 2XMUA 5HHHA 1ZBIA 4IR9A 2F8KA 4C97A 5MLCV 1X9MA 3S01A 2XO6A 3KK2B 4WU3A 1WUUA 1IR0A 4ZCIA 5I42B 1NK4A 1YRXA 2ZWHA 4CLKA 3E3XA 2EFNA 3AXMA 1T03A 3IWNC 4TUQA 2GJIA 3DDIA 3M1FA 1KBRA 3CM5A 3NGZA 5FP0A 2EW9A 3DXSX 1ASUA 3PNCA 3THWB 1WYGA 2UUAF 1SH2A 5LSRA 2LXFA 4CF3A 3ZSRA 5GADP 3TZZA 3DM2A 2CVIA 2F76X 4O4GA 1XNQK 2GVDB 4FE3A 1HKBA 1VQ8N 5B09A 2H5JB 4B3OB 2KJWA 2UUTA 1BPYA 3IHQB 4DOZA 3SQ4A 2MZ1A 4OHXA 4J2AA 3KHRA 4TU9A 4C4RA 3ZZUA 4L8RB 2BKOA 3T41A 4QIGA 1NDCA 1C0FA 5KFHA 2E8NA 1MWMA 3QU4A 2HHSA 2VBZA 1MMDA 3Q24A 3M8PA 3AO5A 3KWMA 1NKBA 3ONNA 4YFKA 1S5ZA 3KG1A 3W64A 4F5NA 5F9LA 3KFUF 3CPWR 4CF0A 2ZJRL 5KNIA 4ZLLA 1GQEA 3MD3A 5CZ2A 3H2LA 3QIPB 5F8LA 4Y1DA 4EBDA 4KYZA 8ICKA 1N56A 1FESA 3KKFA 3F5TA 4RT2A 2EKYA 3GIJA 1TP7A 3OYIA 3CJSA 4CI0B 1NWKA 4P2SA 1NGBA 4CRJA 3SJJA 1B99A 4K8XA 4RG8A 4M7YA 1EP4A 3Q2SC 1NJYA 5L1IA 4I29A 3OLBA 5KFRA 3DGPA 4DR7K 4FS1A 2KV2A 1N5TA 2X3GA 4QWCA 1TL5A 1ZQYA 5AK5A 4WZMA 3CIZA 4DX6A 3KTQA 5TKYA 5BRFA 1BA0A 4U67Q 4OV6A 2A1RA 1QQOA 1NRKA 4DPYA 5JJBA 2CJXB 5HSPA 2EANA 2ZKTA 1KVIA 1JK9B 3NLCA 4JI5K 3WX8A 2IDOA 2FSNA 2G0AA 1U2VA 4H8KA 3PMNA 1YHQS 2FJBB 3HX0A 5A8RB 1U6ZA 3M6VA 3DLLQ 3EGNA 1RLCL 1FKOA 3RJMB 4LF8K 2QLTA 4IH5A 2KYXA 1UFWA 2BJ7A 3TA2A 4FJ9A 2W6KA 2P9PA 2F7TA 1A0OB 3HK2A 4AYBC 2J7KA 3MM8A 3OA9A 4P4OA 3CO0P 3NAHA 1VYAA 2LLZA 4QZFA 1JI7A 5DDQC 3FCVA 4DPUA 1PKUA 4CEAA 5J1EA 1T4GA 1HL6A 1Y0HA 3TRGA 4ZLJA 4K25A 1ZXIA 5DDOC 3UB5A 3FAHA 3ID8A 4R65A 1Q86O 2VPWB 7ICKA 1IUJA 2GAHC 1G1XA 2XZWA 4EMDA 5AKEA 1FTRA 2IVNA 2UU9K 1LWXA 3GR0A 4LF9K 3DXKB 3S3NA 1G15A 4FJHA 3O6QA 1JLEA 4H0PA 3SUPA 2ROEA 2EH9A 4IDKA 2W2PP 1IN0A 2B9WA 4HACB 3KKAA 1ZQKA 2WSEC 3KLGB 4Z4FA 2CJQA 4LF7J 2YH0A 2DNQA 2HQIA 4M5HA 1TL4A 1RTJB 2AZ3A 2A1JB 1UQVA 1DLOB 3MCSA 3MOZA 4E7LA 3D9BA 3V6DA 1NK5A 4DZDA 2NRVA 3VEVA 4YCXA 2K1RB 2ZTEA 4YB5A 4LF4F 1HWUA 2HHUA 4FLTA 1FDBA 9ICSA 4OJLA 2BCQA 1GX5A 4BC5A 1T94A 2V4QA 2YWFA 4YY3K 1FRMA 3WQUA 2GWKA 4Y2JA 2DRAA 4O5FA 1M0SA 3MGJA 4O0JA 3M6ZA 3J7Z5 5FRMA 4KLDA 4KGXB 1U04A 3ULHA 1SI9A 1UWBB 3MX5A 3LP0B 5KFXA 3TUIC 1HPMA 3QIDA 4BY9C 3MEGA 2O8BA 1ZQSA 3ZDDA 2IVPA 5C5JA 3P8BB 4GVBA 2K60A 3VETA 1KR4A 3F2DA 3L09A 4F0MA 4F71A 1OIAA 4TLRA 3MM5A 4Z0UA 3A8KA 3NUQA 4ZVTB 2V7ZA 3JAMY 2P5GA 2EZYA 3C3LA 1NH8A 3V9ZA 1FJGJ 4FLXA 3D3CJ 3VGKA 3SNNA 3VR1A 5DQHA 2MKYA 3L4BC 3CJAA 4K4XA 3G25A 1FNOA 2KI2A 4DR1K 1HWJA 2YNIB 2QWMA 2YQ1A 4I68A 1JMSA 3PIOL 2QEXS 3C8YA 4CNYA 4IFYA 3CB4A 3DLGB 4MK9A 4LFCJ 5J2DA 1X60A 1SQKA 4IQXA 5AQPA 4F02A 3K59A 1CJUB 2DNMA 2ZJPQ 5A2QY 1ULRA 2KQ2A 3L7UA 1MQ2A 4J9NA 5HJYA 3L9ZA 4FVMA 4YB6A 3ULEB 5EXWA 4AHTA 5J0UA 2OA8A 5KT3A 3UKUB 4M94A 4JNEA 4GV3A 1FRKA 1P1LA 4RW7B 1HNIA 2R9LA 3GL1A 3WXIA 2B6GA 3UN5A 2MXYA 2XSFA 4BWJA 4MFBB 4RBVA 5JMVA 2WF5A 2UVWA 3VQAA 1D09B 2FXUA 2KSOB 1Q9XA 3UM9A 1ASVA 2E6MA 3NEKA 2W8LA 4CFCA 3QT5A 1EB0A 2RU3A 2ZZTA 4UB2A 2PD1A 3M8ZA 4C8YA 4RQ7A 1XIQA 1BDGA 2HMIA 2ZH8A 2VBXA 2YB4A 4XA5A 4F72A 3PEJA 1V9OA 3KLVA 3SMSA 3E8OA 5DETA 4FM1A 2DNNA 4NL9A 2GW8A 1HW8A 2YKOA 1ZQIA 1YQHA 9ICLA 3ENQA 4RNHA 3SCXA 5KAIU 4DPWA 2OMOA 2OO4A 2NXCA 1VC0A 4NYFA 4CZIA 4DEZA 2Z0GA 4CFAA 4CF1A 3BQ2A 4NV0A 3DLHA 5AFUA 3EVMA 2GC8A 2J8SA 1RBSA 3EKSA 2XIDA 5GAEP 1W7WA 1TAQA 4KAIA 4A59A 2JZ5A 3J7ZO 1TMMA 4DOBA 5AQYA 4CZMA 4ZVGA 1WG1A 4JI4F 3I56S 1Q8IA 1OW5A 4DU4A 1IXKA 4IR1A 4NLNA 4NXNK 5HATA 2ZH9A 3H3OB 4J9OA 2W9CA 2IAJA 4AHSA 4KKOA 4N8OA 1UTAA 1IQTA 3E51A 4QWAA 2YNFB 2GMJA 2FLPA 4DS5A 2R8KA 3HHEA 1LWEB 4B1YB 1RAAB 1U6FA 1Y10A 3GYGA 1ZQZA 2OI2A 2DKXA 3Q7BA 3FBEA 5B0GA 3I8BA 1VQ4S 2VU5A 4C8NA 3FLCO 4C7YA 4WFZA 5HQMA 2XNRA 4LRBA 2YKAA 4J90A 8ICSA 4X62F 3F73A 3IG5A 3DOLB 3IGVA 4N5SA 1W26A 1OWXA 2FC8A 2P9EA 4ZP8A 3TADA 3B82A 1Q81T 4X65J 3TAMB 4PGYA 2CDQA 1RT5A 3QU9A 2WTFA 1HHSA 1S76D 3JSMB 1Y97A 3RH4A 1OQ3A 5LL6Z 4EUVA 1ZQBA 2DGVA 4TY8B 4NO7A 2QWNA 1FD2A 4IG3A 4I2BA 2YH1A 1KLMB 1JJ4A 3OYEA 2B0GA 1HR0K 2ZIVB 3JPQA 4I2PB 3WK4A 3PNIA 2GNKA 2QB0A 5ALIA 1RXOB 5J2IA 1LAVA 2G8IA 3A3OB 1SS6A 1VQLS 1L7PA 1B70B 2DQNB 3BF4A 5CB1A 1CPZA 4BRPA 4YHHF 2V2QA 3IGNA 2VG7A 1YT3A 1NOZA 3NCRA 1PUZA 4GO5X 4BRKA 3OL6A 1ED1A 5LJ3Y 2YWEA 3C7NA 4OX9K 4A4JA 3SQGA 4B3SJ 2DHXA 4Z7YA 3THVA 3CC4S 1VQMS 4ED7A 1AXQA 4PH5A 5KFQA 4BC7A 2CA9A 1SL1A 5HMXA 5KPTA 3T5LA 5IM0B 2Z30B 5I3QA 2Q3PA 7ICQA 2XZTB 2GMLA 3T19A 1Z2LA 1VK8A 1JLBB 2K4HA 3MAQA 3HKZD 2KMDA 2DR6A 1KVAA 4B6JA 3VQBA 2CQ3A 3BGLA 4FYDA 1Z00B 4M5IA 3PRDA 3RFAA 1FK9A 2PC6A 2MUTB 3KLFA 2ACYA 3I28A 4HTJA 1WEXA 3QFWA 4Z7CA 4OZJA 3CQXA 1FI4A 1VS3A 2EWHA 3WEEA 4YEAA 1WB9A 4PKDB 3AQFA 3JXOA 1KFDA 2KN4A 5KFVA 3D45A 4R0JA 2A1AA 2A10A 2A41A 1J5EK 3I0SB 1K1QA 3KLHA 1I94J 5K14A 3CCUN 1BGXT 3V6JA 3TJ8A 3LPEA 3TA0A 2NS1B 5FPMA 3M1VA 2WFBA 1GLDG 5AZIA 3RWUA 1WC5A 4RNNA 1U26A 3AY0A 2AEMA 1RACB 5KL8B 3P96A 1ZXOA 3D6JA 1XK8A 2OPRB 1QHAA 3GIRA 4ZJLA 2UXDJ 2JC1A 5LMUF 5AKJA 1IKVA 4WQ4C 2OPPA 4PPZA 4IFVA 2LQJA 4NL5A 3UR3C 4HCCA 4O0IA 4ZCLA 2F96A 5TKWA 4MFFA 2BRKA 2E1RA 3DDHA 1RDUA 4OZNA 4BR2A 3CJRA 3ZSQA 3V7KA 1FRJA 5I3UA 2GBZA 2P9LA 3DLLL 3OS1A 1ZM3A 4KI4A 1QQ7A 2MSSA 3R5DA 5JLHA 3RAXA 3H42A 3CJKA 4CCHA 3DXMB 3RBXA 3GP9A 4QR0A 2HOEA 2MKJA 4CLPA 3CJ5A 2CGJA 2CQ0A 3N4MB 2UP1A 2Q31A 5FIIA 3VAHA 2ZVSA 1RYUA 4B3MJ 5HLFB 3ZZZA 5DDMA 1SWWA 3AODA 2KB2A 2RRDA 3CJQA 5CHCB 3IS9A 3QDKA 1QVGM 4KGMA 2CQIA 2YMMA 2XS7A 1VMBA 2E29A 3KLIA 4W5NA 2HQ3A 1YHQN 3NVWA 2HBKA 1AUDA 5E33A 4FF1A 3HBTA 5J2QB 2P9UA 1KQFB 3OJUA 2DNHA 1N36F 4UB1A 5CH7B 4RLEA 3QETA 3AVCA 2WB1C 3RGIA 4OIXA 2RU9A 2HGNA 1S0VA 4RU9A 3GG0A 3W2WB 4CDGA 5BR8F 3Q23A 1UCNA 1H0HB 3GV5B 3CCJS 1NO8A 1RJJA 3CCLN 2OGUA 3HJVA 3JXUA 1DQ8A 3PYEA 1OMSA 4ZIVA 1K8KA 4FXDA 5TISU 3J80Y 4ECQA 3AD8C 2KE7A 5CCLA 2PFFB 2KKZA 2DH9A 4B1UB 1RT7A 2F9WA 4HTLA 4QZDA 2EAOA 4CHNA 5AQQA 3QRPA 4AYBD 2J9DA 2WZ1A 5KRSA 1QAIA 1HA1A 1U1OA 3CD0A 3SQ2A 3VGMA 4ICLB 2HF4A 5CCMA 1XTZA 4DUZF 1NM1A 4RQ2A 2HS4A 2YHYA 1UPMB 4ECSA 4DI6A 5F8NA 1IKYA 1LWCA 4NJ8A 3CSKA 2YX1A 4NWIA 4DR6J 4QZIA 3HULA 3R97A 1AFIA 4UARA 3Q83A 4FM2A 2H3VA 1COOA 2FHMA 7ICLA 1A0PA 2ZD1A 1VBZA 2UVRA 2HHHF 4RW6B 3K1ZA 3L3VA 2UUCF 2LECA 4KLOA 1F0XA 1RBRA 2AXTU 5E3QA 1NK8A 1P9YA 3NFAA 1C1CA 2IBOA 4DQSA 3GIIA 1N5XA 3SSSA 4A2AA 7ICPA 3M6KA 3KUEA 4CJQA 2DFEA 2L3MA 2NPFA 2G06A 2G1DA 2GVZA 3AHPA 4F4ZA 2DGOA 4ZPWR 3MUMP 1OSCA 5G5HA 2GH1A 4IKFA 8ICCA 1CULB 2XG8A 2HBMA 1BPZA 3VHQA 2ZUGA 3NS7B 2ZJPL 2DF4B 3NWGA 4NEZA 1SV4A 4H0TB 5F3XB 5DBAA 3CFPA 1Q1KA 3OBIA 3HZEA 3QNOA 2FJWA 5AI4A 4DS4A 2RQCA 4F92B 2PYLA 2I6XA 4B3SK 5F1XA 3NNHA 3PJ9A 4ZOHC 2W3SA 3B6OA 4DKWA 2ZBQA 2DGZA 4CZCA 2QEXN 2HDOA 1VIXA 2F4VJ 2FJ6A 1HEKA 3RMAA 1IJEB 5E84A 1S1TB 2AJ0A 4DV7J 1K9MT 4Y2TA 4F36A 4CF2A 3C28A 1FXXA 3MN5A 5ETTA 2QKQA 4FWOA 1S1WB 2FPLA 4QIWC 4OI4A 3VAIA 3PVXA 4HWIA 2Z2LA 5CWRA 4BDZA 4JI1J 1VK0A 1H3DA 3D6RA 3CJ4A 5G0RB 1KDHA 4CBXA 2VFRA 5J2AA 4UQTA 4OLPA 3MTKA 4A62A 2BW7A 4ILLA 4LFAK 2DY4A 1JNZB 1MMNA 3GU0A 3HF5A 2P9KB 3LP1A 4FOEA 2H3FA 3PV8A 3MR2A 2DJWA 1KOHA 2ATQA 4FJLA 3SPYA 3WK6A 2DTJA 3W2VA 4BUGA 2KHQA 4NZ0A 4Y2KA 4J5OA 3ZZPA 1HQUA 4DL3A 1O03A 5LJ5Y 3QO9A 2CNKB 1ZQEA 1MMLA 1N34J 1T95A 1X7VA 4P75A 4JI0F 1Z2ZA 4I2CA 4F50A 1NM2A 2F9TA 3TZWA 2D9OA 1Q79A 3SUNA 2ZIUA 4RQ3A 4BR7A 3MEDB 2IY5B 3SAHA 4CJTA 1S0NA 1E6VA 2RPIA 3O1BA 3ZNUA 2AHOB 4U9RA 4CIEA 5ETPA 3M8RA 4BC4A 3EVWA 2C2MB 3J7YP 9ICWA 2O8EA 1KFSA 3P3DA 4CH0S 5JMNA 1CZ9A 4ZVQB 3B6PA 1ZQTA 4K41A 2MZSA 4ZTJA 2D0PA 3I56N 3O3FA 1F5SA 4A2BA 4TNOA 4BR0A 3A5MC 1WG8A 2MKSA 4DUYJ 2MY7A 1IR2A 4CHZA 1ZRMA 4H4OA 2FHKA 4AFFA 1GLCG 2WK4A 1MWKA 4DV3K 1YWXA 3J81O 3BSOA 4K4HA 2PEBA 5CAAA 4X66K 4DJBA 4BRIA 1EKEA 1HNXF 2NRTA 3CDWA 3EICA 1BISA 1JUDA 5HANA 4C0OC 1TL1B 1VQ4N 5CXTA 3TOQA 3CFOA 3ID6A 5M1PA 3ZSWA 5HROA 4BVPA 1KS2A 1Q53A 4OYXA 3B0XA 1RT1B 1M90O 1ZPVA 3NF9A 4IBNA 1T3VA 4WK1A 1TKTB 5ALLA 2NR0A 4F0HA 5E3AA 1ZBUA 2PY5A 3CJTA 1X5OA 2RS2A 4CJUA 1KXPA 2B9XA 5THWA 3CJ7A 2OPQA 3TACB 2CQBA 2MQPA 1DGKN 3Q8MA 3WC0A 3HSJA 5M2RA 1IG9A 3EUB2 2POKA 2UUAJ 4QYZK 2D1KA 2V2KA 2G07A 3FYHA 4USMA 2FI1A 3I55S 3L4IA 4FBTA 2IFXA 4KPYA 4EIAA 5ETKA 4YOTA 1MU2B 4YMOA 4EP4A 1VQLN 4ZK7M 2NYVA 3H5UA 2BQRA 2CXEA 1NGGA 1TFWA 4JP8A 4ILRA 4PAAA 3OYJA 9ICGA 2QKKA 1ZQXA 5IXUA 2J76E 1RU2A 3DYAB 1HQEB 4O3PA 1S9EA 4G1QA 2NZ4A 5ADXA 3WNGA 3DLEB 2HNYA 1VQMN 4L6V3 2ZWOA 1EQMA 2E44A 2G2YA 3A5LC 4DWIA 1BPBA 3NY0A 1UMJA 5J0XA 4PR6A 1J5OA 4CE6A 4YOXA 1X6JA 1TUYA 3NVZA 4M5DA 3A3NB 3EVOA 3AOBA 3VVUA 4X4VA 1ZQMA 4CO0A 1UVJA 1QAJA 2HMXA 4OZ5A 3K2PA 3T1HK 3G82B 2LQ9A 4PG6A 1IM4A 2W7AA 5E7OB 1RDRA 4DTXA 4M0AA 3ULDA 4HDHA 2D69A 4ZVOB 4PUOA 4Z6CA 3H8MA 3H8WA 1KOOA 4JHDA 1U8SA 2K8GA 4HI1A 1R7IA 4WFBL 3ZETA 3FFKB 1BD6A 2EFQA 4E7IA 5ITHA 4US9A 1W25A 3C23A 2WSCC 3KK1B 3ETRA 1VSJA 1HBMB 4YR0A 1VQ6S 4F7VA 5KG5A 5C12A 5AR0A 4I0WA 4JEPA 1Q7LB 3T9ZA 4K4YA 1KNZA 4JI6K 3D67A 1YBUA 4OPKA 5C2CA 2QLFB 2Y3YA 4JI3F 3GV8B 1TU0B 1LW0B 1RNHA 3MGIA 3ETMA 4DG1A 3BY5A 3IRXA 3MM9A 1RILA 1RPLA 1FJCA 4AHRA 2Q4TA 2BPCA 3M2VB 3OL9A 3C2KA 4DFKA 1SIZA 5CYQA 3LM9A 2OJ3A 4ID5B 2NRWA 5SWMA 2DBYA 5DLFA 4JS4A 3PO4A 3T5KA 2OP5A 2I6WA 3JTOA 4NLYA 1XNRF 4UQGA 4XRHA 1S6QA 3M2RA 1RAIB 2G8KA 1OXJA 4C98A 4XH1A 3AEVA 3CJ1A 5T7BA 5M1QA 3LPYA 5EHHA 1ZTTA 2HNZB 4O3NA 1N32F 2GV9A 5EUHA 5ALMA 3OL8A 4A8YA 4KHQA 3AXKA 3D6TB 1DAXA 4X4NA 4FP9A 2VA2A 4I7FB 2E1YA 3OFFA 3H08A 3KJVA 3IBCB 9RUBA 3OXLA 3R1XA 3N01A 2GAGC 2DHGA 3M8WA 2ASOA 2E8OA 1HBNA 1WF2A 5IT9U 5B66U 4LF4J 5CA7A 1T9VA 2B5JB 2C42A 2KVIA 4WP8A 3E01A 5AJ3F 4DTPA 3LGNA 3CF5Q 2C1EB 3FK4A 4QWDA 4B9TA 2CJ9A 3DU6A 3CCJN 1L3KA 3IWXA 3ZZRA 4PQAA 3KMSA 2LBOA 2NUHA 1YBTA 6FD1A 1KC8O 2G2OA 5KG3A 5DM7Q 5HMZA 3ZYYX 2W1BA 3EKUA 2G5IB 4B9LA 3ZT2A 4FJGA 2WB1D 3TI0A 2O67A 9ICVA 2VWJA 3V4MA 2K8BB 3HLUA 8ICHA 1Z1ZA 1NEEA 4CGDA 2AYGA 2HQGA 4NWBA 1A5VA 1O08A 4ZVEA 1D8ZA 4GC6A 3C2LA 3NS6A 3OTQA 1QM9A 3P1GA 2B6AA 2EC0A 3MEKA 1ZA2B 1GMWD 4BRFA 2YKNB 3SAFA 4DO9A 3I9ZA 1WWVA 1U45A 2YHAA 4K59A 3OYAA 4B8CA 3FE1A 4K4TA 1X5PA 1T9TA 2NV3A 4CO3A 2Y1JA 2XMWA 2GIRA 4Q5VA 1Q82T 1TGOA 2QMXA 3UD3P 2XSJA 4M3UA 4RW9B 4DBQA 1KEKA 1RT6B 3M6XA 1XR6A 1JN3A 4ZMMA 1WBBA 2ISPA 2C3OA 3VEXA 4O5EA 4J2DA 4WQ5C 4KRWA 3O44A 2E1MC 3ONQA 3QUTA 1SH3A 2EC2A 2QN6B 3HT0A 3K9KA 4WTYA 4CJEA 4DL4A 1VLYA 2UVVA 3GWCA 1W9HA 2K7JA 1MSWD 3IRUA 1RAHB 2K06A 3AA8A 2Q0UA 1YSJA 3W5XA 2BJ1A 3OT9A 5HBMA 5KFSA 4B3RK 3KKRA 2YMPA 1VLBA 2OANA 5F3TA 2KKVA 2RHFA 4J9PA 5KAKA 3DOKB 3WIUA 1U49A 3QAUA 2E9RX 3NMAA 3VQDA 2QWPA 2LP4A 4OYMA 3HMJG 5L9NA 3QU5A 5ALFA 4FLUA 4TQRA 3QU7A 3MWPA 5BPNA 1HNWF 1DFDA 4UB6U 1XC9A 4XUSA 9ATCB 4U95A 5RUBA 1TUUA 2PFOA 2XY8A 1S79A 1T9XA 3PX0A 4EYIB 3R5JB 3UE2A 3AO4A 5EWEA 3JPSA 4I2FA 3RJJA 2I8EA 4CK3A 4O44B 2CKWA 2RLTA 1NGJA 1BPEA 3CETA 1NGCA 3NGYA 2HK2A 4A8EA 2ILZA 1RKJA 4MFAA 4TXSA 2YTCA 4JI4J 4QIWD 2P51A 3ZT3A 2KDOA 4MIWA 5C24A 1S1UB 3HL8A 4BR5A 1SC6A 2F1HA 5GIOA 1JB0C 1KVJA 1U25A 2GQQA 2FC9A 1M6YA 2VG6B 1PC4A 1J6ZA 1U0HA 2D41A 3GCXP 3HFZB 2O8FA 2LFVA 2RT3A 3NVMA 4TYBA 4QJVA 1RDCA 4IEIA 5H9FK 1YKWA 4L73A 2JWLA 4ZPAA 4NCAA 4F04B 1HBOA 2HBYB 2IDEA 1NJXA 4OLOA 3VWSA 1S1VA 4AXJA 2OLWA 4PJ0U 2H5XA 3GU3A 4FPBA 4RBTA 4RUAA 3HVRA 1KD1O 2RUSA 1IBLF 4KX5A 2WOMA 4CFBA 3PR4A 1WELA 2U2FA 3HD2A 1Q0NA 2FJAB 4O3RA 5B0AA 4FZYA 3RMBA 1NGFA 1ZBLA 3H7IA 5AE1A 2G5HB 3O5BA 3ZSOA 4E1NA 7ICSA 1W2BM 5EWFA 3OR2A 4B1ZA 2KL8A 3K5PA 2V51B 3H0PA 1JLCB 7FD1A 2WMMA 4N47A 1HHTP 2QTDA 1FRLA 4Q0BB 1KQGB 4JWMA 2A42A 4H5VA 3GILA 3PKMA 2OYQA 7ICJA 1QQNA 1BI4A 3OTBA 3WT0A 1IVZA 3ETLA 3EYZA 2NO4A 2BXJA 1G2EA 1W2BR 5C2GA 2Y1IA 4RTFD 3AGRA 1V3ZA 4O23A 3BUZB 4CGFA 4YOEA 1P1TA 3K75D 2EHGA 1Q7YO 2H3GX 3TTDA 3M32A 1V4SA 3VF0B 4DN0A 3DU5A 2F8LA 1HNVA 1XN9A 3OYHA 4IO9Q 3VA0A 5EE9A 1BPDA 1WAJA 3G86A 4DU1A 5AI8A 5F3ZA 1X3MA 4X4SA 3D5MA 1CG2A 1XNQF 5KG0A 4DB3A 1FA0A 2E8PA 4M6WA 2CQHA 1X40A 4FKXA 3I55N 1TYQB 3LP2A 2HFSA 4KV8B 3W3SA 2PA3A 2DK2A 2BACA 4ZCKA 4BX9C 3JQJA 3N9UC 3EGWB 1R8PA 1PVPA 5BJRA 3D6HB 3AA5X 4AHVA 2GIQA 2PKEA 3HKZF 5HMLA 8ICJA 1XQSC 3CJBA 2EI5A 2ZH7A 3RW6A 5J0YA 1TKXB 2OZMA 1SZHA 1T0TV 2MDAA 2EEYA 4A8MP 2FBTA 4CNZA 3E9LA 3RG6A 3D0PA 4QZCA 3TZYA 5LMUJ 4KY3A 2DNLA 5FJ4A 4CGZA 1OY6A 3PRVA 4F5PA 2IJFA 2NSCA 4ES2A 1YJTA 1QQCA 2A0FB 4F3QA 4RZRA 3SCIE 2G9OA 3Q7CA 2BGGA 4PXEA 4KH4A 3FZLA 5K8MA 3BZKA 8RUCA 2KHDA 2PMHA 4DR7F 3AMZA 2D74B 3MEEA 3OTOK 4RBUA 2DBBA 2VQFK 4CJVA 3C2MA 4ER8A 3HI9A 1J53A 3TKAA 1IWAA 3M05A 3SZ2A 3CQ8A 2FE9A 3SV4A 2HHQA 4I56A 3CCMS 3QXGA 2P6RA 4JI5F 4ZLNA 3TAQA 2M7SA 3IFEA 3TYTA 4O5CA 4IUFA 1VQ6N 3OR1A 5K8NA 4XH5A 3OPXA 2YKPA 3EPGA 3PX6A 3H2VE 1H98A 1RT3B 1JXLA 2A6AA 3LDQA 4ECZA 3BN7A 4LF8F 4DL6A 4RU2A 4KLEA 2JFDA 4JRQA 4JAXA 3VN5A 4ZS6A 1Q95G 2VIXA 3A1YG 2W3RA 1N36J 1QTNB 1RHMB 3Q8PB 2EX3A 3TJAA 1GTHA 1LW2A 3DM2B 3G8SA 3KK7A 1T3NA 4O4GB 3TVZA 2OM6A 4DLEA 1N0UA 1LXJA 3M7DA 3DLKA 2XCAA 2Y9HA 5ALSA 1ZQFA 3VQTA 4KHPK 3PDNA 4K4VA 5BR8J 3J8AA 1BPXA 5ETMA 1UCVA 1K8AT 5ALEA 5ELZA 4WF9Q 3P5TL 4BVOA 2N4DA 4KO0B 4DR5K 1UOCA 1URJA 2AF6A 3I32A 2UU9F 1ZQHA 2P9GA 3M8PB 4LF9F 3NH1A 3CF5L 3KD3A 4M3RA 2YI1A 4L3NA 3AV9A 2KVCA 1Z3EB 4UOFA 1NGEA 3PW0A 3W60A 4N41A 4D3GA 1XHXA 4WFXA 2HW3A 2DEIA 3AD9C 2NCKL 1BOTO 2Z56B 4Z94A 5DM7L 1OO0B 1B22A 4O3OA 2MGZA 4WQ4A 2L9WA 1E4GT 4USWA 4B9NA 1DK2A 2JLEA 4PG8A 3SENA 3QUBA 3HJEA 2QYGA 3AT1B 3DGPB 4KH0B 1XMOK 4CJ3A 3ZEUA 2DXFA 4LSNA 4MJKA 2HHHJ 4ED4A 3B78A 3AGKA 4JI8K 3I87A 2UUCJ 4YY3F 1JLQB 4BREA 4DV0K 2QFJA 3HRDD 4AYBF 4FJIA 1HLUA 5I4MA 3D68A 4XPCA 3RMDA 9ICRA 1HWIA 4CM2A 3KYLA 1N6QB 4RQMA 1OUQA 1U2VB 3PIPQ 4O8UA 2M3DA 3IAYA 1WC6A 4U7CA 4WIIA 2FJXA 1CJKA 4QCLA 2CPFA 4RQ0A 3QGIA 1WSGA 4FYVB 2VH7A 1DTQA 1HWKA 3G8TA 1VSMA 4AL5A 1EIYB 2AJQA 2P9PB 2ACMA 3MMJA 2UZAA 3MM8B 4DL0C 2P9NB 3AVKA 4Y1CA 1ROFA 4M95A 4ILMA 2QL9B 4DR1F 1NNDA 1AA1B 5J2NB 3THXA 2Z1HA 3D0HE 1A9NB 1TUGB 1DJ0A 1ZC6A 5KFOA 2F3NA 3L7PA 1NJIO 4Y2QA 2E5IA 3UFCX 3AD7C 2FJEB 1NHVA 1WOSA 1SJRA 1FT8A 3DJCA 4YB1P 3VZIA 3O3LA 4KLJA 7ICVA 3I96A 4F9OA 4IDKB 3RTVA 2MLZA 3P49B 1GMWA 5AKLA 1BL3A 1VBYA 1W0HA 4AT1B 3M1YA 1ATNA 4KRFA 2AW0A 1YK9A 2WUSA 5IIIA 1RAGB 3VQ7A 2YQ0A 7ICMA 1SL0A 4M3XA 1AUSL 2VGMA 5EX3A 1WNEA 3L2RA 3QEAZ 4N8NA 2E8AA 4YD1A 1R0AB 4IG0A 2VD3A 3R1HA 4JD2A 2OFGX 2ZIWA 2LM4A 1WSJA 3KG0A 1RHQB 2P6UA 4FKYA 1WSIA 1KN5A 2R8GA 5AE3A 3AL0B 3MMBA 1N48A 4H0XB 3CMQA 3AJ1A 4IS7A 3MR3A 2CJBA 3M8QA 3UI3A 2R4FA 3MEGB 4RQ1A 3DRSA 4Q44A 3EE9A 1GMUA 3DI6B 4C9DA 4NRUA 3PJWA 4UY8T 2DEJA 2DKZA 2W25A 2F5GA 4I2AA 2QMWA 2RNEA 3F44A 4JI0J 2Y1RI 1MNEA 2DTUA 3MM5B 3EZOA 2RF2A 3NTUA 4Z4CA 4JKHA 1DT9A 2BE2B 3RJFA 2DPJA 1YDLA 3Q8RB 3C46A 4KX3A 3DRPB 1QHTA 1Q3UA 5ETLA 4RUHA 3QWPA 4IFYB 4DR3K 2ETJA 5SZTA 1OPIA 4KITB 4ZLPA 3C6HA 3LWLA 2HBQB 5AQIA 2FMSA 2J9EA 1RA6A 3GLJA 2M70A 4NXNF 2B4JA 2RB7A 2RVJA 5L1MA 1CQNA 3M6WA 3D66A 2HLTA 4RKUC 4YS2A 1VR6A 3IN5A 2V8HA 5EOYA 3VOVA 3DRXA 4ZN3A 3CDUA 2KICA 4C7QA 2VODA 3ED5A 1C1BA 1YJ9S 5DDPC 3TUPA 1HNIB 2B9EA 4CD3A 2FSJA 3SMVA 3KDOA 2D0AA 1HNXJ 1VBXA 2HWIA 3AQEA 9ICEA 1U02A 2UUBJ 2JRZA 5KFUA 1KP6A 2JSXA 2DCUB 2IVOA 1KTVA 4JKGA 4OHVA 3OYKA 4JI2K 2IHMA 4USAA 3CULA 5AFUH 2MQOA 3W62A 2B7CB 2HMIB 1NGIA 3OVNA 3VAFA 3DRYA 1R31A 3SQIA 4IOAQ 1IXRA 3KKSA 2YV0X 1CRXA 4OD0A 5B5EU 2BANA 1PC5A 3MMAA 4ZVFA 2VFUA 4RX6A 3P6YC 2O1PA 4ED0A 2ATCB 1HR0F 2DXDA 2GFFA 1TL7A 5HMWA 1JJ2M 3NGDA 4WFNQ 1LCUA 2ZHOA 4RJVA 2E5GA 2B21A 3TUZC 4LF1A 3WK9A 4CERA 2KU7A 4WP9A 2FTRA 1IM6A 4LUBA 2DFHA 2HKEA 1ZRNA 1G6BA 5KPZA 2HLUA 3D3BJ 3KK3A 3G6EN 1X0PA 3NF7A 3VQ6A 1JJ2R 4OX9F 1RAFB 4RPZA 3K8VA 1T02A 1PILA 2RQMA 4YNQA 2P5VA 3AA2A 4QU6A 3BZCA 2HOFA 2IOFK 5AK6A 2KTQA 4V1Ak 3UNYA 1L7MA 1BQNA 2KJ8A 3NVKA 3CNHA 2IAJB 2A3ZA 4ZITA 4Y2MA 1OPZA 2XI2A 4RO0A 4NLZA 2NXUA 4KKOB 2PFNA 5KFBA 4BG9A 4P2FA 4F3MA 1SB6A 1L8OA 3MN9A 4O5BA 4ZOSA 4I2DA 4FWSA 5KFGA 4MIAA 1FWKA 2M9KA 2WVFA 1AZSA 1GT8A 5E0OA 4ANEA 2P9CA 2QL7B 1C4AA 1FJGF 4LSLB 3S7RA 3FZKA 1WC0A 3MFHA 4KLGA 3V1QA 3NOGA 4C0ZA 3H8JA 3UR0A 3VGSA 3BR8A 2QA4S 5C2FA 5F8MA 4LBIA 4AL6A 3FBCA 2W9BA 2CQ2A 1JLAA 4NLKA 4B1VA 4JV1A 3OVAA 1SIWB 3RRHA 4OZ1A 3PTWA 2BZFA 1FFVA 4A8KA 2G1HA 1P90A 1J5EF 8ICTA 5BRDA 1UVMA 1RT5B 1G99A 2YB1A 4ZH4A 2PXIA 2DUYA 3OFEA 4C11A 4XIUA 3IKMA 3VGLA 5IT9Y 4BRGA 4JI3J 1WWUA 2H51B 2Y9UA 2KW4A 3OJSA 1O8BA 1KDNA 5HK4A 3EY1A 1S9GB 3CG7A 2C22A 3MMCB 3GFHA 2QB0B 3CYMA 1FNXH 2BKEA 2GELA 2BVZA 2W2OP 4NA1A 5DGAA 4CHQA 3FSIA 2YNGA 2VG7B 4ISFA 3TAGA 1QAYA 3OYLA 5L1JA 2B8PA 4CLZA 1WC4A 3I82A 1Y11A 1XNRJ 4TYAA 3VF6A 8ICLA 2VPXB 1CJTA 4DR2K 8ICIA 3SQGB 4FL9A 4YFUA 3MM6B 2E5LK 3MZIA 3BV8A 4USTA 2QLXA 4UB5A 2PIIA 1RXVA 3SXLA 4YDUC 3CCMN 1NLKL 2WFAA 1R0BG 4KLFA 1F2HA 3SMPA 3MABA 2O8DA 4WF9L 4PG7A 3H1VX 1TL3B 4ZN1A 2QGFB 2MA1A 2XMJA 3QATA 3VQ8A 2R8JA 2BOPA 1FK9B 2QWRA 9ICMA 3LGHA 1TTHB 1VDHA 3QINA 3KLFB 2UXCK 2CPXA 4PKGA 3RSEA 1I6JA 5AXMA 2YNHA 1N33K 3PM9A 5AJ3J 2VV5A 4LJXA 4RNOA 1SQGA 3LDNA 5CD4A 3H20A 2OPSA 3KVGA 4P6QA 4J8FA 3HVAA 4OV1A 5AKZA 4M41A 4ECTA 3KLHB 5C42A 5K14B 2O3DA 4C3LA 2UV8A 5F0UA 3O3HA 3RR8A 1NK9A 1EWQA 3M1VB 1RTDA 5AZIB 5B0DA 2CIMA 2HYIB 2PBDA 1FFGB 8ICRA 3O9SA 4P71A 4XPEA 1NG9A 4RWWA 1RM6C 3VZHA 3FEYB 2QB1A 2A5XA 3W3DA 3G6XA 1ZQJA 4DL5A 3U6FA 3CVKA 2RN2A 4DV4K 1D9AA 5KOXA 2OPPB 4PKIA 5EGYA 1IKXA 4IFVB 1C0MA 3NMUA 3VEWA 4IJAA 3IDHA 2G8FA 2ZITA 2UUBK 3L7OA 1QD1A 1S49A 3PIPL 3MX2A 2L9DA 3LA0A 3EWAA 2P9LB 2B56A 4P9SA 4LVSA 4K4ZA 1H1VA 4MK7A 1VK3A 3ZZOA 3N97B 3SBGA 3CJKB 1N0VC 2B0CA 1URRA 5KG6A 4OX6A 3UMCA 3P5BP 2R7OA 1NZPA 1WI6A 4W5TA 2YQ3A 2QMUB 5I42A 2Q79A 2WB1F 3WNEA 1T11A 3H98A 5BYSA 3A0HU 1U09A 1I5OB 2I1RA 3CRXA 2ZUBA 3SSQA 3SEIA 3THWA 4OHWA 3IS9B 5KT6A 3ISZA 4M5GA 3EEQA 2R7QA 2K4IA 3PYDA 3CWJA 3OBYA 4P73A 3TABA 2AX1A 2P9UB 4TU7A 1TFYA 5D3GB 1RI7A 1X4DA 1U1PA 2QLWA 3E0FA 2DPNA 2R18A 5HVGA 5FDLA 4XDCA 2DKOB 4UB8U 5AQJA 3QGGA 3TP2A 4Z4IA 2RSQA 4HKQA 4JKCA 2WVBA 4O4RA 1KONA 3N7RC 4B3SF 7AT1B 2R7TA 1R8AA 2J0XA 1QE1B 4FJNA 3KFWX 5B7WA 3CJ2A 3UDLA 2FZGB 2R2SA 3V9WA 3H5XA 1NSQA 4I6AA 2R42A 3HZGA 4RPXA 3S3OA 3QIPA 1BWVA 2AQ0A 3K89A 3AU2A 4CHOA 2P8IA 1RT7B 3AVNA 4DU7A 1UEKA 1H38A 3FM9A 4C1NI 2A3VA 3NAIA 4OYPA 3A8EA 4KB0A 1ZAWA 2CVEA 3JTPA 1X0FA 1PJ6A 4CWBA 3BDEA 5L46A 1NSKL 1DGSA 1KQKA 3ZDCA 2C2RA 1V3RA 1S4FA 4F3OA 4KTZA 1T8EA 3L95X 2G0JA 2VA8A 3RVCA 2M0GB 4LFAF 4W90B 4KLUA 1MWQA 3BS7A 7ICUA 1Q78A 4H5NA 8ICVA 1EETB 3L8BA 2R7WA 3KHLA 4I2GA 3IC1A 4FLYA 3PW2A 8ICEA 3AVGA 1JJCB 3C0BA 1MDUB 5DG9A 2XC9A 3GFYA 1VJ5A 3DWLA 5ALKA 5AQWA 5AK4A 3QLHB 3Q86A 2YY6A 1VDVA 4L72B 1K44A 4IO1A 2BM1A 3C15B 2MZTA 1JCGA 1XHZA 2BM0A 4LREA 3R8EA 5TZVA 2RRNA 3VEZA 5AKYA 3AM9A 4UAWA 1S10A 3GTYX 2C2ZB 1VQKS 1T3OA 1WF1A 1WUAA 3BR9A 4PWDA 3S9HA 4DL7A 2PA8D 2BCRA 2NRHA 4YOYA 4AL7A 1NOMA 4QIWF 3MCPA 2WC9A 1UJ4A 1F3VA 3OD2A 2V68A 2BBEA 1WHVA 2NUUG 3BO2A 4QZHA 3BBCA 4M3WA 2WF8A 1XU4A 4M2YA 5E2QA 2O8CB 1R0CB 3PSIA 1NPKA 3VQ5A 1REVA 1M1KO 2MKCA 1A7GE 4H4KC 2AA4A 3MPDA 3QZ7A 2FB0A 3ZTOA 3JSRA 2A1JA 1DLOA 4KFBB 3BGRB 4DV3F 5B0BA 3VQPA 3I4PA 4IOAL 2K1RA 4X66F 1KVBA 3UNGC 1YJ9N 8ICWA 1PAEX 3GFZA 2NXNA 4HVJA 3O08A 3LP1B 4BC9A 1WG4A 5E3RA 3KXDA 4WFNL 3MHYA 5B0FA 2XULA 5EU7A 2KJ5A 2QLBB 3VESA 2FPKA 4K4UA 1UWBA 3KMQA 3LP0A 3NRWA 1RBTA 2WONA 1RCXB 2HNDB 3W2VB 4R64A 4ED2A 2ZOFA 4TU8A 3J81j 4KC5A 2ZJ8A 3NXZA 4KAZA 4QZEA 5J0RA 2AGOA 2HWHA 2F77X 1M5KC 2E5HA 5A8KB 4RNMA 4X5VA 2AH5A 2VWKA 2PI5A 4EX7A 2FMQA 1YAGA 1LOUA 1QQ6A 3ZO7A 2ZBIA 3VF4A 1Q7YT 4OKEA 3P39A 4QR2A 1HUOA 2WRMA 3DLRA 3SPZA 1XNQJ 2ZIUB 4X4OA 3R3LA 3MM7A 3DLGA 2EDUA 1IBCB 1E6VB 1FRXA 5HHIA 3W9JA 2E6LA 4LF2A 2XTJP 2V50A 2O4GA 3C1ZA 3SQOP 2VPZB 2O8EB 3MCNA 3HVTB 4O8KA 3PR5B 5HQLA 3WU2U 4CFDA 3OTEA 2VG5A 4HEA9 1U24A 1XC3A 2CPDA 4W92B 3VF2A 2IBKA 5G4DA 3LDPA 2E4LA 4CLYA 1UAXA 5J0PA 6FDRA 2HCFA 4RQ8A 4JLHA 4IQMA 3H0MB 2W55A 1FO4A 1D9DA 2AZ1A 4DSEA 2QYCA 1FVQA 1NZ8A 1RWMB 2HVEA 3PIOQ 4BE2A 3BSNA 4MFBA 3FFIB 3QYPA 2DR7A 3J80U 1SPBP 5D4NA 3NGSA 3US5A 2NLWA 1WCLA 2YKMB 2QX0A 4TKTA 4OI1A 3KHYA 3X1LB 2XLIA 1C0UB 5ETQA 5LSLA 2JMGA 1KHWA 3TR5A 1M5SA 2ZIXB 1CEZA 1TUWA 3T1HF 3AOAA 2K7KA 3QRRA 2JVRA 1WSEA 4DR7J 4TUPA 3NS5A 4USIA 5HROB 1X4BA 2A3JA 4R25A 1NMEB 4C0BA 3CD6S 2P35A 3LAMA 4RUCA 4DPTA 1NGAA 2I2YA 1P6TA 1CC7A 2LQ5A 4ES1A 3W65A 4JI5J 2GOLA 1ATRA 1V5IB 1WHWA 4JI6F 4DCOB 5ETRA 3CC2S