4DSFA

Ternary complex of bacillus dna polymerase i large fragment f710y, dna duplex, and rctp (paired with dg of template) in presence of mn2+
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
580
structure length
546
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRNYGGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase
publication title Structural factors that determine selectivity of a high fidelity DNA polymerase for deoxy-, dideoxy-, and ribonucleotides.
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
total genus 188
structure length 546
sequence length 580
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4dsfA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4dsfA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dsfA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4dsfA01
5HROA 2VA3A 3KK2A 3SPZA 4CF9A 4KLDA 3AA5X 2DFLA 1HUOA 3DI6A 3HVTA 1UA1A 5FRMA 4KKOA 4OJRA 3H08A 5KGXA 4Z4GA 5L1LA 1X9MA 2BCSA 4HCCA 1C1CA 3Q8SB 4R8UA 3RWUA 4CJLA 3HL8A 1CEZA 1HNVA 4FVMA 4W5QA 1IKVA 1QSLA 4CJEA 4F4KA 4GXKA 4DL6A 4QWBA 3SQ0A 5SWMA 5HP4A 3C6UA 5EWGA 1WSFA 4CHOA 4QZBA 2G8HA 3AVMA 1A5XA 3O3HA 3Q8LA 3OYDA 4DFKA 1DLOA 5L9XA 4IDKA 4B9UA 3V9ZA 3CYMA 4I2EA 2FLNA 4C8LA 3BDPA 2ZTEA 2KZMA 4NYFA 3V1RA 4CK1A 1UWBA 4PA1A 4YCXA 3MEDA 3MDCA 4DO9A 2NRXA 1SKSA 3K57A 4KLFA 5KFIA 2ASJA 3C5GA 4FJLA 2Z1GA 2R7YA 4RZRA 1A77A 1T8EA 1TKXA 4W5NA 4QZEA 1ZQHA 8ICPA 4DU1A 3PX6A 3LP2A 4BE0A 4DSJA 3U3YA 3TFRA 4NCAA 4RQ8A 4ED8A 5DDYA 3TABA 2YHBA 3L3VA 3SZ2A 1TL1A 4B8AB 8ICTA 5HRSA 5DKWA 2ETJA 4CJQA 5KT3A 1BGXT 4LZGA 4M45A 3QEIA 1RT3A 4P4PA 3L2QA 4FLZA 2QK9A 3PX0A 4LSLA 4FM1A 9ICJA 5KFCA 4N56A 4QZAA 1L3VA 3SV3A 1CZBA 3AU2A 3MXJA 4KITB 1C0TA 1EXNA 3ZDAA 9ICGA 4J9RA 5CP2A 4RQ7A 1VSJA 4FZZA 4FJKA 1BQNA 3V4IA 3TANA 4I2GA 4EBDA 9ICIA 5KFKA 7ICIA 4KB0A 4K4HA 3MR5A 4DTOA 3HVRA 4Q43A 3I0RA 4QZHA 3RR8A 2X6SA 3MXIA 1UAXA 3HX0A 4F5OA 4KO0A 5KFOA 1ZQUA 1S1UA 4I2IA 7ICRA 3PO5A 2D5RA 1NJXA 1IKWA 5BOLA 4F2SA 3OS1A 2LYHA 5KFXA 2F1JA 4IG3A 4J9KA 4IQWA 5KI6A 1CUKA 2WOMA 1QQCA 4E7IA 2NRZA 1HUZA 8ICXA 4FJXA 4Z6CA 1SL1A 4O55A 4O9MA 3AA3A 5SZTA 3AVHA 4R5PA 4CJFA 4M47A 1C7YA 4BDZA 5J2QA 1SKWA 1WCNA 4PGYA 4M41A 4CGGA 5DG7A 3HT3A 1JLBA 4MF2A 3LWLA 1NKBA 1QSSA 3JPPA 4UB5A 1SL0A 3KIOA 4LY7A 3QEXA 5D3GA 4CHNA 5CHGA 4AHTA 4J2DA 2I9GA 2FPKA 3FDSA 4FJ9A 4CEAA 7ICLA 3AVCA 5CY4A 3TR8A 4E7LA 4NLGA 1QE1A 4I28A 2DTUA 3ZSZA 2KFZA 1EETA 3TAGA 4RUCA 4P2HA 1C1BA 3HM9A 2W9BB 4DL7A 2B4JA 1NKCA 2QXFA 2KFNA 2VA2A 2G8IA 2G8UA 2Z1JA 3S3NA 3L8BA 1VSDA 4MEYA 2YHAA 3HP6A 4W5OA 7ICFA 4J9MA 1Z25A 4F8RA 3KJVA 3OYIA 3SJJA 2R8HA 3SUQA 2EHGA 4ECZA 1U49A 4F4YA 4IKFA 2YNFA 3PO4A 3LANA 4DFMA 4I9QA 1RBUA 4FK0A 3JPNA 1TVRA 1VK0A 3AVLA 2VG5A 5KFJA 3IS9A 3Q8PB 4GLXA 1V9PA 4EYIB 4F3OA 4HVJA 3HW8A 1LWFA 1LWCA 3SQ4A 5CZ2A 2YNIA 4OGEA 4ECTA 3V7LA 4M6WA 5TZVA 4B3OA 1WAJA 3PNCA 4BXOB 1EP4A 4CF8A 3LP1A 1MC8A 4F50A 4M2YA 3S3MA 3K59A 4TUPA 2IMWP 3LP3A 5C24A 3RAQA 2RKIA 3BQ1A 3DMJA 2UVVA 3VQBA 2P1JA 4YG2A 1IM4A 3MEEA 4RQ3A 3M9MB 4DL3A 3NTUA 2RN2A 3HPGA 4YR3A 3CQ8A 5J0XA 4Z6FA 5J0WA 4YMOA 7ICQA 3QZ8A 1XU4A 3KHLA 4KHNA 1JLEA 4UBBA 4RQ5A 1D8YA 3V6DA 4UAWA 2AQ4A 2OYQA 4AHUA 3TAMA 4HCBA 3ZDCA 4K4GA 1NOYA 4CFCA 4I2DA 5CB1A 3LWMA 5KFYA 2PYJA 2V4QA 1UT8A 3RBEA 4CERA 3RJGA 3OYGA 2E4LA 4XRHA 2IOCA 1KEJA 1RT5A 3BQTA 3ZT4A 3H40A 4I2AA 3ZSWA 1NK9A 4DLGA 4CGJA 2GWSA 3D0PA 3VQCA 4KLHA 1L3SA 1ZQCA 3KLEA 3HP9A 3UXOA 2PFQA 4JWMA 4I2BA 1ZQIA 4Y1DA 1S1XA 3ZSQA 3ZT0A 1KRPA 1WSJA 2DFFA 3U3GA 3RB6A 8ICUA 3C5FA 8ICJA 1VSKA 1BCOA 3ITHA 1T4GA 2ZUDA 3MGIA 3Q8RB 3HYFA 4Z4FA 2DPIA 1NK4A 4O5CA 1CXQA 3PMNA 3DLEA 5KG6A 3WNEA 3C2MA 4F5PA 2P66A 3S9HA 2R8IA 4ED0A 3M8RA 1JLCA 4NLNA 1WCLA 1SUQA 7ICVA 2G8KA 4DL4A 5C42A 3ZDDA 4LVSA 3EPIA 4OVLA 4FW1A 4ID5A 1RBTA 3T5HA 4E1NA 3QE9Y 3MR3A 3H8SA 2VG6A 3HXMA 2HHXA 4YNQA 2GUIA 4FJHA 4RU9A 2W8LA 3V9UA 4ED3A 5KFSA 3DM2A 3EW9A 5J0PA 2P6RA 5J2FA 3DRPA 1ZQBA 2XY6A 1N48A 2XY8A 1LB2B 1W9HA 4RNMA 1TGOA 4M3XA 5KFLA 4DFPA 4G1QA 4CEQA 3JPRA 1VSEA 4DTJA 4KRFA 3QIPA 1J54A 4E89A 4EBCA 4DSLA 3HSTB 4KPYA 4KI6A 1HNIA 4UAYA 2MAXA 3H8WA 2YV0X 5EWEA 1HQUA 3C2KA 1R0AA 5FDLA 1BPEA 1S1TA 3JYTA 2VA8A 3ORYA 1S97A 4FO6A 1S0NA 1ZQXA 2IGIA 4O44A 2IDOA 4PHDA 3EPGA 4DL5A 4LSNA 4K4IA 3ZCMA 2HHWA 9ICOA 1T7PA 2FBTA 3MBYA 3V9WA 3DRSA 8ICBA 1S0MA 3M8SA 8ICGA 3RB3A 4DSIA 4QZDA 3WNFA 3ISBA 3V6KA 2D0CA 3GDXA 3AVNA 2F1IA 4KTWA 3RTVA 1ZBLA 4F4XA 1JL1A 3Q8KA 5J2GA 2QKKA 1C1AA 4UQGA 3THVA 3GIJA 4CJPA 3ULDA 5CR0A 1XSNA 1VSFA 5DGBA 3LPUA 4Z0UA 4CESA 1B43A 2FMQA 1TVAA 4FLTA 4Q8FA 4KTZA 4JK1A 1JN3A 1ZQMA 4RW9A 1IKYA 4IRDA 4KHSA 2BCQA 4FZYA 4J9PA 1SKRA 3CFPA 1D9FA 3ZT2A 2W9CB 3MABA 3V72A 3RJEA 4DS5A 4RQ1A 2KN7A 5J2JA 4FLYA 3DOLA 1LW2A 3LAMA 2X6NA 2NUBA 4MFAA 5HRPA 2I1QA 3GV5B 3KTQA 4QAGA 2G8VA 4I2HA 2BPCA 3VQ9A 4JS5A 3NF8A 2DFEA 4PHPA 2ZJAA 5J2MA 4UB1A 2IBKA 5J2KA 3KK1A 4N5SA 1S76D 3V6HA 3VA0A 3RH5A 4RT2A 3GFKB 3RJIA 1RCHA 5IIJA 1NK8A 3FYHA 1RT1A 3OYAA 5IINA 4DF4A 5J2HA 4J9OA 4YP3A 1D8LA 1REVA 2XCPA 4PQUA 4NYNA 3G10A 3N97B 4HUGA 9ICKA 2A1JA 3ZDEA 5DBAA 2ZQBA 4CJTA 3PW2A 4F5RA 5KG5A 1KFTA 2OPSA 1QHTA 1RT7A 2JZBB 4RQ6A 1NK5A 5DLFA 1JXEA 3PR4A 9ICHA 4R65A 3P83D 1BQMA 5C5JA 5KT7A 9ICVA 3H8JA 2C2EA 8ICLA 1S9EA 1YTUA 3U6FA 5DG9A 2B6AA 1ASVA 1S6PA 4GW6A 2P5GA 2F96A 3MAQA 1HYSA 4OKKA 5DBCA 4RPXA 4OKJA 4BE2A 1ZBIA 4QZ8A 2W8KA 2W9BA 3KKRA 4ID1A 3T5KA 2KZ3A 3P5JA 1ZQFA 3AVAA 3AVGA 3DLGA 1HQEA 4DSKA 3AO5A 3ZSYA 5CWRA 1S5JA 4CJRA 3O3FA 1WSHA 4M9GA 4FK4A 4QCLA 1X2IA 1J5OA 1RXWA 7ICGA 4FW2A 4MFCA 4NM1A 4O5BA 3OJUA 4R66A 4CIEA 4NXZA 4DQRA 9ICNA 3PV8A 1TV6A 4JUZA 2OPPA 5KG2A 3T5LA 3RB4A 8ICAA 3NH0A 5J0YA 3NGYA 5IILA 3K75D 3BQ0A 3OSNA 1XC9A 3EWAA 1ZQVA 2ALZA 3C95A 4HYKA 2ZD1A 3RJHA 5J2BA 1BPXA 3IAYA 4ZHRA 3SPYA 2HVHA 4M3WA 2BANA 2HNYA 4CF2A 1HJRA 4PGXA 3V7KA 4CF1A 2I5JA 4BXOA 3UPQA 2W42A 3KLGA 1BPDA 1U47A 9ICMA 4DEZA 4KLUA 1RTIA 3TI0A 3L3UA 4XIUA 4FBUA 2GV9A 4E7JA 4CK2A 2JGUA 1D9DA 4TSXA 1XS9D 4H8KA 3OYCA 4CGDA 1YTAA 3LDAA 3KLHA 3E01A 4CJKA 3UXNA 4PUOA 5KFEA 4KHYA 3AA2A 1HJPA 3OYHA 5I42A 4EP4A 5E41A 1RTJA 8ICOA 3QETA 4M04A 1JMSA 4JV1A 5KG3A 3AVIA 2JLEA 4ECRA 1KVCA 3RMCA 2OA8A 4AH9A 3RJJA 3NF7A 3OYEA 3VQ6A 1A76A 1WLJA 3PW5A 1QTMA 4EZ6A 2Z1HA 3T1AA 3OYBA 2ZE2A 4YFKA 1S0OA 4M9NA 2PZSA 2BCUA 1K1QA 1PZNA 4DQPA 4IR9A 1U04A 4MF8A 3TQ1A 1I3AA 3NDKA 4ZTJA 4FK2A 5KFUA 3O4NA 3IHQB 3VQ4A 2IAJA 1RTHA 3M9OB 4ECUA 3LK9A 4FJIA 2H5XA 3RJFA 3ASMA 4IG0A 7ICMA 3QEVA 2XO7A 2Y1IA 2BR0A 4QWAA 7ICHA 1A5WA 4QZ9A 2YKNA 3AVKA 3MEGA 3QEPA 8ICEA 2DY4A 1O1WA 3CFOA 1S9FA 9ICTA 1X9WA 1AROP 3BJYA 4XA5A 2R8JA 2AGPA 3VQ5A 3PW7A 3TAQA 5D49A 5HHIA 1HRHA 2X78A 3ZSVA 3QNNA 3JPOA 3VN5A 2XY5A 1IG9A 1Y88A 1EX4A 5I3UA 5JS2A 2J6UA 1T03A 4J2BA 4CFAA 4M3UA 4NY8A 1L3UA 1ZQEA 1ZQZA 1TK0A 4FLUA 4B8CA 4XUSA 2JEJA 3V6JA 2FLPA 2VANA 4Q0BA 3ZD8A 3GQCA 1NK0A 4BGDA 5J2NA 2M9NA 4UB4A 3RMAA 3AO1A 3UXPA 4RW7A 4ZTFA 4BWMA 5KG7A 5L1IA 1S6QA 4N47A 4RUAA 1RT4A 2V9WA 1VSMA 3PY8A 4MFBA 4DTSA 5EWFA 4EBEA 5L1KA 4FJ7A 2BCVA 3HJFA 2Z1IA 4CHPA 4KHWA 2BPGA 1FXXA 2AGOA 4O4GA 4HHTA 1N6QA 9ICLA 8ICNA 2ITGA 3LAKA 4UB2A 3C23A 3I0SA 3OJSA 3RJKA 4EEYA 1RNHA 1LW0A 1KVAA 1XHZA 8ICYA 1LWEA 4Z6DA 3ZSOA 4PHAA 4KHQA 2EX3A 4KLOA 1JLQA 3KKSA 4M9HA 3WNHA 4C8OA 5DMRA 1BI4A 9ICCA 3QO9A 3E2EA 1T3NA 4B9LA 4JLHA 4B9SA 1WAFA 4E0DA 5KG1A 4YD1A 3RB0A 4YD2A 5J2AA 4KLSA 3QEWA 1IXRA 4KLIA 1BL3A 1GOBA 4I2PA 3MGHA 1Q8IA 3OYFA 4M3RA 5HRRA 3TWHA 5HRNA 4TQSA 2VWKA 1RDAA 4TURA 1GOCA 2FBXA 3C1YA 1XI1A 4Z4HA 1HYVA 5J2DA 1B22A 3C6TA 4RW4A 1GOAA 1JX4A 4H4MA 5KFNA 2RDIA 3NF6A 4OGCA 4KHUA 2RF2A 5BPCA 2W9CA 2ASLA 3LALA 3Q8MA 4YMNA 2AJQA 4OPKA 4O3NA 3QEAZ 4E7KA 3GIMA 2KQ2A 3N4MB 4FBTA 4Q44A 3K2PA 5IIKA 4ECYA 5FRNA 3MDAA 4B9VA 2KTQA 2BKEA 2JEFA 3GILA 3H4BA 4AHCA 4ED7A 4IFYA 2PYLA 2OWOA 4NCBA 3QIOA 4CFDA 3EY1A 2BQ3A 4B9TA 3OYMA 3UIQA 2BGWA 1CZ9A 2OPQA 4CF0A 4FCYA 2BE2A 3GV7B 1WSEA 4ZH4A 3RRHA 3PMLA 1NK6A 3JPSA 1G15A 3M9NB 1H38A 1IKXA 5DQHA 4FLWA 3DLKA 1DTQA 1UT5A 3PW4A 4O3QA 2BCRA 3ZDBA 5KFWA 5KFVA 1SL2A 2RDJA 1SZPA 4CHQA 5KT2A 2D0AA 2IHNA 3QESA 3OYNA 4KLMA 1KFDA 3RAXA 2IC3A 3NGZA 8ICQA 4DMNA 2YNGA 4M9LA 4FJMA 3KLFA 2JZBA 3LPTA 2ZUBA 3ISDA 4FM0A 1LV5A 3SI6A 4CJSA 4ED2A 5J1EA 3SUOA 3EYZA 4ICLA 4DG1A 9ICWA 4RNOA 4I2FA 2J6TA 2KZZA 1B92A 3LZIA 4JS4A 1RXVA 4IQUA 2C28A 4CCHA 2FBYA 4DQSA 5KRTA 1RDDA 4YXJA 2X74A 1BPBA 1TFRA 3B0YA 1BHLA 1A5VA 3LP0A 1N56A 4Z6EA 4FJ8A 1ZQPA 2FMPA 3SQ1A 4C8MA 2OPRA 1VRUA 3FFIA 3MECA 1ZBFA 9ICQA 4LD0A 1YVUA 4CJWA 4C8NA 4Z4EA 4IQTA 1WN7A 3DRRA 8ICVA 1UOCA 4DU4A 3KHHA 5KFTA 5DQIA 4PWDA 5DQGA 1BVSA 7ICEA 1C0UA 5KGWA 4XQ8A 4FS1A 4EP5A 2ATQA 4YVZA 1RPLA 4LZDA 7ICJA 3PX4A 3GIIA 4F92B 4O3PA 3S3OA 1K6YA 1JIHA 4GC7A 3ETLA 1XHXA 3TAEA 1EKEA 1QLNA 2D0BA 5KFAA 3KLIA 1ZBUA 4PPXA 7ICPA 1TKZA 4JRQA 9ICEA 2F1HA 4QWDA 1TL3A 3AV9A 1X1PA 2PFNA 4DU3A 4TQRA 2ATLA 4CIFA 4M3YA 2HHVA 4FLXA 5HNKA 1RZTA 4WE1A 1KLMA 4JRPA 4FJNA 4F5QA 4Q45A 3TAFA 4OPJA 4QWCA 4KMUA 3P1GA 1KFSA 4R63A 1N5YA 5CZ1A 9ICBA 3H7IA 2G8WA 1CXUA 3AO3A 4TUQA 3AVFA 2BQUA 4J9QA 4W5RA 4EZ9A 3IG1A 3AA4A 5KFDA 2NRWA 4DL2A 3RBDA 1HPZA 5KFBA 3NHGA 3G6VA 4CK3A 3SNNA 5CYMA 4I7FA 1S0VA 1NK7A 2W9AA 1J53A 4DFJA 4NLZA 1S10A 2E6MA 4QW8A 4AILC 3VQQA 1I39A 2BGGA 4KLQA 3EZ5A 2PFPA 3CM6A 5FROA 4R64A 5HP1A 4J9LA 1L5UA 4FM2A 4NM2A 2G8FA 1TKDA 3MXMA 2PY5A 4YR0A 4Q5VA 1KVBA 3RMBA 3JSMA 3OVNA 4RNNA 1RBSA 4QZGA 4CJVA 3V9XA 4J9NA 2O4IA 4FS2A 1KTQA 4CEOA 3VQEA 3K4GA 1BCMA 4J2EA 2NRTA 4DOBA 4CJ4A 2F8TA 4DSFA 1XSLA 4DOCA 4F3TA 3G6XA 2FMSA 3K58A 2XRIA 5J2PA 3DLBA 1ZETA 2WONA 3MR6A 2IS3A 7ICOA 4OKEA 1ZQYA 2RPIA 4B9NA 5KFQA 3UQ0A 3RH4A 4CEBA 1LAWA 1ZQOA 3LDSA 5J0SA 2IA6A 4CECA 4UB3A 1ASWA 3ZT3A 3K5NA 4DTMA 3I8DA 2NRVA 3DOKA 1BPZA 4GMJB 2B5JA 4KFBA 5J0RA 1BPYA 8ICRA 4ED1A 3BGRA 8ICKA 1S9GA 3NFAA 4JV2A 2HHUA 3KD5E 4KAZA 4O5KA 4M3TA 2HW3A 4KREA 3BQ2A 3NH2A 3MR2A 4M0AA 3QZ7A 9ICSA 1KLNA 4IR1A 3L2UA 5KFGA 4GXJA 4NLKA 3VQPA 1S1VA 1FKPA 4FXDA 3A2FA 3L2VA 3NGIA 1DTTA 3MFIA 1ZQQA 3V9SA 4BWJA 2XY7A 1VSLA 3QLHA 2C22A 4DTPA 1Z00B 4TUSA 3KK3A 5JS1A 1RBVA 4DLEA 1MSWD 1ZQNA 1ZQWA 4CGHA 4ECSA 1ZYQA 1MU2A 4YFUA 3QERA 2MUTB 4CJUA 3QINA 1S77D 4ELTA 2HHTA 4CHYA 3OGUA 3TARA 3AU6A 1RTDA 3AVBA 1RT6A 2AGQA 4FJGA 3VQ8A 3RMDA 2ZJ8A 3TFSA 5JUMA 3D45A 3IRXA 3QNOA 3SQ2A 2WTFA 3B6OA 5KT6A 4Q8EA 4QOZB 2B21A 2O4GA 4HUFA 5KTQA 1TK8A 1FK9A 3T3FA 3HO1A 4IQVA 1RYSA 4BE1A 3OS0A 5IIOA 4BACA 4GXIA 2ZJ5A 5T7BA 1NKEA 1IO2A 3CM5A 1ASUA 2FC0A 1JLAA 4FYDA 4K8ZA 4RT3A 4KLGA 4CEZA 2QKBA 1ZQSA 2P5OA 2ZUCA 9ICAA 3OHAA 4I2QA 1BISA 3KD1E 3NCIA 2ISOA 3NF9A 7ICTA 2OZMA 1WSIA 5BOMA 1NJZA 2A1JB 3SUNA 3OYKA 4DF8A 5HHHA 8ICHA 5HMMA 3ZSXA 1ZJNA 5J0QA 1NOMA 2BPFA 4KLLA 4R8UB 3CG7A 3PUFA 1W0HA 3SUPA 1QS4A 4RW6A 4DTUA 3T5JA 1Y97A 2GBZA 3WNGA 3OY9A 5IIIA 4AHRA 3KHGA 3H4DA 4JV0A 5DB9A 4HUEA 2YNHA 3F9KA 4N41A 3HPOA 3Q8QB 2E6LA 1D5AA 4MQ3A 3C2LA 1ZBHA 2XGQA 5EOZA 1HYZA 1U48A 1YT3A 1ZQDA 2PI4A 8ICZA 4RQ2A 1KSPA 3RR7A 7ICKA 4I9LA 3JPQA 5DB6A 2XHBA 2HVIA 4O0IA 1RDCA 4ELVA 4M42A 3GV8B 1TKTA 3ZT1A 4CEDA 5F9LA 5CYQA 4Z4IA 1KDHA 4L8RB 1NJWA 2OZSA 1WSGA 1COOA 3KHRA 2XCAA 4DOAA 2FLLA 1RDBA 3T19A 3AUOA 2ZTCA 1ZJMA 1B9DA 4E1MA 1BIUA 3PR5B 3ALYA 4KTQA 3VQDA 4I27A 2A1RA 9ICFA 2Q3SA 1C6VA 5EU7A 4BDPA 4IRKA 4CGIA 3IM1A 3SCXA 4Y1CA 4E19A 4FJ5A 2BHNA 4KLTA 4LH5A 4B9MA 3V7JA 4I2CA 1JXBA 5D46A 1ITGA 1ZQTA 5KFMA 4YMMA 4K8XA 1CLQA 5KG4A 1HMVA 1KCFA 4Z4CA 4J9SA 2P51A 1MQ3A 4I29A 2V4RA 2HHSA 1WNSA 2ISPA 4W5TA 3B6PA 4QZIA 2UVRA 5HBMA 3VQ7A 1BIZA 1UA0A 1RILA 5CA7A 2W9MA 4KN4A 4ECVA 3C94A 3HK2A 3PW0A 5J29A 8ICCA 3AO4A 3L2RA 4UBCA 1ZQJA 3C21A 2JEGA 4NCGA 4PY5A 1F21A 4IBNA 1ZQAA 4CGFA 2PI5A 1L3TA 4MEXA 4OLBA 4ED6A 5J2EA 3NBPA 2FBVA 3RH6A 5KRSA 3RRGA 7ICSA 4KV8A 2BDPA 4DSEA 4QWEA 3VQAA 3OHBA 2AQ0A 4KB1A 1LAVA 5F9NA 2AU0A 1X9SA 1XWLA 2ASDA 4FLVA 1Q9XA 2VG7A 1IH7A 3M8PA 2P6UA 5DB7A 2HMIA 4PHEA 3HWTA 4DQQA 2HNDA 1Z3EB 1TAUA 1U45A 1VSIA 3AO2A 1K1SA 2LSNA 2UVWA 5KFHA 4YR2A 2R8GA 8ICFA 4F91B 4DTXA 2Q0ZX 9ICRA 3NE6A 1TAQA 2JEIA 3PVXA 5J0UA 3ZSRA 4X5VA 1Z26A 3HPHA 3V1QA 1C0MA 4P4OA 3QEBZ 4M3ZA 4O3RA 4P4MA 4CJ3A 2UVUA 2KW4A 4KI4A 2J6SA 3ISCA 3OYJA 1ZQGA 1JLGA 3L2WA 1U4BA 5J2CA 4ECXA 3K5LA 7ICNA 3JPTA 4IRCA 4M9JA 3SYZA 4LH4A 2Y1JA 2A1SA 3TAPA 2PFOA 4RPYA 1NJYA 3NAEA 4RG8A 9ICUA 1QSYA 2F8SA 3G6YA 3ZD9A 1TV9A 4EYHB 4FZXC 4O3SA 2C2RA 1ZQRA 3K5OA 2IHMA 1SV5A 5J2IA 7ICUA 9ICPA 1XSPA 5CJ7A 4O5EA 5KFZA 4DTRA 5DB8A 4YQWA 4ECWA 4CJ5A 3G0ZA 1VSHA 4AHSA 5C25A 2FPMA 4F4ZA 8ICSA 8ICMA 3O3GA 4CEFA 1RT2A 3LZJA 1JLFA 3C1ZA 1RBRA 4CHZA 4I2JA 4O0JA 3DLHA 4M6WB 3SI8A 1JXLA 3AVJA 1TK5A 8ICWA 2VWJA 5KFPA 2HNZA 4RQ0A 3F73A 4DS4A 4AHVA 4QW9A 3MFHA 2C2DA 4RW8A 5J0OA 4ELUA 4G3IA 1T05A 3VA3A 5HLFA 4BDYA 2XGPA 4RQ4A 1BI4B 3SV4A 8ICIA 5IIMA 1J9AA 4OLAA 5KG0A 2ZTDA 1DOQA 4PH5A 5HMLA 2XC9A 1ZQKA 4F5NA 5D4BA 3UQ2A 5DBBA 2HB5A 3ISNC 3GIKA 1Q9YA 2YKMA 5DLGA 4QZFA 4UAZA 1MQ2A 1NOZA 1Z00A 5J0TA 5K14A 4DTNA 4DWIA 4IFVA 5L1JA 4CIGA 4GVMA 4RPZA 2HHQA 4N76A 3V1OA 2BQRA 2MUTA 1B9FA 4CE9A 5KFRA 4F2RA 4E3SA 5KFFA 3K5MA 3O4QA 4PGQA 5DK5A 4CFBA 1DGSA 2R8KA 1S1WA 4QZCA 3OSPA 1VRTA 4KN7A 3OS2A 3V81A 4F4WA 3CFRA 4DQIA 5KT5A 4YXMA 4O3OA 4F93B 1JKHA 4KLEA 3NGDA 4C8KA 4HTUA 5DDMA 4B08A 4E7HA 5KT4A 1RYRA 1EXQA 4ECQA 2FPLA 4FJJA 4J2AA 2PXIA 4H4OA 4GC6A 4CEEA 1ZQLA 3B0XA 1U9LA 3DYAA 3M8QA 2DPJA 9ICXA 3DLRA 5DG8A 2DFHA 4KLJA 4YN4A 4MFFA 5DGAA 1FKOA 3NH1A 1XO1A 4JWNA 3OYLA 1JL2A
chains in the Genus database with same CATH superfamily
1MMNA 3LPEA 2M0GB 4PZOA 3H5UA 1SBRA 2DFLA 4BX9C 3O3LA 3CO0P 5C42B 4PG5A 4WCEQ 3TTDA 1IBCB 2NUHA 3I1YA 2KVCA 2LLZA 3RWUA 3Q86A 2K8AA 2G07A 1HNVA 3PSPA 4FVMA 2EG1A 1QSLA 3J80Y 2UU9J 2DHSA 3D7EO 2UZAA 4UT4A 3NRZA 4R0EA 5CHCB 4LR8A 3H3OB 1PVPA 2A3JA 2IPOB 4ZVUB 1CRXA 2ZIUA 2CQBA 1N8RO 2K2PA 4KX3A 4WFNQ 3R1LA 5SWMA 1EJ7L 5HP4A 1EO1A 4HDGA 1TUVA 4KYZA 4QZBA 5JXSA 2G8HA 2CQ1A 4RBTA 1L8OA 4C1NI 1Y4ZB 5LOQA 3Q8LA 3BGFA 4DFKA 2ATCB 1YSJA 2YMQA 4QIWF 5L9XA 4CLUA 4UOGA 1KW4A 3V9ZA 4I2EA 5I9EB 2ZTEA 2KZMA 3LP0B 4E8UA 3RSEA 4PA1A 2JR5A 4DO9A 4C4TA 2NRXA 3K57A 2JNJA 4O44B 4AT1B 4MDAA 2ASJA 3VAFA 3SDEA 2C42A 3EICA 1ZQHA 4LBHA 2DNHA 3QBCA 4USTA 3LP2A 4DX7A 3TABA 2Y8WA 2IVFB 1RBLA 3ZTPA 3SZ2A 1C0UB 4D3GA 5DKWA 3IG5A 3ZZYA 4OLPA 2IVNA 4CJQA 1BGXT 2QK9A 3PX0A 4M7YA 1I5OB 4EIAA 1YI2N 1U6ZA 1S57A 2Q6CA 5JICA 4DQ8A 3CD5A 2WC9A 1CZBA 3I33A 3MXJA 1C0TA 1MDUB 1EXNA 9ICGA 1F3VA 5ALDA 4J9RA 2K1RB 3J81j 2CQHA 4LF8F 5FJ4A 1VSJA 4FZZA 5GTHU 4NLRA 2XWYA 2OKQA 4I2GA 5KFKA 7ICIA 4Q2MA 3MR5A 1KBUA 4Q43A 3PTWA 3I0RA 4ILHA 3MXIA 5ALFA 1FA0A 3I87A 3T1YK 2G0JA 2QLWA 4DV1F 1F9FA 3MD3A 1M5KC 2CG8A 3N4QA 4BR0A 4P10A 2D5RA 4PL7A 4JMUA 2LYHA 1PILA 2F1JA 4J9KA 1CUKA 2DIVA 4HL9A 4E7IA 1NMNA 3MMJA 2BDUA 3QSYB 8ICXA 2E7XA 2EAOA 4C3LA 3QMQA 5SZTA 3MM8B 2O8BA 4CJFA 3ENOA 5JMNA 1SKWA 4FO0A 3SEOA 3MGVA 3NP5A 1RAHB 2M7SA 4CGGA 3AFGA 2VPXB 4WQ5C 5ALLA 1QSSA 3NRBA 4LVNP 3JPPA 2MGZA 4UB5A 3M4XA 3THXB 3AQOA 1SL0A 2NXNA 3C6HA 1NNDA 3KIOA 4LY7A 5ALSA 5AI6A 5D3GA 1J27A 4CHNA 1EB0A 4K5RA 3MXHP 3TADA 3CXCM 2NYHA 1BQMB 5GIOA 7ICLA 4OJPA 5CY4A 3KD3A 3CNHA 4CIOA 3L7OA 1CJTA 2XO6A 2DY1A 4I28A 1YZ7A 1HYSB 4LF8J 1AFIA 2AJ0A 1C1BA 3HM9A 2W9BB 5EE0A 3D5MA 1G2EA 3E66A 2FJVA 4YOXA 3MN6A 3GFYA 2Z2YB 3GG0A 2QXFA 5JLHA 1X4AA 4RL1A 2GMJA 2J0QD 2Z1JA 3R5DA 2YHAA 4W5OA 4F8RA 1WSVA 4DV1J 4LRBA 2MLYA 2OTLS 1W2BM 1RHUB 2AEJA 3BS9A 2EHGA 5DDPC 2WW4A 3M05A 1SJFA 4IKFA 2R7SA 2G9OA 1VHIA 4FK0A 4EX7A 3HHEA 3AVLA 1X9XA 2VG5A 4W92B 4O4RA 2C2ZB 3LH2S 2CJ9A 1V9PA 2HCFA 4F3OA 4JKEA 2MSSA 5B09A 4OI1A 4HVJA 3HW8A 2ZD1B 4C11A 4RNHA 1WKLA 1UFLA 1LWCA 3EZWA 3CE8A 2EEYA 4QPXA 1VFJA 3GB0A 4GVEA 4I1TA 3V7LA 1M5SA 1URNA 2YWWA 2H3GX 4XDDA 1FNXH 4CF8A 1MC8A 3UWTA 1YWXA 2XMVA 4M2YA 3OVBA 4JI4K 3K59A 1OYEA 3UN5A 3QJLA 2C2NA 3BQ1A 3RBXA 4L3KA 5TKYA 2E29A 2WCXA 3VEWA 3VQBA 3SMSA 1NU4A 4YG2A 1IM4A 4QJFB 5AKEA 4PWUA 4DL3A 3EUNA 4PUOB 5CA5A 4YS2A 1OQ3A 4Z6FA 4HACA 3QZ8A 4ES3A 1Q81O 2GAGC 4ILRA 2H4WB 3I82A 2QA4S 2KOBA 3C15B 1SH3A 3PSIA 4RQ5A 1D8YA 3V6DA 3UKUB 4UAWA 3HZGA 3AAQA 2AQ4A 3GIRA 5KAKA 3HKZD 2DRAA 1FXRA 4IOBA 2ALYB 1UT8A 1NJIT 2E4LA 2UXCF 4X65F 3BQTA 3JQJA 1NK9A 1ECWA 4CGJA 5M2PA 3J80O 3P5TL 4P6QA 3N6MA 4ZVOB 3TUPA 2DYAA 5L1MA 1S1XA 1JUDA 3RAMA 4DUTA 3ZT0A 2H3ZA 1KRPA 2UP1A 4I6MA 4CLSA 5KOXA 2VQEJ 2UXDF 8ICUA 1V6HA 1AUDA 2MY8A 4PXEA 1LFPA 2ZVIA 3TSQA 2EWHA 1ZC6A 2IRYA 3IP0A 1ACMB 1MA9B 2G2OA 4K0KK 3PMNA 5H9FK 5KG6A 2FJXA 2YWGA 4OJLA 2P66A 2F2AB 2CQ3A 1X60A 2PMZD 3S9HA 2CVIA 1FE4A 1VBKA 1WCLA 4US9A 1SUQA 4LVSA 5I3UB 3T5HA 2VJ4A 1MWYA 2XI2A 4E1NA 1J2NA 8ATCB 2YX7A 3J7ZO 3AJDA 3LA0A 2POKA 3VAGA 2CQ4A 2W03A 4U6PA 4XK8C 4ED3A 3DM2A 1TFYA 2GCFA 5J0PA 4HHJA 5J2FA 1HL6A 1N48A 2XY8A 2RS2A 5CYQB 4RNMA 5KFLA 1S6QB 4IO1A 4C4SA 4G1QA 1AZSA 4CEQA 1XMOK 1UJ5A 1P27B 4LFAK 1RWMB 4R79A 1KTVA 2ZWHA 5EY4A 4FZMA 2ZIXA 2QLJB 4N77A 4RNFA 4UAYA 2OD6A 4BC2A 2MAXA 4NXMF 3H8WA 1DQAA 4UOHA 2MQQA 3DJCA 5AFUA 1P1LA 2BKPA 3FLCO 4RBVA 4DR5J 2FHMA 4EFAC 4EHTA 4OHWA 4WIIA 1JCGA 3ZNJ1 4TY8A 2UXCJ 4Y2JA 1UEVA 1S97A 4X65J 3RBZA 1GLJO 4YEAA 2J9CA 2IGIA 1LWEB 4PHDA 4DL5A 4USIA 4LSNA 3TW0A 3NWRA 4IOCL 3QBWA 1T7PA 3T1YJ 4MDBA 2FBTA 3QDKA 3MBYA 2PIIA 2DNOA 2YPYA 3QO9B 2EC0A 2OM6A 3ZI4A 5AKKA 3RB3A 4DSIA 4QZDA 3BKUA 2UXDJ 3WNFA 2HAFA 1KD1O 3ISBA 3V6KA 1WG1A 2WHEA 2R7OA 2C1EB 2XLJA 5B5EU 4KTWA 1RUSA 1ZBLA 5CEHA 3BS5A 2WVCA 3EWGA 1IR2A 3AGRA 1PYOB 2QKKA 2FIUA 4UQGA 2GH1A 4YHHF 1B43A 3KBBA 4ZPAA 1ZBSA 1N32F 4PXDA 3FZHA 2FJDB 3A1YG 1A0PA 2GHPA 1KVIA 5IM0A 4KHSA 4FZYA 3TZYA 1Y9OA 1D9FA 2OO4A 3KMQA 1SJ1A 4KGXB 3HFZB 1UVKA 4IUFA 5J2JA 2HBKA 3MCOA 4AFFA 3LDPA 1ZD4A 3LAMA 4UTGA 2HAIA 1PK3A 3OW2M 1O03A 4MFAA 2I1QA 3PDNA 2WFBA 1YJUA 5IOLA 1HPMA 3SFUA 1AUSL 4IOAQ 4JV5K 4DPYA 4JKGB 4NXMJ 4F25A 1O0PA 2W3SA 3V4MA 2ZJAA 5J2MA 4ZN3A 4CJ7A 3D1HA 2Y0SD 3RH5A 1VQ7N 5ADXH 3EXYA 5AHXA 3RJIA 4M63A 1KXPA 1NK8A 1WEZA 1Y3JA 4NASA 3PSFA 3ZZRA 4I0WA 1KQSM 3GYNA 1WG4A 4YP3A 3D28A 3P39A 2XCPA 3HSDA 1DGKN 2NYVA 2BJ8A 5G5GA 2BKOA 3M6ZA 3UMCA 5AQVA 4U96A 5KG5A 5AQSA 3O80A 1QHTA 4LR7A 2YNGB 5LSLA 3KLFB 3ZX0A 1XNQF 1BU6O 3L6QA 2PD1A 4P2SA 2OIHA 4CLTA 1NK5A 3PIOL 1O5JA 2BZ2A 5J1EB 3P83D 4ZJQA 4ICLB 4YHHJ 4LIWA 3RW7A 2EFNA 4FWRA 3F5TA 5L39A 1N32J 1S6PA 4GW6A 2F96A 4OKKA 1Y0HA 5DBCA 2L41A 4ED5A 4QZ8A 2W8KA 1NGBA 2E1YA 2P9KB 3KKRA 4ID1A 2MQMA 3EKSA 3UE5A 1HBMB 3CXCR 4HWIA 4DSKA 4NI2A 2KG5A 4JI3F 1ATNA 4FK4A 1X2IA 3TSUA 2VJVA 2AH5A 4MFCA 2KJ9A 4U8VA 4CI6A 1VRUB 2W7PA 4R66A 1ZTWA 2F4VF 4ES2A 4NXZA 1TV6A 4HLBA 4BG9A 2OPPA 4BR9A 2DT9A 3T5LA 8ICAA 2B0CA 5J0YA 5IILA 4WTYA 1OH7A 1WYGA 1RAGB 1ZQVA 2BMBA 1W2BR 4DV2F 1YHQN 4G9ZA 1XQIA 4PL1A 3TYTA 5MAOA 4WF9Q 1TUGB 1N61A 3IAYA 3KOAA 4ZHRA 2OCEA 3HRDD 2DIUA 5H9EK 2ZH7A 3UO0A 1A7GE 1PYSB 4CF2A 4GVBA 4NWIA 2KVQE 3SR6A 1J2MA 4BXOA 2QARA 2YKMB 3KLGA 1U47A 1WBDA 4KLUA 1OXJA 4FVUA 1TL3B 2KJ5A 4ZVHA 3L3UA 1OS5A 4NLCA 3C46A 1TL5A 3SAFA 1WUUA 5KAFU 2HLUA 3AHPA 3VCDA 4Y2XA 3WKCA 4H54A 4H8KA 4FWQA 5ALXA 3QJPA 4KAIA 3OL9A 3E01A 4OQJA 4CJKA 3UXNA 1N5YB 5ALGA 1N4LA 3AA2A 1HBOA 3OVAA 4WK3A 1NSQA 5LJVA 2AEMA 5AQTA 3LGNA 4CO3A 3DDIA 1VQ4N 3VGLA 1GMVA 2ZBQA 2OA8A 2VIHA 4ZLLA 5HMYA 4JI3J 3IR5B 2QWMA 2Y3YA 2Z1HA 3SCKE 3BO4A 4LBPA 1KNZA 2RUGA 4YFKA 4HHUA 1S0OA 4M9NA 3EGZA 2QI2A 2BCUA 2V6AA 1QVGM 2XSJA 3CC4N 4CO1A 3VEVA 2RT3A 4ACOA 4MF8A 3TQ1A 1NRKA 3KG0A 5D6GA 1I3AA 4X4OA 3DXKB 4H5VA 4ZTJA 1RTHA 4B1UB 4PYDA 4JI7J 5AK5A 3BGUA 2BTFA 4ECUA 3LK9A 4MIWA 5AQKA 4DV2J 3ASMA 1OH6A 1C2PA 3QEVA 2Y1IA 4QWAA 3EXCX 2M3DA 1R0BG 3GU3A 3OR2B 4XTTA 3CERA 4WYBA 5M2UA 1A9NB 2MPUA 2DY4A 2JC0A 2HQDA 3G8QA 9ICTA 1X9WA 2VF3A 2WK4A 1AROP 2PKEA 1QAYA 3PW7A 1IKVB 1HRHA 3QNNA 1LNQA 1DK2A 3VN5A 2P9GA 2IA0A 1IG9A 3QPIA 2MHNA 2WF7A 1HIYA 3J7Z5 2CNKB 2KLAA 1ZH5A 4A8MP 3FM9A 5AQNA 1T03A 4C0OC 2XQCA 3BS7A 4B8CA 2RHFA 3EE9A 2FLPA 4AYBC 5FPMA 3ZD8A 4BY9C 3GQCA 2KKPA 5IT9U 3F0NA 3RMAA 2QLXA 4ZTFA 5KG7A 2B5JB 4KFBB 4N47A 4RUAA 3BUZB 2Z2MA 1VSMA 3W61A 4MFBA 3BO2A 3ZZPA 1VQ8S 4KHWA 3NLCA 1N6QA 9ICLA 8ICNA 2KRBA 3LAKA 3I0SA 4LFBF 1LW0A 1XHZA 8ICYA 4MAKA 4Z6DA 4C48A 4KHQA 1GX5A 2EX3A 2LYVA 2Q2RA 1JLQA 3KKSA 4NXNK 3KK3B 4RBUA 4C8OA 1GLDG 2D7SA 1EX8A 3MAAB 4F04B 1BI4A 9ICCA 3H90A 1SV0A 1T3NA 3TVKA 2L3MA 4OX9K 1FRHA 5EXWA 5FLXY 1Q8BA 3MR7A 4KLSA 4I2PA 3GR0A 3ENVA 1Q8IA 3OYFA 4M3RA 2DR9A 4MT1A 1D09B 5HRRA 1APSA 2WF9A 3ADAC 2DNNA 2FJ6A 5ALOA 5HK4A 2GIFA 2PEBA 1T9YA 1GOCA 1KAXA 2IYIA 4WFYA 1B22A 1XMBA 3C6TA 4OZ3A 1S59A 1JNZB 1NLVA 3LO3A 4F3MA 1OVQA 4H4MA 3SCLE 5HJXA 1RWPB 3LALA 3QU4A 3Q8MA 2D0PA 2DR8A 1W2IA 2AJQA 4CLLA 4O3NA 3QEAZ 3GTYX 2H5JB 4ZPBA 1J2VA 3UD3P 2KQ2A 5ETQA 5A0YB 4Q44A 1VI7A 1RHKB 2QT7A 2KTQA 4NLYA 2ZWPA 4R5PB 3GILA 3OD2A 3W2VA 3H4BA 2ZITA 4TVAB 1FW6A 1TL7B 2AX1A 1SWVA 5KNIA 4IFYA 5AQHA 4QQBA 4B9TA 1WSRA 2V7ZA 4OYXA 1FD8A 1QAXA 4FCYA 3OW2R 4JD2A 4FPAA 4LF9F 3GV7B 3QBXA 2HGLA 4K4WA 3E58A 1WSEA 4LFBJ 1R8CA 2W6KA 4ZH4A 5F3XB 1G15A 2VB6A 1PKUA 2M9KA 5DQHA 4FLWA 3CCWA 1D8ZA 5CZXA 2F8HA 5G0RA 1T3QA 4J91A 1YBTA 4UUWA 4G9BA 4PR6A 5KT2A 2D0AA 2KIWA 1W7AA 1WOQA 2E2OA 1T0TV 4KLMA 3OYNA 8ICQA 1NPRA 1F9HA 3CCTA 2VGNA 1KDNA 1KQSR 2JZBA 3ZTQA 1XNSA 4FM0A 3MWTA 1DT9A 1TKTB 1W25A 5LJWA 3EYZA 2BJ3A 1U1LA 3HJEA 4JP8A 1VS3A 4G1PA 2DGWA 2W04A 2FJEB 1UHUA 3GE1A 2CH5A 4AL7A 4CQ1A 3FBCA 2MY7A 3N4WA 1RXVA 2FBYA 4DX8H 2DH7A 3Q8UA 4UAUA 4DPWA 1RDDA 2HOEA 1BPBA 4GV9A 1TFRA 5D78A 2HRUA 4F71A 3LP0A 3LTOA 4FJ8A 1L6NA 2PFUA 2EANA 4WWSA 4CJWA 4Z4EA 3ET6A 3KNGA 2W4CA 3DRRA 1F0XA 2KKHA 2NXCA 4J7CA 2LXFA 4U8YA 1UOCA 4PRFA 2LU2A 2P6TA 1FCAA 5DQIA 4PWDA 1BVSA 4LF9J 1RCXB 3M3ZA 4NMLA 3LVVA 1C0UA 1HMVB 4XQ8A 5BJRA 4PWWA 1AFJA 3N4PA 4EP5A 3PRDA 2KMDA 4LZDA 3BSAA 3PX4A 3GIIA 3BBFA 2G06A 3S3OA 1ZM2A 1JIHA 4GC7A 2X3GA 4OI4A 3TAEA 2E8OA 3J81O 3QICA 1WG5A 5E2QA 2D0BA 1OY9A 2PSZA 5DM6Q 3KYLA 3UI3A 3TKAA 1OH8A 2RRBA 4J5OA 9ICEA 1FNMA 3BBBA 2E9ZA 1H98A 1X1PA 2PFNA 4DXLA 1FWLA 2RHSB 1ZPVA 4TQRA 5AE3A 2LKYA 3H0RB 3DXBA 4M3YA 2HHVA 3NBPB 1XMQK 1RZTA 4WE1A 3RVCA 4JRPA 3BGOP 4IO9L 3QFUA 4H5RA 3MM5B 4Q45A 2RD5C 3S41A 5B0FA 3KG4A 4GFJA 3P1GA 4X66K 1C4CA 3S6JA 3H7IA 5KAIU 2G8WA 4NZ7A 2VG7B 5JJBA 3M8PB 3VF0B 3E9PA 3CMQA 4DR1F 1X6JA 3OQ2A 2QEXS 1U0HA 3A0IX 3SBMA 3IDWA 2HOIA 1COKA 1WHVA 1YJNS 2VIXA 5E84A 3H42A 2QA1A 2HNDB 2J0SD 2X7IA 1FVSA 2VODA 4W5RA 4EZ9A 3AA4A 3CGIA 5KFDA 3HOTA 2I1RA 5KFBA 3MM8A 3G6VA 1QQ5A 3D66A 2UUWA 1EIYB 2R7TA 4FPIA 2FPHX 3F9MA 4BVOA 3TJAA 4GMKA 1NK7A 4WIQA 1U2VB 4MMOA 1U2RA 1Z6RA 3KJNB 3AXKA 4B9QA 2BGGA 4ZJLA 1MMDA 4OLOA 2VONA 1DEJA 2YVSA 1E4GT 3THXA 1L5UA 4FM2A 4NM2A 2G8FA 1R59O 3MXMA 2FJBB 4H0VB 2GTDA 1KVBA 1JLCB 4NZ6A 5LMUF 3WX8A 3AM9A 1XUPO 4PABA 2A0FB 2F3NA 4QZGA 2ZXHA 3TZWA 4KX5A 2VG6B 4XAKA 2D3ZA 1BCMA 2W55A 4DV5F 4CJ4A 2F8TA 4F0KA 5ALIA 4FYWB 4DSFA 3K5PA 2EW9A 2I2YA 3K58A 5J2PA 2HZAA 3DLBA 1ZETA 4DCCA 3U1LA 4C7YA 2XMWA 2ZH1A 2O66A 2YHWA 2H3VA 3PJWA 4B9NA 5C25B 4PQAA 2BW2A 3TNVA 1FEEA 3PYDA 1NGFA 2E1PA 4OX9J 1IQTA 3Q7CA 4F0MA 3J7AP 3MAHA 4I69A 5FLXO 5J0SA 2WVEA 1HUXA 1M0SA 3O1LA 3CSKA 2YKPA 3H25A 2NNWA 3HSZA 1NHUA 4UATA 1SB6A 1BPZA 2WB1D 3O6QA 3E8OA 5J0RA 8ICRA 8ICKA 2P5VA 1T05B 4YDDB 4KAZA 3IKMA 2ADCA 3CJBA 3CB4A 2HW3A 1ELOA 3K8WA 3QT5A 9ICSA 4IR1A 4P7VA 5KFGA 1LXJA 4UW2A 4EGLA 5BRHA 4TU8A 5GMDA 3AH6A 1Q1KA 4FPRA 3FFKB 4PYAA 4BWJA 1HWJA 3M32A 2P9LA 4DTPA 1GLLO 1Z00B 5JS1A 5K14B 3EMTA 1MSWD 2HFUA 1K47A 3LGHA 5LMUJ 1ZYQA 3QU2A 4P0PA 2NXJA 1CI4A 3HHLD 1QD1A 3HKZF 1S77D 3QINA 2MKIA 2OMLA 2MKYA 1B99A 4DV5J 2V52B 2Y9UA 4RUHA 1NU0A 3RMDA 2ZJ8A 5JUMA 1UZDA 1Q7YT 2NREA 2WTFA 2EH9A 3UKUA 3W0LA 4Y2TA 2R7UA 2O4GA 1NGAA 2ZC3A 5KTQA 1FK9A 3MMAB 5M1OA 4AM7A 3DEEA 3SQOP 2XICA 1RYSA 4IYQA 4BE1A 3J7YI 4V1Ak 4GXIA 2X1GA 1NKEA 1JLAA 1TQLA 1RKJA 4FKYA 4KLGA 4CEZA 2QYGA 2QKBA 2ZHOA 1ZQSA 5HROB 2P5OA 2H3IA 9ICAA 1BISA 4OZLA 3NCIA 2PMZF 4ANDA 4R25A 4K41A 2KE7A 1REVB 5B0EA 1WSIA 5JMVA 3DKDA 2YX4A 2A1JB 5HQ8A 3MPYA 3NS6A 2O01C 5HMMA 2B4VA 4M5DB 3ZSXA 3H0PA 3OA9A 4KLLA 4I67A 2GVDB 5E3PA 1M1HA 4A8SA 3T41A 2VU5A 4LF5K 3T5JA 1NBWA 3Q22A 1OQ6A 3KHGA 3ULHA 4RQMA 4HUEA 3U9ZA 1PGZA 3U7JA 5GAGU 3HPOA 3M7DA 4ZA1A 1HNXK 4ZVRB 3Q8QB 2MZ1A 1D5AA 1UEKA 5AQGA 3THWA 1YT3A 1ZQDA 1Q5YA 2IIHA 2Q66A 8ICZA 1Z4NA 4RQ2A 5D77A 1MWQA 3ZLJA 1KSPA 7ICKA 4I9LA 3H5YA 5DB6A 4C97A 2JHEA 2XHBA 4ZP8A 1FDBA 4ZPDA 1DLOB 4IDKB 4NL9A 5CYQA 2UV8G 2O3DA 4X4PA 3HHLA 5GVQA 2N82B 2Q1LA 5J1NA 2OTLN 4PG7A 2F9JA 3T19A 3AUOA 3GCWP 3R8YA 3H59A 4P7TA 1B9DA 2FC8A 1BIUA 2N3LA 4EELA 2WHOA 3VQDA 2BJDA 2VKRA 2Q3SA 4NLBA 2AYGA 4Y2UA 3IGNA 4BDPA 3PYFA 3R8EA 3WHIA 2CN1A 4E98A 2ZDOA 2J7UA 1XNRK 2F8KA 3I4HX 1NDCA 4JI0J 3Q7BA 3V7JA 2VOPA 4EU0A 1ITGA 3FEXB 5BYRA 2J5AA 1NGDA 3CCQS 3OTEA 2I5JB 2ILZA 1R43A 4E1JA 1J5EF 2PE8A 5AFUH 3DNCA 1ESVA 2HHSA 4K7QA 2ISPA 4A8FA 4NZ0A 1VLBA 3FKBA 2ZOGA 2UVRA 4KR0B 3VQ7A 2VBWA 2ASPA 1FRMA 2W9MA 5ALVA 3A12A 1HNZK 4ECVA 1VBXA 1V85A 3O4WA 5J29A 1T3VA 3CCVN 2Y1RI 2DO4A 4Y2RA 2M52A 4PY5A 2Y0BB 1F21A 4Y0FA 3R2CJ 1ZRMA 4Y2PA 4FNIA 3MM7A 1GLAG 5KRSA 3VTIA 7ICSA 4QOTA 1DURA 4CYUA 5D0RA 4ZOSA 2E5LF 2W25A 1ZA1B 2JH3A 2DWQA 2E88A 2OGUA 1KS2A 2AU0A 2FGCA 4JHDB 3P38A 5ALYA 4DV0K 2ES6A 4EO6A 1IH7A 2YKOA 4RTFD 3W1YC 1UAWA 3TQEA 1NB7A 2EG2A 1NSKL 1TAUA 1QVFM 1PAUB 2LSNA 2UVWA 3L4IA 3B8AX 4DTXA 2KN4A 3IWNC 1HBUB 2RILA 3BM7A 4PKGA 3V1QA 3L95X 3QEBZ 5DM7L 2KW4A 3UD4P 3EZUA 4IFEA 5A76A 2JMGA 4M63C 3F44A 2O8DA 2OLWA 5J2CA 3D2EB 4ISGA 3D4JA 4M9JA 4LH4A 3HDSA 1QZ6A 2HLTA 1S5ZA 4WKYA 3M30A 3TAPA 2PFOA 1GX6A 2K8BB 1NJYA 4RG8A 6FD1A 2F8SA 3G6YA 4ZN1A 3FQLA 2G0IA 3D68A 4IH7A 2F8EX 3UDCA 1VQLS 3AAWB 2C2RA 4MO5A 2YNFB 1OW5A 1KC8O 2P9SB 5J2IA 1WHWA 2P2CB 4C0HA 1CSJA 1XSPA 2N4CA 3IS9B 5KFZA 2RP5A 4CJ5A 2FPMA 1BY9A 4F4ZA 2B8QA 8ICSA 1RT4B 2DHXA 8ICMA 1HWLA 2E5LJ 2XS2A 3O3GA 4CEFA 4AQYK 2V9KA 3FC9A 3M6UA 3VCBA 3CCJS 1X5OA 2JRSA 1JLFA 2B3TB 5L38A 2YNIB 3L3CA 4I2JA 4J8FA 3P45B 3DLHA 1Q7LB 3EE8A 3GYGA 3IM9A 3PACA 4M6WB 3AVJA 2NZTA 1FO4A 5BRDA 5BPMA 5KFPA 1Z2ZA 1EP4B 4WFAQ 3EE3A 2KJ8A 2C2DA 5J0OA 1LFWA 1X4CA 1FRKA 4BDYA 4IO8A 2RKIB 2AZ1A 5IIMA 1YJVA 1DOQA 5HMLA 2XC9A 3MEEB 3AD9C 2HB5A 3TX8A 2YKMA 4URQU 3RUBL 4HT5A 2R9LA 2IOHA 5B7WA 1LKYA 3FQKA 4LRAA 2LU1A 4DTNA 4GO5X 5HMXA 4NA3A 4GVMA 2CNLB 4QS8A 4DBQA 1VQ6S 2HHQA 4N76A 4WU2A 5AQWA 1ITPA 1TMMA 2MUTA 3O8MA 1Q86O 3P3DA 5FPDA 2Y0SC 4C4WA 4UOFA 1BLUA 1X3MA 2EK1A 4UQTA 2QWNA 1UPHA 3NGSA 1S1WA 5HOOA 4EK2A 2AA4A 2MLZA 1ZXIA 1N33K 1RU1A 3OSPA 1VRTA 5HL7L 3I5CA 4ZLJA 1RT5B 2W43A 2I0XA 3D54A 2AWZA 4YXMA 1ZOLA 1UW4A 4C8KA 4HTUA 3UW1A 3AOCA 5KT4A 1RYRA 1EKRA 4F7VA 1EXQA 2HPUA 3KLEB 4U7BA 4J2AA 4ZMMA 3NWGA 4H4OA 4GC6A 4IC9A 1WC3A 9ICXA 1F0MA 4IS7A 4GKJF 2DFHA 4BC5A 4KLJA 1FFUA 2BE2B 2GFFA 2XMAA 3GG1A 1CPZA 4RJVA 2RVJA 3DXKA 3KWMA 4PG4A 2G5IB 2KHVA 4JWNA 3OYLA 1JL2A 1KQQA 4LBIA 2MTLA 1FJGK 1P1TA 2VA3A 1IKXB 4NO7A 2FUG9 2HWIA 2JGAA 4PL2A 2A6AA 4YORA 3IV6A 3SIPB 4CF9A 2G0CA 3H6EA 1BUXA 1UA1A 4IDHA 2P6SA 4ID5B 4KKOA 2UUCF 3H08A 4OJRA 1SXDA 1QQOA 3KHYA 4KHPK 2BCSA 1L7NA 2J0XA 1C1CA 3CQYA 4UB8U 1VQPS 2IC3B 4F4AA 3D0HE 3QUTA 1RISA 4CJLA 3A3PB 3DU5A 1QAIA 1MROA 2RQKA 1IKVA 5M1PA 2F8LA 2HRYA 1GMWD 2K4PA 2D74B 2ZZNA 4Y2QA 4A59A 1HNIB 4QIGA 1IBKF 1JJHA 3C6UA 5EWGA 4UW9A 1HQUB 3M6KA 1N36K 1A5XA 3P49B 3JYTB 2K3KA 3SSSA 1XQSC 3NEKA 4B9UA 2G1DA 3UN3A 2X1FA 4C8LA 1CJVA 4DI6A 1L8LA 2GX8A 4YCXA 3MEDA 3MDCA 4CRXA 1Y3KA 3OBIA 3R9LA 1WDDA 4FWOA 2V8HA 3MDQA 5A8WA 3CC2S 1K9MO 2R7YA 4ZVGA 4FOIA 2E1AA 4RZRA 1NUEA 4QZEA 3DDHA 2GA7A 2VUGA 4GKJJ 3PX6A 1Q0NA 1QQMA 3U3YA 3TFRA 1E4FT 3THYB 8ICTA 1KEKA 1HKGA 4WZMA 5ETMA 4P4PA 4FLZA 2DNYA 1VR6A 1MWKA 4LSLA 2ADBA 4FM1A 9ICJA 4OJ5A 2ZG6A 4DR7K 1JJ4A 3MMCA 3QB0A 1TZ0A 5CXTA 2UUCJ 1B4SA 3KVGA 4J03A 4OZNA 1IKYB 3HJVA 2JH1A 4DR2F 4RQ7A 1YBUA 3CNQP 5AQRA 2V2ZA 1BQNA 3V4IA 5EE9A 4EBDA 4LFCK 2F65A 4KB0A 2J9DA 5A8KB 1YJWS 3AARA 4JI2J 1KLMB 1TUYA 1K8AT 3OTOK 3SMVA 3HX0A 2V50A 4ZPVR 2O8FB 3S6EA 5KFOA 3J7YP 1ZQUA 2G4BA 1S1UA 4I2IA 7ICRA 4ZOHC 1IKWA 5BOLA 4F2SA 4DUZF 3E51A 3JAMU 4HR2A 5KI6A 5IT9Y 4FWKA 2WOMA 3AOBA 1IBKJ 4C0BA 1VQMS 2NRZA 1HUZA 3EJMA 2AJ1A 5T14A 3C65A 2L9NA 3R6LB 2MZRA 1GMWA 4O9MA 1FX4A 1W26A 2CAJA 1YUWA 2NLWA 4R5PA 4M47A 3CD7A 1SJRA 5J2QA 1PSDA 3SAGA 2EAPA 1VQ9N 3AL0B 5LXYA 1WCNA 3A8JA 5H1SV 2DL0A 4MF2A 1NKBA 3H8YA 1SIJA 2CXEA 4C7QA 5HP1B 2WBRA 4YOEA 1RT7B 2ZH6A 4J2DA 4DCPB 2KEYA 3FDSA 4TYAA 3IRUA 4P0QB 3AVCA 1IBLF 4E7LA 2UV8A 3H20A 1P90A 2QWPA 2DTUA 3TAGA 3DLGB 2D3OR 1HQEB 2VA2A 3L8BA 3LPYA 1J5OB 7ICFA 2X3DA 3KJVA 1UFKA 3SUQA 4F4YA 4DUZJ 1TU0B 4ED4A 2E8NA 3PO4A 7FDRA 3LANA 4PG8A 2XVTA 3JPNA 4RU2A 3AY9A 1X5TA 4B1WB 4JI5F 1L7PA 5KFJA 4A57A 1SWWA 2XS7A 1CG2A 1CJKA 4GLXA 4EYIB 3ZZZA 2XZWA 2IVOA 3IWLA 2NZ4A 1NZBA 1RAIB 2OFGX 4PAAA 4B3OA 1VQ8N 2BANB 4DR1K 3LP1A 3X1LB 3ZC4A 1N33J 2LP4A 2CPIA 3LP3A 4MK8A 3K17A 1SQFA 3D2WA 1TMJA 4DV7J 3RAQA 3R5JB 2N4DA 3H45C 3ZZTA 1NGJA 3DMJA 3W8PA 2R4FA 1NAQA 3O9TA 3MTKA 1BWVA 4ETXA 3N28A 3ULEA 3IR6B 2VWBA 3I56S 1ZZFA 3KLHB 3AJ1A 1UMJA 4UUXA 4KJIA 3CQ8A 5J0XA 1YGYA 1KHVA 4H0XB 3KWGA 2YWHA 2VCPA 2LXIA 1X0FA 4FF4A 5J0WA 2JVOA 5HAOA 4P2XA 3WKDA 1H7XA 1XU4A 4KHNA 4JI1F 1BD6A 3DGPA 4UBBA 2QMUB 3EL2A 1BQXA 4ZKAA 1DKGD 4AHUA 2EFQA 1XERA 3TAMA 2E20A 4NEZA 4HCBA 2ZE2B 3ZDCA 5CB1A 3TTCA 2ZIWA 3I4PA 2AP1A 2PYJA 1N63A 2JVRA 3A4TA 4XRHA 3ZT4A 3H40A 4I2AA 2OJ3A 2E5JA 4JI5J 4DLGA 2IAJB 2EZZA 2E9TA 3G9CA 1BNOA 1ZQCA 3MGJA 4WP8A 4O0NA 3HP9A 2CGKA 3UXOA 3E9LA 2PFQA 1MN9A 2EZXA 3D2FB 2O8CA 1FX2A 1U2VA 3ENBA 3RB6A 2BKNA 2YKNB 3KUEA 8ICJA 1VSKA 5K8PA 1O08A 4DR4K 3MD1A 5HSPA 5G4DA 3HYFA 1U1MA 4CTAA 3DLEA 3C16A 3D6TB 2KXFA 3C2MA 1V38A 2GIQA 4GO7X 2R8IA 3U8XA 1JLCA 1QJHA 7ICVA 2G8KA 1TUWA 2Y8YA 3EPIA 4OVLA 2MU2A 2CDQA 5EDWA 3MR3A 2H1YA 4NL5A 4PKHA 3GWCA 2VG6A 4UOCA 4FJHA 3GFZA 1N5QA 3V9UA 4LF6K 2CUYA 2VQFK 1TELA 1FNOA 2HI0A 5ALRA 5KFSA 1MN7A 3EW9A 3HVWA 4OYAA 2P6RA 1I94F 4CBUA 3DRPA 2XY6A 3QWUA 3BZKA 1LB2B 4DFPA 3KJFB 4GVLA 4DTJA 2QL5B 1J54A 4E89A 3D67A 4DSLA 4DR7J 1VDVA 4KPYA 4BHQA 2YTUA 2YV0X 5EWEA 2ZH3A 3C2KA 1R0AA 1Z1ZA 1YLXA 5FDLA 3O8WA 4FVCA 1W7WA 1ZQXA 1CC8A 1VYAA 2ODGA 3ICLA 5ALUA 4K4IA 2HHWA 9ICOA 3BF4A 4U7UK 2OAUA 3CTRA 4KH4A 3V9WA 5HO4A 3DRSA 3LOUA 3M8SA 2NPIA 5JTIA 4NX9A 2V8GA 2D0CA 5DS7A 3PJXA 1ZAXA 4JKHA 2F1IA 1E6YA 5IT9O 3RTVA 2V94A 4F4XA 3CO9A 5BYSA 3CP8A 2GQQA 3GIJA 4CJPA 1XSNA 1VQON 3GPAA 2NYIA 3SQGB 4DV3F 4CESA 4CGZA 2HQCA 1TVAA 2R2UA 1X9JA 4FLTA 4RW4B 3QFHA 2HS0A 5D4LA 2YY3A 1YJ9S 1P8ZA 3T1HK 1YF5L 3T9ZA 1SKRA 1SJ3P 2CA9A 2MZQA 3RRKA 5IS2A 2E5HA 2CJXB 4CD3A 3V72A 3RJEA 3E0FA 4Q7AA 4RQ1A 2Z2LA 5KPRA 5EHHA 3DOLA 1I94J 2O8EA 4OI0A 2ZH9A 2A6MA 1C20A 5HRPA 9RUBA 1GLBG 3SCIE 1RWUA 3KTQA 4B3MK 3TVZA 3KKFA 2BPCA 1IJEB 1SXEA 3VQ9A 4DX5A 3VAHA 3NF8A 1Q95G 4FYYB 3NNAA 4UB1A 2QEXN 2OPQB 2QWRA 5J2KA 5IWAF 4N5SA 3KK1A 1S76D 4BR4A 1RFQA 1SS6A 4X4NA 2DHAA 1RT1A 3OYAA 2CZ4A 3D2QA 1DTQB 3M6XA 4K4UA 1DBDA 1OWXA 1REVA 4PQUA 1OKJA 2A1JA 1R3NA 1YRUA 4KY3A 4H4KA 3ZDEA 3NMAA 1IJJA 3UVJB 3OUYA 4BRAA 1HWIA 1K0TA 3PW2A 3GZ7A 5IC6B 1JLGB 2OPSA 3CMAS 3C2PA 2XZTB 4RQ6A 2H48B 2OEJA 3MM6A 5DLFA 3PR4A 4R65A 1RDRA 2PMHA 1OH5A 3H8JA 3U6FA 1BA0A 2Q79A 3VGUA 2B6AA 4B3SK 2P5GA 2FZCB 1LVHA 1KVKA 2VKQA 5A8RA 3JXOA 3CT9A 3IFRA 3AO5A 1S5JA 4UASA 3LUYA 5ALNA 2VDIA 9ATCB 2HVDA 2ZEJA 2GIRA 1RXWA 1GMUA 3NS1A 2XMUA 3CCLS 3PIPL 4WFXA 2MZJA 2OPRB 1RCOB 1YIJS 1N0UA 3FFIB 3MECB 4CO4A 5K8MA 2VHGA 1N8RT 4BLGA 3HOSA 9ICNA 2W40A 3PV8A 1RTZA 4WXWA 3CRXA 3TU5A 4IOCQ 4JUZA 2QB0B 5KG2A 1SC6A 3NH0A 2GHWA 4NL9C 5GMEA 3NGYA 3M1VA 3OSNA 1OVYA 5IWAJ 1RI7A 2ALZA 2MZTA 1DQ8A 3RJHA 2ZJRL 2CJYB 3QXGA 2PO4A 5J2BA 2FVCA 4IH5A 1BPXA 3H1QA 1IBMF 2HVHA 3SBTA 4YDUC 3RG6A 4M3WA 3K7RA 5ALJA 2LQ9A 1M90O 3WK6A 2HNYA 2J9DE 2I5JA 4ZIVA 2W42A 3UPQA 2CPFA 5CCLA 1TKZB 2ZIVB 4K4SA 1R8AA 1YKWA 1G4CA 9ICMA 4M5IA 1RTIA 2JGUA 1D9DA 4TSXA 2R2RA 1ZS6A 1X40A 3CJKA 3OYCA 1UKUA 4CGDA 2F1FA 3RYLA 1YTAA 2GUPA 4BGAA 3N0VA 2QC3A 1FTRA 1R0CB 1MLAA 1HJPA 5I42A 5E41A 1RTJA 5E3CA 3WXJA 3MN7A 3SEIA 2HS4A 3TEGA 3DAWA 3MMBA 4JV1A 3TA1A 4B3RK 4P73A 4ECRA 3H2VE 3RMCA 3ZEUB 2WSEC 3JSRA 4LF7F 3M2RB 2VD3A 1WLJA 2QKQA 4EZ6A 1NMEB 1HPZB 2RH3A 1Z2LA 3PFOA 4DV4F 2HWHA 4BR5A 4U67L 2WAQC 3OYBA 2ASOA 3JTNA 2CNNB 4C2MA 4FFDA 2PZSA 4OHXA 5ALHA 4OX8A 2HFNA 4CW7B 1PZNA 1C0GA 1WORA 3IAM9 3NDKA 5E0OA 4FK2A 4KHRA 3IHQB 2WF5A 4ILLA 3M2VB 3J7A1 2HBYB 1KHWA 3M9OB 1FFGB 3BKFA 3KK2B 4L75A 1IVZA 4XO0A 4IG0A 1HNWK 1VGYA 1JWWA 1FJ7A 7ICMA 3CJAA 4I6WA 2XO7A 2A5XA 1S79A 4FWSA 4QZ9A 3WEEA 3MEGA 5A2QU 1RDUA 8ICEA 3CFOA 4A8KA 2KB2A 1S9FA 4FZLA 2Q1NA 3N6LA 2PBDA 1FRJA 3FSIA 1SH0A 3TAQA 5HHIA 3CIPA 2X78A 2NS1B 2A2DA 2XY5A 2LKZA 4CO5A 1EX4A 4B6JA 4PKDB 2AW0A 2DRDA 2UUBF 2ZJPL 4XH4A 1S4FA 2J6UA 2MMYA 3PYGA 3CQXA 4DCHA 4XUSA 4Y2MA 2CQPA 4Q0BA 1K8KA 5J2NA 3IBPA 4UB4A 3AO1A 4RW7A 4X4SA 3DOKB 4WXOA 1Z19A 4NYPA 1UL3A 3C3LA 4LF7J 2AMCB 1RT4A 3B9JA 2V2VA 4DV4J 3WQTA 1LXNA 4IQMA 5F8IA 5L1KA 1IXKA 4I56A 1X4BA 3OTBA 4AM6A 3O9SA 1VISA 5HVFA 2GC8A 2DNGA 4O4GA 1FDDA 3C23A 4QIVA 3OJSA 2F7VA 1FKPB 2XHCA 3F53A 1KVAA 2KVSA 3Q8VA 2QB1A 3QLHB 1ZTTA 5D15A 3OR1B 4JKFA 5DMRA 1IV8A 5L8RC 4B9LA 1HARA 4B9SA 1WAFA 4E0DA 1T6CA 5KG1A 3Q83A 4X64F 3VC8A 3RB0A 2E1RA 4Y2AA 2C3MA 4YD2A 3CI5A 1HWKA 1IXRA 3CCQN 3MGHA 4ZVQB 1HLWA 3C14A 3TWHA 2GJIA 3CD6N 3SAHA 5HR7A 3GFXA 2Q0UA 5HRNA 1RDAA 1VQNS 2CJAA 2FBXA 3O6WA 3C1YA 3W65A 1XI1A 3CJ0A 3HSCA 1NPKA 1GOAA 3GONA 2UUBJ 1YVNA 1H7WA 4Y28C 1RDFA 2AZ3A 5KFNA 5AM1A 2RDIA 1XR5A 5AQYA 2EBEA 3NUQA 2W9CA 3IXQA 2ASLA 1CS4B 2BABA 4OHVA 5IT4A 5FPNA 3QGGA 3GIMA 1KQGB 1Q81T 3N4MB 3UMGA 4FBTA 3TZZA 4NRUA 5IIKA 1AQ6A 3MDAA 4B9VA 3EDRB 4IOAL 3K1ZA 2B6GA 2JEFA 3AB4B 4AHCA 3HD1A 2CQCA 3QGPA 2WVFA 2OMOA 3T6BA 4OL8A 3QIOA 2BQ3A 3UIQA 4EAHD 4YUDA 1CZ9A 2CZVC 1JLBB 3CC7S 2BE2A 5LT5A 4FZVA 3UM9A 4JK9A 1VC5A 3PMLA 4RW6B 2CPHA 3JPSA 3M9NB 1H38A 2CRLA 1UJ6A 1IKXA 1ATRA 3DLKA 1UT5A 3PW4A 4O3QA 4DR6K 3PSTA 2XULA 3C8YA 1SL2A 2CPZA 1JJCB 2F3JA 4QNLA 4X64J 4B3TK 2ZM6F 2YX8A 2IHNA 3IFEA 2P9UA 5M2RA 1KFDA 2HOQA 2ZZMA 2IC3A 2OANA 2KXNB 2YY6A 3LPTA 2WW8A 2AHOB 2BM1A 1UVJA 5T7LB 4DG1A 4RNOA 2QWOA 1N34K 4Y3CA 1T94A 2AV5A 3DLLL 3NVKA 3LZIA 3J7ZT 1FWPA 1UCVA 4OJ6A 1VQLN 1VQSA 5FD1A 4IJAA 1ZZNA 4DUYK 2C28A 3PM9A 4DQSA 3LVWA 4DR2K 3V2UC 5KRTA 4YXJA 4DPTA 2VPWB 1BHLA 4YY3J 3LDNA 1ZQPA 2P9IA 9ICQA 2MRLA 1YVUA 2JFKA 1WN7A 3KKAC 5LL6Z 2FE9A 2LDIA 4UY8O 5KFTA 2GQ2A 4JYAJ 5DQGA 2C3UA 2UXBF 3VAMA 2R7VA 3CCZA 3MX2A 3IR7B 3KXDA 4OJHA 4U7CA 3GL1A 1XHXA 1AA1B 2VFRA 5AKZA 1VBYA 3VTHA 1RXOB 1E3MA 5KFAA 3QATA 3KLIA 1KD1T 2ZM6J 1S12A 1ZBUA 2WF8A 4NCGB 1HR0K 3AV9A 4OYZA 2UU9F 2EDUA 1NGIA 3MOZA 4YOYA 1JLEB 4K25A 2UUAF 4FLXA 2VBXA 1RYUA 3SBGA 1KLMA 3EX7B 3BR8A 1SC3B 3ISND 4K4ZA 3QRPA 1VQ6N 1JRPA 3WX4A 4QWCA 4KMUA 3CVKA 1BOTO 1KFSA 5CZ1A 1R27B 2H51B 3FSYA 3QFWA 1YZ6A 4ZPWR 4W98A 4DX6A 4NB4A 4V19X 2QRRA 2HMIB 3AVFA 2BQUA 5M1NA 1R89A 1S6OA 4WPAA 3IG1A 5AXLA 1XN9A 1WBBA 1NGHA 2NRWA 4I4BA 2B7BB 3GDQA 3HD2A 5CR4A 3SNNA 5CYMA 4I7FA 4BRCA 5CZVA 2W9AA 5EX3A 1C4AA 1GH8A 4NLZA 1Z4UA 1S10A 4JAXA 3NCQA 2E6MA 2DITA 4C4RA 3VQQA 1I39A 4KLQA 4ZIWA 3VMFB 1NDKA 3BYPA 2UXBJ 1YRXA 5HP1A 3FMWA 5DETA 4JKCA 2PY5A 4YR0A 3DGVA 4NLQA 5AXKA 3RMBA 3JSMA 4UARA 3G82A 3ID8A 1RAJA 2I7PA 3W2WA 4I6YA 1V3ZA 4RNNA 4CJVA 1JMTA 2O4IA 4FS2A 3CJ1A 1BNPA 2G1HA 4LF4J 4DOCA 4F3TA 3G6XA 1SV5B 5LMNF 1CJUB 2FMSA 2XRIA 4BRKA 2KSOB 2WONA 3FCHA 5AZJA 2UUAJ 4FE3A 1URRA 2IS3A 1YJRA 4LQ9A 2AIRB 3UFCX 1GXLA 4OZ5A 3QJJA 5AZIB 1TUUA 4AL5A 2BOAA 3UQ0A 3IP4B 4CZGA 3FC4A 1L7OA 4CZMA 1V3SA 2LMIA 1Z1VA 1ZQOA 3DHXA 1S1TB 1N0VC 1ASWA 2IJNA 3UN2A 1PJ7A 2HNZB 2DGQA 2GV1A 2V2KA 1KOHA 4GMJB 3M5RA 4RW8B 1BPYA 4ED1A 2WTUA 2DNZA 3U26A 3NFAA 5HLFB 4PCQA 2G13A 3KD5E 5B08A 1IN0A 4O5KA 1X4HA 2P9NB 4M3TA 4PHTX 3NH2A 1X31C 3MR2A 4M0AA 3OPKA 3CPWR 3L2UA 4CNYA 3LDOA 3A8YA 2F40A 3VQPA 1S1VA 5AK6A 1DTTA 3MFIA 1ZQQA 1RAFB 1QCKA 2XY7A 1Q78A 3JTPA 2NUUG 5AXNA 2ZOFA 1UEUA 3ENAA 4DLEA 4Z2XA 3I31A 3UMBA 4IFVB 4DV6F 1ZQWA 3J80U 4RW9B 1RU2A 4CJUA 2KIVA 2MDAA 4IO9Q 2NR0A 3AU6A 4HTIA 1WKKA 1RT6A 4WKRA 3OLBA 4CT9A 4CLFA 2GW8A 1O6XA 1FVQA 4HDHA 5LMNJ 1LW2B 3V81B 3IRXA 3D45A 1RACB 1LOUA 2OSQA 4RWWA 3VEZA 3SQ2A 1EHWA 4M5LA 3POTA 2B21A 5AQPA 1TK8A 5AIBA 5ALPA 3HO1A 3M8QB 1VJWA 2CDRB 1CLFA 1BDGA 3OS0A 1VQMN 2E7WA 5T7BA 4L74A 4JB8B 3TJ9A 3CM5A 4FYDA 4K8ZA 1NO8A 2E2PA 3PHTA 4XPCA 3F2BA 3P5BP 2BRLA 2ZUCA 1UETA 4I2QA 4PEOA 5B8HA 4DR3K 3KD1E 2DEIA 3FBFA 3L3FX 3NF9A 3CJCA 2QGFB 5BOMA 3SUNA 4DF8A 5HHHA 5J8YA 2YN4A 2XWXA 5U47A 2QWQA 3E3XA 4FP9A 1NOMA 1EWQA 2I5HA 3PUFA 4DJBA 4CZIA 5HVHA 4KRWA 3NMRA 4DTUA 1HNVB 3OY9A 1U6BA 4AHRA 5DB9A 2HF4A 2YNHA 2QWLA 4ETZA 1S9EB 1TP7A 4DV6J 2N7YA 2D3UA 3C2LA 5GAHU 4L72B 4JI8K 3TUJC 3W5ZA 3SK3A 2ZIUB 2PI4A 3R6GB 2MSNA 3F5AA 2E1FA 3C66A 1SV4A 4O0IA 4M94A 1ED1A 3WBZA 4A48A 3I9ZA 3RSEB 1KDHA 4L8RB 5LL6d 5AKIA 2OZSA 4QIWC 5AJ3K 3IAS9 3KHRA 5IFMA 4C3MA 1RDBA 3SDEB 1ZJMA 1TYQA 3K89A 4Y6IA 4ZK7M 4BQLA 2IM2A 3LP2B 2QMXA 3D6JA 5ALZA 4KTQA 4CLWA 2I6WA 4I27A 2A1RA 2ROPA 2KP7A 1RWOB 5F0WA 5AM5A 3H2LA 3SCXA 4E19A 3GCXP 2DHGA 4FJ5A 4UY85 2BHNA 2RU9A 2VQEF 4LH5A 3TVYA 4I2CA 2A1BA 5E79U 5KFMA 1C0TB 2HBMA 1SVDA 2P9PA 1HI0P 1ZA2B 3OPXA 4X62K 1Y00A 1FRXA 1MQ3A 2LA6A 1RADB 4FL9A 2ZZTA 1WNSA 2IM0A 3D6RA 1XC3A 4QZIA 3QAEA 3NVMA 3ONQA 4BRGA 3K0JA 3I0RB 5HBMA 3CDAA 1BIZA 3VAJA 1F5SA 5LSRA 3CCRS 4KN4A 4ZLPA 3I56N 3C94A 3HK2A 3BH6B 2KRRA 4OYPA 3L2RA 1NB2A 1ZQJA 1VK8A 4R0JA 4MIBA 3G8SA 2ITMA 3AGKA 1L3TA 3H5SA 5GAEI 2VICA 5J2EA 3RH6A 1NDPA 3B4MA 2BDPA 4QWEA 3VQAA 3D6MB 2AQ0A 4KB1A 2O8BB 5F9NA 2PMWA 3QT7A 3AODA 1XIQA 2MB0B 2EQYA 4CZCA 4XH5A 1Q9XA 4I6AA 4DR5F 1UVMA 2QG9B 3EM1A 1MMLA 4LT6A 4PHEA 3HWTA 4ZVSB 1U25A 1Z3EB 5LJ3Y 5KL8B 3ZX2A 1FDNA 3NVYA 4LIRA 9ICRA 3T1YF 2ZVSA 5D3GB 1TAQA 4YOTA 4RWTA 3HSJA 2JEIA 2H3QA 3PVXA 2HSZA 2AT1B 3IRWP 2I9SA 2DB1A 4LMZA 2P8IA 1C0MA 3AQFA 3ZETA 3WKBA 4O3RA 1CJTB 3MC1A 3CJ7A 4OPHA 4M5MA 2NO4A 5K4LA 2L5YA 2I38A 3OYJA 1JLGA 1C1BB 1S22A 3M1YA 1IWGA 3JPTA 2Z4PA 3SYZA 3D6FB 4KC5A 5AKXA 1RQ0A 4RPYA 4KPCA 4KGMA 2W24A 2KICA 4TLRA 5ETKA 1TV9A 2MKJA 3CCSS 2GELA 3M1FA 1GTEA 1IBMK 4FZXC 3AQEA 3K9JA 1ZQRA 3BF3A 2K3IA 3B6BA 3K5OA 2V4JA 2VG5B 3T79A 1RHMB 1FJCA 4O5EA 2DGZA 3PJ9A 2Y9TA 3G0ZA 2KV2A 1VSHA 4EEKA 4DPUA 4DFDA 4FXVA 5TISU 3MCAB 3GYXB 2CJQA 1RT2A 1YITS 1LWCB 3OTDA 3CDEA 1HWUA 2RDDA 2VFVA 4CHZA 4O0JA 4Y2CA 2EFVA 1X6IA 4CDIA 2AXTU 3TWZA 3BKTA 3VGMA 2KO1A 1OY8A 2CQDA 2EI5A 4NA1A 4OX6A 2VYPA 2NSCA 1HJOA 4RQ0A 4DS4A 4CLKA 5BR8K 4QW9A 3MFHA 2XYGB 5C2FA 4ELUA 3CJ4A 3VA3A 1ILYA 2RJZA 2QJ3A 4RQ4A 3HM8A 4F02A 8ICIA 1J9AA 3T69A 5KG0A 2ZTDA 1N52B 5AXMA 2M8HA 4PH5A 3EZOA 3DDKA 2PAVA 4F5NA 3DWLA 5D4BA 5DBBA 5C12A 2FF3B 3LL3A 1HBNA 2XEXA 1LCUA 3GIKA 1Q9YA 2D9PA 5DLGA 3GLJA 1H6KX 1X8DA 2PA8D 1HW9A 4HACB 1MQ2A 1NOZA 1EQYA 2JH7A 4QJVA 1WTFA 4GRSA 5J0TA 5L1JA 1YVFA 3QQCD 3V6DB 5AT1B 4DR3J 5L46A 3CJ2A 3D3BJ 3FZMA 2BJ7A 3W9IA 4F2RA 3WXLA 2DGSA 4PGQA 4EMDA 2B9WA 2R8KA 5DK5A 1JXVA 1S6UA 2D0OA 2QE5A 4QZCA 4B1VA 3CF5L 4JI4F 4PXBA 1JCEA 1Y5IB 3CFRA 3ZEUA 2G08A 5KT5A 4O3OA 3H98A 3TACB 1JKHA 5DDMA 1H74A 4E7HA 3W64A 1B70B 1YG0A 2D69A 3ZX3A 2V5HG 1S1XB 4U9RA 2WVBA 4Y00A 4I6MB 4JI8J 2HMPA 2KH9A 1WUDA 1Q8KA 3VGSA 1RAOA 3PYEA 1FKOA 4Z37A 1XO1A 2F9TA 3A5OC 5DM7Q 4UZBA 2E5SA 4BRQA 3KK2A 1T3OA 3SPZA 1F1BB 2NRHA 3AA5X 1HUOA 1SUQB 2HBQB 1KR4A 1ZM4A 3HVTA 2HGNA 5AJ3J 2DGTA 5KGXA 1PJ6A 3NGUA 3PLAA 2B9XA 5L1LA 1X9MA 2B7CB 3LYSA 4JOUA 4HCCA 3Q8SB 1S3XA 4R8UA 2OTJN 4TY9A 2ZXIA 3G2XA 1CEZA 4Y65A 4B1XB 3G6EN 3CMAN 4CJEA 2FZGB 2RUSA 4F4KA 4GXKA 3N01A 4M5KA 3VEYA 5MLCQ 4G1QB 1AZSB 2DKOB 3GJTB 4QWBA 5GADI 4O8KA 3SQ0A 2ZIXB 1WC0A 4ID8A 1RWNB 2B56A 2JFDA 2FSJA 2CQIA 1RLDA 3AVMA 3O3HA 3E1YA 2JJ4D 4K0KF 4TY8B 4JI4J 1D8BA 4ZVEA 5EGYA 2FLNA 5ALEA 2AKWB 2YWFA 2WSCC 4NYFA 1UWBA 4L76A 4JI6K 3CCLN 4GKKK 4LSNB 3C5GA 2PT0A 1YIJN 1ZAVA 4QIFA 3H8MA 3I5BA 2HSEB 1A77A 1TKXA 3HFVA 3H46O 8ICPA 4DU1A 3FAHA 4DSJA 4NCAA 1P9QC 4RQ8A 3WIVA 2KG1A 3TPQA 5ALWA 4JI7F 3TTFA 2YHBA 3L3VA 2LQJA 1TL1A 3NS7B 4B8AB 5HRSA 2ETJA 3CCUS 3BS5B 3VZHA 3QEIA 1RT3A 3L2QA 2W11A 1XMOF 2FZKB 2LEAA 4LFAF 5A2QY 5ETVA 4N56A 4ILJA 4QZAA 2DEJA 5F8NA 1L3VA 1J97A 2FYXA 1WC4A 4X2BA 4QIEA 5JVGQ 1YDLA 1QUPA 5B0GA 3EVMA 3ZDAA 1M1KO 2R42A 5CP2A 4ILGB 4CBWA 4EUVA 4FJKA 4IXCA 5AR0A 1N60A 4P71A 1KQKA 2XI9A 3QX7A 4M5GA 3TANA 1H2TZ 2DVIA 3R1XA 9ICIA 4K4HA 3HVRA 3M6WA 2HHHK 2O1PA 2Q6BA 4QZHA 1U8SA 4JBCA 1UAXA 1E6VA 5HL7Q 4FYVB 4KO0A 3OHRA 2AJFE 3PO5A 3OS1A 1F2HA 4IG3A 4IQWA 5F2RA 4KMOB 4KGKA 3BZCA 2YJEA 3GR1A 3R6MA 4Z6CA 4HH1A 3Q2TC 2PA3A 4K0KJ 3R5GA 4ZCMA 5H9FJ 2ZKUA 2N3OA 3AVHA 1DY3A 4K4YA 1C7YA 4BDZA 1XK8A 4A47A 1UZHA 1JNRB 2ROEA 3M2UB 4JK8A 5AQOA 1F9EB 5HQMA 4HAIA 2MQ8A 2B9YA 1YK9A 3I8BA 4M41A 5DG7A 2F44A 3UKRA 1JLBA 3LWLA 4CH0S 1RGVA 1KQFB 4DPXA 2YWKA 3OT9A 5BN8A 2EBGA 5CHGA 4AHTA 1VAZA 1XMOJ 5D4OA 4LFAJ 4BGBA 2FPKA 4FJ9A 1HI8A 4JV5F 3JS6A 3TR8A 4NLGA 1QE1A 1S6PB 2KNJA 2RQ4A 2KFZA 1EETA 3W66A 4RUCA 4P2HA 1BE4A 1CULA 5AI8A 1CBKA 4QU7A 2B4JA 1S5LU 3R9KA 2YX1A 1NKCA 1U1PA 4NI2B 3AD8C 2KFNA 2YKAA 2G8UA 3S3NA 2AF6A 4MEYA 3HP6A 4OJ3A 4FPBA 1AYEA 3SJJA 1K5OA 3I76A 1I51B 1RA7A 4ECZA 3FJ2A 2HFZA 3J81U 1TV6B 3ZTRA 1RBUA 1TVRA 2ZNZA 3LF0A 1VK0A 2OPPB 1KN5A 4QZVB 3Q8PB 2F9WA 3NOGA 3PG9A 5C0YA 3BGRB 1S9GB 4AYBD 3T9NA 5B0CA 3ATVA