4DSFA

Ternary complex of bacillus dna polymerase i large fragment f710y, dna duplex, and rctp (paired with dg of template) in presence of mn2+
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
580
structure length
546
Chain Sequence
b'AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRNYGGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase
publication title Structural factors that determine selectivity of a high fidelity DNA polymerase for deoxy-, dideoxy-, and ribonucleotides.
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
total genus 188
structure length 546
sequence length 580
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4dsfA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4dsfA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dsfA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4dsfA01
4CJUA 4Z4HA 2P66A 1NK8A 4FJXA 2BCSA 3L8BA 2ALZA 1KVBA 1C0UA 4J9MA 4JK1A 2DFEA 1JLQA 1SKRA 1BQMA 4EEYA 4DU1A 1BI4B 1Z26A 4GVMA 3OYIA 1ZQSA 1JLEA 3C2LA 2KZZA 3ZD8A 4CEBA 3OS1A 2VWJA 4CEEA 4QZDA 2P5OA 2UVWA 1KFDA 4CJFA 1AROP 1VSDA 3V9WA 2IA6A 4EYHB 2HHQA 1T03A 3CM5A 1IKYA 1RXWA 1SKSA 1ZQBA 4HUGA 3QEPA 4UQGA 3QIOA 3WNGA 2V4QA 4I2JA 3C5FA 5KFZA 5HMMA 3OYHA 2R8JA 2XGQA 4ID1A 4DTXA 4UB3A 4BACA 5L1LA 9ICVA 3U3YA 4QZAA 1ASVA 1U9LA 1S9EA 5HP1A 1JL2A 5KFSA 1BPXA 1RBVA 4NYFA 4FLUA 1VSJA 3OYBA 4QZCA 2YKMA 1S6QA 4KLMA 5J2EA 1HQEA 5J29A 3ZSVA 3F9KA 1L5UA 3IRXA 3PW7A 4IRDA 1ZQKA 3C1ZA 2FMPA 5KFFA 2IAJA 1S76D 2VA2A 2JEIA 9ICNA 9ICBA 4B9SA 3I0RA 1ZBLA 4DTMA 2BCVA 5KFYA 4Z6EA 7ICRA 4CCHA 1B9FA 7ICGA 3SQ4A 2FLLA 3QIPA 3P1GA 4YN4A 3LPUA 3V4IA 4KREA 2D0AA 2MAXA 2XRIA 2HB5A 3NF8A 4J9KA 4M41A 3ISNC 1COOA 3CQ8A 3O4QA 3LK9A 3L2WA 1QSSA 5BPCA 2IC3A 3AO2A 3PW4A 3V72A 4IQWA 4M3YA 4QW8A 3HK2A 3HT3A 1RBUA 4KLHA 3PV8A 4BGDA 5HBMA 3IHQB 3M8PA 1CUKA 3AU2A 3IS9A 5IIJA 4EZ9A 4DF4A 3K5MA 4Q8FA 3OYAA 2BDPA 3OYJA 3AO5A 2FLPA 3KIOA 4B8CA 5SWMA 3PO5A 3DOKA 1RZTA 1VSHA 2IDOA 5J0YA 2G8VA 1VRUA 2XY5A 3GDXA 1LWCA 3ZT1A 1YTUA 1LAWA 1HNVA 4H8KA 3GV8B 3JPSA 4NXZA 1D8YA 2OPQA 3TAGA 1EXQA 1L3SA 4KLDA 1NK4A 5J2GA 4CESA 3DLRA 4E7IA 3PMLA 4F5PA 3DOLA 3KKSA 5J2FA 3NDKA 4CJEA 1TK5A 2BE2A 2IHNA 4Q8EA 8ICCA 3O3FA 3NE6A 3LAMA 3RJIA 1SUQA 4OVLA 4CHNA 1UOCA 3K75D 3DRRA 2OPPA 5DGBA 4ECSA 1S1WA 4QZ9A 1HJRA 3S9HA 5K14A 3LZIA 1D5AA 3NF9A 4O3RA 2IOCA 1UT5A 3HYFA 3AVAA 3LALA 4KPYA 3EW9A 1B22A 4DWIA 4KAZA 4C8LA 1ITGA 1A5WA 4FJKA 1J9AA 4CHZA 4GXKA 3KLGA 3TAPA 1EKEA 2MUTA 3MR6A 4PPXA 3E01A 3ULDA 1JKHA 5I3UA 4YR0A 2FMQA 2WOMA 4Z0UA 3PR5B 4M47A 3MEDA 3VQ6A 4DLEA 1SV5A 2FPKA 4ED8A 3MR2A 3AVKA 4FK4A 5C24A 3WNFA 1JIHA 8ICNA 4IFYA 5DDYA 1RT5A 3OYKA 1BHLA 1TAUA 2PYLA 2WTFA 4O5EA 1W0HA 3ZSZA 3C21A 1W9HA 5KFUA 8ICEA 1TK8A 1RDCA 3OYGA 3VN5A 4DU3A 2P5GA 4C8KA 3KHLA 7ICUA 4KKOA 5KT3A 4O55A 2AGPA 3TANA 2G8FA 4JWMA 1S97A 4M9JA 2HNYA 3SUPA 3GFKB 2KW4A 7ICKA 4DFKA 1ZQDA 4LD0A 1KSPA 4KLUA 2JEJA 1S5JA 3SYZA 4N56A 4ED3A 1G15A 3S3NA 1IKWA 5J0RA 3V7JA 4J2DA 3WNHA 8ICAA 3L2QA 5IIKA 4DL7A 4CJQA 4YQWA 3DLKA 3JPNA 1XSPA 1XO1A 3MAQA 4CEZA 2BHNA 3MXMA 1Z25A 2ZTCA 4N5SA 1VSMA 1U04A 2YNFA 4F5NA 9ICMA 3DRSA 1S9GA 4K8ZA 4F3OA 4RG8A 5KFNA 4ECQA 3MXJA 3V1OA 4FM2A 4LZDA 4ZHRA 2FPMA 9ICEA 3OSPA 8ICOA 5KFOA 3AVHA 1EXNA 4RPYA 4W5TA 4MFBA 4KLTA 1HUOA 5IIMA 2Z1JA 1XU4A 3MEEA 2HNDA 3QEIA 2PZSA 4M3ZA 4ZTFA 5KT6A 3ZDCA 4G1QA 4M6WB 3NHGA 5J2NA 1U47A 1A77A 4YXMA 4CIGA 4JV1A 3PX6A 3N97B 4PHPA 3NFAA 4FJ5A 2HMIA 3V6JA 2ZJ8A 4HVJA 1Z00B 8ICGA 5CJ7A 2XY7A 2QKKA 4QOZB 3TAQA 3KD5E 3NGDA 3K4GA 2W9MA 4DG1A 3C95A 4PQUA 1TV9A 4X5VA 4DL6A 5D4BA 1QSYA 1TVRA 1R0AA 4Q0BA 8ICZA 4IBNA 2XHBA 1BCOA 3GV7B 4L8RB 3QINA 4FJLA 4UAYA 3ISDA 2PYJA 4OGCA 3ZSOA 3KLIA 3RRHA 1KLNA 1LV5A 2G8UA 2XY6A 1HPZA 1ZQMA 4IFVA 5JUMA 5KFEA 3IAYA 1HYSA 4E89A 3RAXA 3UIQA 1L3UA 2BKEA 2Z1HA 4I9LA 3G6XA 4YR2A 4I29A 2QXFA 3UQ2A 3T3FA 1UT8A 1O1WA 4IQVA 4M0AA 3RWUA 2RDIA 3MFIA 3HP9A 4K8XA 1XHXA 4XRHA 3GIMA 1RTJA 3KLHA 4CJLA 4LH4A 1SL2A 3MGIA 4I7FA 3TR8A 4R8UB 2B5JA 1QS4A 1ZQTA 8ICPA 4M2YA 3QE9Y 4TSXA 4YFKA 3TWHA 4TQRA 4DMNA 2B4JA 5KFBA 3KK1A 2EX3A 3RH4A 4FK0A 4MF2A 2DPJA 5KFMA 4DSFA 2Y1JA 2W9BB 1MC8A 2JGUA 5DBBA 2W8LA 1ZJNA 3AVBA 2X78A 3V6DA 2C28A 3O3HA 5TZVA 4BDYA 4GXIA 1ZQJA 4BDPA 2FBTA 4MFCA 4NY8A 1ZQPA 1Q9YA 3OYFA 2V4RA 3RMBA 1KFTA 3SPZA 9ICLA 5J2CA 3H40A 4DLGA 4DO9A 4RQ5A 5IIIA 4FS2A 1TGOA 3VQPA 5DLGA 1GOCA 8ICYA 3IG1A 1JX4A 4I28A 1L3TA 1U49A 1KFSA 2IGIA 2O4GA 3RJKA 1TK0A 4M3RA 1FK9A 2OWOA 4RQ6A 1IKVA 4ECUA 1XWLA 4MEYA 2PI4A 9ICKA 3KLFA 3U6FA 1WCLA 3H08A 2HHUA 2ZE2A 4QWEA 4F4ZA 4FJJA 1ZQXA 2A1JA 2ZTEA 2KZ3A 5DB7A 4FJMA 4TUPA 2BPFA 5FRNA 1LWFA 4QZHA 2F8SA 5KG5A 1N6QA 4YD1A 5J0PA 4RQ3A 5EWFA 2Q3SA 3KTQA 2BCRA 1DTQA 5KFLA 5DLFA 2OZSA 4M3UA 3SUOA 3MR5A 4QWDA 3IM1A 3T1AA 1LWEA 3LWLA 9ICJA 4J2EA 2FMSA 4YMMA 5D49A 1JMSA 1NJXA 3CFPA 2X74A 3M8QA 4RNMA 2VWKA 3V7KA 1WAFA 3H4BA 3TARA 4P4OA 4O44A 4CK1A 4I2AA 1WAJA 2D5RA 8ICKA 3SCXA 3UPQA 1ZBUA 2AGQA 4Q5VA 4DQIA 4IKFA 1C6VA 3SJJA 2XGPA 3C5GA 3OYCA 1Z3EB 1ZQWA 2ETJA 2ATLA 4CFAA 2P6RA 3BQ0A 3AA5X 2HHWA 2UVRA 1KVCA 4LZGA 8ICHA 1RPLA 4YD2A 3DMJA 2FC0A 2W42A 2BCQA 4I2DA 1ZBFA 4RQ0A 1Q8IA 4CGFA 5FROA 1HUZA 5L1KA 1RT4A 4IG0A 4FXDA 1ZBIA 1TL1A 4GXJA 2OYQA 4LVSA 3MDAA 4UB2A 9ICWA 4F4KA 3P5JA 2HVHA 4M42A 2BQRA 3TQ1A 3O3GA 4BWJA 4PH5A 2I9GA 4FJIA 4E19A 1U4BA 3SNNA 4AHTA 4KLSA 1WCNA 3CM6A 4DF8A 3M9NB 7ICQA 4Y1DA 2OZMA 4G3IA 4KB1A 3Q8LA 2KFNA 4MF8A 4FO6A 3O4NA 2A1SA 4OLAA 1A5VA 9ICUA 4I2QA 4CERA 3GQCA 1NJWA 4H4OA 3BGRA 3GV5B 3AA3A 4J9OA 2BR0A 3KK2A 4DFMA 5FRMA 2J6TA 5FDLA 1SL0A 5DB9A 4FJ9A 1L3VA 2IMWP 2KQ2A 3VQCA 1KTQA 7ICVA 1C1BA 4JUZA 8ICIA 4FLXA 4KHNA 1HRHA 1TL3A 1BL3A 3E2EA 2HNZA 4EBEA 2QK9A 1RILA 4RUAA 3AVIA 5KTQA 4KHYA 2BANA 2VA3A 3M9MB 1JXBA 1VSKA 1K1SA 8ICWA 3ZT2A 3QEWA 4RU9A 4HCCA 1S1XA 2NRZA 8ICXA 4FJ8A 3ASMA 4DEZA 4IRCA 4DTRA 1D9FA 2DPIA 3QZ7A 4KB0A 4Z4GA 4UAZA 4KRFA 5DG9A 4CHPA 1CXQA 4RW8A 3OHAA 4CJPA 3PMNA 4R65A 4DQQA 4KTWA 4HUFA 2OPSA 1WLJA 3M8SA 3ZSRA 4CJRA 2ZUCA 5J1EA 4ECYA 3RBDA 2JEGA 3LP1A 1CLQA 4J9PA 4OKKA 1FXXA 3OS2A 1DLOA 3V9SA 3RR8A 1XSLA 1FKPA 1WSJA 1BVSA 4OKEA 3RMAA 2MUTB 1BPZA 1C7YA 1EX4A 2ZUDA 5CP2A 3MGHA 1ASUA 2G8HA 1ZQFA 4CFBA 4YMOA 2EHGA 5CY4A 5I42A 3RJEA 3QEBZ 2ZTDA 5KFDA 5DDMA 1PZNA 3Q8QB 1XSNA 2D0BA 3RJJA 3M8RA 1WSIA 4E7HA 1TKZA 3V81A 4EBDA 1VSLA 4OJRA 3L2RA 1S77D 4ECRA 4DTJA 1TKXA 3RMCA 4F5QA 4KTZA 1QHTA 1QSLA 1ZQAA 3UXPA 2RKIA 4K4IA 4BE1A 3CG7A 1CXUA 4FZZA 3VQEA 2Y1IA 4FM1A 1F21A 3ZT3A 1KEJA 4C8OA 1HQUA 4YNQA 1VSIA 2ISOA 3AVMA 1NK9A 3ALYA 5DBAA 4RPZA 3TABA 3HWTA 2G8WA 4PGYA 4CEAA 3BJYA 4R64A 4CJTA 4JWNA 9ICQA 4KI4A 3NGZA 1ZQQA 3H8JA 3AVLA 5J2IA 5L9XA 2GV9A 1C1CA 2E6LA 1XI1A 3OSNA 4DS4A 2BQ3A 3HPHA 1B9DA 1IG9A 1NK0A 5C42A 4F93B 4QZBA 1BPEA 1RT6A 3CFRA 3NGIA 5CWRA 4NLNA 1EP4A 4FBUA 4RQ1A 4J9NA 3GIJA 1JLAA 1BGXT 3K5LA 3K57A 3SPYA 4M04A 4CEDA 4K4HA 5DQHA 2HHXA 2J6UA 4B9TA 4PGXA 2OA8A 2G8KA 4CGDA 3LP3A 4F2RA 2ZD1A 4CJ4A 4MFAA 4YVZA 4ECXA 8ICSA 4FLTA 4NCBA 3S3MA 4RT2A 3HVRA 4FJGA 4P4PA 2ASJA 3KKRA 5HLFA 4LH5A 2KTQA 4F50A 8ICBA 2JZBA 1WSFA 1S0NA 4FLZA 4F5RA 4J2BA 2PFQA 3RAQA 4ED6A 3OS0A 4DTNA 1JN3A 3P83D 3L2UA 4M3XA 4KN7A 3ZSYA 1ZQOA 3GIKA 2FPLA 4B9UA 1JLFA 5KRSA 3VQ5A 3ITHA 2G8IA 1SZPA 4NLKA 3DLHA 1S0MA 2JLEA 8ICFA 4O3SA 2DFHA 4RW9A 2Z1GA 9ICOA 4XA5A 3NF6A 4XQ8A 3HXMA 4KHUA 4Z4IA 4DTUA 4YMNA 1ZQHA 4Z4EA 4LSNA 3AU6A 3ZSQA 4KHQA 1RDDA 2R8KA 3M9OB 1UWBA 4RW6A 2ZQBA 4CEFA 2ASDA 1WSEA 5BOMA 4DOCA 1XS9D 4DL4A 4FZXC 3NAEA 3SUNA 4QWBA 4FK2A 3Q8PB 2R8GA 4NM2A 3V6HA 4F4YA 3I0SA 4CF9A 3QLHA 1ZQCA 2F96A 4UB5A 2YHAA 1J53A 3V9XA 1S1TA 4O3PA 3UXOA 1D9DA 1N48A 2PFNA 2PI5A 4P4MA 2VG7A 5DBCA 3PW5A 5KI6A 2AGOA 1SL1A 3OVNA 5KRTA 1JLGA 1CZBA 4RNNA 5KG7A 4IQTA 3MABA 2AJQA 2VANA 3QNOA 3B6PA 4M3TA 4YXJA 3TAFA 1VSFA 2XCPA 3RMDA 4W5RA 4H4MA 3SZ2A 4TUSA 2C2DA 2I5JA 4KTQA 1Y88A 7ICTA 4F3TA 3ZT0A 2A1JB 1BCMA 5KFPA 4XUSA 3TFSA 4QZFA 5CA7A 1X9WA 2O4IA 4DTSA 3AA2A 3ZCMA 4IG3A 4TQSA 2W9CB 1RCHA 5J2JA 4FJHA 5E41A 3SV3A 5IILA 3V1RA 3C1YA 3FYHA 4FJ7A 4ECZA 3T5JA 2NRVA 4ED2A 4QZGA 5EWEA 4IR1A 4I2CA 4KLQA 5HROA 3A2FA 4ID5A 2NRXA 3PX0A 5J2DA 1NKCA 3LAKA 5KG6A 5DGAA 4GC7A 4KLOA 3PW0A 1J5OA 3H8WA 5BOLA 4YFUA 4KITB 4KFBA 1N56A 1X1PA 1TFRA 5KFIA 3TAEA 5EU7A 2XO7A 2YNHA 1HNIA 4Q44A 4Y1CA 1BPBA 4CJ3A 5J2BA 1XC9A 1RBSA 2RN2A 3C94A 4PHDA 3THVA 2R7YA 2Q0ZX 3K59A 3QEVA 4IRKA 4TURA 4RUCA 2FLNA 4MFFA 3AO1A 4CJKA 4QWAA 9ICCA 2RF2A 4KLLA 1RT7A 3VQAA 4E1MA 3HX0A 3OYMA 3L3UA 4J9SA 3LANA 4ED0A 1I3AA 5CYMA 4I27A 4B9MA 4N76A 3ZT4A 1JLBA 1LW0A 1C0TA 4OLBA 5DG8A 2BQUA 4M9LA 4R63A 4Z4CA 4J2AA 3SI8A 3KJVA 3OJSA 5KG3A 5SZTA 5HP4A 8ICQA 4AHCA 5C25A 4B8AB 1ZJMA 2PFOA 3FFIA 2NRWA 1NOYA 3RJGA 3NGYA 4LY7A 1V9PA 3QEXA 8ICTA 3V7LA 5IIOA 4DTPA 5KFHA 1YT3A 4B08A 1TAQA 5KG2A 4TUQA 3QZ8A 5KT5A 2R8IA 4BE2A 3EYZA 5T7BA 4NLZA 1K6YA 4NLGA 3TI0A 3AVJA 2BCUA 3RJHA 3HL8A 1X9SA 1JXEA 4Q43A 4UBBA 2UVVA 3ZDAA 5HRPA 3ORYA 3RB6A 1NOMA 3SUQA 3H7IA 2AU0A 1ZQUA 2BGWA 1A5XA 4KLGA 1T3NA 3HW8A 1X2IA 2IHMA 1BQNA 7ICFA 5EWGA 4N41A 1VRTA 1S6PA 4QCLA 1NKEA 4ED7A 1HMVA 3LPTA 4P2HA 5J0OA 3DLEA 4JRQA 4F91B 1BPYA 4CF1A 2RPIA 1RTIA 4NCGA 4QZ8A 1RBRA 4CJ5A 2BGGA 2OPRA 3EPIA 4FBTA 2DFLA 3LWMA 1U48A 4CHQA 5KG1A 1MU2A 4B9NA 5KFVA 3UXNA 1H38A 3ZSWA 1WNSA 5J0TA 4RQ2A 3JPQA 1IM4A 4W5QA 4CHYA 5KGXA 4HCBA 4EP5A 1NJZA 4OPJA 2IBKA 3OYLA 4DU4A 3AUOA 3G6YA 1NK7A 4O5CA 5CYQA 3VQBA 1QTMA 2C2RA 1HYZA 3G10A 4I2PA 4BXOA 3QERA 1ZBHA 1TKDA 3RB0A 4PHEA 4ICLA 3U3GA 1RT1A 4FYDA 4ECVA 2LSNA 5J2HA 4R5PA 1T7PA 4FW1A 3HO1A 4I9QA 5JS1A 3MEGA 4AH9A 4ELVA 4FLWA 4OKJA 4O5BA 5KFGA 4RPXA 5L1IA 4IQUA 3K5OA 2YNGA 4F4WA 3ETLA 3D45A 1S0VA 3DM2A 4F4XA 4PA1A 4DOBA 3OY9A 1KLMA 5HRSA 2IS3A 5J2MA 1JLCA 1ZQLA 4CEOA 4C8MA 3DI6A 1LW2A 3KLEA 3T19A 4AHUA 1S9FA 4KO0A 3ISBA 4O4GA 3GIIA 3RJFA 1J54A 1BI4A 4JRPA 5J2KA 4CIFA 4F92B 4KLJA 4K4GA 4E1NA 1RDAA 9ICGA 3JPTA 3SV4A 3RRGA 2X6SA 3C6UA 3K5NA 4RQ7A 4DTOA 4RT3A 3PNCA 3HPOA 5DG7A 4FS1A 1DTTA 4EP4A 1BIZA 3SQ0A 1S0OA 7ICOA 4HUEA 4DSJA 3C23A 3I8DA 4EBCA 4AHVA 2BPGA 5KFKA 4NCAA 1RTHA 3HPGA 3JPRA 3NH1A 3KHRA 3VQ9A 4CIEA 5HMLA 4JLHA 5KG0A 3PUFA 3C6TA 3V9ZA 9ICHA 4FCYA 3PY8A 2QKBA 1UAXA 2XCAA 2KZMA 5DKWA 1RBTA 2V9WA 1RT2A 2NUBA 4PGQA 3D0PA 4E3SA 3BDPA 4HYKA 5KFTA 3VA3A 4HTUA 4XIUA 3C2KA 3CYMA 5J2PA 4O3NA 3RTVA 3G0ZA 5CB1A 1KDHA 2P1JA 3NBPA 9ICFA 3AVGA 1JXLA 7ICMA 2A1RA 4E0DA 4B9LA 1IKXA 1WN7A 4WE1A 3BQTA 4ED1A 1WSGA 5KFJA 1VK0A 2C2EA 4CK3A 3QNNA 5DQGA 2ZUBA 5KT4A 4YP3A 5F9LA 3MR3A 2VG5A 4CJVA 1C1AA 1RTDA 5J2AA 3NCIA 1K1QA 2H5XA 3V1QA 5J2QA 5HNKA 3T5HA 2JZBB 4I2IA 4KV8A 3VA0A 2ASLA 4PY5A 5L1JA 4CGHA 1ZQVA 2NRTA 3EY1A 4DFJA 3V6KA 3H4DA 4O9MA 4CF0A 2VA8A 4LSLA 1ZQIA 3G6VA 5KFWA 3C2MA 1X9MA 5HRRA 4JV0A 3HM9A 4ECWA 1REVA 4KMUA 4QZEA 3HP6A 1S10A 5D46A 4UB1A 1MQ3A 5DQIA 1RT3A 3DYAA 5HHHA 5DMRA 2F1IA 3RR7A 1WSHA 1YVUA 4RZRA 4EYIB 5KFQA 3SQ2A 3AV9A 4UAWA 1ZETA 3LZJA 3VQ8A 7ICIA 3ZDEA 3H8SA 5F9NA 3HVTA 2KFZA 4HHTA 5DB8A 4I2HA 3PVXA 4Z6DA 3VQ4A 5IINA 4CGGA 9ICIA 1NOZA 2FBYA 1LB2B 8ICUA 4CF8A 4FVMA 5KFRA 4DSKA 3UQ0A 4JV2A 1B43A 2JEFA 2J6SA 8ICRA 2LYHA 4YR3A 4DS5A 9ICAA 2ZJAA 4OGEA 3AVNA 3AVFA 3FDSA 1Y97A 3ZDBA 3T5LA 4R66A 5KG4A 7ICNA 4RW4A 2GWSA 4GMJB 3KK3A 3LDAA 1UA1A 2HVIA 3DLGA 2F8TA 2PFPA 1RXVA 2DFFA 3ZD9A 3KD1E 3NTUA 1QLNA 4CGJA 4DL5A 4YG2A 4CGIA 1U45A 3JSMA 4N47A 4DSEA 1HJPA 1T8EA 8ICLA 4DSLA 2F1JA 3RBEA 3AO4A 4O3QA 3QESA 3QEAZ 3SI6A 1BPDA 3MFHA 5KT2A 3EPGA 3RB4A 2ATQA 8ICJA 1LAVA 2AQ0A 4M9NA 1YTAA 4KHSA 1NJYA 4KN4A 3MBYA 1KVAA 1ZQRA 3KHGA 4CEQA 4CFCA 4PHAA 4JS4A 2W8KA 3EWAA 1RYSA 3VQQA 5KFXA 2D0CA 1IH7A 1JL1A 2KN7A 1DGSA 3CFOA 4F8RA 5J0WA 1TV6A 4RW7A 3NH2A 1RNHA 4FLYA 4CE9A 2C22A 3NH0A 1ZQNA 3QETA 8ICMA 3Q8KA 4ECTA 3PX4A 1KRPA 4FJNA 2ZJ5A 3LDSA 2VG6A 5CHGA 4FLVA 7ICJA 4CF2A 4M9GA 4FW2A 4MQ3A 4KLEA 3BQ1A 4PWDA 4C8NA 3B0XA 4IDKA 1TVAA 3ZDDA 3TAMA 2FBXA 3OJUA 4Z4FA 3AVCA 5CZ1A 1Q9XA 2I1QA 3L3VA 4DOAA 4KLFA 4DQRA 3PR4A 4E7KA 1ZYQA 1MQ2A 4KI6A 2XY8A 5EOZA 1QQCA 4DL3A 3PW2A 3ZSXA 1ZQZA 5KGWA 1A76A 4CK2A 4O3OA 4I2GA 5J0XA 4ZH4A 2M9NA 4O0IA 4QZIA 3Q8SB 1GOAA 2B21A 1ASWA 3K2PA 2BPCA 5J0QA 1T4GA 2P51A 1HYVA 2GUIA 9ICXA 3OYDA 3K58A 1N5YA 2DTUA 1T05A 3AA4A 4AHRA 4J9RA 1RYRA 4BE0A 4M6WA 3OHBA 1UA0A 1NK5A 3EZ5A 4W5OA 3WNEA 4CJSA 4KLIA 9ICRA 4IR9A 2RDJA 5J0UA 4M3WA 3OYEA 9ICPA 2E6MA 3RH5A 5HHIA 4RNOA 3ISCA 4M45A 2E4LA 4YCXA 2W9AA 4I2FA 4CHOA 1Z00A 1IO2A 4NYNA 4J9QA 2UVUA 2FBVA 4OPKA 4DSIA 5JS2A 4O0JA 4J9LA 4JS5A 5DK5A 4UB4A 3RH6A 2YKNA 1BIUA 4F5OA 3V9UA 3Q8RB 4F2SA 3JYTA 2B6AA 1CZ9A 1ZQYA 1NKBA 3QO9A 2R8HA 4M9HA 3MDCA 5KFCA 5KT7A 3NF7A 2YV0X 2HHSA 1FKOA 2ISPA 5CR0A 4DQPA 2XC9A 4GLXA 2Z1IA 4EZ6A 2HHTA 1RDBA 3MXIA 4QW9A 2P6UA 1CEZA 3TFRA 4GW6A 1B92A 5KFAA 4AHSA 1EETA 2X6NA 3OYNA 2YHBA 1XHZA 3L2VA 3N4MB 2WONA 5J0SA 4W5NA 7ICLA 2GBZA 4R8UA 3DRPA 4CFDA 3Q8MA 1SKWA 4DQSA 7ICEA 4DL2A 3PO4A 4Z6FA 4UBCA 2HW3A 2YNIA 9ICTA 5CZ2A 3KHHA 1TKTA 7ICSA 1KCFA 3OGUA 3JPOA 4FM0A 7ICHA 2PY5A 4B3OA 3F73A 1IXRA 4Z6CA 3HJFA 3VQDA 4GC6A 2AQ4A 2W9BA 1MSWD 4E7JA 1DOQA 4RQ4A 3RB3A 2W9CA 5DB6A 2HHVA 4CECA 1ZQEA 1VSEA 1C0MA 3B6OA 3BQ2A 3VQ7A 5C5JA 3B0YA 4QAGA 3LP2A 2F1HA 4B9VA 2ITGA 4MEXA 3HSTB 4Q45A 1ZQGA 4NM1A 4BXOB 9ICSA 1I39A 4PUOA 3SQ1A 4I2EA 7ICPA 4RQ8A 3AO3A 2PXIA 4ZTJA 5D3GA 3LP0A 4ELUA 4ELTA 1GOBA 5HRNA 4O5KA 4BWMA 8ICVA 4QWCA 4AILC 3S3OA 1S1VA 3DLBA 1NK6A 3MECA 3T5KA 3JPPA 1BISA 1QE1A 2DY4A 4CJWA 1D8LA 1S1UA 4KHWA 4E7LA 4DFPA 4FZYA 4I2BA 3GILA 4BDZA
chains in the Genus database with same CATH superfamily
4B3TF 4LF5J 1LKYB 3DM2B 4ZPBA 1B64A 2HF4A 4FJXA 1X9JA 1FRHA 2E7WA 2EG1A 4OYIA 2P9UB 4JK1A 1X4HA 2HVEA 2UXDJ 1JLQA 1SKRA 4C0BA 3UN5A 2NYIA 2KB2A 1Q82T 3O8MA 5D78A 3OPXA 4DU1A 2VIXA 4CLKA 1ZD4A 2Q4TA 3MTJA 3OYIA 1ZQSA 3CPWM 2AP6A 1UZDA 2FZKB 1JLEA 4FYWB 3C2LA 4ZN1A 3LM2A 2KZZA 1ATSA 4DUZJ 4IO8A 4CEEA 2P5OA 4IQMA 3AODA 1RXOB 3C0BA 3QAEA 1B0TA 2BJ7A 2WRMA 3NMRA 4B3RF 3V9WA 2NR0A 3O9QA 3GE9A 1XNQK 5BN9A 4U7UD 3VAKA 2X3DA 3D1HA 4K42A 2YHXA 3QIOA 2HRUA 2RU9A 3OYHA 5B0BA 4ID1A 5L1LA 5GAGP 4ZPCA 4QZAA 3W3SA 4NYFA 4P0QA 4NYPA 2YKMA 2G0AA 5HQLA 1J5EF 4KLMA 3T7ZA 2KHOA 1GXLA 2Y9TA 5J29A 1T6DA 1L5UA 1RYUA 4CH1A 3H5SA 3NVMA 5D4PA 3C1ZA 3NBPB 2UU9F 4XPCA 2QX0A 4CM2A 1S76D 1W25A 1TL4A 3EM1A 3FMWA 1WI8A 3TSQA 1SWWA 9ICNA 2HAIA 3LVVA 3I0RA 5LY3A 4DCPB 7ICRA 5KL8B 5IT9U 5C7PA 2ASOA 4NLTA 2AF6A 2ZH5A 1IN0A 3G9CA 3BSNA 2EZZA 4YDUA 1WHWA 2VFSA 2D0AA 2MAXA 3NF8A 4J9KA 3LL3A 4M41A 3VVTA 1YRTA 5J2QB 1M1KT 3LK9A 3L2WA 4CZEA 4KV8B 4KMOB 1OSDA 2IC3A 3V72A 4IQWA 3HK2A 2RP5A 2H3IA 4KLHA 3O2IA 5EGYA 3VAGA 5HBMA 2HBLA 4DFDA 2YKQA 2YWGA 3R1HA 3IBPA 2UV8G 2H3EB 2K3KA 1SB3C 5DETA 3WT0A 4EZ9A 3VF2A 1F9HA 3R3TA 4Q8FA 3OYAA 4C0OC 2BDPA 2KSOA 3UNGC 3AO5A 4UOGA 3KIOA 5SWMA 3DOKA 1JLAB 3R8EA 1WG8A 2F40A 2W4CA 5U47A 2DR5A 4A8FA 1H2TZ 1U1PA 3Q22A 4MKAA 3DLJA 4CIOA 4A57A 3FEXB 4W4MA 1QTNB 3M6XA 3GV8B 4HAIA 1FWLA 3ENQA 1FW6A 3MI7X 1F0MA 3QUTA 4CQ1A 3U1MA 2D69A 4L3KA 4CESA 1TMJA 3OL6A 1OVYA 3E0FA 4FOIA 1NMEB 3D5MA 1O08A 2O8EA 4E2FB 1VRQC 1SB6A 5HAOA 3O3FA 2QLBB 4FWLA 1RA6A 1TUYA 1RKIA 3L4QA 1RWNB 3RW7A 1ZM2A 2G13A 4FZNA 3ZETB 4RW4B 1HJRA 1X6IA 3WBZA 3I8BA 4QNLA 3DWLA 4O3RA 1V5VA 5ALFA 5AQOA 3M8WA 3DN9A 5C15A 1B22A 4JD2B 4C8LA 1A5WA 5AR0A 1KHWA 2DGXA 4CHZA 3KLGA 3RUBL 3MR6A 3L4IA 2MZQA 3HT0A 4A46A 2EVZA 1QD1A 4I64A 3SIPB 3ULDA 1WF1A 1DXSA 1JKHA 1H7XA 3UKRB 1RWPB 3O08A 2FMQA 3KJQB 2CADA 5GMEA 1Q53A 1SV5A 5AQIA 1NPKA 4FK4A 2EC2A 3UD5A 4NXNJ 5C24A 1N36J 4MLHA 1JIHA 8ICNA 5B8HA 5DDYA 1BHLA 3FE1A 1TAUA 2PYLA 1A7GE 1GEHA 2GEMA 5KFUA 8ICEA 3OYGA 4HTIA 1S4EA 3CHWA 2CPYA 2G8FA 1KWMA 3THWA 2M5YA 1U1KA 7ICKA 1UL3A 2BABA 2ZIWB 3D2NA 3SSSA 1FESA 1KSPA 1XJWB 4KLUA 5ALOA 1ACMB 2WC9A 1CSJA 3MGJA 1F60B 1IKWA 4OI1A 5J0RA 3TWZA 3GYGA 4Y3CA 3Q0AA 5IIKA 2K8AA 1EKSA 2DGWA 4CJQA 2CIMA 3C7NB 3DLKA 1V97A 3JPNA 1PJ7A 2G0JA 1XSPA 3CCES 4OZ3A 2VQEF 4CEZA 2WF5A 3LOUA 4C8YA 2OXOA 3AY9A 3ICLA 3D67A 4ACOA 2ZBPA 3ZFVA 4ED5A 1U04A 2Q31A 5DM6L 4BC3A 1S9GA 3PYGA 4K8ZA 5LMUF 2HIYA 4RG8A 3KG0A 1L8OA 2YWFA 3HTVA 3WDOA 2N1RA 1FJGK 9ICEA 3OSPA 8ICOA 3A3PB 1EXNA 2GS8A 4TU9A 3MHYA 1AT1B 3C19A 4KLTA 2AEJA 4UW9A 2WZ1A 1N5YB 2D74B 1JB0C 2ZIXA 4AQYF 4FYXB 4WXWA 3WKEA 2C2MB 4G1QA 4UUXA 2QGFB 4LREA 4M6WB 4P74A 5GMKa 1U47A 3C46A 5J1PA 1A77A 4JV1A 2B7BB 2GJ2A 1EQYA 3NFAA 3V6JA 2XEXA 3TADA 2Z56B 4NLQA 4B3SK 4HVJA 3JXOA 2XY7A 3D0HE 3NGDA 5FPEA 3SDEA 1VDHA 2LM1A 3U26A 4YB6A 3K4GA 2NO4A 5GAHU 4GKJK 4DUYJ 2RS8A 2YKNB 2PE8A 3JYTB 3E1YA 2Q1LA 1QSYA 2QMXA 1ZC6A 1YBTA 3TVYA 2CQDA 2XHBA 4L8RB 4GRSA 1VBZA 3AOBA 4OGCA 2Q1NA 4CJ7A 1YZ6A 4EAHD 1KLNA 2G8UA 2EANA 2XY6A 5D15A 3PSIA 2ZVSA 1GX6A 4JI4J 4E89A 5BN8A 1L3UA 2BKEA 4Y2MA 4ZKAA 2J8SA 3UE5A 4UUWA 4L3NA 1CS4B 2ZHOA 1IG6A 5CYMB 1SPBP 1F6TA 3T3FA 1CBKA 2VFUA 3RWUA 2RDIA 3HP9A 3UPFA 1K0VA 1DBDA 1SJFA 3VCDA 4CF3A 3ZXWA 3QSYB 2CG4A 2KDOA 2B5JA 3NOCA 4B3MJ 3UWTA 5AKZA 4PYDA 3AY0A 1HA1A 2YNIB 3TX8A 3ZTPA 3TWHA 3FKBA 5ETMA 3RH4A 2XMUA 1VLYA 1IBKF 4FK0A 5KFMA 2JGUA 3BV8A 2J4RA 4JI2F 5CYJA 2C28A 5M1KA 2FBTA 3OBIA 2LDIA 4NY8A 4FDFA 3ETRA 3PYDA 2J0QD 4X66F 2V4RA 2M70A 4ILJA 1HIYA 1AYEA 1NLVA 1ZOTA 3TVKA 2GCFA 2A1AA 1FFWB 4FS2A 1TGOA 4CRJA 5DLGA 1RWWB 2E44A 1GOCA 5ALZA 2HK3A 2O01C 2CPFA 2DGVA 3PRVA 8ICYA 4MYTA 4K4XA 2ZIVB 2I5HA 4OX9J 1TK0A 4JYAF 5M1OA 1S6PB 4OO1J 2AA4A 4O8UA 3Q23A 9ICKA 2AHOB 1S12A 2WF7A 4Q2MA 1WCLA 1WUDA 2ZJQQ 4IH5A 4WBFA 1C0UB 5HL7Q 4BRMA 2A1JA 3UW1A 2Q3PA 3BH7B 4ERDA 1YJ9S 4B1XB 4RQ3A 1HNZF 3IRUA 4LF9K 2BKPA 1FNXH 1OS5A 1RAOA 2PA3A 2OZSA 1ED1A 4CNQA 4UZBA 2ZDOA 2V8PA 1T03B 9ICJA 4K25A 3I5BA 1NJXA 1IKYB 1VQON 2AWZA 2GVDB 3N4WA 5AK3A 4BC7A 2HYIB 1VQLN 5AKGA 4PEOA 1WEYA 3BS7A 1PILA 3VQSA 1WAJA 2I9SA 3SCXA 3HM8A 3UPQA 2VPZB 1ZBUA 2AGQA 4Q5VA 1WOQA 1TYQA 3SJJA 2XGPA 2HPUA 1KXPA 1LXJA 1ZQWA 4HTJA 5HN0A 3BQ0A 2EDUA 5J2MB 2G5HB 1R8CA 2IAJB 2A6MA 4KO0B 2FC0A 2PD1A 2BCQA 3CMQA 3D6FB 5F8NA 4I2DA 5ETLA 1ZBFA 4RQ0A 4NLYA 2WFAA 2IM1A 1HUZA 2EZXA 2OYQA 4HI1A 2W2OP 4UB2A 3VEZA 2VQFJ 4P73A 4CLWA 5FPNA 2BQRA 3V4IB 2I9GA 1U4BA 2IYIA 4BRNA 2YWKA 4DR3J 3GFYA 3CM6A 3M9NB 5AQKA 2MZSA 3QRQA 5EHHA 2QLJB 2AX1A 4MF8A 1A6LA 2FHJD 4H4KC 5DZ6A 2RSQA 2RLTA 1URRA 2GTDA 4OLAA 3V4MA 3CIMA 3X3UA 3GV5B 4S0MA 3AA3A 5F0WA 4DX7A 2HGLA 3H8YA 4DV2F 1NGDA 1CI4A 4RJVA 3AB4B 4WK1A 4IQXA 2HGMA 5FDLA 4OI0A 1SL0A 2C3PA 4FJ9A 3C2PA 1CQNA 3G6ES 2KKZA 5AZIB 1Z4NA 1GH8A 3S7RA 2VU5A 7ICVA 2C2KB 3U7JA 1VRUB 4JUZA 2EAPA 1BL3A 4YOWA 3EGZA 3E2EA 1HNVB 1F5SA 2XYGB 1N33F 1RILA 1Q3UA 2KIVA 2BANA 2VA3A 4BC5A 2KRRA 3SR6A 8ICWA 2FC9A 1YG0A 4C9DA 2P9UA 3OHRA 8ICXA 3M7DA 3HKZD 4RR5A 4DV1K 2DPIA 3O8WA 5KPRA 4KRFA 3OTOF 1SUQB 1N2XA 1CXQA 1SQFA 2MA1A 4CJPA 4BRFA 1N5VA 2MHNA 3TTDA 1EKRA 4HUFA 1WLJA 2ZUCA 1BNOA 4FL9A 2JEGA 3RBDA 4UF4A 1GLJO 1CLQA 1WELA 3QFWA 3QAUA 2CPIA 3EGVA 1FE0A 1FXXA 5ALVA 3NAIA 3V9SA 1XSLA 4CH7A 3AH6A 2VJ5A 1F9EB 3JS9A 1WSJA 2WB1D 2MUTB 2GX9A 2GMJA 1VJ5A 5CP2A 2FHJA 1RT3B 3ONQA 4DR4K 5GAGU 4KH0B 1ASUA 2RU3A 4BY9C 5D0GA 5I42A 3RJEA 3QEBZ 4J7CA 2ZTDA 2Y8WA 3RBXA 5DDMA 4DR1F 3Q8QB 1XSNA 2D0BA 4E7HA 4Y2XA 2F63A 3B8AX 4O3MA 4IFYB 1RT5B 4OYZA 4OJRA 1S77D 4ECRA 1OY9A 3RMCA 2HSZA 3DRXA 4X62K 4KTZA 4KKOB 4M5JA 3VQTA 2KP7A 1WOSA 1RAAB 2QV6A 3DXSX 2HNYB 3HSDA 5AHXA 1NXIA 2KU7A 2E5IA 5JTIA 4JI7J 2E8AA 3CJAA 4H54A 2RS2A 2E3TA 2Y1IA 1WF0A 5A2QU 1F21A 3ZT3A 1HQUA 4CO1A 1VSIA 4RTFD 1UPMB 3NASA 2P2CB 4RPZA 4CZGA 4AXJA 4R64A 4K4TA 2EWSA 1KVIA 1P8GA 4RWTA 9ICQA 2LQBA 1JROA 1CJKA 1KQSR 4LVOP 2YNFB 2Y9UA 1LXNA 5E79U 4K50A 5L9XA 5CD4H 1WG5A 1U1NA 2FVRA 3MOZA 3OL9A 2E6LA 1XI1A 2EW9A 2C2ZB 2BQ3A 5EE0A 3M05A 1U6BA 2JC0A 1IR2A 5A0YA 3NP5A 1T9UA 3QMLA 4MLEA 3VPZA 2CZVC 3NGIA 5CWRA 5FLXU 3IM9A 4J9NA 1VQOS 1JLAA 1BGXT 4YHHF 3K57A 1F2GA 3VGLA 5BRHA 3R6LB 1AZSB 1Y00A 3O9UA 4EU0A 2G0IA 5BYRA 2HMIB 4CZLA 3PIOL 4FYVB 1HI8A 3H5XA 3S3MA 3KXDA 3CCVS 4P4PA 5AKEA 2VPXB 1XNRJ 3AAPA 1Q79A 5HLFA 1XEZA 4Y2PA 3R27A 1XR6A 2C3MA 2UUBJ 8ICBA 1WSFA 1VOMA 5GADU 2BE7D 2PFQA 1LK7A 2VBZA 3OS0A 1U26A 4MN4C 5IS2A 3DGVA 3QFHA 2CH5A 1HWJA 4CYUB 4R0EA 2AYGA 4W98A 2MQQA 2FPLA 5CZXA 1GX5A 1I94J 3HSJA 2HS0A 3H0LB 1HYSB 3ZZTA 1UQVA 5KRSA 2Y1LB 2OM6A 5ADXA 1GMVA 3K9KA 1S0MA 4WQ4A 4LF4J 2JLEA 1GLEG 3JAMY 4Z7CA 1KC8O 1RTJB 4FN5A 2UXCK 2CXEA 1GLBG 1ZD3A 1ELOA 3KLHB 1CULB 2DTJA 4UOCA 1VYAA 1ZQHA 1SC6A 2RHFA 3AU6A 1TU0B 4NRTA 1KKHA 5C2GA 4ZVFA 2R8KA 4RW6A 4M5DB 2ZQBA 4CEFA 2CNNB 2A2CA 2MGZA 1APSA 3LDOA 1FRJA 1XS9D 4MMOA 2E5LK 1Q4RA 3BZQA 4DL4A 4BC9A 3Q8PB 3T79A 3TEHB 3V6DB 2PFDA 4NM2A 5A8WA 3V6HA 5C2CA 3GMGA 3NCPA 3AMZA 4I4BA 4DX5A 3L0QA 5EX0A 4C4SA 2YHAA 4WFBQ 2JDJA 1JXVA 2DNQA 3V9XA 5K8MA 2VKRA 1UCVA 2G0CA 3C3LA 1D9DA 1NHVA 3W5YA 4ZVHA 4JHDB 3IG1B 5KI6A 1V3ZA 5KRTA 3M2UA 4RNNA 2VANA 3QNOA 4M3TA 4YXJA 2GWJA 2EI5A 1RCOB 2HRYA 4ILHA 3ZTRA 3C6HA 4TUSA 5IQQA 5DZ7A 2CGJA 2KYZA 2Q0RA 2DT9A 2GJIA 3D0GE 3ZT0A 1W7WA 3MX2A 5M1FA 1WUUA 3GE1A 1NPPA 5CA7A 1ZD5A 2B9XA 1N6QB 1N32K 1S5LU 1XUPO 2OMLA 2EAOA 2Y0SC 1SJRA 4M63C 3SV3A 2B3TB 3QUBA 4EFHA 3V1RA 2FVPA 3FYHA 4QZGA 4IR1A 2W2MP 3A2FA 4GKKK 2NRXA 3PX0A 1F5CA 3CJBA 3LAKA 4GC7A 1J5OA 3H8WA 3CDUA 3TW0A 3FBCA 1XBWA 3EGNA 3WZ0A 3LP0B 4FZMA 1ITPA 1TFRA 3TAEA 5EU7A 1EIYB 2YNHA 1HNIA 4M94A 3HRGA 3C94A 4O23A 3AQFA 2N82B 4NA1A 3THVA 5ETNA 3K59A 4IRKA 2FLNA 4OYOA 5AJ3J 3D68A 3R5CA 3F56A 2KG0A 4E1MA 5LM7E 2CQ2A 4ED0A 3GYXB 5CYMA 3H3OB 3GU0A 4CTAA 3MXHP 5JLFA 1R6VA 2FGOA 4WKYA 1N62A 4OX8A 1JLBA 1LW0A 4OLBA 3M2RB 2F8LA 2BQUA 3I82A 3VAHA 4DZDA 4LF5K 1W2IA 2E2PA 3CGIA 1RHRB 3SI8A 3QU7A 4OYWA 4J5OA 3KJVA 3HVAA 3OJSA 2OSQA 3EZUA 4BJQA 3VAJA 5HP4A 2UXDK 4AHCA 3GSDA 1DEJA 4B8AB 3EGWB 3DXBA 2LP4A 1PK3A 2IRXA 1YJWN 4NB4A 2DL0A 2R7RA 4DUZK 5IIOA 3QATA 1KQSM 2WVEA 4DL0C 2XS2A 4KX5A 1B7FA 1D8BA 2B43A 2R8IA 1I51B 2VGNA 4BE2A 3BGRB 2BKOA 4NLZA 1KC8T 1SV4A 3W9JA 4NLGA 3L7OA 2B56A 5LOQA 3TI0A 3UVJB 4U67L 3WX4A 2PBDA 1X9SA 2BKNA 3CCLS 4PAAA 3Q89A 2CXYA 1ZQUA 2XMWA 2BGWA 2UXBF 1A5XA 2ZIVA 1CC7A 2XI9A 3IMXA 2KVSA 1UPHA 7ICFA 5MAOA 4DR6F 2EKYA 3ZLJA 2O5DA 2GIFA 2HNZB 1S6PA 4QCLA 5ALEA 2PFFB 3O1BA 1UHUA 3LPTA 1RAIB 4P2HA 2ROEA 1ROFA 4JRQA 4F91B 2KICA 2PMHA 1B4FA 4IL6U 1FNOA 4MK9A 1CJUA 3L3FX 2B51A 4ES3A 4WWSA 3FBFA 5FP0A 1KQQA 1H38A 4WU3A 4WCEL 1NPRA 2A40A 1GK8A 4KT0C 4DX8H 2MKIA 3K1ZA 3NWGA 2FUG9 4W5QA 1XC3A 1QZ5A 4OPJA 2IBKA 4Y2TA 4DU4A 3WKCA 2KT2A 4DN9A 3AUOA 4JI8J 1QTMA 2OCEA 2C2RA 3VALA 2QYGA 4ES1A 1VQKS 1ZBHA 1TKDA 5LL6d 2GVDA 2WBRA 5KOXA 5J2HA 2BV3A 3DDIA 3HO1A 2KMDA 4I9QA 2WB1F 5JS1A 1SAZA 3QYPA 1NO8A 2YY6A 1MWZA 3QT7A 5KFGA 2CUYA 2YNGA 1HD0A 4F4WA 2YQ3A 3LUYA 2DRBA 3ETLA 2GHPA 5J2MA 1MWKA 2HQDA 3EXCX 3DI6A 4QPTA 4N77A 3PFOA 3KLEA 1S9FA 4KO0A 4O4GA 2ZKUA 2RKIB 1X5PA 1A6SA 4YDDB 1K9MO 3CJSA 2Q36A 4K4GA 1XNQF 1HD1A 2VHGA 2MHEA 3IC1A 3SV4A 2EQYA 3J81U 3K5NA 2QG9B 3C14A 3PNCA 2JC1A 2YMMA 1DTTA 2MLZA 2ZWOA 1HBNB 4XAKA 1S0OA 1ESVA 4PJ0U 1K8AO 2BPGA 1FXRA 4NX9A 1MN7A 3S1TA 2K8BB 1RAHB 4YOUA 5T7LB 5JJBA 3MM7A 4PG4A 4LSZB 1UAXA 1WC5A 2KZMA 3H46O 2V9WA 2IJRA 1K5OA 4X64J 2YN4A 3CJ7A 3WK7A 2E1FA 3CCRS 1SC4B 2QRRA 4Y2SA 1UETA 4LFCF 3HSCA 3KK7A 1KR4A 3OUYB 5JLHA 3CC7N 2DHGA 4YOVA 3PLAA 3NCQA 3N0VA 4E3SA 4A8MP 2K7KA 2YB1A 1ZRMA 1XMOJ 4O3NA 1FEHA 4FF4A 5AZIA 3KUHA 2A6OA 2P1JA 4YOYA 2XSFA 3ENOA 4DI6A 1N88A 1NGJA 5ALGA 2VOOA 2I0XA 3H2UB 4NXNK 4WE1A 3KFWX 4UB6U 4ED1A 4RWXA 4Y28C 4J9UE 4XH4A 2A18A 3NKYA 2Z4PA 5GTHU 3N4PA 3L09A 3GU3A 6FD1A 2DH7A 2V63A 3QNNA 3UDCA 2D9OA 4K5SA 4JK8A 2CVIA 4DR7J 2VG5A 4CJVA 5J2AA 1K1QA 4AT1B 1NGBA 2GNKA 5HNKA 3DGPB 1W2BR 4M95A 3ALRA 5D4NA 4L74A 4OHYA 4PY5A 4CGHA 1EJ7L 1ZQVA 3F44A 3GP9A 5B5EU 3EICA 3LPEA 1F1BB 4KBOA 4CF0A 1ZQIA 5KFWA 5HRRA 3ITHB 2VJUA 2F8KA 2LQJA 3O5TB 4ECWA 2MSTA 5L9NA 2GIRA 4KMUA 3CCUN 4KH5A 1H98A 2MKHA 1S10A 4UB1A 2RQ5A 4OYAA 1YJWS 5JVHQ 1BUXA 4K4SA 3SLCA 5DQIA 1RT3A 3OTEA 2V67A 5HHHA 1RSCA 1YBUA 4NWIA 4QYZJ 2EG2A 4ETZA 3QFUA 3AV9A 2HFVA 2QI2A 3LZJA 1S22A 2B8QA 5AQHA 5ETTA 1WTBA 2QB0A 1M5PC 4IEEA 1J97A 3AM9A 4FWNA 3OTCA 3D2EB 1UWBB 4UZCA 4I2HA 2YQEA 3BZKA 4I0WA 3PVXA 4ZJOA 4Z6DA 3VQ4A 3DDNA 2AT1B 4CGGA 2FY1A 2FBYA 3ZTSA 4M1KA 4FVMA 3UE2A 1WSVA 4OJ1A 1X4AA 5LJ5Y 1YVNA 4NLRA 3UQ0A 4JV2A 3BBCA 5AQNA 5JMVA 4ZVSB 4MYUA 1V4SA 9ICAA 3LO3A 4OGEA 2N4CA 3ZDBA 4R66A 1HR0J 3C16A 3WK6A 3UDLA 3MTKA 3TP2A 2DFFA 4DUYK 1YQHA 1VQ9S 3HHKA 4G9ZA 1Q7YT 1QLNA 2VG7B 3HZ6A 3VEXA 5KAFU 2V52B 1FKAF 3A3OB 3JSMA 3ILOA 4LF8J 3EE9A 5ALSA 1A0OB 8ICLA 4A8QA 1Z1BA 3GG0A 3AO4A 2BUNA 3QESA 1A9NB 3EPGA 4WFZA 3G2XA 3VOVA 2XMAA 4JI4K 2HRTA 2KN4A 1KVKA 1LAVA 2AQ0A 4M9NA 2WSEC 3MUMP 4KY3A 3HHLD 2HQ3A 4CFCA 4PHAA 3EWAA 4NV0A 1RBAA 3UQSA 5ALMA 4V1Ak 2D0CA 2JNJA 1K8AT 4B3MK 1H6KX 4FLYA 5F8JA 3R5BA 3BM7A 3NH0A 2V8DA 4ZIWA 3CQYA 4ID5B 3M8YA 1S7IA 4BQLA 3AXKA 4FJNA 2ZIUB 2EAMA 5CHGA 4M9GA 4A8XA 1WUAA 4MQ3A 5F8IA 2E9RX 4C8NA 1TVAA 1D4XA 3MM8A 2FZCB 1N61A 5THWA 3ZDDA 3TAMA 4MJKA 2DYAA 4DV4J 3AVCA 5CZ1A 1FJGF 3L3VA 4DKWA 3L7UA 3BEXA 2ZJRQ 5KPZA 5K5MA 3PW2A 3KYLA 2F1FA 5KGWA 3KZIU 3R3LA 4OJ3A 2D3DA 5J0XA 5B66U 2CJ9A 2G9OA 2B21A 2BOPA 1FIQA 2HQFA 4OX9K 5J0QA 2IIRA 1NBEB 2DBYA 2ZH9A 3IA0A 3D0IE 9ICXA 3DHWC 5D0HA 4B3SF 2GZOA 4WKRA 4J9RA 2ZM6J 1TL7B 2DWQA 4Y2AA 1NGIA 4CVNE 1NK5A 3EZ5A 4KJIA 3CJKB 2O8DB 5FPDA 3EUNA 3J7YI 4DB3A 2XYPB 4C4RA 4GKJF 1IJEB 3IO1A 1SWVA 1NSQA 2E6MA 1Z19A 4M45A 4YCXA 1IR1A 3HHLA 4I2FA 3W60A 1IO2A 4U7CA 2KJVA 1TUGB 4H5TA 2E5SA 1LWEB 4ZIVA 3CC7S 4OPKA 4LF7J 3IMQJ 4O0JA 3MN5A 2P35A 2CH6A 2R7QA 4JS5A 2KJ9A 4NL9A 1VIOA 4UB4A 3P38A 3G8SA 2OUGA 3UO0A 2CQ3A 3ONNA 3K89A 4L76A 2HVZA 2R8HA 4L73A 2ZOMA 3OVAA 3EDRB 5IV4A 3MDCA 2P9SB 5AQSA 5KT7A 2EZYA 2FY8A 4P2FA 2HHSA 5CR0A 5E3RA 2HS3A 4M5MA 4XTTA 1A0PA 2Z1IA 3CCZA 4KGVB 3KZXA 1CEZA 1ZBSA 4FKXA 1SV0C 2P9PB 5F3XB 1QM9A 1VRTB 4BRDA 1EETA 2X6NA 3DLEB 2GBZA 3RGIA 4R8UA 4NCGB 1CG2A 1SKWA 4FZLA 3R7NB 4UBCA 2OPRB 3JSBA 5CZ2A 4FNHA 7ICSA 1KCFA 3JPOA 1VISA 4NASA 1PUZA 4UTGA 4N8NA 2KH9A 5J1NA 4IOCL 4TLQA 5A2QY 2W9BA 2HHHJ 1DOQA 4FXVA 3U8XA 1W2BM 3D6MB 2EPIA 2DR9A 2WUSA 1U0HA 3ENHA 1PC4A 2F1HA 4B9VA 5CYQB 2RUGA 4ZA1A 1FFUA 1ZTTA 4NZ7A 4I2PB 4BXOB 4DR3K 1UFKA 4KAIA 3MURP 4KR0B 5D3GA 3LP0A 2BJDA 3QUQA 2KEYA 2LXFA 2Y0SD 1FNMA 1GOBA 3CE8A 4O5KA 4BWMA 3PSPA 8ICVA 3O80A 3S3OA 1S1VA 3BP8A 3IBCB 2M0NA 2QLTA 3MECA 1MDUB 2V2VA 2DY4A 1QE1A 3GSIA 3RBZA 1Z2ZA 1D8LA 1SXLA 4NL5A 2XI3A 1RADB 1KNZA 5FLXY 7AT1B 2N3OA 3GILA 2YMPA 2A10A 4CJUA 3UDVA 4MDBA 3HI9A 2AD9A 2QLFB 2P66A 4GVBB 3BPDA 4LC9B 2ALZA 4LF9F 2UUAJ 4P9SA 3BB5A 2R2UA 1O51A 4GVLA 1N8RT 2CQ4A 1BI4B 1NEEA 5JRTA 3POTB 1FJ7A 2JGAA 4A8OA 2PN6A 3ULHA 3OVSA 2VWJA 3PHEA 4C8ZA 3TJ8A 3MD1A 5HQ8A 1RISA 1BWEA 3WK9A 2RUSA 1P90A 1PK1A 4NYOA 2IA6A 2EFPA 3IR5B 1RTHB 1HIWA 1M5KC 1RWOB 1SKSA 1WC1A 3BO4A 4I2JA 1ZAWA 4OFZA 3J7AN 4ISFA 2F77X 2XGQA 1RT2B 4BACA 5ALPA 3U3YA 3IGNA 1NZ8A 1S9EA 2JHEA 5KFSA 1BPXA 1JL2A 4FLUA 3UMCA 1E6YB 3SXLA 1LOTB 3OYBA 4QZCA 3QU5A 1AB8A 1S6QA 2EBGA 1GQEA 2XMKA 3W62A 5IM0B 1HQEA 4U95A 1FXDA 3ZSVA 3F9KA 3MWTA 3PW7A 1T3VA 4IRDA 1ZQKA 3BGUA 4M63A 2IVNA 2JFDA 5KFFA 4EX7A 2D3O1 4WFYA 5L1MA 1NI3A 3LVWA 3RF9A 4QIWF 1SI9A 4JI6J 4DTMA 1IV8A 2V0NA 1YUWA 5KFYA 1FD8A 2MSSA 4PG8A 3C29A 1B9FA 1Z1ZA 1Y5LB 2V4JA 3P1GA 3D3BJ 1O8BA 1FFSB 3FGVA 2OH2A 3J7ZO 6FDRA 4C0HA 1RTDB 2HB5A 4KPCA 1COOA 2IIHA 3HULA 4USKA 4JI7K 1M6YA 2A19A 5AI9A 3O4QA 4OMFG 1QSSA 4JKBA 5AI8A 1T6CA 1FJCA 4AL7A 4M3YA 1BXNA 4QW8A 3TSPA 4PCQA 1X31C 3HT3A 1RBUA 3PV8A 5EN1A 4DHYA 1WWVA 4BGDA 3IHQB 3A3NB 1NRKA 3M8PA 3SCIE 3G71N 1ZH5A 2RMLA 2ZITA 4LSLB 2DEJA 2A41A 2JWKA 2YXLA 2VIHA 1REVB 1Y3JA 3F41A 4WK3A 4UY8O 3PM9A 3F0NA 4TU8A 2ZHBA 3DYAB 3FZBA 4X4NA 2FLPA 4B8CA 3K8WA 4LQ9A 1Q5VA 3ED5A 1ZD2P 4NLVA 2XY5A 3GDXA 2F44A 1Q5YA 3HVTB 4DV1F 4NXZA 2OPQA 3TAGA 2Z2ZA 1RB0A 1EXQA 2CYYA 2D0PA 4NMXA 1LWXA 4C6AA 5J2GA 2V69A 3GR0A 3HX9A 3IRWP 3UD4P 3DOLA 3KKSA 5J2FA 1UVNA 1TK5A 1NB7A 3TTCA 3CMEN 4Q8EA 3KG4A 3Q8UA 4AYBF 3NE6A 4YY3K 4OVLA 1IR0A 3MUTP 3Q2TC 2UZAA 5A6WA 3K75D 1P6TA 4MHVA 4QZ9A 4FNIA 3KK3B 1D5AA 4CI0B 1ULRA 2GGPB 1XNRK 1UTAA 1Q8LA 2IOCA 3HYFA 4DR4F 2JVRA 2E1AA 4D3GA 3LALA 4KPYA 2UUBK 4A62A 4DWIA 4KAZA 3MCSA 2R18A 1ITGA 3MC1A 5AZJA 4GXKA 4LRFA 2QA2A 3TAPA 2HOEA 3E01A 1XMBA 3BF3A 1KQKA 2H5EA 5HOOA 1I94K 2ZKTA 4X62F 1FHTA 2WOMA 4Z0UA 4NLBA 1K8KA 2E8OA 4M47A 3VQ6A 4DLEA 3ISND 4ED8A 5BPNA 3D2FA 2DRDA 2V8HA 4LQ3A 4LF4K 2PSZA 3FEYB 4OL8A 1ZRNA 4O5EA 3DFEA 3PIOQ 1HI0P 4TU7A 3VN5A 2P5GA 3KHLA 1ZXOA 3A13A 2J8AA 5L39A 3CEDA 2FE9A 3TANA 2W2NP 4Y2KA 1S97A 1TV6B 2W7OA 1ZQDA 4JKCA 1QUPA 4LD0A 1SJQA 1R6YA 2D6FC 3SYZA 1GTEA 1H74A 3E3XA 2M0GB 2KG5A 3HMJG 3S3NA 3I5CA 4WP9A 2O3DA 1ILYA 4BCAA 1FDBA 2LCWA 2FIUA 4DL7A 4IDKB 3GDQA 1NAQA 1NH8A 4CM0A 1XO1A 3AB2B 1WSRA 1N52B 1D0EA 1HKAA 3MXMA 4F0MA 1Z25A 2ZNYA 2ZTCA 3THPA 5M2PA 4J03A 3ZEUA 1WBBA 5KFNA 4OV6A 4ECQA 4FM2A 5AKIA 3NVKA 3MUVP 4OPHA 2I5JB 4BRCA 2NZCA 2VFTA 4Y2RA 4PKHA 3THYB 4ZN3A 1HUOA 2BH1A 5IIMA 1TQLA 3MEEA 3D3CJ 3QEIA 3GJSB 2LA4A 2CQHA 5KT6A 1NSPA 5J2NA 3WK4A 4CBUA 3OFHA 3Q83A 3BSOA 3D2EA 4A8SA 4QOZB 4DZ6A 2NUHA 2K3IA 2EEYA 1GXTA 1I3OB 5TKYA 5D6GA 4DG1A 3GFXA 3A4TA 3F5TA 2QARA 2OAUA 1TV9A 4X5VA 2FLOA 4DL6A 2B6AB 1TVRA 2MKKA 3GYNA 1YIJN 4IOXA 4P0PB 1BCOA 3D7EO 3TSUA 4FJLA 3ISDA 2PYJA 2WF8A 4F67A 3ZSOA 4O4RA 2C3UA 4XDCA 1EO1A 3BYRA 2H3FA 1LV5A 2CPJA 1FKOB 4F36A 2YKOA 2UXCF 4Q2LA 2ZBQA 2A3ZA 2PMZF 3MMBB 2B4PA 2QXFA 3UQ2A 5FJ4A 3H5UA 4Y2IA 1O1WA 4IQVA 4M0AA 4C11A 3MFIA 4XRHA 5IWAJ 2LPEA 4M8LA 2AYBA 3FZHA 1RABB 4LH4A 5AJ3K 2JFKA 3MGIA 2E5LF 3Q86A 4K5RA 2HOQA 3GFHA 3QX7A 1TKTB 4TQRA 4DMNA 5KFBA 3KWMA 4FWSA 4MF2A 2DPJA 1T02A 2XLKA 1JALA 1NWKA 2D3ZA 1N5QA 1MC8A 3FCVA 3P31A 4UOFA 3KKAA 5TZVA 5AK5A 2KKVA 1VC6A 3IAS9 3LP2B 4YORA 1ZQPA 4C48A 2E1RA 2KV2A 3OYFA 1B99A 1HX1A 4ZITA 3RMBA 3N9UC 2W2QP 3M2VB 4PUOB 9ICLA 3H40A 2I7NA 4WQ5A 5KPTA 3EWGA 4C3KA 3C15A 1JMTA 1D8ZA 3JS6A 3CUNA 3RJKA 1B7YB 1FK9A 4RQ6A 1VS3A 1UW4A 1YI2S 3M8ZA 2PI4A 2J9EA 4UT4A 2O1PA 2HF3A 2F3JA 5M1PA 1N32F 2O8FA 2BVZA 2QFIA 2GQQA 1JLQB 3SAHA 5I3PA 4US8A 5DB7A 5FRNA 3CULA 3WK8A 4QZHA 4GKKF 2EK1A 5MLCV 4YD1A 5EWFA 4LFAJ 1JLEB 3KTQA 3HJVA 1VDVA 3I56N 2O8DA 3DLLQ 5F0XA 1WG1A 2B9EA 1VC5A 1DTQA 5DLFA 1SQGA 3SUOA 2MZ1A 4DCCA 1LEOA 1VFJA 1LWEA 3SAFA 4YMMA 3CFPA 1JMSA 4OIXA 3TUJC 4LIWA 5J8YC 5HJYA 2VWKA 2IFXA 2R2RA 1X4FA 4JI8K 4O44A 1G4CA 1FJEB 1RWVB 4I2AA 2ZG6A 2OKQA 1VQ6N 1X8DA 2MEWA 2KK0A 3RAMA 5HMWA 3WXMB 4C7YA 2DNZA 4EI2A 1I6JA 2IA0A 4DQIA 4CO2A 5FIIA 3D2QA 2PEHA 2YKMB 1C6VA 1SXEA 4USWA 3R1LA 1GMWD 3C5GA 2HBZB 4P72A 1GXUA 1GLFO 5DO2A 4LF5F 3CPEA 3AA5X 1JLCB 4JB8B 2P9PA 1KVCA 4IO9L 1NDLA 1UKUA 2UXDF 4M5KA 4XPEA 3R5JB 2FSNA 3I0RB 1LFPA 3AGRA 4CGFA 2ILZA 2CPDA 1Y3KA 4TN2A 2HBJA 1RT4A 4IG0A 4FXDA 1TL1A 1Y4ZB 1IBLJ 1X42A 3ZZ0A 4DPXA 3P5JA 2HOFA 4NYZA 1JJ4A 3CCQN 2HVHA 4DUZF 3TQ1A 2G08A 1KBRA 4E19A 3SNNA 1TR0A 4DR5J 4Y2CA 2H65B 3U9DA 5H1SQ 4Y1DA 4KB1A 2IC3B 1T9VA 4FO6A 1HHQA 3VCBA 1HNWJ 1U1MA 3ZTOA 2AJ2A 4FE3A 3WKAA 5HBMB 2MRLA 5DJBA 1NJWA 4ZLNA 2OJ3A 4J9OA 1KAXA 3D54A 4URQU 2J6TA 2RJZA 1H3DA 3OT9A 1PO6A 1VGYA 2KSOB 3W5XA 2WAQF 3EKSA 2Q6CA 5A6PA 4Z37A 3I32A 3HBTA 2G2ZA 2OLWA 3DOKB 4X64K 1KTQA 3ICXA 4GO5X 5C12A 1DZ5A 8ICIA 3O44A 1HRHA 3B6BA 4EBEA 2QK9A 4RUAA 2BYCA 5KTQA 2VGMA 4AF1A 4KHYA 1YIJS 3EUB2 4KRWA 4I6MA 4OQJA 1GMWA 3H2LA 3M9MB 1VSKA 2P9EA 2EFVA 4RU9A 2M7SA 4YEAA 1MA7A 4K8RA 3FCHA 3VF0B 2O8EB 1D9FA 2JL9A 3KDNA 2CZ9A 3QZ7A 4JMUA 2XM3A 4CZMA 3GG1A 5DG9A 3EEQA 3I87A 4L3QA 2OTLN 4RW8A 3SFGA 3TTFA 3L4PA 4R65A 4KTWA 1U8WA 4DR7K 1XR7A 4ECYA 1M1GA 4QZVB 2KI2A 3TYTA 4OKKA 1WTFA 4JB3A 3OS2A 1DLOA 2HQCA 3RR8A 1Y5NB 3H42A 3KLGB 1WF2A 1BVSA 1BPZA 1C7YA 3FVYA 1J2VA 1SXDA 1JKHB 1KW4A 4PZVA 2QIFA 2G8HA 3W1YC 4BREA 2EHGA 5ETVA 1G99A 4J37A 3W9IA 2YCHA 3NS7B 2B7CB 4HHJA 4HDHA 2B6GA 4KQZA 4C4TA 1SV5B 5C24B 1WSIA 5CAAA 3V81A 2J7UA 2R7WA 3J7Z5 1TKXA 3J80U 4QYZK 5L38A 4LMZA 3THWB 5C2FA 1QSLA 5K8NA 4BE1A 2MZTA 4FZZA 2QL9B 2P9GA 3FLCO 1H1VA 1YRXA 2DEIA 3ENBA 5IC4B 1IKWB 5FD1A 2ZH2A 4F25A 4C8OA 1RE1B 2ISOA 3AVMA 2GC8A 3MCAB 5BR8J 2NXNA 3DLKB 3TABA 3HWTA 4PGYA 4UY85 4P6QA 4CEAA 1SKUB 3BJYA 2ASMA 4PWWA 2VASA 4L6V3 1LNQA 5HR7A 2OEHA 2MXYA 1ZQQA 3R9LA 5J2IA 1HR0K 1JJCB 1S9GB 3QB0A 1YRUA 2HFUA 4TY8A 3PKMA 4G1IA 1NDKA 4RLEA 2R7TA 3AD9C 3T41A 3I56S 3OSNA 2KVQE 1WDTA 1T9YA 4LF8K 5EXWA 1B9DA 1XERA 1NK0A 2HHPA 4HACA 4QZBA 4BLGA 2E5GA 4NXNF 1N36F 2E8NA 2ZZTA 2L08A 4C80A 2M2BA 4G1QB 3W2VA 2LQ9A 4K4HA 1HW8A 2V50A 2ZBRA 2FJBB 2J6UA 1KD1T 2LM4A 4ZP9A 1VJWA 1PAEX 1VQ6S 4CJ4A 2HZCA 3GTYX 1OSCA 3N7PD 8ICSA 4X4QA 2R2SA 4P2XA 2ROGA 4OZLA 3SDEB 4OJPA 2ASJA 3T1HJ 1TUVA 2FSKA 3KKRA 4LH5A 3U9ZA 4JKGA 2DF4B 2KTQA 3CWJA 3MAAA 1EX8A 2JZBA 5LJWA 5ALXA 3WIUA 4FLZA 1NLKL 5BPMA 3GZ7A 5DRKA 4A4JA 3R5GA 4M5NA 2EK6A 4E1JA 4M3XA 2H3ZA 4AP9A 3SQIA 3MMJA 4DV4K 2IVFB 3CCQS 3MDFA 2J9DE 3VQ5A 2BA9A 4C98A 2V9KA 3OXFA 4NLKA 2D9PA 1FEEA 1OWXA 5ALDA 3ILIA 3WXIA 1Q86T 9RUBA 5IXUA 4RW9A 4WF9Q 5GTIU 4QR0A 2Z1GA 3ZC4A 4XQ8A 3RG6A 1UJ6A 4KHUA 2B5JB 3W3DA 4Z4EA 1T3OA 1YBAA 2MZRA 4ZS6A 1HWKA 3IP0A 4DOCA 2B8PA 1NGFA 1MW7A 1B0XA 2ZM6K 2B4UA 2I2YA 3NAEA 3J7AP 3CP8A 3T69A 3N4QA 3SUNA 4CLLA 4RUHA 1Q18A 1BG3A 3PJ9A 4DUYF 3I0SA 4CO4A 2IDEA 3QLHA 4A8EA 1ZQCA 3L3CA 3KUGA 4FWQA 3ZYYX 4LF7K 3PNIA 2ADBA 3NNAA 5K20B 1YDLA 1FRLA 2M4MA 1N48A 3OXGA 4JI4F 1SL1A 1OUQA 3F5EA 1JLGA 3U1NA 1SJ4P 4FWKA 4IQTA 4F72A 1FVSA 3T9ZA 3A5OC 1I5OB 2IY5B 2OTLS 4W5RA 4H4MA 4XDDA 2I5JA 7ICTA 1X66A 1Q16B 2FD2A 5AM3A 2KO1A 4ANDA 4B3MF 2A1JB 2ZBIA 5KFPA 3C65A 1QY7A 4HKQA 3N5FA 3OA9A 2CJKA 4KC5A 3ZCMA 4TQSA 4BRIA 3QICA 2RQCA 5CD4A 3ETMA 5J2JA 3A8YA 3IWXA 2F8MA 2OEMA 3BH6B 2VF3A 2K06A 3T5JA 4ED2A 2LEAA 4KLQA 4I2CA 1NNDA 2MMYA 2QA4S 5J2DA 1NKCA 3BY5A 2HHHK 1AXQA 3QBXA 5AQTA 4YFUA 4KITB 1D3WA 1RA7A 4QPXA 4KIAA 1N56A 2CN1A 2HS4A 4R25A 2KHCA 2AV5A 3A8JA 5IT0A 2YY3A 3Q7BA 4Y1CA 2Z7JA 1BPBA 2X3GA 2MYFA 1RBSA 2RN2A 2WFBA 4CJ3A 3CB4A 4OX9F 3OV7A 3IDWA 4P7VA 3M7VA 4DPOA 1DGJA 1TYQB 4TURA 4MFFA 3SD7A 1JNZB 3SQOP 4H0VB 2MZJA 4WJ3B 9ICCA 4KLLA 1V9OA 3HX0A 1EQ0A 3OYMA 4J9SA 2LU2A 5CXTA 2EFNA 4FWPA 2XMJA 1I3AA 2DGQA 5AKJA 2FJVA 2Y8YA 2MQLA 2ASYA 5GIOA 1C0TA 4JI0J 2DNPA 2YPYA 2NCKL 2EC0A 4M9LA 4Z4CA 3E8OA 2UUAK 2Y1RI 2JRSA 2J0WA 2DHAA 1ZJMA 4USUA 5CHCB 2GV1A 1VC0A 3N6MA 4GV3A 3RJGA 1N0UA 2Q79A 3NGYA 4LY7A 4KGMA 2BUPA 1ECWA 3H0PA 2JH3A 3PKYA 4RBTA 4X4RA 1ATNA 3NRWA 1MLAA 3VWSA 3SJHA 1KONA 3EYZA 1YJNN 2HSTA 5HP1B 4PL2A 2HCFA 3B4DA 2CPZA 2DVIA 1G3OA 3RJHA 3VAFA 3HL8A 1ZAXA 4Q43A 1JXEA 3M6VA 1HUXA 2UVVA 1N4LA 1RKJA 3A0IX 5FDLB 4ZVRB 1U6ZA 3SUQA 1YGYA 2HFZA 5CQGA 5AQLA 2B4OA 2IHMA 1N34J 3ENVA 2Q0UA 4ISEA 2VPYB 3MMCA 1S59A 3QRPA 1BLUA 4W92B 1HMVA 4AL6A 2BANB 5J0OA 3MK6A 3MPVA 2IYGA 4BUGA 3TUZC 4K4VA 3TZYA 3JXUA 2BGGA 4USHA 1UAWA 3MM6B 1TFWA 3QQCD 3EPIA 1I1GA 2VQFF 1U48A 2CPXA 4B9NA 5KFVA 4JI6K 1F44A 2QWQA 3N7RC 1WNSA 5J0TA 5F8LA 4HH1A 4DR3F 3JPQA 1GLAG 5KGXA 1NJZA 2V8VA 4J91A 3ADAC 3KNGA 4CLSA 4PXDA 2DGSA 3KHYA 1RDWX 1NK7A 2K60A 2OELA 4A59A 2I1RA 5HVHA 2PO4A 2GJFA 4NLXA 1ZPWX 2LQ8A 3G10A 3W2WA 1VK8A 3DDKA 5IV3A 1X0FA 4BR5A 3OR1A 1UJ4A 2HI0A 4ICLA 2XVTA 4FYDA 4DCHA 4GV6A 2LSNA 3WUHA 1U2VB 1Q1KA 4R5PA 1T7PA 1O13A 1Q7LB 1X4EA 2KXNB 2DNYA 2JX2A 3FMBA 5GAEP 2C3OA 2V2ZA 5I42B 4UARA 4FLWA 2CQGA 1G2EA 4OKJA 4IH6A 4FPIA 3NL0A 2YX1A 3LQVA 3C28A 5L1IA 1H0HB 2I6WA 2VICA 2FHKA 4HR2A 3NXZA 4DOBA 3OY9A 2FZGB 1KLMA 4OZ5A 1PIEA 1JLCA 1ZQLA 2N7CA 4CEOA 4C8MA 4AHUA 3A0HU 1X7VA 3RJFA 4CIFA 3AA9A 4F92B 5A0LA 5H2FU 1RBOB 4E1NA 1RDAA 2W04A 9ICGA 3JPTA 3C6UA 1HQUB 4RQ7A 4DTOA 3E58A 4RT3A 2G07A 2B0CA 5DG7A 3F2CA 5RUBA 2QMUB 2GWKA 1GFWB 4BGBA 1FRKA 4HUEA 3I8DA 4EBCA 5KFKA 4DX6A 2EBEA 2ZXIA 3HPGA 3JPRA 3NH1A 1HKBA 1CJKB 3KJFB 3IWNC 4ILGB 3PUFA 3C6TA 3V9ZA 9ICHA 2VOPA 2IVMA 3PY8A 3EE3A 4BG8A 2ATCB 5I3UB 4C97A 4LFCJ 3B4MA 5A0YB 4PGQA 2DHHA 3T9NA 4CZCA 5KAKA 5KFTA 2Q66A 3GIRA 5E26A 3C2KA 3CYMA 1NM2A 5J2PA 1OH7A 3K8VA 1NZPA 4ICAA 4RUBA 1WC6A 1KDHA 1RHJB 3QGHA 1GLDG 1RQ0A 3AVGA 2K8GA 1JXLA 7ICMA 4H0PA 3VF6A 2A1RA 2BTFA 1IKXA 2AYEA 1B3TA 3BQTA 2DQNB 3NRZA 4AM7A 2XULA 1RM6C 4NXMJ 4X2BA 2DHSA 2CNOB 2V7ZA 1AFIA 4JI7F 5CHIA 3EDQB 5EY4A 1WSGA 5A2QO 5KFJA 4ZDNA 2FHMA 1LQ9A 4CK3A 1SC3B 1EZZB 5DQGA 2ZUBA 5F9LA 5HLFB 4JEPA 4DPTA 2H5XA 1F5AA 5BXIA 3V1QA 3T5HA 4QYRA 2IHR1 4I2IA 3GL1A 1ZXIA 5CRXA 3PEHA 5AQPA 5GADP 2AZ3A 3DRSB 2W3RA 3W61A 4JK9A 3CJ5A 2QA4G 1RDUA 3GR1A 2VA8A 2LXUA 1M90O 1FDAA 3AJ1A 3NVZA 1X9MA 2VBYA 4CE6A 2F2AB 4MFBB 4KH1B 1M5SA 2XWXA 3HP6A 3VV2B 5D46A 5AKKA 2OP5A 4U8YA 5F8MA 3MWPA 2R9LA 5FLXO 1OIAA 2YTCA 2F1IA 3EMTA 1DRGA 3RR7A 4LR7A 1YVUA 3SSQA 3THXB 4RZRA 1N5XA 3AJ2A 3TKAA 1ZM3A 2Z0GA 3I96A 5H9FJ 3SQ2A 2ES6A 4UAWA 1ZETA 3VR1A 4RW6B 1YJNS 2MGZB 3DNCA 5IINA 9ICIA 2LU1A 1NOZA 3K5PA 1LB2B 2DNHA 4CF8A 1E6VA 5KFRA 1B43A 5A8WB 2JEFA 1XNRF 2W4DA 8ICRA 4YR3A 2ZJAA 3S8SA 1VHIA 3O3LA 1QZ6A 2UUBF 1AQ6A 2JH1A 3T5LA 2KHVA 3QGIA 2FQQB 2FYXA 2GWSA 3LDAA 3DLGA 2F8TA 1NDCA 1RXVA 4PHTX 4LF2A 3O9TA 3IWLA 2AZ1A 4KH6A 3ID6A 1I94F 2GAGC 3GBTA 4LJXA 2XMTA 4CGIA 1ZTWA 3M2UB 4DSEA 1HJPA 1T8EA 3G8TA 2F1JA 3GCXP 4LF4F 1BPDA 4WIQA 3U4LA 1RI7A 1X60A 2E1YA 1VQMN 1Y7PA 4I7FB 1K0TA 5AI4A 1HLUA 3TOQA 2JWNA 4KN4A 3MBYA 2CKWA 1RWKB 4FKYA 4OHZA 4CEQA 2ZWHA 2FJ6A 5IWAK 2R7XA 2WHOA 2W8KA 3D1OA 1V5IB 2YWEA 3VQQA 4DV3J 5KFXA 3MDQA 3H7HB 1OH6A 2KN7A 2HFNA 4F8RA 2XS7A 4C1NI 4UAUA 4RW7A 4WYLA 3NS1A 1LCUA 4CE9A 4B1WB 3QETA 3Q8KA 4ECTA 4FP9A 4Y0FA 4BRHA 1KRPA 1BOTO 3AL0B 2RE2A 2JH7A 3LDSA 2VG6A 1J5OB 4FW2A 3HDSA 1SZ2A 3BQ1A 4ZVPB 1E3MA 3I9ZA 2ZJPL 3P4IA 3ULEA 3UCZP 1Q9XA 2I1QA 4DOAA 4CZJA 2YNHB 1HNIB 3UFCX 3O0FA 1ZYQA 1MQ2A 3DRYA 1QQCA 4DL3A 3ZSXA 3NY0A 3DDHA 1ZQZA 4O3OA 4ZH4A 2PAVA 4FVUA 4URGA 4QZIA 2ZE2B 3HRDD 3W63A 1QVGM 4FWRA 1ASWA 4CTAB 1T4GA 1PVPA 1HYVA 5AQVA 3K58A 3K17A 4EENA 2DTUA 1T05A 3AA4A 1JLBB 1LW0B 2ZH3A 4FWOA 2FC8A 4C3LA 3OHBA 1UA0A 4AL5A 2CWKA 1R8AA 3KJVB 2NXJA 2XI2A 4DV0J 4IR9A 2RDJA 3RSEA 5B09A 3NRBA 9ICPA 2EWHA 4R79A 3ILLA 1HKGA 3RH5A 3ISCA 4B1VA 2XHCA 3Q24A 2W9AA 1Z00A 4OYBA 4NYNA 2K7JA 2EKNA 5JS2A 4LFAK 3L6QA 4Q7AA 3EVMA 4RWWA 4KHRA 4PL8A 5AKHA 2AX0A 4LF6J 2JZ5A 4YDUC 4HLBA 1VR6A 1ZQYA 2JLGA 1NKBA 1Z6RA 3QO9A 2P8IA 5KFCA 2X1GA 3P45B 3NF7A 3W0LA 2KHQA 4P2SA 3HF5A 2J7KA 4GLXA 4FF2A 4B02A 5AJ3F 2G2OA 3G87A 1RDBA 2P6UA 5ALTA 3TFRA 2LYVA 3FBBA 3CETA 1B92A 1HBUA 4AHSA 5HATA 1CC8A 1ZZFA 2HIQA 3MMVA 2Y0BB 1OMSA 3DC2A 4OX6A 4EHUA 1VQ8N 2WONA 7ICLA 4CFDA 3TA2A 5HL7L 4DQSA 4Z6FA 3QNMA 1CJUB 2VC0A 3T1YJ 2V7YA 1V3RA 1HBMA 1HWUA 1MG7A 2IMOA 4B3OA 3F73A 2DIVA 3CD0A 1IXRA 4OPAA 1X5SA 5D0RA 4RQ4A 3RB3A 1IBLK 4FXWA 1F2HA 5DB6A 1UZHA 4CECA 1ZQEA 1WWUA 4IEIA 2BJ1A 3BQ2A 4K43A 3B0YA 4QAGA 2L3MA 4MEXA 3ET6B 1ZQGA 4DR5K 3G86A 3CXCR 2DO4A 3HCXA 3E9PA 1I39A 1B0VA 4Y65A 3E51A 2L41A 7ICPA 4CLYA 3GWCA 1NGEA 2PXIA 4TYBA 1HNWK 2QA1A 1P1LA 4H0XB 4DOZA 2MJNA 1C1BB 3UCGA 2MTLA 1RLCL 3DXMA 1GTHA 3M6WA 8AT1B 4IO9Q 2D1CA 1S1UA 4KHWA 3DJCA 2YNGB 4E7LA 4I2BA 2DGOA 5GVQA 1DT9A 2CJXB 4KYZA 2CGLA 2HAFA 2L9WA 4J9MA 1VLOA 1S1XB 3DI6B 2DFEA 4YB7A 3KLEB 1VQPN 2HLTA 4BRLA 1BQMA 4EEYA 4O4GB 2FF3B 4WTYA 2FGCA 5IFMA 2UUWA 4NI2A 2DK2A 1YF5L 1Z26A 2FJAB 3PEJA 4JV5J 4GVMA 3JQKA 1Q81O 3TUPA 1M0SA 3ZD8A 4CEBA 4F04B 3BF1A 3IV6A 4QZDA 3C14B 4YDXA 4KHPJ 2UVWA 4JI8F 1DTTB 1HEKA 1PC5A 5J1EB 1AROP 1VSDA 4A2BA 4JK7A 3AQEA 2HHQA 3CJ2A 2A42A 3M1FA 3CM5A 1SZHA 3GZFA 1ZQBA 1TMMA 1RJJA 4CNYA 3QEPA 2GX8A 3MM7B 3WNGA 2V4QA 3C5FA 5HMMA 2R3VA 1CPZA 3B82A 4CT9A 4UB3A 4DUTA 5DM7L 9ICVA 1L8LA 3P49B 5ELZA 1ASVA 5HP1A 1RBVA 1V6HA 3H0MB 1COKA 2JMGA 4H5VA 4IJNA 2WW8A 3CC2N 3C8YA 5HMXA 1T9TA 5CH7B 5AQMA 1FRMA 3TEGA 3P8BB 2W2PP 1RAFB 4H5NA 5LJVA 2E1MC 3OD2A 2VA2A 1HL6A 4WE1B 3H90A 1ZBLA 4ZLJA 1R59O 4CCHA 4DV7J 1N0VC 2ZZNA 7ICGA 3AQOA 3SQ4A 2FLLA 1WORA 3QIPA 3J81O 1D9AA 3MM6A 4YN4A 3LPUA 1HW9A 3K0SA 3CCJN 4NOHA 2F3NA 2VG5B 5DDRC 1DRZA 4KREA 3CJ1A 1URJA 3LGMA 3TADC 4BVOA 2O6KA 1U7LA 2HBQB 1SH3A 3AO2A 3NWRA 3M6ZA 2KJWA 4WJBA 5ALJA 4Y00A 5BR8K 4LR9A 1PVRA 5GAHI 4CZIA 2OTJN 4X64F 1AUDA 3EVWA 2CAJA 1MA9B 2Q6BA 3IS9A 1NJIO 3VEYA 1HQ2A 4OJHA 3ZZZA 5EOYA 4O0NA 1FTRA 3OYJA 1U2VA 2YPZA 1HPMA 2GMHA 5GAEU 2PIIA 1XMOF 3PO5A 4USIA 2IDOA 5J0YA 1ZM4A 1LWCA 2IM3A 5EX3A 3ZT1A 4H8KA 2PT0A 2QB0B 1Q8BA 2U2FA 3R97A 2CG8A 1UVMA 3A0BU 4PL7A 4OYXA 1OY8A 2VL1A 4KLDA 1NK4A 3DLRA 4E7IA 4BRQA 2ZXHA 4F5PA 4DV6J 3QJPA 2BE2A 4C0ZA 4DR7F 3RJIA 4OZJA 2MU2A 3VVUA 3P39A 3M6GA 3AN1A 2OPPA 5DGBA 4ECSA 1S1WA 4MIAA 3C16B 3S9HA 5K14A 3LZIA 3T1HK 4ALZA 4M5LA 2FJDB 3VTHA 1VQ8S 3X1LB 4Y0WA 4QU6A 1AW0A 1CVJA 4ISGA 2VPWB 1FDNA 3JSMB 2APOA 4DN0A 4AD6A 4Y2YA 3LGHA 2P9KA 3HI0A 2ZUAA 4C7ZA 1XQIA 1J9AA 3KWGA 5AQUA 1DURA 4PPXA 3ZZUA 4IH7A 4BGAA 1IWGA 1JNRB 5I3UA 4PPZA 3AAQA 4EO6A 3AJDA 2E2QA 3O6QA 4U96A 1C0FA 1FTCA 2Z2YB 1XR5A 1V85A 3UMGA 2PC6A 3MEDA 3W8PA 3BBFA 4DXLA 1RAGB 4CD1A 1LOUA 4OHWA 3OYKA 2P9NB 3IP4B 1T3QA 2FJXA 2N3LA 3G82A 4CLUA 1W9HA 4DU3A 4MO4A 1WKKA 1FX4A 2HMXA 5HK4A 2AGPA 4B6JA 3BR8A 1VQLS 3SUPA 1PGZA 3GFKB 4I6YA 4N7TA 4YY3J 2C2OB 2JEJA 1S5JA 3QDKA 2P9LA 4N56A 4ED3A 2MJUA 2IOFA 3V7JA 4WYWA 3H25A 1HR0F 4J2DA 1V4TA 3CXCM 1S4FA 4AM6A 3MM8B 4YQWA 3TAMB 5AQYA 5ETQA 1WYGA 3MAQA 3VEVA 2BHNA 1SQKA 4P75A 1VSMA 1VQPS 4LF8F 3SBGA 3KBBA 1VQSA 9ICMA 1CZAN 3DRSA 2VWBA 3LDQA 4C1NK 4F3OA 4X4VA 3NLCA 5HMYA 3RFAA 3V1OA 4LZDA 2WSCC 4ZHRA 1R0BG 3D28A 5KFOA 1R31A 2HBYB 3AVHA 4RPYA 4MFBA 3H59<