4DSJA

Crystal structure of fragment dna polymerase i from bacillus stearothermophilus with duplex dna, dgtp and calcium
Total Genus 186
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
186
sequence length
579
structure length
579
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical and structural insights into the fidelity of bacillus stearothermophilus DNA polymerase
rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA polymerase
total genus 186
structure length 579
sequence length 579
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4dsjA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4dsjA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dsjA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4dsjA01
3H7IA 3HT3A 4JLHA 4J9NA 4OKKA 1WCNA 5F9NA 4C8MA 4DL6A 3EWAA 2XCPA 2HHUA 3V9UA 1CXQA 4E7KA 3Q8LA 3PW5A 2HMIA 2XGPA 3OYIA 1IO2A 1TFRA 4ECWA 3QINA 2G8WA 4C8OA 3KIOA 5KG4A 1QLNA 2UVRA 5IIIA 4NLKA 4YR3A 3S3NA 3AVMA 5BOLA 4JRPA 1L5UA 7ICPA 4UQGA 4F5PA 2JZBB 5KFOA 3PVXA 4F92B 5HHHA 4CEFA 4DG1A 4GVMA 4R64A 3OVNA 4HVJA 1C0MA 3KK3A 3CM6A 1YTUA 4KRFA 3KHGA 4PH5A 5J2AA 4CFCA 1RT1A 2QXFA 3RJKA 4JK1A 3OS2A 3L2RA 2D5RA 4RQ6A 1T4GA 2W9BB 3VQAA 1RTIA 3EYZA 1REVA 3QE9Y 3RBEA 4CIEA 4RUAA 1S6PA 4FK0A 3B0XA 4NM1A 1C1CA 1WCLA 4KN7A 5HRNA 3HM9A 1ZQWA 2D0BA 5C42A 3OGUA 3PR4A 5J0UA 4O9MA 4DU4A 3H8WA 2VANA 3NH1A 4FZXC 4CEDA 3KLEA 1BQNA 1BIZA 4R63A 5KRSA 4CF1A 9ICNA 2W8LA 3QLHA 3I0SA 3RJEA 3ZD8A 1D8LA 3ZSOA 1PZNA 3I8DA 1S1XA 2KZ3A 4TQRA 1C0UA 3WNFA 4DEZA 5DKWA 2BCSA 4KLOA 3NDKA 4FJIA 1D9DA 3K75D 2UVVA 3P1GA 2ISOA 2XY5A 3D0PA 5KFRA 4PPXA 4F91B 5DDMA 3PNCA 4M9GA 4DL4A 5J0XA 3NBPA 5DB9A 5CR0A 4RT2A 3VN5A 3ORYA 3PW2A 2AGQA 1ZQRA 5HHIA 1LB2B 1QSYA 3L2WA 2IHMA 1LW2A 3KD1E 1RBSA 4Z4IA 3AA5X 4M9HA 1VK0A 5CB1A 1S9GA 2I5JA 2HHTA 4QW9A 3AVAA 4F4YA 2JEJA 4DFKA 3QIOA 4RW9A 4M0AA 4K8ZA 8ICPA 3HX0A 4KLJA 4M3WA 1N5YA 4Q45A 7ICHA 9ICUA 2JLEA 2ZJAA 3HJFA 1MQ2A 1KFTA 4I2PA 5DG9A 3LAKA 1B92A 4QZBA 3EPIA 2HHWA 4K4IA 2A1SA 3RJJA 1ZQAA 1BPXA 4MF2A 1IKVA 3U3GA 3ZT2A 5HP1A 1EETA 4BDZA 4E1MA 3MDAA 1LAWA 4IR1A 7ICVA 1X1PA 3MXIA 3MFIA 4PHEA 1IG9A 1VSEA 2P6RA 1CUKA 5DGBA 1G15A 4O44A 4O55A 3ZSZA 2X78A 3QEIA 1SL2A 2NRWA 4DOCA 4DQPA 4I2EA 1KLNA 3RTVA 3C94A 4J2EA 5KFZA 4YXJA 9ICIA 1S1TA 4QWBA 5DDYA 3RMAA 7ICEA 4GW6A 3KLGA 2ZTCA 3OYHA 4B08A 3OY9A 3RAXA 4N56A 1COOA 3MFHA 9ICVA 5KT7A 4LH4A 3AVLA 2D0AA 2JEGA 3RMBA 5HMLA 3RH6A 1CEZA 3QEVA 3H8SA 1ZQOA 3UXNA 4QZ8A 3AVHA 2DFLA 3GIMA 4FJ5A 3HXMA 1WN7A 4Z6CA 3SCXA 4ECVA 4K4GA 4KLQA 2BQRA 1NJWA 1S0OA 3C2MA 4DF4A 2ASDA 3TARA 8ICHA 1HNIA 3LWLA 5KI6A 4RW8A 8ICIA 2JZBA 3BQTA 3GIKA 1BISA 3I0RA 2BCRA 4DTSA 4I28A 4DSJA 2ATQA 4FW2A 5DK5A 1NOYA 3L2QA 5KFXA 4NLGA 3K2PA 1SUQA 8ICOA 5KFCA 4K4HA 8ICRA 3BDPA 3T19A 1NKBA 3OJUA 3G10A 2Z1GA 2PXIA 4G3IA 3LAMA 9ICRA 4F5QA 1L3VA 2DPJA 4CHOA 3TAEA 3QEWA 3TAGA 5HLFA 1K6YA 3VQDA 4CIFA 3PW4A 4I2QA 2JGUA 2BQ3A 1NJYA 2QK9A 1UAXA 1RBVA 4AHRA 5DLGA 4F5OA 4R65A 4YMOA 4EP5A 9ICCA 3RMDA 4P4OA 3B6PA 4RT3A 2F1JA 1S77D 3Q8QB 4E89A 3NGYA 4G1QA 2DTUA 1JKHA 4I2IA 4CJKA 2VA3A 1ZBFA 4HUEA 4FJNA 3RB3A 2MUTB 3RJGA 1VSFA 4F4XA 3ZSYA 4PGYA 1JLGA 3OYGA 2PFQA 3PO4A 4N47A 5DB7A 5EWEA 4DTRA 3D45A 4CJ3A 3LP0A 1Z26A 1S1UA 1S97A 5CY4A 4RQ3A 5J2GA 4CERA 5DQIA 1QSSA 4ZTJA 1ZQDA 4CHNA 3O3HA 4KI6A 3NF8A 4ED2A 3VQEA 1S6QA 4YNQA 3V1OA 2G8KA 4FYDA 4Q43A 1FK9A 4IQTA 2ETJA 4HTUA 2RKIA 1ZBHA 4HHTA 8ICVA 4IRDA 4CF9A 4PGQA 7ICFA 3P5JA 4FM1A 3RB0A 5HROA 1NOZA 1JXLA 3T5LA 3K58A 2Y1IA 1WSEA 1NK9A 2YKNA 1Y97A 2XC9A 5J2EA 3RAQA 4YP3A 4O5CA 4CJ5A 4I2GA 3S9HA 4QZHA 4KLTA 3ZT1A 3EZ5A 2A1RA 5CZ2A 1RT7A 1JXBA 4KHQA 1CZ9A 3S3OA 3LANA 4FLVA 1ZBIA 4C8NA 1SKWA 3HYFA 4RPYA 1EXNA 3G6XA 7ICMA 3L8BA 3VQ5A 4FJJA 3M8QA 3VQ4A 3C2LA 4KTWA 4Q5VA 3NE6A 4E19A 3ISCA 4DFPA 4M3XA 4CK2A 4M3YA 3ZDBA 3RMCA 3DLKA 4OLBA 2LYHA 2XRIA 4CF8A 1Q9YA 5I42A 4FJ9A 2MUTA 4UAWA 4YFUA 4YR2A 4KTQA 2IDOA 4NLZA 5SZTA 5SWMA 4AHVA 4M6WB 1RBRA 4O3PA 4Z4HA 2OPQA 3PW0A 4RQ8A 5D46A 4RPZA 5J0TA 4FBTA 4KITB 5E41A 3MXJA 1QTMA 1ZQFA 3AA4A 4FJMA 3MABA 8ICQA 2Z1JA 3WNGA 3LZIA 5HMMA 1HNVA 4DWIA 3GIJA 4FM2A 3AO4A 2PI5A 4DQIA 3PMLA 4CGIA 2YNHA 4YQWA 3CFPA 1RT4A 1RZTA 1RTHA 4NY8A 4KO0A 4CGFA 2C2DA 2OA8A 2R8KA 4MFCA 2AU0A 7ICKA 1TGOA 2G8HA 4KHNA 1KCFA 5J2PA 2XY8A 5D49A 2BCQA 5KFAA 4E3SA 3C2KA 5D4BA 4CF2A 4FBUA 1NK0A 4YCXA 4EP4A 4M9NA 4IRCA 4NYNA 1ZQSA 4F3OA 3ZDEA 1ZQUA 5J2BA 1KFDA 1QSLA 4DMNA 3VQQA 3N4MB 4DSLA 1B22A 1QE1A 4J9KA 4CJ4A 2HNYA 3C6TA 4H8KA 4LZDA 4KLSA 3OYAA 3KKRA 2W9CB 1U47A 4CFBA 2ATLA 4UB2A 3VA0A 4I2HA 4DO9A 1TKDA 4O4GA 4LZGA 3OYEA 3K5NA 4HUFA 2AGPA 2YNGA 2IBKA 4DTXA 4PA1A 3U3YA 3H40A 1A5XA 4CJUA 3V4IA 2I1QA 1RXVA 4CK1A 1HJPA 2IGIA 1DTQA 4I29A 2KZMA 4B8AB 2C28A 8ICTA 2BDPA 3L3UA 4DTOA 3JPNA 5HRPA 2NRXA 1BIUA 1NK7A 3JPSA 4N5SA 4CJTA 2HHSA 1WSIA 1BL3A 1KEJA 1UT5A 3OYDA 3V6JA 2W9BA 3TAMA 1JL2A 1KRPA 2R8HA 2GWSA 2FBTA 1ASVA 3ZT0A 2HHXA 4JRQA 3QETA 3T1AA 3UXOA 1UOCA 4GLXA 1GOAA 2IOCA 3LWMA 4TURA 1ASWA 3PY8A 3RRGA 1XC9A 8ICGA 3L3VA 1S9FA 4JV0A 3M8SA 5CHGA 2P1JA 2HB5A 4C8KA 3LPTA 4KHUA 4OKEA 5KT4A 5KGXA 4O5BA 3TAFA 5EWFA 2WOMA 4PHPA 5KFPA 1TAQA 4B9UA 3V1RA 2W9AA 4J9QA 4ID1A 4FK2A 1UWBA 1RDBA 1ZETA 4CJFA 1XU4A 2R7YA 4JS5A 1ZBLA 1ZQIA 1TKTA 2ALZA 4Z6EA 2FBVA 2W9MA 3RBDA 3LK9A 4OGCA 3P83D 4KHWA 3RWUA 3ZT4A 1TKZA 5JUMA 3KJVA 3KHLA 4BXOB 5KT3A 2I9GA 2IC3A 1J53A 3IG1A 1ZQNA 4RQ7A 3VA3A 4O3RA 1ZQHA 4KFBA 3VQ7A 3TI0A 1BPEA 4FW1A 2VG6A 3ZDAA 4QZIA 3TR8A 3DI6A 1RYRA 2DFHA 4KLGA 1C1AA 4RNNA 2ZJ5A 3ZSXA 1HPZA 4Y1DA 2OWOA 4ECSA 1KVCA 2D0CA 4DS5A 3C6UA 3NFAA 3O4QA 4B9VA 2HNZA 3C23A 4UAYA 9ICMA 4M45A 4M3UA 4F5RA 4FJXA 3NF9A 4PHAA 4KI4A 3SZ2A 5IINA 3AVIA 1VSMA 3HWTA 2PFNA 4CHQA 3PX0A 4CJVA 3DM2A 4CEZA 4FJGA 4UB4A 3LZJA 4J9LA 4XRHA 5KTQA 4O3SA 3O3FA 1BPYA 2P66A 1YTAA 4B8CA 1Z3EB 3G6VA 5L9XA 4BE2A 3KHRA 1WAFA 4JUZA 4OVLA 1JMSA 1W9HA 4I7FA 2X74A 1HQEA 4HUGA 2ZD1A 2VG5A 4O3OA 3VQCA 1RNHA 1ZQCA 4R8UB 4ECTA 4YMNA 1ZQQA 1S1WA 3DLHA 2QKKA 3HW8A 4CEBA 4E1NA 2KQ2A 3K5LA 4M41A 4M3ZA 4I2JA 1IXRA 4BGDA 1BPZA 2VWKA 4OKJA 2KFNA 4O0IA 4DLGA 3KLHA 3PV8A 1U48A 2ZE2A 4E7HA 3LPUA 2HHQA 1JLBA 4F2SA 5J0RA 4CJEA 3C1YA 1RPLA 5HRSA 2RDJA 3V7JA 4W5QA 2Z1HA 5JS1A 4NM2A 5DMRA 2ITGA 4QWAA 9ICLA 3CYMA 4O5KA 1MU2A 4HCCA 4PY5A 4TUPA 3Q8PB 9ICFA 5DB6A 3KTQA 4AILC 3UIQA 3IS9A 4Q0BA 4J9SA 7ICSA 4LY7A 1UA0A 3JYTA 3ISDA 4CEAA 3MEDA 4F4ZA 2F8SA 1H38A 2PYLA 1ZQJA 5KFDA 4YN4A 3BQ1A 1Q8IA 1TL1A 4KLDA 2Q3SA 4RW6A 4QZEA 1XSLA 1RCHA 2J6TA 3NH2A 1RT2A 4F8RA 3G6YA 4R5PA 4KHSA 5J2KA 2HNDA 3M8PA 2GV9A 1O1WA 1I39A 5L1IA 5J2IA 2RN2A 1TK5A 4O3QA 3AUOA 4ED3A 4DTUA 3OYNA 1N6QA 4DSIA 2MAXA 5J2NA 3KK1A 4RPXA 5C25A 1HUZA 1S5JA 3TFSA 5DBAA 4O3NA 3DOKA 4KAZA 4I9LA 3Q8RB 4DQSA 4RW7A 4AH9A 4DS4A 2DPIA 3MR3A 4KLHA 3MBYA 3HVRA 1RTJA 3SNNA 4O5EA 1KLMA 4J9PA 2ZUBA 3O4NA 3ZSWA 4B9TA 4KMUA 4MFBA 9ICXA 4FLYA 4IQUA 2X6SA 3K57A 8ICEA 5J2QA 3K5MA 2DFFA 3ZCMA 2XGQA 4E7IA 3ISNC 4ICLA 1SZPA 1C0TA 4I2FA 4FLUA 1WNSA 2AJQA 5L1LA 3TQ1A 3QIPA 3QEPA 4CHPA 1HJRA 3C1ZA 5J0OA 2KN7A 4GXJA 2ZQBA 3GFKB 4ED0A 1JIHA 5KFFA 5J2HA 3N97B 1HYVA 2B5JA 4N76A 3DYAA 5KFTA 4GXKA 3OYCA 1IKXA 3AVNA 3HVTA 1A76A 4IRKA 5CZ1A 2A1JB 4IQWA 2LSNA 4FVMA 5CYMA 2XY6A 7ICGA 2BPCA 5J0YA 3IRXA 5EWGA 2G8IA 5IIKA 4F50A 4YD1A 1DGSA 2RDIA 2ASLA 4KB1A 2YNFA 3MR6A 4RZRA 1T05A 1CZBA 5J0PA 2ZTDA 3V9ZA 1V9PA 1ZQTA 4ZTFA 1MSWD 2IA6A 2BGGA 4BE1A 2OPPA 3M9NB 1D8YA 4DQRA 4CESA 4ELVA 4LVSA 1UT8A 1ZQXA 1L3SA 2YHBA 4CEEA 4F2RA 4DU1A 4CFDA 3PR5B 3BQ0A 3SUQA 4DSFA 5KFYA 3M8RA 4RQ1A 4CEOA 1T8EA 3ZSQA 4P2HA 4ID5A 4FJKA 4M42A 4KN4A 5J2JA 4F4WA 3Q8MA 5KG0A 3LDAA 4IG0A 3KKSA 2IS3A 3H4BA 3HSTB 2EHGA 1VSDA 4W5RA 4BACA 2KZZA 1WAJA 3BGRA 4B3OA 4JV1A 3SQ4A 4QCLA 5F9LA 2W8KA 2VA8A 1ZQPA 4CGJA 3KD5E 4H4MA 2G8UA 2FMSA 5DQGA 5KG2A 4DL2A 4ECXA 3TAQA 1T03A 1VSJA 1WSFA 4I2DA 3F9KA 4GC6A 1U45A 4F4KA 3RH5A 1TAUA 3HL8A 3SQ2A 4FJ8A 2VWJA 2VG7A 2P5OA 1F21A 4FLWA 2WONA 5HNKA 2HHVA 3DLEA 3RB4A 2FMQA 4QZFA 2E6LA 4ECRA 1RILA 4CEQA 4QWEA 1RDCA 4LSNA 3MR2A 2G8VA 3SI6A 3V9WA 4FO6A 5J0QA 4ED1A 1EP4A 5KFVA 2VA2A 4DTNA 1WLJA 3VQ9A 2GBZA 3PX6A 4QZ9A 3JPPA 2PY5A 5CJ7A 5FRNA 3RH4A 3VQ8A 5KT5A 1W0HA 4I27A 4IFVA 4CJPA 5L1JA 1R0AA 3B6OA 4PGXA 1BI4A 1CXUA 3LALA 8ICKA 9ICOA 1X2IA 4YG2A 4TQSA 4Y1CA 4KLLA 3DLRA 2J6UA 3NGIA 5C5JA 1Z25A 4ED6A 5FRMA 1ZQBA 1ZQGA 2C2EA 4CJWA 3ZD9A 1VRUA 3SJJA 1BGXT 1NK8A 3OYJA 4C8LA 5HRRA 2P51A 4DTPA 3L2UA 5IIJA 2F1IA 4IFYA 4QZCA 1NKEA 3WNHA 4NCGA 2NRZA 3T5HA 3C5GA 4EYHB 4FZZA 1JXEA 3SUNA 5J2MA 2FBYA 8ICUA 3V9XA 2YKMA 3AVKA 2YHAA 3ZSRA 4MFFA 2FC0A 5KFEA 3GV7B 4BWJA 5KFLA 4WE1A 5KFIA 5DB8A 3K59A 4Z0UA 1IM4A 3CG7A 7ICTA 2F8TA 1GOCA 1Z00A 4XA5A 3NGZA 1KTQA 2PYJA 4ECYA 1HRHA 9ICQA 2FLNA 1JX4A 1HYSA 3ETLA 5KFWA 1XHZA 4FK4A 4LSLA 3MGHA 4FM0A 1ZQYA 3OYLA 4TUSA 1FKOA 4FLXA 1RXWA 3GQCA 2O4IA 2E4LA 3UXPA 3MDCA 3RJHA 3U6FA 5KG7A 3HP9A 3TFRA 3SI8A 3H4DA 1KVBA 3MECA 4B9SA 2R8JA 3BJYA 1EKEA 3K5OA 3NHGA 5I3UA 3LDSA 4KLIA 4UB3A 3V1QA 4H4OA 5KG3A 1LAVA 4ELTA 3OYFA 1D5AA 4JS4A 4RQ0A 2V4RA 4CIGA 3HPOA 4DFJA 2V9WA 3ISBA 1LWCA 8ICSA 1TL3A 4M9JA 3K4GA 4DOBA 4P4PA 9ICPA 1S76D 1J54A 1VRTA 1YVUA 3T5JA 3RRHA 5KG1A 5D3GA 5C24A 2AQ4A 5CP2A 4EEYA 3THVA 2R8GA 4MFAA 1JLQA 3AO3A 2QKBA 3DLBA 3UPQA 4CECA 1HQUA 3V81A 3VQBA 7ICUA 1IKYA 4O0JA 5CYQA 1U9LA 1IH7A 1U49A 4JV2A 9ICJA 2EX3A 4KKOA 4DL5A 4QZGA 3ZSVA 2BHNA 4I9QA 1HUOA 4BDPA 3OYKA 1RT5A 1ZJMA 2RF2A 1ZQLA 4I2AA 3GILA 5BOMA 3M9MB 1C6VA 3AU2A 4J9RA 2UVUA 4Q8FA 4DL7A 4KTZA 2E6MA 5KFGA 1X9MA 2IMWP 1CLQA 3OHAA 2BPFA 2JEIA 3EPGA 4I2CA 5J2FA 4OLAA 3RJFA 4Z4GA 5IIMA 4OPJA 5J1EA 5IIOA 9ICAA 3CQ8A 3NTUA 3OSPA 4ELUA 3CFOA 4ZHRA 1UA1A 3MEGA 2W42A 4YVZA 4AHUA 8ICLA 2B21A 4W5OA 2WTFA 3JPOA 3QEBZ 1TK0A 5CA7A 5JS2A 3NCIA 5HP4A 4LH5A 3L2VA 3SPYA 2PFOA 4R8UA 1XWLA 3PW7A 4EBEA 3AVCA 3SV3A 3RR8A 3DRRA 1XSNA 1WSJA 4EZ6A 4CJLA 4OPKA 3AU6A 1K1SA 3Q8KA 2NRVA 4KHYA 1RTDA 3E2EA 4FJ7A 3SPZA 3SUOA 3PX4A 4AHSA 4AHCA 3MAQA 2FMPA 3NAEA 3E01A 3ULDA 9ICEA 8ICZA 5KG5A 1QQCA 2OYQA 3MXMA 2O4GA 4CGHA 3AO5A 2P5GA 1N48A 9ICTA 3NF7A 3O3GA 4DOAA 4YFKA 4CJSA 4DF8A 1MQ3A 4M04A 2F96A 4FJHA 3GIIA 1SKSA 4ECQA 4L8RB 4JWNA 4J9MA 1S1VA 2ZTEA 5KFNA 5L1KA 1RBTA 3NH0A 7ICIA 2ZJ8A 4QWCA 3OYBA 2B4JA 3OS1A 2BCVA 2FLLA 9ICGA 4IR9A 1VSKA 1K1QA 4J2BA 1S0NA 1NK6A 4KLUA 3ASMA 4MQ3A 3SQ0A 1NOMA 2BANA 4M3RA 2Y1JA 3AO2A 4YD2A 4KV8A 3TWHA 4DU3A 1RT6A 3AA2A 1EX4A 4W5NA 4QWDA 4ZH4A 1RDDA 1JL1A 2OZSA 3DMJA 5K14A 2ZUDA 3IHQB 4BDYA 1ZQKA 1B9DA 1XO1A 3TANA 3V6HA 4OGEA 2ASJA 3AA3A 3OS0A 3JPRA 4GXIA 4Z4EA 1JN3A 2OPRA 4PHDA 4Z6DA 1SL1A 4DFMA 2G8FA 9ICHA 7ICLA 4NYFA 2NUBA 3OYMA 2ISPA 5CWRA 3QO9A 3QERA 4DL3A 5KT2A 3OJSA 4FZYA 5FDLA 4RUCA 1TV9A 3AVJA 8ICXA 4CHYA 5BPCA 3H8JA 2HVHA 4IBNA 5KT6A 5KFSA 2XO7A 1BQMA 1LWEA 3TAPA 3RJIA 8ICCA 1B43A 2P6UA 1LWFA 3T3FA 1XSPA 3PMNA 2AGOA 4FCYA 4J2AA 1N56A 2DFEA 1TKXA 1Q9XA 3AO1A 3CM5A 4ECZA 3MR5A 1BPDA 3OHBA 1VSHA 1TVRA 4YMMA 3TABA 4UB5A 3V7KA 1AROP 3WNEA 3HP6A 3HPHA 4KPYA 3FYHA 3CFRA 1ZQMA 8ICMA 9ICBA 3HO1A 2BGWA 7ICQA 3IM1A 3C5FA 3V6KA 1J9AA 4QW8A 4RW4A 4X5VA 4OJRA 5J29A 3SYZA 3NGDA 5KFJA 1I3AA 1A5WA 1DLOA 2YV0X 3VQPA 1NK4A 4CFAA 9ICKA 4RNMA 8ICNA 4M47A 3LP1A 1LV5A 3ZDCA 4CGDA 3ALYA 4F5NA 3AVFA 1ZBUA 1BPBA 4P4MA 1RDAA 4CJQA 4AHTA 5DG8A 1RT3A 2FBXA 4N41A 7ICJA 4RQ2A 4J9OA 1ZQZA 2BKEA 3V72A 5J2CA 3M9OB 2A1JA 1X9WA 2FPLA 3BQ2A 4KREA 4EYIB 4EBCA 1SL0A 2BQUA 3SQ1A 4FXDA 3MEEA 4TSXA 4IKFA 3ZDDA 4XIUA 4BXOA 4JWMA 1TVAA 3PO5A 1VSLA 1QS4A 1NJXA 3MGIA 1Y88A 4KB0A 2XCAA 2XHBA 8ICBA 1LW0A 5KFUA 2KW4A 4CF0A 4HCBA 1X9SA 4B9NA 3AVGA 1YT3A 3DLGA 3F73A 4E7JA 1ZQVA 4PQUA 5J2DA 1XI1A 1BCMA 4IDKA 3H08A 4CJRA 5J0WA 4PWDA 2C22A 1RYSA 4NCBA 3FDSA 7ICNA 4DLEA 1C1BA 3AV9A 2UVWA 1ZQEA 3C21A 4YXMA 1XS9D 2XY7A 1WSHA 4M2YA 1D9FA 4NLNA 4M3TA 3NF6A 1BHLA 2OZMA 4FS1A 1A5VA 1ASUA 4MEYA 1SV5A 4KLMA 1JLCA 1S0MA 4YR0A 2M9NA 4UBBA 4ECUA 3LP2A 5KRTA 2PI4A 3GV8B 3RB6A 2HVIA 1TV6A 4HYKA 1KVAA 1NJZA 2GUIA 2Z1IA 3JPTA 4BE0A 1J5OA 4UB1A 2IAJA 1HYZA 4CE9A 2PFPA 5J0SA 2DY4A 2FPKA 1ITGA 2RPIA 4I2BA 5KFQA 8ICAA 1C7YA 1TK8A 4TUQA 3EW9A 8ICJA 4B9LA 5FROA 3G0ZA 1BCOA 1S0VA 4LD0A 2Q0ZX 3GV5B 1JLFA 1B9FA 1ZJNA 3KLIA 4DTJA 1DOQA 5DLFA 1SKRA 2BPGA 3KLFA 1QHTA 2KFZA 2IHNA 2H5XA 4KLFA 1FXXA 1FKPA 5KFHA 2BCUA 4UBCA 5EOZA 4W5TA 2BR0A 1VSIA 1XHXA 3B0YA 5DQHA 3QESA 3C95A 4DSKA 2BE2A 2C2RA 3AVBA 3RR7A 4EZ9A 4UAZA 2FLPA 1T3NA 5KFBA 1T7PA 4MEXA 1U4BA 2HW3A 4XQ8A 3LP3A 1NKCA 4QZDA 4FLZA 4DQQA 1JLAA 4Z6FA 1A77A 4RNOA 5KFMA 1EXQA 4GC7A 2KTQA 9ICWA 4Q44A 4GMJB 5DBBA 4IG3A 2OPSA 4J2DA 4FLTA 4DSEA 3SV4A 4PUOA 3Q8SB 4ED8A 1KDHA 2X6NA 7ICRA 2W9CA 2J6SA 4Z4FA 5KG6A 3DRPA 4NCAA 3ITHA 2ZUCA 2V4QA 5HBMA 1NK5A 4EBDA 2F1HA 4NXZA 5T7BA 1WSGA 3UQ2A 1MC8A 3UQ0A 3FFIA 4MF8A 1L3UA 4Q8EA 3KK2A 3QEXA 3GDXA 3QZ7A 1RBUA 3JPQA 1S10A 4R66A 4Z4CA 4K8XA 4B9MA 4CHZA 4BWMA 4XUSA 8ICYA 1U04A 5DG7A 1DTTA 4CGGA 4CK3A 3EY1A 4KLEA 4RU9A 4FJLA 1Z00B 1IKWA 3ZT3A 3SUPA 1BVSA 1KSPA 3V6DA 2FPMA 1ZYQA 2R8IA 5TZVA 3HK2A 8ICWA 2NRTA 4QOZB 3JSMA 4F3TA 3QNNA 3QNOA 3QZ8A 4RQ5A 4FS2A 3QEAZ 1KFSA 8ICFA 5KGWA 4IQVA 3IAYA 2B6AA 3DRSA 3PUFA 5EU7A 2AQ0A 4RG8A 4CCHA 3V9SA 4DTMA 3A2FA 3T5KA 5DGAA 3KHHA 5IILA 2JEFA 4E0DA 3HPGA 4RQ4A 1S9EA 4ED7A 4QZAA 4QAGA 5DBCA 3S3MA 1GOBA 3V7LA 3OSNA 1JLEA 9ICSA 1BI4B 4M6WA 1L3TA 3VQ6A 7ICOA 2YNIA 4M9LA 1HMVA 5KFKA 3DOLA 4F93B 2PZSA 4E7LA
chains in the Genus database with same CATH superfamily
2A6AA 1TKZB 1IBKK 1WCNA 5A0YB 3CDEA 3PSIA 4DL6A 3EWAA 1TZ0A 1BMQB 2BE7D 1WOQA 3NNCA 1IBLK 2ZVSA 2WFBA 4ZITA 4E7KA 4LREA 3HLUA 1FE4A 3IFEA 3J7AN 1E6VA 5AZIA 2XGPA 2YKPA 1MWYA 1H2TZ 4DBQA 3CETA 3SMPA 5CYMB 5L38A 1ELOA 4M5GA 1TFRA 2BRLA 4X65K 1FO4A 1S9GB 2C3UA 3L4BC 3ZZPA 2UVRA 3BF1A 2C3PA 4C4WA 5HQLA 3S3NA 5IC6B 3AVMA 5AXLA 2BZFA 2B4OA 7ICPA 3CDWA 1UZHA 4EFHA 3PVXA 3KZIU 1CPZA 4BQZA 4R64A 3KK3A 3KHGA 4PH5A 1KVJA 3RUBL 3OTDA 2E1YA 4ILJA 1RAAB 4JK1A 4RQ6A 4OZJA 2W9BB 3TAMB 5HVGA 4OYXA 3VQAA 1NZBA 5GAGI 2IOFA 1SH2A 4K5RA 1N8RT 1WUUA 4AYBD 3RVCA 5DZ6A 4RUAA 3EE3A 1S6PA 5ETNA 3HJVA 1WCLA 3A0HU 4KN7A 5HRNA 2E1MC 1NJIT 4MJKA 1NDCA 2P9EA 4O9MA 1BUPA 1U26A 2MSTA 4DU4A 3GR0A 3N6LA 2EG2A 5H1SV 3TA1A 4ANCA 3HKWA 3CCTA 4R63A 3QLHA 2X1AA 3QU5A 3RJEA 1PO6A 1BNPA 3BP8A 4DU7A 1ZXOA 3EVWA 2VYPA 1PZNA 1QJHA 2A1AA 1RT4B 2RQMA 5AXKA 3AGRA 4DEZA 3FBBA 5DKWA 4C3MA 5KQDA 1D9DA 3K75D 2ISOA 4NB4A 2E8MA 1ZD5A 4NX9A 3X3UA 4CO0A 4USWA 4PPXA 1Y10A 3PNCA 1U0HB 2ZWOA 4PWWA 3H2UB 1OJ4A 5CR0A 1Q1KA 2MQNA 3VN5A 3ORYA 3PW2A 1S12A 2BW7A 3L3CA 4C4RA 2IHMA 1LW2A 5ALIA 4Z4IA 4M9HA 1VK0A 1S9GA 2I5JA 1L7NA 1T3VA 3NVWA 4PQUB 5ALZA 4F4YA 2JEJA 4DFKA 3QIOA 3V4IB 1E6YB 8ICPA 2FY1A 5LMUJ 5IZHA 2LEPA 2YX1A 4X4NA 4M3WA 1XERA 1N5YA 4Q45A 1Q16B 4X4RA 5GADP 4A8FA 3HJFA 1MQ2A 1AZSB 4PKDB 5DG9A 4J03A 3LAKA 3MM8B 4MLEA 5HLFB 1SQGA 4CP5A 2VJ5A 1N5SA 2HHWA 4K4IA 1UJ5A 3HMJG 4WE1B 3QATA 3OR1B 4ETXA 4YY3J 3LF0A 1MMDA 2QWQA 4C0HA 3CI5A 3FBEA 4ZVRB 3ZT2A 3R6LB 3W9HA 2D4WA 1LAWA 2WONB 1TL7B 3D1OA 4DV0F 2X51A 1R7IA 3FFIB 2E8NA 3AN1A 2D3UA 1X1PA 1MA7A 3J80U 1MDUB 4G1IA 4JMUA 1IG9A 1VSEA 3PIOQ 2G5IB 2Q43A 2QC3A 3UKUB 4HH0A 3QEIA 1SL2A 2NRWA 3M8PB 3C46A 3IGNA 4CIOA 3UD5A 5EX5A 2AYMA 4I2EA 3H90A 4JV5F 3N4WA 3ITHB 4J2EA 1UW4A 4XDDA 2HSZA 4YXJA 5KPZA 3CC7S 7ICEA 5F0UA 2MLYA 3BPDA 3OY9A 3H8MA 1RQNA 2CPXA 4GFJA 3SSQA 2CPEA 2D0AA 4A59A 3RMBA 5HMLA 3HHLC 1M6YA 3QEVA 3UXNA 4DV3K 3V5RA 3AVHA 4FVUA 3G8QA 3HD1A 2ALYB 4KGZB 2Z30B 4EFAC 4K4GA 2P9CA 2FQQB 2H3VA 2KN4A 1NJWA 2MLZA 4DV3J 3CMAN 2RRBA 4RW4B 3CJKA 3C2MA 4DF4A 3GP9A 2AHOB 2PFUA 4KX3A 2E1ZA 1UW9A 4NRUA 2JZBA 3BQTA 1RM6C 4JI8K 2P9NB 1BISA 3I0RA 1D3WA 4DTSA 4DSJA 5D4NA 5EX3A 3MMJA 5ALLA 1BQXA 2KG5A 1NOYA 3L2QA 2LBOA 2ZBRA 2DKXA 3FFKB 5C2DA 5KFCA 1FRXA 3AB4B 2AP1A 3T19A 1NKBA 3OJUA 2BKOA 2P9KB 4I6MB 4G3IA 4YUDA 4B3RF 5GADU 4F5QA 3H2VE 2C2MB 1L3VA 4CHOA 3ENBA 3LDQA 3G6EN 1WF1A 4I1TA 1TFWA 1X5SA 1UETA 4ILGB 4S0MA 5HP1B 4A8SA 2N3LA 1IG8A 3HZ6A 4WFZA 1RBVA 2FIUA 3S6JA 4CZHA 4F5OA 5D4OA 3RMDA 3B6PA 3ZLJA 5FPEA 4X62J 1KTVA 4XK8C 3Q8QB 2RS2A 1YJVA 4A8OA 3ZZUA 4I6YA 2DTUA 4YDDB 1JKHA 1O03A 4CJKA 2AXTU 2VA3A 4HUEA 4A8EA 4MK9A 2MUTB 3RJGA 4LR7A 4PGYA 1JJHA 3OYGA 3CJ1A 1PKUA 4U8YA 5DB7A 1S72S 2GNKA 4DTRA 1WI6A 5AKEA 1Z26A 1HNWF 1JLQB 5ALGA 5AKJA 1S97A 2KSOA 2NLXA 4I56A 4RQ3A 5B0CA 1OVYA 2NRHA 4ZCLA 3I5CA 5LMUK 4KI6A 2OEHA 2HS3A 2O1PA 4Q43A 1FK9A 5BRHA 4AM6A 4IQTA 2DR5A 4UOHA 2ETJA 4KH1B 4HHTA 2XS7A 1RU1A 1I3OB 4PGQA 7ICFA 2VIXA 4JI2F 2CG4A 3BGUA 3R97A 2ZJPL 5JXSA 2LA4A 4JKGA 3C7NA 2FJEB 2KG1A 2X3DA 1L6NA 4DUYK 1NK9A 3M8QB 2XC9A 5IV3A 5ALEA 1A0PA 4C80A 4F0HA 2R3VA 3ID8A 3EZ5A 2A1RA 3A3NB 1RISA 1RT7A 2DGZA 1N63A 4NXNF 4XH4A 3DXMB 1ZAWA 1SC1B 1WBBA 4Z2XA 2XBPA 1ZBIA 4X84A 2UU9F 4JI1J 1SH0A 3CJTA 3M7VA 3G6XA 7ICMA 1FXLA 3DRRB 3L8BA 5CCMA 1OYDA 1X0PA 4FJJA 4EIAA 3HHEA 3CMEN 2CG8A 2VWBA 1UP1A 3UFCX 3NCQA 4CK2A 1EP4B 2PEHA 3ZDBA 4LF9F 1JWWA 1QZ5A 4DJBA 4OLBA 2LYHA 1U1MA 1O0PA 1F5BA 1AUDA 3TTCA 5I42A 4QR2A 2MUTA 5JMNA 4W92B 1VQ7S 1VIOA 5SWMA 5GTIU 4DV2F 4LFBJ 4JOUA 2YWWA 4B3MJ 4RQ8A 4K4XA 5AFUA 1RHKB 4KITB 4EWTA 5IT0A 3QQCD 2IAJB 3IAM9 3MCPA 2AEJA 1U24A 3IWXA 4LFBK 4YOUA 2Z1JA 3I4HX 2ZIXB 3L7UA 3EUB2 3WNGA 5HMMA 5F8IA 1YAGA 1S6QB 3CFPA 1RT4A 3BF4A 1F9HA 1RTHA 2CDQA 4RR5A 4KGKA 1NH7A 1RWKB 2Z58B 4LBPA 2C2DA 1R3NA 2WVBA 1ZBTA 3A1YG 5K4LA 2HF4A 1N4LA 3WKAA 2AU0A 4ZPDA 4KHNA 2AWZA 5J2PA 2XY8A 2HHPA 2CGKA 2BCQA 1HHSA 3S1TA 3Q83A 2XSJA 4TU7A 4CF2A 1B0XA 4UQTA 1NK0A 4YCXA 4X64K 4NYNA 3QT5A 1ZQUA 5RUBA 1QSLA 3BV8A 2ZF5O 1FX2A 3N4MB 2OEKA 4OMFG 1B22A 4J9KA 4IWVA 1GLFO 1FO1A 1U8WA 2HNYA 3C6TA 4H8KA 1RAJA 3S6EA 2DIUA 3IBPA 1SCJB 4ZVPB 3B8AX 3KKRA 1LNQA 1FVSA 2MQMA 1S49A 1YZ6A 3D7EO 3VEYA 3T1HJ 4I2HA 3UCUP 4DO9A 1RADB 2GMHA 3MMCB 2KVCA 3OUYA 1NGGA 4LZGA 3IR5B 1YJNN 4J7CA 4IG3B 2YNGA 4DTXA 4EELA 1VI7A 3AD7C 4CLFA 1A5XA 3V4IA 4CJUA 2I1QA 2JH7A 3RF9A 5HVHA 2IGIA 3GJTB 5M1PA 2KZMA 4JEPA 4B8AB 3L3UA 2F9DA 4UW9A 4X66J 3JPNA 4MLHA 1UHUA 3EZUA 3GJRB 5D0RA 2DH7A 4NLVA 2KT5A 4H4KC 5JJBA 3CCMN 1SWVA 2UUCK 3QNMA 1NK7A 3JPSA 4CJTA 2YWKA 4MFBB 1NM2A 5GMEA 2CDRB 4PWUA 2HHSA 1WSIA 3BS5A 1YRTA 2WBMA 4N7TA 1BL3A 1KEJA 2Z2YB 3N7PD 4YHHJ 1JL2A 3GR1A 1ASVA 2HHXA 4J9VA 2PMZD 3T1AA 4BG9A 3EGNA 4B3SJ 3ULEB 4L73A 4GKKF 5HR7A 5HROB 8ICGA 4X66F 1LOTB 2KI2A 3E0FA 2V4JA 1SJ4P 2W40A 4EHTA 3TAFA 3DXKB 4NLBA 2IM1A 3V1RA 2ZHAA 2H51B 1UWBA 1NUEA 2EFNA 1Z19A 1FEHA 1UCNA 3A5MC 3W2VB 4Z6EA 3KVGA 2KVSA 3ETOA 4OHXA 3O4WA 4TYAA 3FSIA 3CC7N 3P6YC 1HI0P 2XSJB 3D6MB 1U2FA 3MM5B 3KHLA 5JLHA 2CRXA 2YX8A 1HW9A 1ZM9A 1WELA 1G2EA 2D74B 5CHCB 2WB4A 3FVYA 2ATCB 2DVIA 2VG6A 2DT9A 3O5TB 4KGVB 2VC0A 3TR8A 1UEUA 2A5XA 2DFHA 2QW9A 4PZNA 2DH8A 2XYGB 5DRKA 5HO4A 1WKLA 4DCJB 5ALMA 4ZDNA 2KH9A 1KVCA 5KL8B 3A3OB 3NFAA 3TTDA 2HNZA 3O1WA 4OYWA 3UVJA 1RDFA 3VESA 9ICMA 4A57A 4F5RA 2HK2A 2YNGB 4FJXA 3NF9A 4KI4A 3SZ2A 1W2IA 3CW2C 2PFNA 4C1NK 4CHQA 1S1VB 5E26A 1JJ2M 4CO4A 3DM2A 2J0QD 3US5A 3LZJA 4XRHA 5KTQA 3H2LA 4OX7A 1HL6A 4DV6J 4C3LA 2F7TA 5L9XA 2WHOA 2ROGA 3RW7A 3R5BA 3PACA 3NWRA 2ZH7A 4DR7F 4LF1A 2X74A 4FWLA 1HQEA 4HUGA 4FO0A 1RNHA 2EFVA 4R8UB 1FD2A 3DLHA 4CEBA 3FBFA 5HQMA 2B0GA 2V7YA 3KLGB 2AT1B 4CH0S 4DV4J 1K8AO 4JI1F 1BPZA 2VWKA 2KFNA 3IA0A 3PV8A 2JWKA 3D1QA 2HHQA 2AJ1A 1JLBA 2MEWA 2NSBA 4IJAA 2V68A 1VISA 2UXDK 3F5EA 2GMJA 2IJNA 4ID8A 4W5QA 4NM2A 2ITGA 3CYMA 4O5KA 1NMNA 4HCCA 3FCVA 2HAIA 4JHDB 3MI7X 2UXCK 4CH7A 4B3TJ 4J9SA 2DKZA 3CC2N 1UA0A 2DNHA 4CEAA 2OH2A 5DM7L 4F4ZA 3V81B 1SVDA 1NLVA 3V4MA 2VPZB 5GVQA 4YN4A 1TL1A 2ZIUA 5FLXY 4ACOA 4QZEA 4RW6A 3SCLE 5HJYA 3NH2A 1UVIA 3G6YA 4YDUA 1IVZA 3ISZA 4PG4A 3VGKA 3KMQA 5CQGA 1BA0A 3M3ZA 2CPJA 3C66A 2IA0A 2DK2A 4YB7A 4C4TA 2QYGA 4XEIA 1IIPA 5DM7Q 5AI9A 3ZZRA 4JI4J 5C25A 1HUZA 5D78A 4QQBA 4WFAL 3A8KA 3LH2S 2JVRA 4CDGA 4QJFB 2OANA 4DQSA 3HCXA 2BKNA 1CG2A 1RTJA 4O5EA 1R8AA 1KLMA 1VLBA 3O4NA 3KWMA 3F5AA 4JKCA 1FDAA 2O3DA 4MFBA 2IJFA 4LIRA 1OIAA 3K57A 1RP5A 5J2QA 3ZCMA 2HSTA 2XGQA 4E7IA 3CDAA 2HSEB 5AQYA 4CGZA 4FLUA 3C1ZA 5J0OA 4GXJA 2ZQBA 1JIHA 3U27A 1QAXA 5J2HA 1HYVA 2H9ZA 1YVNA 2RSQA 2ZE2B 4QZVB 5KFTA 3O6WA 2KSOB 1XMBA 2VFRA 1WWVA 3AVNA 4JYAF 3HVTA 3R8YA 1IXKA 3MZIA 5CXTA 2A1JB 4FPIA 4M5KA 2QWPA 3SFUA 4FVMA 4CLTA 4OJ3A 4OYZA 3O2IA 4X4QA 2F8HA 2CFXA 3PRDA 2NCKL 2G8IA 2EAOA 1SC3B 4YD1A 4OZ2A 2YNFA 3MR6A 2ZOGA 5T7LB 2UUBF 5K20B 1BA1A 1FI4A 1U2CA 1N52B 5G5GA 5B0EA 4LF6J 5FIIA 1EQYA 3LVWA 1J5EJ 2IA6A 3QDKA 2BGGA 3HSGA 2FI1A 5GAEU 2JHDA 2BUNA 1VAZA 2IM2A 3CCSN 3KLFB 4CFDA 1GFWB 3PR5B 4I6AA 4YOVA 3M8RA 4CEOA 3DN9A 4X2BA 3C7NB 4FJKA 4UAUA 4M5NA 2RRAA 4F4WA 1SJ1A 5ETLA 5KG0A 2V7ZA 3CCVS 2IS3A 2EHGA 2AW0A 2UXBF 4W5RA 4BACA 2KIWA 1WAJA 3SQ4A 2HOEA 5FPNA 2G8UA 4NYOA 1X8DA 1JLCB 4BC4A 4UASA 2YKQA 2VQEK 1VSJA 2DCUB 2CXEA 4RTFD 4A8WA 3HILA 2OI2A 3MDFA 1BXNA 4ZHRB 1APSA 1U45A 4GRSA 3M7DA 2VQEJ 3ENHA 1F21A 4FWPA 4O23A 1ZAVA 4GV3A 4FLWA 4A8KA 2E8OA 3EKUA 3TEGA 3RB4A 2FMQA 2E6LA 5M1FA 4PJ0U 1RILA 1IN0A 4LSNA 1OO0B 3MCSA 4XH1A 3DM2B 1U1RA 1I1GA 2RLTA 5GAHP 3MCMA 1X9JA 4DTNA 1JMTA 5JU5A 1SBRA 3CQXA 4QZ9A 2PY5A 3AJ1A 4RWWA 2B8QA 3AM9A 5KT5A 1VQ8S 2J5AA 2QZ8A 2Z0GA 4CJPA 1HPMA 2P9SB 5KAFU 1U0HA 8ICKA 5F3ZA 1YI2S 1FFSB 2Q36A 1VRTB 3WIVA 4LFCJ 2E1RA 5TKYA 1RAFB 2C2EA 4H54A 3ZD9A 3GFHA 4JKAA 4DR5F 1YF5L 1NKEA 3C5GA 2E66A 1M5PC 1JRPA 3MM5A 1FX4A 2FBYA 1S5ZA 1NGFA 3V9XA 4ES2A 3AVKA 3GV7B 3VAHA 5KFLA 1RHMB 4WE1A 1OH6A 3D6RA 4H5TA 5EXWA 2KJ5A 2RMLA 3T6BA 2ZITA 4QYZJ 1TMJA 3UVJB 1RTZA 1HW8A 4XPEA 1S22A 2R7WA 2FLNA 1KBRA 1XHZA 4LSLA 3MGHA 2QTDA 3LDLA 4TUSA 1NU4A 2J7KA 3A13A 3MDCA 4UATA 5LSRA 5AM5A 3SI8A 3VAGA 5K8NA 1HLWA 2GH1A 1CBKA 3TO8A 4B9SA 3K5OA 3DWLA 1YJ9S 2CJAA 4UB3A 2VH7A 2K1RA 3P8BB 4ELTA 1N36J 1ZAXA 4RQ0A 3BYPA 1EARA 1UTAA 1HBOB 1J5OB 2DD8S 4NI2A 1Q86T 4NA1A 3K4GA 3OL7A 2GVDA 3DDNA 2AQ4A 5IWAF 3THVA 2JFKA 4ZVHA 2ZH2A 3BZCA 1DQ9A 4MHVA 2LYVA 3LUYA 3BB5A 4ZN1A 1HQUA 5C2CA 3ZX0A 5AR0A 7ICUA 1IKYA 5JRTA 2RHSB 5LOQA 4KKOA 2NXNA 3SBMA 1KWMA 2X7IA 3I0RB 5ALQA 4BDPA 1ZJMA 2W7PA 5BOMA 3M9MB 2O8EB 5G4DA 1I94J 4DL7A 3VWSA 1SXEA 4KY3A 2P9IA 3LM9A 2WF9A 2BPFA 3JXUA 3EPGA 4I2CA 5J2FA 2QIFA 4OLAA 1BLUA 4ANDA 4ILHA 4USIA 1EIYB 1SUQB 1LVHA 4QJVA 2DBBA 1QQNA 5EE9A 2ASMA 3VEXA 4OV1A 5IIOA 3OSPA 4ELUA 1UA1A 1O5JA 3W8PA 3LDPA 2W42A 3EDQB 2GHVC 4H5WA 1YZ7A 4YVZA 3D68A 2B21A 4KPCA 1PYTA 5LSOA 3UR0A 3J7ZT 2MKKA 3QEBZ 5CA7A 3ISND 1P1TA 2I1RA 2LA6A 2YKNB 5DDQC 3ZTSA 2PFOA 1TL5A 1GLJO 4LH5A 1XNQK 4CDIA 3AQPA 1R89A 4LSLB 5MAOA 5IT9Y 3PW7A 1WWUA 3ZFVA 3AVCA 3GJSB 1Q18A 3TA0A 4KMOB 1WSJA 4CJLA 2A19A 5B09A 3TA2A 2NRVA 4KHYA 2XWXA 1RTDA 3E2EA 4RNFA 2JRSA 4FJ7A 3SPZA 2FC9A 4RKUC 2VV5A 1HA1A 1JQGA 3U7JA 3E01A 4KT0C 4N8OA 3ULDA 2F4FA 3D2NA 4WFNL 3C6UB 1Q81O 2YHYA 1NBEB 4CGHA 3VVUA 4LFCK 3O5BA 1N48A 9ICTA 2P5GA 2DR7A 1W25A 4YFKA 3HI0A 1MQ3A 1GLDG 4ECQA 2DY1A 3R1LA 4JWNA 1IBKJ 1KL9A 1X42A 1FWPA 1NGDA 2DR9A 1U1LA 2ZBCA 3OS1A 1X6JA 2FLLA 2QLBB 2DNRA 2ZBQA 3MD3A 3PYFA 1RTHB 4G9ZA 1NK6A 4CLWA 5CR4A 2BE2B 1VHXA 2VBXA 2BANA 2Y1JA 1WC0A 2R42A 1OQ3A 3CD6S 4C98A 2KHCA 4ISFA 1ZS6A 2P9PB 4ZH4A 2IM0A 3CERA 2CQ2A 4R25A 4I64A 4WKYA 1QVGM 2OZSA 1GMWA 4QOTA 3AJ2A 2I2YA 1T6CA 1B9DA 4OGEA 1S6UA 2XLIA 3OS0A 2MY7A 3UNGC 4USVA 4DV1F 4B1WB 4UAVA 2YH1A 4JD2A 3ATVA 3GYXB 2W7AA 2V8PA 2I7NA 4NYFA 3OQ2A 2NUBA 1MLAA 3D7SB 2XI9A 1NSQA 3OJSA 3ENAA 4OYIA 2QWRA 1ZC6A 3R9KA 3AB2B 5FDLA 2BA9A 3ZEUB 2O8CA 4CHYA 5BPCA 3FRYA 3G8SA 5KFSA 4R5PB 1JNZB 2MPUA 5E3PA 2BH1A 2P6UA 5F8LA 1VQLN 5JVHQ 4J2AA 3KYLA 1ZD2P 3BQ7A 3VGTA 3CM5A 4ECZA 3N7RC 2DHHA 3L7OA 2G07A 2DNLA 3OHBA 2WB1D 1NPRA 2WUSA 1IBMJ 4YMMA 1GLEG 1LQ9A 2A10A 1NO8A 1AROP 3HP6A 3HPHA 3LYSA 3CFRA 4NO7A 2IRXA 3W5XA 1Z1VA 2BGWA 1GNKA 4RWTA 1HYSB 3QFHA 3IM1A 2EDUA 2BM1A 2IVOA 1RAEB 2Q4TA 2OMOA 3CMAS 5IT4A 3J7ZO 3G8TA 1N0UA 3CIZA 3H6EA 1A5WA 2VGMA 1ZZFA 3H0RB 2RRDA 4ZKAA 3R6MA 4M47A 1FRLA 2VFUA 3D2EB 2WW8A 1LV5A 3IR7B 4CGDA 2VODA 4LMZA 1RDAA 2PMWA 2NO5A 1QAYA 3WKEA 2FBXA 4ZPTR 5GAGU 4RQ2A 1ZQZA 2BKEA 2DGSA 4IFYB 2A1JA 3QRPA 2XMTA 2ZJPQ 3J7AP 4CZCA 4KREA 4EYIB 4C48A 4BS2A 3H0MB 3JQMA 3Q86A 3U1MA 2GTDA 2YBVA 3CC4N 4FXDA 2O8FA 3MEEA 4TSXA 1ZA2B 5AKKA 4ZPVR 2WAQC 3GCWP 4JWMA 2ZZMA 2L9DA 3QRRA 4J37A 1VSLA 1NJXA 1XTZA 2HG4A 4ZCKA 1QVFR 1O13A 4KB0A 2XCAA 2QA4G 3NRWA 2XHBA 1A6SA 2DHAA 1NGAA 8ICBA 2ZJRQ 2EK6A 2VJVA 3DLJA 4NL9A 3AVGA 3AXMA 3BSNA 1KN5A 2RT3A 3U26A 1UCVA 5JVHL 1ZQVA 1Q82O 5LSLA 2GVZA 2FHJA 5EY4A 3P4UB 4IDKA 2KFYA 4DZ6A 1RYSA 2CJ9A 1YBUA 2VG6B 4NLUA 3BN4A 2W4PA 4ZPCA 2CQ4A 2HGMA 2M2BA 1ZQEA 2CPFA 3VAJA 1WF0A 2EK1A 2XY7A 3LOUA 1NXIA 1M1HA 1TL7A 3PYGA 1V6HA 2BANB 1ASUA 1SV5A 4H5VA 3MPYA 3QAUA 3GV8B 2HVIA 3MECB 4HYKA 2G0CA 2FPHX 2CWKA 2GUIA 3GG4A 4M5DB 2Z1IA 3D2FB 3JPTA 4BE0A 3VVTA 2IOHA 2VJ4A 1HBUA 4HVZA 3K1ZA 5ELZA 2QXLA 3BYRA 5ADXA 4CE9A 5J0SA 1T03B 1N32J 5AQGA 4LUBA 2ODGA 1NHKL 2H1YA 3G0ZA 5ALUA 2LQ8A 1S1WB 3QUQA 3BO2A 2V0NA 5AI5A 4PKGA 2AEMA 2MJNA 3T79A 1R8HA 1KR4A 2ZD1B 2YWHA 2Q0ZX 1M1GA 3HF5A 1Q86O 1B9FA 4UZBA 4CNZA 2R7XA 2KEYA 2KFZA 2K8CB 2IHNA 4USMA 4DV2J 2BCUA 1Q7YO 4W5TA 1T3QA 4GKKJ 1VSIA 2FXUA 3C95A 1B0TA 3AVBA 2BZ2A 4B1ZA 3SCJE 1JLAB 5B5EU 1CC8A 4ZJQA 1T3NA 4CLSA 2YWFA 3CJ7A 1IWAA 3LP3A 3DLLQ 4F0MA 4QZDA 1RLDA 5ALSA 4DQQA 3MHYA 1NNDA 4Z6FA 2ZDOA 3R2DJ 4DX7A 2OLWA 4WP9A 5LMNF 4BROA 5GINA 2Y9HA 2E1FA 4IG3A 5CZVA 4CTAA 3WBZA 2OPSA 3GYGA 2XHCA 4DSEA 3SV4A 4KH0B 3Q8SB 5J8YA 3R5JB 5HANA 4IO1A 2QB0B 1XN9A 3NS6A 1NB2A 4KAIA 4I67A 2ZUCA 3E58A 2V4QA 3T6JA 4ID5B 5HBMA 3ZNUA 5H9EJ 4NXZA 4OHZA 2DRDA 4YOTA 3NS1A 6AT1B 3FFIA 5EGYA 4EAHD 1L3UA 1YX2A 4NWBA 4Q8EA 5J8YC 3KK2A 4DUZF 4MDAA 3QEXA 1FD8A 3HULA 2V51B 3BZQA 4R66A 3VQSA 4CHZA 1EWQA 1Q8BA 3MAAB 1ROFA 3AODA 3EUNA 1DTTA 2DGVA 4FJLA 2I6WA 4ED4A 3OL8A 2ZM6F 1KSPA 3L5KA 1VCTA 3V6DA 2FPMA 2O8CB 1ZYQA 4P52A 3QMLA 2G0IA 3O9TA 8ICWA 1S6PB 4YHHK 2G08A 3W2WA 2GIRA 4LIWA 4F3TA 3T9ZA 2MLXA 8ICFA 2YX4A 3H8YA 3GONA 2FZGB 4KV8B 4IXCA 2A2DA 2Z57B 4L75A 1GXLA 3H5YA 5IOLA 5BPNA 1X4HA 1XEZA 1PBAA 5EU7A 2AQ0A 5BRDA 2W25A 1SGGA 3FMWA 1REGX 3T5KA 4E0DA 4F04B 5AQXA 4DR3J 3DOMB 3O44A 3MN7A 1TAMA 5AQTA 1KVKA 2J76E 1JLEA 4V1Ak 9ICSA 3KFWX 2RHKA 3FUYA 1T3OA 5KFKA 4E7LA 4I2QB 1IBMF 4FOIA 4JLHA 4J9NA 4OKKA 1EKRA 4C8MA 1PK1B 2YJFA 2O8EA 3FKBA 3C6AA 3CJ9A 5A8RA 2QL5B 3OLAA 5F0XA 2G1DA 1KW4A 1DURA 3QU4A 1NPKA 1NWKA 3MAHA 3PW5A 2HMIA 2EZXA 2D0PA 1XK8A 4KHMA 3DCAA 2C2NA 4U6PA 1FESA 1I51B 2K4HA 1DT9A 3H0PA 1NSPA 2CH6A 5BOLA 2W3SA 4UQGA 4PAAA 2E29A 3ATUA 3DKDA 2QM1A 4JI3K 5HHHA 2QWLA 1UKUA 1WUAA 3M6UA 1C0MA 3CM6A 4KRFA 3NEKA 2GGPA 4A48A 1ATRA 5IWAK 1K73T 2V2ZA 2DY9A 2WSEC 2LPEA 3L6QA 3NUQA 3PRVA 3S41A 3IGVA 1SJ3P 3MPDA 1REVA 4NRTA 1MROA 4CIEA 2V52B 2FDRA 4FK0A 1C1CA 1D09B 5EOYA 3UR3C 2CPZA 1TKXB 2JH3A 2RIJA 5DS7A 3NASA 2X1GA 4TY8A 3HM9A 2H3IA 1WWHA 1ZQWA 5C42A 3OGUA 3H1VX 3PR4A 5J0UA 2HRUA 3H8WA 2VANA 1YGYA 3NH1A 3A12A 1GEHA 4AXIA 3B6BA 3OHRA 3G86A 2DIVA 2PA3A 4LFAK 3TZYA 3MWBA 9ICNA 2W8LA 3H20A 3ILJA 5J1PA 3TZXA 4AP9A 2GAGC 2A18A 2F9TA 1CVJA 2LU1A 3ZD8A 1RI7A 3ZSOA 3I8DA 3FC9A 3QB0A 3D6HB 4TQRA 3WNFA 2BCSA 2YQEA 3NGSA 2UVVA 2B9WA 4LF4K 3D0PA 2VDHA 4KJIA 1XMOK 4F91B 2K8BB 4M9GA 1TFYA 2ZG6A 4AUKA 5HATA 4YB1P 3OD2A 2L9NA 2JLFA 4DL4A 1NDKA 1VQ4S 5J0XA 3NBPA 2UXDJ 4K41A 3SDEB 4KQZA 1RDUA 2ZIXA 2QA4S 1WC1A 2K60A 1KVIA 4BRLA 5CB1A 1Q8LA 2HHTA 4QW9A 2A1BA 2LLZA 3UNYA 5BREA 4QIVA 1M5SA 4IEEA 3Q8VA 4RX6A 3ZETA 2E1PA 2XMKA 1HMVB 4X65J 2NYIA 1K73O 5CZXA 4LRAA 4TYBA 3SQOP 3BO4A 1D1UA 1VDVA 4WQ5C 3AQEA 1YKWA 3DU5A 5AQWA 4USTA 1A7GE 1GXTA 4I6MA 3EPIA 3CD6N 1D8BA 4U95A 2Y0SC 2JL9A 3RJJA 1ZQAA 4I2PB 3MOZA 2DGQA 2ZKTA 5E3AA 1UPMB 1VHFA 1IKVA 3U3GA 3MX2A 4R79A 4JYAK 2QMUB 1YUWA 3I56S 1ED1A 4ENOA 4FPRA 4AQYJ 2HFZA 3BGRB 3DGPA 3I96A 4IH7A 3UN3A 3D4JA 1F5CA 3SQGA 1CUKA 2LMRA 1VDHA 4UZCA 4O44A 1CRXA 2IVYA 4GKJF 4O55A 3ZSZA 2X78A 1HWUA 4FWRA 3AXKA 4DOCA 1HWLA 3KG0A 2MKYA 1OW5A 1JNRB 1RT6B 2BJ8A 3C94A 1HHQA 5KFZA 2NUHA 2XULA 3E8OA 3EN9A 4QWBA 2F9WA 3KK7A 1I5OB 4B08A 4Z7YA 3M32B 2HQFA 1W97L 1AA1B 4FPAA 1COOA 3MFHA 2MQQA 1YJTA 3H0LB 1ZM4A 4URGA 5DO2A 5AQFA 3KG4A 5ETRA 3TR5A 4BRHA 1NGIA 3RH6A 3EL2A 5E3RA 1SJFA 2W03A 4ZOSA 4AL5A 2KV2A 2PA8D 4JI7F 3TVKA 3MF5A 2BW2A 2OM6A 4WU2A 3HXMA 2HIQA 1FK9B 3EKSA 4Z6CA 3SCXA 3IM9A 4KLQA 4BGBA 4LFAF 1S0OA 2AA4A 5AZJA 2ASDA 1DQAA 8ICHA 1Q7YT 1GT8A 4Q2LA 3GIKA 3KKFA 4JI3J 4Y2VA 4CVNE 5T7LA 4Y00A 5DK5A 4K4YA 3E51A 1Y5NB 2C2ZB 3CHWA 3K2PA 4HI2A 4K4HA 4WFYA 2UUBK 5FDLB 2HVDA 1J5EK 4KH4A 3G10A 1NEEA 4OJGA 3N79A 2F4VK 1F5SA 4Q2MA 2G9OA 2C3MA 4BRAA 1SXLA 3ZEUA 3TAEA 1XMQK 3QEWA 1R59O 3TAGA 2JX2A 2W2OP 4DX8H 4CIFA 1TUYA 5IT9U 2DNZA 2F4VJ 1T9WA 1UAXA 5BYRA 1ECWA 4M94A 4B1YB 1S79A 4LF8K 3HBTA 2MKCA 3Q23A 2YHXA 3AHPA 4P4OA 4IOBA 1JKHB 4IEIA 2HYIB 3LDOA 3NS5A 4E89A 2EG1A 4BVPA 5B0DA 2Y9UA 3W9IA 1MN8A 2HIYA 4Z7CA 3UKRB 4CRXA 2D9PA 1GMVA 1WBDA 1VQ5N 1J27A 2G0AA 3MWTA 2PFQA 3T41A 2CRLA 5ETPA 4N47A 2UXCJ 5EWEA 3C6HA 3LP0A 2ZZTA 4ERDA 3D28A 2E9TA 3ZZOA 5J2GA 1OPIA 2MKIA 3D3CJ 2DGXA 1SIJA 3G87A 1QSSA 1CQNA 5M2PA 4OJLA 1ZQDA 3O3HA 3NF8A 3K2YA 1IUJA 2EFQA 2K3KA 4ATNA 5CD4H 2VPXB 3ENOA 2BV3A 1NDPA 1ATSA 4HTUA 1ZBHA 8ICVA 4IRDA 4CF9A 4P0PB 1W7AA 5H2FU 5B0GA 1NCLA 3RB0A 1T02A 4JI8J 4JK8A 4Y0WA 3PXGa 2WF5A 2P9NA 5HROA 3GCXP 1FNMA 2P9LB 1HLUA 2YKNA 3AL0B 1Y97A 3RAQA 5F3XB 4Y2UA 3GU0A 4WFBQ 1ZOTA 1KN6A 3S9HA 3R1HA 3VGUA 5CZ2A 4CWBA 4E1JA 2GGPB 2DYAA 4KHQA 2F1FA 1JLBB 3G71N 4R0JA 3HHKA 1CZ9A 3S3OA 4F72A 1XBWA 3UI3A 4LF2A 3GU3A 4C8NA 4C6AA 1T95A 1SKWA 2YX6A 3HYFA 3WQTA 4RPYA 3E9PA 2CQPA 2R4FA 1UMJA 3I5AA 1O6XA 1TUVA 2BJ1A 4H0OA 1RWOB 1ULRA 4R0EA 4KTWA 4E19A 4LBHA 4Y2QA 2V67A 5HVFA 3ISCA 1KEKA 2MGZA 2D3ZA 4ILMA 2FJ6A 1ZPVA 4A46A 3TYTA 4FJ9A 2E2QA 5LMNK 4UAWA 3SQIA 3QU9A 5AFUH 1XJWB 1URJA 3MM6B 1UJ4A 4YORA 1VQKS 4AHVA 4OL8A 1RBRA 2K4EA 4RW7B 1HD0A 4Z4HA 4BC2A 2PMZF 2OPQA 4RPZA 2HZAA 4TY8B 2JRZA 5E41A 2CIMA 1RHUB 5IS2A 4MK8A 3AA4A 4NOHA 1WC6A 8ATCB 4LF6K 2VASA 8ICQA 3QGPA 5AK3A 2ZC3A 1HNVA 1NPPA 4DQIA 4CGIA 1RWPB 4YQWA 5AI6A 4I0WA 4K50A 1RXOB 4KO0A 3R3LA 4CGFA 3E9LA 2O67A 2EFGA 1N61A 5K14B 3GJQB 5AQKA 3O80A 2R8KA 5AKIA 4N8NA 2DNPA 2BKPA 1URRA 4EX7A 1KCFA 2F40A 5FP0A 3DAWA 3C2KA 3FK4A 4W90B 4TY9A 2LU2A 3DC2A 2G2ZA 2KHQA 3FQLA 1WEXA 2G0JA 4CJ4A 5ADZA 4CD3A 4LZDA 4C7ZA 3KJFB 5KNIA 4KLSA 4KHPJ 4FFDA 3LGHA 2W9CB 4CFBA 1BC6A 4ZVEA 1VC6A 2WFAA 1S4FA 4M95A 3OYEA 2AGPA 2IBKA 5BJRA 4TNOA 1WSVA 2PEBA 4DV4F 1DGKN 4C7YA 3SENA 3IO1A 4OZNA 4I29A 4Y2RA 1QQMA 2A6OA 2BDPA 3SJHA 4DTOA 3PSFA 2P6SA 1VR6A 1S99A 1NMEB 1G99A 2NXCA 3DHXA 4W98A 4CH1A 3QAEA 4WXWA 2XMAA 5A2QO 1SWWA 2CVIA 3OYDA 2W9BA 3TAMA 2F8MA 3TUZC 4IO9L 1N33K 4B6JA 4JRQA 1SJQA 3BS5B 3RSEA 1SIZA 5ALPA 4GLXA 1V38A 1MG7A 1D0EA 3CC2S 4IOXA 2G1HA 3PY8A 3RRGA 4L74A 3NG8A 3Q89A 3W2WB 1XC9A 4HTIA 3M8SA 1GTEA 2P1JA 1CJTB 1KAXA 2VQFK 4F9OA 2ZJRL 1F60B 4UW2A 2Q0RA 1WG4A 4O5BA 5EWFA 2WOMA 4PHPA 1TAQA 4B9UA 2KJWA 5JVGL 4ID1A 4OI1A 1N8RO 4G1QB 2B56A 3LQVA 4LC9B 5A0YA 2LHTA 2XM3A 1UFWA 1ZQIA 1WNEA 2R7YA 4JS5A 1ZBLA 5LL6d 4KHPF 1Y64A 3VGSA 2VUGA 3WQUA 4MTPA 4K7QA 2YWEA 3CCUN 4M5DA 4CE6A 3FEYB 3RBDA 4USJC 4FF2A 3ZT4A 1TKZA 3KJVA 2YQ0A 4K42A 4BXOB 5D0GA 4BQLA 5KT3A 3IG1A 2BJEA 4H0YB 2DR8A 3W3SA 4RQ7A 1IR0A 2YKAA 3VA3A 2V4JB 2QEXS 1ZQHA 3UN5A 3LO3A 3VENA 4FW1A 2KHOA 3KK3B 4QZIA 3KUEA 5C15A 4MO5A 3J81j 3IBFB 3W65A 1C1AA 3IKMA 3L95X 1G1XA 5AQOA 2ZJ5A 2ZNZA 1RT7B 3D0HE 3K8WA 4GV9A 2OWOA 2QMXA 2DNQA 2DRAA 2D0CA 2NRRA 2Y0BB 4JI2K 1A6LA 4B9VA 3N5FA 2I38A 4BLGA 5AJ3F 2XWYA 4PHAA 2F63A 4U96A 5IINA 3ZZYA 3AVIA 3T1YJ 1VSMA 2LP4A 1BUXA 4ITSA 4JI2J 2VBYA 3CPWM 4MIBA 4CEZA 3KFUF 2DXDA 4UB4A 4C0OC 3KZBA 2YHWA 3M1FA 5J1NA 4IOAQ 5TKWA 3TVZA 3W8GA 3HT0A 3G6VA 2VFVA 1RTIB 4M63C 4P6QA 2VG7B 4ZVSB 1WAFA 1ZPWX 2CQHA 4OVLA 3MPWA 1W9HA 3DRPB 2F8KA 4Y2SA 4K4SA 4P0PA 2ZD1A 4WYBA 2Z8QA 1TMMA 3CJ5A 1NZAA 2ZBPA 1FT8A 3CULA 2QARB 4YMNA 1ZQQA 2HS4A 1S1WA 4KGXB 3HW8A 4ER8A 2DUYA 3IFRA 2V8HA 3LP0B 3IC1A 4E1NA 4WQ5A 1ZTWA 3ILIA 4ZJLA 1HQ2A 3GBTA 3LA0A 1VQ9N 1DK3A 1S57A 2ZE2A 3LPUA 4B3RJ 2E5SA 4AL7A 4WZMA 4B3SF 2CJQA 1RPLA 4PL1A 3D6JA 2Z1HA 3GMGA 4BY9C 4RBUA 3B82A 9ICLA 5KPRA 4B3RK 2VPYB 4CLZA 3KKAA 9ICFA 5DB6A 4EUVA 5FJ4A 4K8RA 4NXNK 3UWTA 7ICSA 4LY7A 2DHXA 3FBCA 4PABA 3JYTA 3ISDA 4FZNA 3P31A 1V9OA 2F8SA 1ZQJA 4QIEA 3BQ1A 1Q8IA 4U7CA 3CC4S 4JI8F 1TUWA 1XSLA 2KT3A 4OJ5A 1RT2A 4R5PA 5AHXA 1JJCB 1OWXA 2GV9A 2Y1LB 1DHMA 2XYPB 5L1IA 5IQQA 3VZHA 3BGFA 4Y2XA 1LK5A 1TK5A 1N32F 4O3QA 3AUOA 3M8WA 1N6QA 3J7YU 2FY8A 5IC4B 1NSAA 5LL6Z 2OPRB 4KR0B 3DGPB 4KAZA 4AH9A 2YTUA 2DPIA 1X4GA 3MR3A 2YWGA 2Z2LA 4FVCA 1J6ZA 1QQ5A 3NGRA 5KAIU 3SNNA 3F5TA 2W6LA 2Q2RA 2ZUBA 4C0BA 4LF5J 2ZWHA 2JH1A 4P2XA 1YJNS 1TYQA 9ICXA 2BE9B 3FEXB 4FLYA 2Z2ZA 2P9UA 2X6SA 4G65A 2ZH9A 8ICEA 3AAQA 3R5DA 3ZZ0A 2JLGA 1MROB 3K5MA 2DFFA 2DNYA 5AQRA 4ICLA 5C0YA 4HACB 3G2XA 1C0TA 2HZVA 4ZP8A 3W7BA 2AJFE 3D66A 1WNSA 2PFFB 2AJQA 1RYUA 2QB1A 3QXGA 2HDOA 1PAEX 4C11A 4CM0A 4B9QA 1UZDA 1TR0A 4GXKA 3S01A 3OYCA 3CMES 2HCFA 4NMLA 4F7VA 4ZS6A 2PO4A 3QLHB 1RG6A 1PAUB 5GAHI 2IYGA 2ILYA 4QR0A 4ZVGA 7ICGA 2BPCA 3B4MA 1CS4A 5J0YA 1WD6A 1RHRB 2XLJA 1B3TA 5A8WB 2AKWB 2HBYB 1DGSA 3A8JA 3ILLA 2ASLA 4KB1A 3UD4P 2VDIA 4C1NI 1YBTA 3IBWA 1AB8A 5C7PA 5J0PA 1HBNA 2ZTDA 1WDTA 1V9PA 1IG6A 4A47A 4ZTFA 4FWMA 1FTRA 1QQ7A 4LF9J 5IFMA 3DLLL 5BR8K 1C1BB 4F26A 2UUTA 4EX6A 2BOPA 3ID6A 2OPPA 3M9NB 1D8YA 5B0BA 4ELVA 3MCOA 4LVSA 3Q7CA 2OPSB 1UT8A 5CYQB 2DHGA 4IZ9A 2VHGA 4F2RA 1Y00A 1E6YA 4DU1A 3P45B 2XZDB 3WEEA 2OIHA 3BQ0A 2RAQA 2DTJA 3KNAA 1KKHA 4DSFA 3FGVA 4RQ1A 2QSFA 1T8EA 3W66A 4P2HA 1BWFO 2G2YA 3QWUA 2J8AA 2X1FA 4M7XA 4B3TF 3Q8MA 3I6PA 2W2QP 2FJDB 4IG0A 2ZGYA 2Z56B 3H4BA 4FN5A 1Y0HA 2YY6A 4JD2B 3CT9A 2W8KA 4WCEQ 1JLGB 3KD5E 3TX0A 5KG2A 4MO4A 1J2VA 3IRUA 4C2MA 5D0EA 1KD1T 3OW2M 2V50A 1VQ5S 5SUHA 4F4KA 3RH5A 2GLEA 1TAUA 3HL8A 2D3DA 2VWJA 4LQ9A 2IMOA 3LPEA 2WONA 3X1LB 5HNKA 3PIPL 1NMDA 1B4FA 3CWJA 3DFEA 2DITA 4QZFA 3WXIA 3NP5A 3HOSA 4QWEA 3BSCA 4OHVA 2G8VA 2Y1RI 4TLQA 3SI6A 3V9WA 2RQCA 4NLSA 2B7CB 2G2OA 5GMDA 4PL7A 3JSMB 2GHPA 5G5HA 1Z1ZA 2ZJQQ 5AK5A 4CNYA 1CXUA 4MAKA 4NLOA 3QYPA 1VBZA 1VQYA 5ALXA 3SSRA 4KLLA 4FKYA 2WOMB 1KNZA 3NGIA 4AYBC 1Z25A 3MD1A 4ED6A 3CSKA 3UPFA 2G4BA 2XICA 1Z2ZA 2JXJA 1NK8A 3OYJA 4RWXA 2AD9A 1Z2LA 5IIJA 1BQMB 3NGUA 2R7VA 2NRZA 3T5HA 2Z2MA 4EYHB 4BRMA 1IBKF 3SUNA 2HBKA 2LYAA 8ICUA 1RJJA 3MX5A 3CJCA 5IM0A 5CABA 2R7SA 2YHAA 2JFDA 3ZSRA 2FC0A 4BWJA 2GX9A 5DB8A 1IM4A 3I9V9 7ICTA 2F8TA 2GAHC 2UXBK 1ZXIA 2FVPA 1KTQA 2FSKA 3OBYA 4QS9A 3QICA 1GAOA 1N32K 1URNA 2P2CB 3NRZA 1E3MA 2RQ4A 5KFWA 4FM0A 3DDKA 3KXDA 3FCHA 4OX8A 1FKOA 1PILA 1RXWA 3GQCA 5AKGA 1N34K 2O4IA 3UXPA 1IR1A 3IRWP 1JJ4A 2DNKA 2YPYA 4QPTA 2ZH6A 3HHNB 3HP9A 2ERRA 1KVBA 1F0XA 4QNLA 3MECA 5AQJA 4HKQA 3BJYA 3CIMA 3LDSA 3O9SA 3L4QA 4H4OA 1S59A 1C4AA 1LAVA 4WBFA 4IS7A 2QLJB 4RBVA 3HDSA 3W60A 4PYAA 2V4RA 3DOMA 2KVIA 3BPSP 1Y3JA 4TU8A 2D6FC 1SV0A 3MMBA 3ISBA 4OI0A 1LWCA 4HACA 8ICSA 5AKYA 4M9JA 1FNXH 4P4PA 9ICPA 1S76D 1VRTA 3GSIA 4UF4A 3RRHA 4NV0A 5KG1A 2WK4A 4EEYA 4ETZA 1BD6A 5AM0A 1KQSM 2IIRA 3DLBA 3UPQA 1FFWB 4XTTA 3K89A 2Y9TA 3CCLS 4PQAA 4O0JA 5CYQA 1U25A 4LSNB 2BM0A 1U9LA 2K8GA 1SS6A 2A40A 2RF2B 4OJPA 3M6GA 4QZGA 3VF4A 3DU6A 1HUOA 4BC3A 3N0VA 4LQ3A 3JSBA 1RT5A 2LXIA 3GILA 2RNEA 4YB6A 2JNJA 1C6VA 3AU2A 4W4MA 3N9UC 2UVUA 4Q8FA 4NLQA 4KTZA 4BG8A 4CZFA 5KFGA 3OFEA 5F8MA 3I4PA 4I69A 2CYYA 1IBLF 4MKAA 3MURP 2R7TA 1FDBA 3RRKA 1H7WA 1NG9A 2QWOA 4Z4GA 4OPJA 2MKSA 3ZZZA 2MYFA 4CI0B 3CQ8A 2Q66A 4O8UA 2B0CA 4ZHRA 4AHUA 1WUDA 3JPOA 2HK3A 2NS1B 3IG8A 5JS2A 3NCIA 3ULEA 5A76A 1LK7A 1A0OB 2RE1A 4U7UD 5GADI 2PMZC 3SV3A 3RR8A 2ZGZA 3N4PA 4FF1A 4ICLB 3UE2A 3AJDA 2J0WA 1RA7A 1TTHB 3AU6A 2A3VA 4ZN3A 2V8DA 1S48A 1XUPO 1QD1A 2FDNA 2OTJN 2MQPA 3NAEA 8ICZA 4FNIA 1C20A 2ADBA 2B7BB 1QQCA 2OYQA 1YRXA 2GA7A 3NF7A 2JHEA 4YOYA 1C0GA 2WC9A 4DOAA 3WXLA 1KS2A 4DF8A 3UB5A 1PBUA 1SKSA 5EHHA 1EQMA 3DLKB 4L8RB 4CBXA 2BABA 2WVEA 4U67L 4IOAL 1TL3B 2N82B 5L1KA 4DG1B 1RBTA 2ZJ8A 3OYBA 3BKTA 2B4JA 2BCVA 3EGZA 1QCKA 1K1QA 4CO1A 3OVAA 4NLYA 2Q97A 3PLAA 1NOMA 4NEYA 4M3RA 3U1NA 2FB0A 3KJNB 4DV7J 1SB3C 1LKZA 2PFDA 1U1KA 3OL9A 4DU3A 4YDXA 4F67A 2BRKA 2GO9A 1EX4A 4QWDA 1XR5A 1RDDA 4WIQA 2IC3B 3ZXWA 2M7SA 3DMJA 4BR0A 1I94K 5K5MA 1XNSA 3OT9A 3KLVA 2HVEA 4BRFA 2ZIVB 4BDYA 5DDOC 4KFBB 4UOFA 2ASJA 1X5PA 1Y9OA 3S8SA 2OMLA 4ZVQB 4HH1A 3RU0A 3UMBA 1IJFB 3DOKB 5IWAJ 3TADA 4DPYA 4DR7K 2AZ1A 1N34J 2Q0UA 2KM8B 1D8ZA 2L9WA 1X4DA 3OYMA 3CCMS 4DR7J 2XHWA 2VC1A 2AX0A 4H4MB 1TQLA 4AL6A 2UUBJ 8ICXA 1EO1A 4IBNA 4L3KA 4M5HA 2Q1NA 4AE5A 4OFZA 1LWEA 3TAPA 8ICCA 4KYZA 1V3ZA 2ZUAA 1WHVA 1SZHA 4DUYJ 5FLXU 1HKAA 3E66A 2IHR1 2E8PA 5M2RA 2DFEA 5A8KA 3AO1A 2B6AB 4E2FB 3RYLA 3PYEA 3MR5A 4KBIA 2KKZA 2MZRA 3VAFA 1VSHA 5JLFA 2E3TA 2EFOA 4RW6B 3BS7A 3OVSA 5AM2A 3FCWA 3TABA 1PYOB 1H98A 3V7KA 3WNEA 3AY0A 4DPTA 1NM1A 4KPYA 4LF4J 3GL1A 1T94A 3TJAA 2XMUA 1XMOJ 2M0NA 3I82A 3HO1A 3VCBA 7ICQA 3C5FA 5BPLA 4QW8A 2RHQB 1VFJA 4RW4A 4X5VA 4Y2IA 4OJRA 1X7VA 2PN6A 1DJ0A 2H3EB 1DFDA 3FGUA 3VQPA 1NK4A 2G09A 4F0KA 2BEFA 4OZ1A 3LP1A 3U4LA 3P5BP 3ZDCA 2M5YA 1P90A 1Y5LB 1ZBUA 4CJQA 3DGVA 1HR0K 4AHTA 5DG8A 1VOMA 4J91A 1IKXB 2JR5A 3V72A 3M9OB 2ZDPA 1X9WA 2FPLA 4BCAA 5I9EB 4L3QA 4DOZA 5BYSA 4TVAB 4LF6F 3D0GE 5THWA 3RZAA 3QSYB 3WX8A 4JYAJ 4F36A 3FZLA 1R0BG 2W2NP 2KJVA 4IKFA 3ZDDA 1OPZA 4XIUA 2W01A 1MWQA 4BXOA 4X4VA 1DAXA 3UM9A 4HLBA 1Y88A 1LW0A 1UVKA 2PSZA 2DB1A 2GS8A 3HRGA 1YG0A 3S7RA 3TUIC 4Y2KA 3H46O 4PQUA 2E5LJ 4CZLA 5F8HA 1BCMA 4CJRA 4LRCA 4YDUC 2C22A 2EC2A 2RD5C 2RB7A 4IUFA 3FDSA 2Q6CA 2KKPA 2UVWA 4OIXA 3KK1B 4NI2B 1SPBP 1TP7A 3NNAA 1XNRK 4DR6K 1WSHA 4CI6A 4DN0A 3G6ES 4NLNA 3UQSA 3NF6A 4K43A 2OZMA 3P96A 1A5VA 1LWCB 2OSRA 4KLMA 3O08A 3L4PA 2M9NA 4UBBA 4ECUA 3OVBA 3NNHA 3LP2A 1UPHA 2PI4A 2NREA 1FXRA 1M5KC 5KRTA 2FE9A 3DXBA 2EWSA 3ETRA 1MNEA 3UD3P 3D54A 1NNEA 2CN1A 1DK2A 3G4SS 2XMVA 3AQFA 1HYZA 1F0MA 2K7JA 2OPQB 1DEJA 4DR5J 4PXBA 3V6DB 2QA4N 1TK8A 4B9LA 1H73A 2UUCJ 3GFXA 5AK6A 2D41A 1SQEA 2BYCA 2DEJA 3P5TL 3DXKA 4ES1A 4FF3A 4RW8B 1KBUA 4KC5A 3I28A 3M4XA 3IMQJ 4DKWA 2ZNYA 4FNHA 3GV5B 1JLFA 1ZJNA 3KLIA 1NB7A 2VOPA 2MRLA 3QGGA 2BPGA 1XMQJ 1UL3A 3UMCA 3B54A 2R7RA 1U09A 4M5IA 2NPFA 3EVMA 4LFBF 1F3FA 4A8MP 2QB0A 4UBCA 2QFIA 4GVEA 3QESA 3JS6A 4DSKA 4LF8J 4EZ9A 4BR9A 1N54B 4IJNA 3NVVA 4RPFA 2FLPA 3NVKA 2LVWA 1TL4A 4MEXA 1U4BA 4XQ8A 5DDPC 1M5VC 5FD1A 4FWKA 1BNOA 3C2PA 4IYQA 1JLAA 2MGZB 1Z4UA 5AQVA 5AK4A 1EXQA 2Z7JA 1XO0A 1CULB 4GC7A 2QA1A 3TVYA 4C7QA 3QGHA 1M5OC 4GMJB 2WF7A 1YSJA 2KMDA 5DBBA 4WU3A 3QFUA 5ETTA 1CLFA 4P2FA 1DGJA 2K3IA 1YITS 1I94F 1KDHA 4D3GA 4LR9A 3WUHA 7ICRA 3CCEN 2K7KA 2CQ1A 2CQGA 4MYTA 5KG6A 4LF8F 4NCAA 3ITHA 5E33A 1NK5A 3I56N 2F1HA 1SIWB 5T7BA 1Q46A 1WSGA 1RK8A 4OYPA 1NGJA 3TKAA 2GO7A 2GZOA 4QIGA 2GQCA 1XMQF 3QZ7A 1KDNA 1S10A 2VD3A 4DX5A 4K8XA 4BWMA 2GW8A 4OJHA 1ESVA 1UFKA 1SAZA 4CGGA 4KLEA 1AFJA 3SUPA 2R7UA 3QUTA 4X4OA 1JCEA 1Q5YA 4OHWA 2NRTA 4ES3A 3IXQA 3UDVA 4DN9A 4H0XB 3JSMA 2A41A 3P4IA 3QNNA 4HWIA 3V2UC 1NBWA 2QLTA 3UN2A 1HWJA 3FRZA 3HKZD 4IQVA 2OO4A 3TWZA 1XIQA 4OZ3A 2B6AA 3UDLA 4PL2A 4OPAA 3QYYA 4CCHA 3V9SA 2K1RB 2FF6A 2H5IB 2OTLS 1B7YB 4DV6K 3P3DA 3RBZA 3FNNA 4QAGA 5DBCA 2I0XA 3S3MA 5HJXA 2EWHA 3PDNA 1U7LA 2HWHA 2E5HA 4X4UA 4P0QB 4ILRA 2YNIA 4C3KA 3WK8A 4U8VA 2V2VA 2PZSA 5DM6Q 5CD4A 3H7IA 3HT3A 4NZ6A 4URSA 3A5LC 2KRBA 2KHVA 3I76A 4IH5A 2P9LA 1FFVA 1RAOA 1X5OA 3IS9B 2HFSA 1L3KA 4P7VA 1IQZA 2HHUA 4NLRA 3V9UA 2CKWA 2ZBIA 4KE5A 3CMQA 4XH5A 2HKEA 3OYIA 2HF3A 4ECWA 3L4IA 3QINA 4H0TB 2G8WA 4C8OA 3KIOA 5KG4A 1RBAA 4IO8A 4DR2J 4NLKA 4YR3A 1WSRA 4JRPA 1L8LA 3AY9A 4F5PA 3Q22A 3HZGA 3BM7A 1G3OA 4C8ZA 4CEFA 4DG1A 3JAMY 4BBYA 4FZLA 4CYUA 3K9JA 3MUVP 3OTBA 5J2AA 2MHNA 1RT1A 4CFCA 4NL9C 2K06A 1WG8A 1ZRMA 3AA8A 3EYZA 4RBTA 5AE3A 3JSRA 4J5OA 4CZJA 2YCHA 3QBCA 4HDGA 2HBLA 2XYHB 3EM1A 2E7XA 3CVKA 4HI1A 5AKHA 4JK9A 2VFSA 2D0BA 3HM8A 2DBYA 4CZKA 1V4TA 4C11B 2GFFA 4FZXC 4OI4A 3KLEA 2QRRA 1BIZA 2PDAA 3GIRA 3ZTPA 1BWEA 1VC5A 3M32A 1N34F 5KRSA 2CJXB 4CF1A 1VQLS 4LF4F 2FVSA 3PHEA 3J7YP 4JI5J 4ZIWA 2VKQA 5F41A 2Q6BA 1D8LA 3Q2TC 1S1XA 4CF3A 2KZ3A 1KAYA 1C0UA 4IOCQ 2ZOMA 3KG1A 3NDKA 1JB0C 4FJIA 4PKIA 5HMWA 4XAKA 4GNIA 2NNWA 5KFRA 3NAIA 5DDMA 2MJUA 1C0UB 3ICLA 3R5CA 3NL0A 5DB9A 4RT2A 1HPZB 1XC3A 1VQKN 5HHIA 2YKOA 4L76A 3AA5X 5AE2A 5C12A 2EFPA 4L3NA 3HVWA 5AE1A 4RW9A 3JYTB 4M0AA 4K8ZA 5T14A 2JVOA 3J80O 1DTQB 1RDWX 4KLJA 2XTJP 4BREA 1DRZA 2JLEA 3M2RA 2ZJAA 2FSJA 4FYVB 4I2PA 3NOGA 4P71A 1B92A 4DV0K 2LM1A 3GZFA 3CRXA 2K89A 5CEHA 2A1SA 4B3MK 2W6KA 1BPXA 2GQ2A 2D3OR 4MF2A 3E1YA 5HP1A 1EETA 4B3MF 4BDZA 4AF1A 1VQMN 4H0VB 3MDAA 1EB0A 1MN7A 4IR1A 1J2MA 4NXMJ 4B3OB 1A9NB 7ICVA 3W5YA 3MFIA 4PHEA 1Q53A 4OYMA 1G15A 2VPWB 3SEIA 1MWZA 5LXRA 5AI8A 1YJ9N 1KLNA 3RTVA 2QARA 3SCKE 4LF7J 3FZKA 3I55N 1S1TA 4LFAJ 1Q8KA 5DDYA 3M1VB 3RMAA 4GW6A 1FRHA 3OYHA 3RAXA 4N56A 2LQ9A 2N4DA 5L39A 2HI0A 5KT7A 4A2BA 1FKPB 3AVLA 4WWSA 2JEGA 4JHDA 3SAGA 1CEZA 3H8SA 2BJ9A 4QZ8A 4RUHA 2R2SA 3W61A 2DFLA 4JKDA 2W2PP 1X6IA 4FJ5A 4LJXA 2ILZA 1WN7A 3CXCR 1ZTTA 5CE3A 1ZOLA 3LL3A 1CULA 4K2XA 3J8AA 1HNIA 2VG5B 3LWLA 3VC8A 2IJRA 2HRTA 2O8DB 1N5QA 4GVBA 2O6KA 3MTJA 2ZM6J 3BBFA 2ATQA 1RACB 2QSWA 4RQNA 3TX8A 4YHHF 5KFXA 5BR8F 4NLGA 5J2MB 1SUQA 4BC5A 2KNJA <