4DSJA

Crystal structure of fragment dna polymerase i from bacillus stearothermophilus with duplex dna, dgtp and calcium
Total Genus 186
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
186
sequence length
579
structure length
579
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical and structural insights into the fidelity of bacillus stearothermophilus DNA polymerase
rcsb
molecule keywords DNA polymerase
molecule tags Transferase/dna
source organism Geobacillus stearothermophilus
total genus 186
structure length 579
sequence length 579
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4dsjA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4dsjA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dsjA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4dsjA01
5JS2A 1MQ2A 5J2PA 2C2RA 4Q0BA 1SV5A 7ICTA 3AU2A 3RB3A 4AH9A 2PI5A 4PHAA 2Z1HA 1DGSA 4RW7A 2JZBA 4JRPA 1NKCA 3WNHA 1S9EA 2BR0A 4R65A 4J2BA 5KFLA 4WE1A 4PPXA 4DTPA 4JUZA 2HHUA 5I3UA 3H4BA 2ZJ5A 1ZQRA 1H38A 1X9SA 1QTMA 1BI4B 2ZJ8A 5CZ1A 1RT3A 4DTMA 5DQIA 4BDPA 4ED8A 5J2HA 3MBYA 4TUSA 3SQ2A 4RPXA 2Z1JA 2Y1IA 4KLMA 2A1SA 1XWLA 2HHQA 4CJ4A 3O3GA 4PHEA 5D3GA 4ECZA 3OSNA 4KRFA 4FLWA 3SZ2A 3TFRA 3KK3A 1C0UA 1YTAA 9ICJA 3C21A 5CWRA 5KFTA 1RTDA 5KG6A 1T7PA 3LANA 5F9LA 5HBMA 1Z25A 2F1IA 3N4MB 2PXIA 4KTQA 4CHPA 8ICBA 3M8RA 2FC0A 2B5JA 2BCVA 4JS5A 1BPEA 9ICSA 2JLEA 4PHDA 4YXMA 1ZQJA 3VQ6A 5DG8A 2B6AA 4CHQA 5KT6A 3V1OA 3C94A 1EETA 3AVJA 3K2PA 1L5UA 4B3OA 3MABA 4FLYA 2NRVA 3AO1A 3C5GA 4RNNA 1S0NA 4KI4A 2GWSA 3UXOA 2YKNA 4RG8A 3QNNA 1S1TA 4M3WA 1WAFA 1UA1A 4Q5VA 4FJMA 4M3ZA 4CK2A 1WNSA 2G8KA 2J6SA 2BANA 4N76A 2BPCA 3SI6A 4DQRA 4ZTJA 4YMOA 3T5JA 2J6UA 4F4YA 1A77A 5KRSA 3T3FA 4DLGA 1Z3EB 3KHRA 3QETA 3HP9A 1S0MA 4DTNA 2R8KA 4XIUA 4M0AA 3WNEA 1HMVA 4AHTA 5DQHA 3LZJA 4Q43A 8ICKA 2LSNA 1HJRA 1KSPA 4UB3A 1NKEA 2HNYA 3ZSVA 5DBAA 3L2QA 8ICUA 3RRHA 3DLBA 1DLOA 1EX4A 4F4XA 3LZIA 1Y88A 1VSJA 4M6WB 4PY5A 3MXJA 3TR8A 1A5XA 1HQEA 3V6DA 5HROA 4QW8A 3GV7B 3N97B 4RQ1A 2EX3A 4UQGA 3C2KA 1KDHA 3QEAZ 3BQTA 4I2CA 7ICQA 3V6HA 1QSLA 2FMPA 2ZUCA 4FJLA 4KKOA 4DFPA 2WONA 2IBKA 3LP2A 5J2IA 2FBVA 3H4DA 4NY8A 4CFCA 4EBCA 3OYKA 3QESA 4B9SA 5J2NA 1EXNA 1QS4A 4FK2A 3TFSA 1S6QA 4RW6A 3JPQA 3C23A 5IIOA 1QHTA 4DQPA 3TAMA 1ZQPA 3BDPA 1GOCA 3CFPA 4M45A 5EWFA 8ICYA 1J5OA 4ED7A 1BL3A 4FM0A 5KFIA 4CGGA 3QIOA 3VQPA 4CJWA 4W5NA 5HRPA 3OHAA 4KLDA 1BIZA 5KFBA 3RB6A 4CEQA 1UAXA 1LB2B 4HHTA 5J2GA 3TABA 4F2RA 3OYNA 1SL1A 4QCLA 2IAJA 2ISOA 4I28A 4DTRA 2VA3A 4KFBA 5J2AA 1ZJNA 3DOKA 4ED2A 5DGAA 4O44A 4KLTA 4GC6A 5CA7A 3ZT2A 1S77D 2OPQA 5IIIA 5JUMA 3PX6A 5BOMA 3RJGA 3TAEA 1ZBIA 4O5KA 3P1GA 4CEFA 1TK5A 4B9TA 4GXJA 3DMJA 7ICGA 9ICNA 3ZSWA 4E7KA 7ICMA 1JN3A 3V81A 4L8RB 3KLGA 3V1QA 7ICUA 3QERA 4CJVA 4TURA 3ZCMA 2YNIA 1MC8A 5KFDA 4J9OA 1SKSA 2G8FA 3RB0A 5KG1A 4KLOA 3AU6A 2XO7A 4Q44A 5HLFA 4EP4A 1IKVA 4IRKA 4DO9A 4HUFA 4NLKA 1LW0A 4RW8A 4E1MA 9ICKA 4CK1A 3C6UA 4MFBA 3HL8A 3IS9A 3AA2A 4DEZA 3OS1A 1JLGA 4M3UA 5KG0A 3OVNA 5J2MA 2W9AA 4NM2A 5KG3A 4I2GA 1ZQWA 4JRQA 2B4JA 1L3VA 1RNHA 4YFUA 3AA3A 4TUQA 3ZSXA 2ASDA 5FROA 3NH2A 4ECQA 4CFAA 4QWDA 4YP3A 1HJPA 4YR3A 2O4IA 3BJYA 3AVHA 4TQRA 4QZIA 2BGWA 2MAXA 3QZ7A 2YNHA 2J6TA 4KLQA 3F73A 1HYVA 5C42A 4Z4HA 1J54A 3MR6A 3ZD8A 3PW4A 3Q8MA 2PFQA 4CJKA 3IAYA 1KVBA 1RBRA 1S9FA 4DFMA 5KFHA 4RW4A 5EU7A 4O3NA 4KI6A 4DQSA 2IOCA 4MF2A 4PA1A 3VA0A 3PMNA 9ICOA 3S9HA 1KVCA 2KZMA 4RQ7A 3LDSA 1K1SA 3SI8A 3TWHA 1VSMA 2FLPA 5CHGA 3OHBA 4LSNA 3RBDA 2QXFA 1LAWA 1T8EA 5J2KA 9ICMA 3ZSZA 3V4IA 3TAPA 4H4MA 5J0PA 4FLXA 1QSSA 2HHSA 5L1KA 1MQ3A 3L8BA 3OGUA 5KFYA 3OS2A 4PGXA 5KT7A 3AVAA 2UVWA 5DDMA 1IKYA 1ZQGA 2AQ4A 3C6TA 4KPYA 4ED6A 2ZD1A 3UXNA 2NRZA 2W9BB 2PZSA 4IFVA 5DK5A 2JEGA 4DU3A 4M3XA 4PUOA 3DLGA 3L3UA 3M9NB 2W9MA 4I2PA 2D0AA 3AVGA 2MUTB 1XS9D 4M42A 4Z0UA 2P6RA 1V9PA 1HRHA 3FYHA 3K5LA 4F3OA 9ICEA 3HSTB 3MR2A 4F5QA 1NOMA 2ZTCA 4JWNA 3K5NA 4X5VA 4FJHA 5F9NA 3RR7A 3DYAA 4Q8EA 2VANA 5J2DA 7ICIA 1J9AA 1BCMA 1UWBA 3KK2A 2C2DA 4KTWA 1IH7A 4H4OA 2P66A 4P2HA 3ITHA 2IC3A 3AO3A 3TANA 4N47A 1D5AA 1VSHA 2BHNA 4FS2A 4GVMA 2Z1GA 4AHVA 5C25A 8ICMA 3OYBA 3OJSA 1RT4A 4KN4A 5C5JA 7ICPA 3MFIA 3RRGA 3GV5B 3RMDA 5CJ7A 1T4GA 2FLNA 4M3RA 2ASJA 4IR9A 5KFAA 2BCQA 2HMIA 4EZ9A 4J2EA 4KN7A 5J0UA 2PI4A 4RT3A 2BCUA 1CZBA 3V9UA 5D4BA 3H8WA 1LV5A 3PO5A 1BVSA 2UVRA 4DWIA 4N56A 4Z6EA 3CM6A 1ZQHA 4YN4A 1NJWA 3G6XA 5KFPA 4ECUA 4I9QA 1TVAA 1LAVA 5KFWA 1BI4A 3L2RA 5HNKA 1HYSA 5IIJA 4I27A 3AO2A 1Q9YA 1SKWA 5J0RA 4UAYA 3ZSQA 2NRXA 3VA3A 2F8SA 8ICCA 3PV8A 3M8PA 4CJ5A 3OJUA 4DLEA 2E6MA 4LVSA 3CYMA 3OYGA 2AU0A 4AILC 5FRNA 2WTFA 2YHAA 4DL7A 3HPGA 4RQ5A 3ZT0A 1VSEA 4B9LA 2IHNA 3TQ1A 1KEJA 3L3VA 4O5EA 4CJQA 3THVA 3C5FA 8ICPA 4O5CA 3CFOA 4LSLA 1ZQYA 4DG1A 2XGPA 5KFCA 3BQ0A 4KO0A 5D49A 4UB4A 1RBVA 2X6NA 1ZQZA 2R8GA 3I0SA 3QINA 9ICIA 4RPYA 3K5OA 2ATQA 2KZ3A 1B9FA 4O4GA 4CHNA 4UAWA 2HVHA 3IRXA 4OLAA 4I2JA 3MDCA 4IG0A 5KFNA 4ELTA 5J0WA 2NRTA 4RQ4A 4RQ8A 3GILA 4QAGA 8ICSA 4FK0A 4TSXA 3NHGA 4J9SA 4RNOA 1NOYA 4DU4A 2I5JA 1TFRA 2ZTEA 5J2FA 3PW7A 3KK1A 3UQ2A 3RJIA 3C2MA 2ETJA 4TQSA 2P5GA 4M9JA 4F50A 4M9GA 4YNQA 4J9MA 1S9GA 4B9VA 1Z26A 4W5TA 4FZYA 9ICVA 2R8JA 4CHZA 3KTQA 2F96A 4CEZA 1D9DA 1ZQLA 4M3TA 3ISBA 4C8MA 4K8XA 5KGWA 3M8QA 4KLUA 3AVLA 4NXZA 4YMMA 4I2DA 4CJTA 1HNVA 4PGQA 3PW0A 4QWEA 4QZHA 4FYDA 3H40A 3BGRA 4OPJA 3ZSYA 3NGDA 3ZT1A 4QZAA 1RZTA 2YV0X 3OYDA 4PGYA 1UOCA 4NLZA 4DOCA 2UVVA 4DTUA 3NBPA 2FMSA 3SQ1A 4RQ2A 3AVBA 1JX4A 2OZMA 1NKBA 1JIHA 4Z6FA 4BE0A 2AGQA 3KLIA 1XSNA 3DM2A 1K6YA 1C7YA 1F21A 4ELUA 3P83D 3CQ8A 1UA0A 1NOZA 4CGJA 4J9RA 4KMUA 1FKOA 1TKZA 4HUGA 3ZDEA 4QZGA 3LK9A 2R7YA 2KFZA 3H8JA 3CFRA 5KFVA 1U49A 4DTJA 4KV8A 4CGFA 1ZBLA 4R66A 5J0TA 1XU4A 4E7IA 2Q0ZX 3PO4A 1TGOA 1ASWA 1FXXA 4OPKA 4Y1CA 1ZYQA 3LDAA 4XQ8A 2RN2A 3VQDA 2Y1JA 4GLXA 2BCSA 3H8SA 4IQTA 3C1YA 1NK0A 2OPRA 4OKEA 3ISCA 2PFPA 1VSDA 1JLQA 8ICNA 1JLFA 3KJVA 4M04A 1QQCA 1BPDA 3DI6A 1S1UA 3AO4A 5HP1A 3VQAA 3L2VA 2RF2A 5J2EA 4I2FA 1UT5A 3AVNA 3QEIA 4KB1A 4E1NA 3F9KA 1C1BA 1YT3A 8ICLA 3MEGA 1RILA 1RT1A 4C8KA 3GFKB 5J1EA 1NK9A 1EKEA 4DOAA 4RQ0A 1X9WA 4QZ8A 4J9NA 2BQ3A 3CG7A 8ICAA 1CXUA 2A1JA 4QZCA 4I29A 3VQ7A 1XC9A 3WNGA 3EW9A 4K4IA 2FPMA 4PH5A 4AHRA 2G8VA 4CF9A 4DMNA 3LPUA 3OS0A 1IKXA 1WCLA 3MGIA 3KHHA 1WSJA 3GDXA 5HMLA 2BQRA 4O5BA 4KB0A 1CLQA 9ICHA 5L9XA 5KT4A 3UXPA 3TI0A 8ICFA 3NAEA 4QZ9A 2F1HA 3SYZA 5J0XA 1ZJMA 2KZZA 3C95A 4ZHRA 1BPZA 4M9LA 1KCFA 4K4HA 2X78A 4R64A 1T3NA 4CJ3A 4DL3A 4NYFA 4CIFA 1WSIA 1S1VA 2XCAA 3RJJA 1IM4A 4G3IA 2C22A 4UB1A 9ICXA 3V7LA 4B9MA 3GIKA 4DSLA 2GUIA 1G15A 1NK7A 4BDZA 3RJEA 1LWCA 2ITGA 1JMSA 4EEYA 3AA5X 2HW3A 3RB4A 4P4PA 2IDOA 4BXOA 4ZH4A 3HO1A 4ID1A 1XHXA 3LALA 1RYSA 4YR0A 2OZSA 4CEBA 5EWGA 3UIQA 5KT5A 2JEJA 5SZTA 1S97A 1B9DA 1HYZA 4W5OA 1ZQKA 2IGIA 1ZQVA 1NK4A 4FZZA 4KHSA 1COOA 3QO9A 2ALZA 3NF8A 3EPIA 2AQ0A 4DSKA 3ZDAA 3O4QA 3UQ0A 2I1QA 2FLLA 4FLTA 4DTXA 3B0YA 1FK9A 2DFHA 5KFZA 4FJ7A 2G8IA 1TL3A 1VSKA 3QEWA 4CGHA 2DFFA 3NGIA 2KW4A 4J9LA 4CHOA 1D8LA 1NK8A 3NGZA 4ECXA 3MR3A 1A76A 4O3RA 3SCXA 1NJXA 5C24A 5DKWA 7ICFA 4IG3A 2KTQA 2LYHA 1X1PA 4FLZA 5I42A 4FJ9A 7ICRA 1S76D 1U9LA 1RBTA 3QNOA 5KG5A 2MUTA 3U6FA 4YCXA 2X6SA 3QE9Y 4GXIA 3V72A 4RQ3A 4N5SA 3NCIA 2C2EA 3U3YA 3I0RA 1TK8A 2H5XA 2UVUA 4F3TA 4RU9A 3H08A 3RH6A 1W0HA 3JPNA 5DQGA 1RT6A 4NLGA 4KHUA 1R0AA 5KFSA 3QEPA 1S10A 7ICEA 5DLGA 3M8SA 2BPGA 4NM1A 2JGUA 2X74A 3PW5A 2Q3SA 4CHYA 4FCYA 3C1ZA 4Z6DA 3PX4A 4O9MA 4DS4A 4GMJB 1RTHA 5CYMA 4CECA 4I9LA 4K4GA 4KLIA 1BQMA 2OPSA 4LZGA 1IXRA 1J53A 1JXEA 3RJHA 5KFXA 4FJIA 4RUCA 1TV6A 1RDDA 1SZPA 4FJ8A 1KLNA 4DL2A 4CJRA 2FBXA 9ICPA 4FW1A 4FM2A 1BGXT 4H8KA 3K4GA 4FJKA 3AVFA 4QW9A 1U45A 7ICHA 3ZT3A 3HM9A 3OYJA 4OGEA 2HHTA 4ELVA 1S1XA 1RT2A 1PZNA 7ICJA 8ICZA 4F8RA 5HMMA 1YVUA 1L3TA 3E2EA 3OYIA 2R8IA 4IBNA 5L1IA 2RPIA 3Q8SB 2GV9A 2VG7A 1REVA 1ZQFA 4CF1A 3JYTA 3PR5B 3Q8PB 1VK0A 3JPPA 3VQ8A 1JXBA 4IRDA 5KFMA 4FK4A 1JL2A 3DRRA 3MECA 5KRTA 4IFYA 4I2HA 4YG2A 4CIGA 3G0ZA 3SPYA 4J9KA 3RH5A 4J2DA 1N56A 4NCGA 4IQUA 4I2EA 4O3SA 4ED1A 3RMCA 5L1JA 3K5MA 8ICVA 2FPKA 3MEEA 4F5OA 4HUEA 3T5LA 3WNFA 1BISA 5DLFA 4JV0A 4O3QA 1C1CA 3ULDA 5D46A 1SL0A 1L3SA 4FJGA 4HTUA 2Z1IA 3LP0A 4EBEA 5IIKA 3V9WA 4C8NA 2HNDA 4M9NA 2M9NA 4E0DA 4O0IA 8ICJA 3TAQA 3RMBA 1L3UA 1ZBUA 2EHGA 5FDLA 4M3YA 1BIUA 4W5RA 3AVKA 8ICTA 4Q8FA 1JLBA 3SQ4A 3OYCA 1BPBA 3JPOA 3S3NA 4CK3A 3L2WA 4CERA 1ZQTA 1RPLA 5T7BA 5HRRA 3RJFA 2BPFA 4LH5A 4F2SA 3PNCA 5DBCA 3VQCA 3QEBZ 4FM1A 1SKRA 5CR0A 2PYJA 4KHWA 1SL2A 1I3AA 3K58A 4UB5A 3JPRA 1DTQA 5HHIA 1U48A 1MU2A 2VWJA 3DLRA 4LY7A 4LH4A 1UT8A 4CEEA 4FLUA 4FW2A 3TAGA 4OVLA 4YXJA 5DG7A 1WSFA 8ICIA 3RAXA 8ICHA 2PFNA 3O3FA 2W9CB 2PFOA 4Q45A 3E01A 2AGOA 1CEZA 1BQNA 4RNMA 3VQBA 2B21A 2IA6A 4YMNA 1EP4A 9ICBA 1FKPA 1ZQAA 2AGPA 1ZQBA 3NF6A 4FBUA 2C28A 2V4RA 4B08A 1B22A 2G8UA 4F92B 1JKHA 4FJXA 2HHWA 2XY8A 1Z00B 4R8UB 1XSPA 3ISNC 4IQWA 2QKKA 2FPLA 4CEOA 4DSJA 1HPZA 3HT3A 3RMAA 3KHLA 1ASUA 4ED0A 2IHMA 1JLEA 1U04A 3V9SA 4CFBA 4FO6A 1VRTA 9ICWA 3VQQA 5DB6A 4O55A 2P1JA 2PYLA 3AUOA 4YQWA 1CZ9A 4IQVA 4KLSA 5KFRA 4IDKA 3ETLA 3SUOA 1DTTA 5EWEA 1ZQMA 2KFNA 4E7HA 4CIEA 3QEVA 4YD2A 2ASLA 1MSWD 5CP2A 4F5RA 3RR8A 2XY6A 3LP1A 4RW9A 4Z4FA 4FZXC 2OYQA 4KLGA 4QZEA 1RXVA 4O3OA 4NCBA 4M2YA 3RH4A 2BKEA 4NLNA 2FBTA 4DSEA 3KKSA 5L1LA 1TAQA 1S5JA 1U4BA 5KT2A 1RXWA 3DOLA 4AHSA 4DQIA 3V6KA 4DU1A 2ZTDA 4J2AA 3SUQA 3NFAA 3EYZA 1RDBA 2OA8A 1TKDA 1JXLA 2HB5A 1W9HA 5J0QA 1RT5A 3KD1E 2IMWP 4ECWA 4ZTFA 4FBTA 4Z4EA 1LW2A 5HP4A 4J9QA 3ZDDA 2DTUA 4UBBA 1GOBA 3P5JA 1Q9XA 3VQEA 1RTJA 1ZQUA 5J0OA 4M6WA 1KFDA 7ICOA 3MFHA 1C1AA 4DFKA 7ICKA 4F4WA 3JSMA 2F8TA 2JEFA 3IM1A 5DGBA 4KHNA 4CFDA 3DLKA 1TVRA 3MXMA 5KFUA 1QLNA 1WSHA 2FMQA 4E3SA 1ZQDA 2E6LA 5KGXA 3ZSRA 5KFJA 4QWAA 4MF8A 2RDIA 2DPJA 4MFCA 1X2IA 4YR2A 2ZQBA 1ASVA 2O4GA 5HHHA 5KFKA 3RAQA 5KG2A 3PMLA 1HQUA 4EYHB 8ICEA 3MEDA 3DLEA 2BQUA 3BQ2A 4CJPA 2ZJAA 4BWMA 9ICQA 2HVIA 3GIJA 3Q8LA 3AV9A 3HJFA 9ICUA 9ICCA 5SWMA 3QZ8A 3SQ0A 4XRHA 4EYIB 4RPZA 1JLCA 4AHUA 4DOBA 1IG9A 3OYFA 3HVTA 5K14A 3AVCA 4QWBA 4M41A 4Y1DA 3KIOA 3QIPA 3O3HA 3NF9A 5CB1A 5KG7A 4BWJA 3G6YA 4QOZB 3B6OA 2W8LA 3GIMA 1BPXA 3HXMA 9ICTA 2G8WA 4ED3A 4RT2A 5CZ2A 3OYHA 3SV3A 4F91B 2JZBB 4DQQA 4C8OA 3EY1A 3D0PA 3MGHA 1LWFA 1WCNA 1RDCA 1VSIA 4B8AB 4DTOA 4XA5A 1QSYA 5DB7A 5J2JA 5J2QA 3G10A 1WLJA 3V7JA 4QWCA 4F4KA 3AO5A 3V1RA 4NCAA 4JK1A 3VQ4A 8ICXA 4MEXA 3NGYA 4KAZA 4R5PA 4N41A 5JS1A 3PR4A 2VA8A 3AVMA 3OYLA 4C8LA 1RYRA 4GW6A 2VG5A 3K75D 3EWAA 4Z6CA 4KLEA 4YVZA 4PHPA 3NE6A 5BOLA 5KT3A 4EZ6A 3I8DA 4CEAA 1RBUA 3HK2A 4UB2A 4E7JA 3RTVA 4ECSA 3KD5E 2P5OA 1C0MA 3BQ1A 2KQ2A 3EPGA 3L2UA 1WSEA 1KRPA 1O1WA 4IR1A 1Y97A 4I2IA 5DB8A 1NK5A 3LAMA 4CGDA 3KLEA 1B43A 1TV9A 1RDAA 4OJRA 1ZETA 4TUPA 3V9XA 4M47A 4KHYA 8ICWA 4RZRA 1XSLA 3RBEA 3SJJA 4HCBA 3HYFA 4BE2A 4MEYA 4G1QA 9ICLA 5KI6A 1D8YA 1ZQNA 3MXIA 5J2BA 3HP6A 4JLHA 2DPIA 2D5RA 2HHVA 2D0CA 1S0OA 3PVXA 3PX0A 4GXKA 1IKWA 5IINA 1KFSA 4FJJA 5J0YA 2YNFA 4KREA 3ORYA 4BE1A 4CJLA 3AVIA 1TL1A 4O0JA 8ICGA 1TK0A 5TZVA 4P4OA 1CXQA 4JV2A 1HUOA 1VSLA 2A1JB 4CF0A 7ICVA 4FS1A 1S1WA 8ICRA 4OKKA 2R8HA 1WN7A 3VN5A 3ZDCA 2W9BA 5DDYA 3TARA 3FDSA 3KHGA 4EBDA 2ZE2A 4W5QA 4FJNA 1X9MA 3A2FA 3MR5A 4QZFA 3GV8B 9ICFA 5CY4A 5J0SA 4YFKA 3SUNA 2XY5A 1HNIA 4CF8A 2ATLA 4FXDA 4B8CA 3VQ9A 5FRMA 3RJKA 2V4QA 4OGCA 4MFAA 3HW8A 3ZDBA 3IHQB 3SNNA 4I2QA 1NJYA 1XI1A 4IRCA 3HX0A 2GBZA 4E7LA 3MDAA 2HHXA 1ZQOA 1CUKA 4JWMA 2F1JA 2I9GA 2NUBA 4DL6A 3Q8RB 1WAJA 4DL4A 1SUQA 1ZQCA 4KLHA 5KFQA 2DFLA 9ICGA 1JL1A 1ZBHA 1Q8IA 3OYEA 1D9FA 5IIMA 3C2LA 1DOQA 4BXOB 3PW2A 1BHLA 3OY9A 1TKTA 1TKXA 2DFEA 1XHZA 2V9WA 3Q8QB 4Z4GA 3LPTA 4CESA 1NK6A 4FVMA 4CJSA 4CF2A 5KFOA 2BE2A 2VWKA 4GC7A 3V7KA 2XY7A 3T19A 4DF8A 1NJZA 4ICLA 1N48A 1C6VA 1QE1A 3JPSA 3OYAA 2BCRA 5HRSA 4HYKA 4B9NA 4DS5A 4RUAA 2A1RA 4ECRA 3T5KA 2W9CA 3MAQA 4QZDA 2BDPA 1ZQXA 4QZBA 5CYQA 2BGGA 4BDYA 3S3OA 2E4LA 7ICSA 1ZQIA 2P6UA 4CEDA 1HUZA 3QEXA 3SPZA 3OYMA 1KLMA 1A5VA 3K59A 8ICOA 2ZUDA 4PWDA 1Z00A 4R8UA 3UPQA 3NF7A 2QK9A 4I7FA 2XC9A 3V9ZA 1RCHA 1VRUA 1ITGA 2WOMA 4UBCA 4I2BA 5HRNA 2YNGA 2AJQA 5KTQA 3EZ5A 3D45A 5BPCA 3ZT4A 2ZUBA 4E19A 2ISPA 1BCOA 3S3MA 3B0XA 4IKFA 3OSPA 1WSGA 1LWEA 4Z4IA 3SV4A 2VA2A 3HPHA 3QLHA 3KLFA 3TAFA 2PY5A 5KFEA 4LZDA 4YD1A 4CE9A 5KG4A 5J29A 4CCHA 2DY4A 4M9HA 1KVAA 4HCCA 9ICRA 3T1AA 2QKBA 4DL5A 3B6PA 4F4ZA 3PY8A 4OLBA 4K8ZA 3LAKA 5DB9A 5IILA 1U47A 3ALYA 4DFJA 1IO2A 3NH1A 4ID5A 4RQ6A 4NYNA 1GOAA 3Q8KA 1EXQA 1B92A 4XUSA 4KITB 4ECVA 3NH0A 1BPYA 4AHCA 2VG6A 2D0BA 4OKJA 4MQ3A 1VSFA 4CGIA 2XCPA 4JV1A 3KLHA 4F5PA 3K57A 3O4NA 4CJFA 9ICAA 3PUFA 1ZQSA 4FJ5A 4F5NA 2HNZA 3CM5A 3NDKA 1K1QA 4J9PA 4HVJA 3DLHA 1KTQA 4B9UA 3DRSA 5DMRA 4MFFA 3V6JA 3LWLA 4EP5A 1S0VA 4KLLA 3LWMA 7ICLA 5KFGA 4F93B 3GIIA 2OPPA 4KHQA 2IS3A 1N5YA 1T05A 2JEIA 4KLFA 7ICNA 1T03A 1KFTA 4ECYA 5DBBA 1ZQQA 3SUPA 4UAZA 4I2AA 1I39A 4E89A 2P51A 1ZQEA 3H7IA 1JLAA 4BGDA 3VQ5A 1RT7A 3IG1A 3FFIA 1A5WA 2XRIA 3T5HA 4LD0A 5E41A 1RBSA 5EOZA 3NTUA 2G8HA 2W42A 3GQCA 2RDJA 4BACA 5KFFA 2KN7A 3ISDA 2YKMA 3M9OB 4KTZA 3AA4A 3RWUA 4CJUA 3HWTA 1ZBFA 4KLJA 4O3PA 4CJEA 1TAUA 4DTSA 3U3GA 3JPTA 2W8KA 8ICQA 2XHBA 3ZD9A 1YTUA 4DF4A 4P4MA 4Z4CA 2RKIA 3G6VA 3LP3A 2OWOA 3KKRA 3HVRA 5J2CA 1AROP 4DSIA 1N6QA 4FLVA 3ASMA 3DRPA 2XGQA 3ZSOA 2FBYA 4ECTA 3HPOA 4JS4A 4PQUA 5DG9A 2YHBA 4R63A 1S6PA 4DSFA 1C0TA 1XO1A 1RTIA 2NRWA 3M9MB
chains in the Genus database with same CATH superfamily
5JS2A 5J2PA 2O67A 1Y5NB 3R2CJ 1YJTA 4Q0BA 3DXKB 4X4QA 3RB3A 2GIRA 4LF4J 2BDUA 1Q86T 3M3ZA 5KPTA 4CO5A 1EKSA 2WB1D 2NXUA 3C16B 4YB5A 2O1PA 1VAZA 1A6SA 3H1VX 3H4BA 3CHWA 1P8GA 3E01B 1T6CA 5CZ1A 4OHVA 4DTMA 5DQIA 1QQMA 5J2HA 2CJBA 3MAAB 1P9QC 1JKHB 3O3GA 3MMCB 3OVBA 3OSNA 2KRBA 2Y9TA 4ZPCA 1FF2A 1Y00A 3TFRA 9ICJA 2QA4N 3EXCX 4NLRA 5CWRA 1RTDA 1RI7A 1CULA 5A8KA 1KVIA 4MTPA 4DCHA 2VCPA 2F1IA 2OI2A 8ICBA 2AP6A 1FJ7A 1SJRA 2HOQA 3WBZA 2M0GB 3CVKA 4PHDA 4KX3A 2MZQA 4E8UA 2RSQA 3VQ6A 3BSOA 5JICA 5KT6A 3FUYA 2NRVA 1KBRA 4QBUA 8ATCB 3IRXB 3OXGA 1EX8A 1RABB 3A13A 3BPDA 3MX5A 2GWSA 3TJ8A 2HK2A 1VLBA 4FJMA 3I55S 5IOLA 2BJ8A 2R4FA 1I1GA 4N76A 4JK9A 5ELZA 1ZAWA 1TYQB 1OQ3A 2AJ0A 4ZTJA 2W7AA 4YMOA 2XG8A 2J6UA 1FFUA 4DR4K 2AYEA 4PRFA 2GOLA 3CCLN 3K8WA 1KQSM 4XIUA 1ZAVA 3PSTA 1URJA 1VI7A 2P9GA 1RT5B 4DR4F 2RQCA 1KSPA 4HVZA 3KVGA 1VQLS 1NKEA 5DBAA 3RRHA 3DLBA 3IRWP 1DLOA 3BGRB 4MLHA 4CDGA 3M2UA 4YB6A 1RWWB 5B7WA 1SIZA 2DNLA 1A5XA 5CZXA 4K41A 3V6DA 1OH7A 4A8FA 3GV7B 5E3AA 5C2CA 5HMXA 1KDHA 3FEZA 3BQTA 1PJ7A 3J80U 4WPAA 3DLKB 3H3NO 7ICQA 3TVKA 1QSLA 1U7LA 3HRGA 2ZUCA 4FO0A 1PILA 4KKOA 4DFPA 2DUYA 2WONA 4K25A 2IBKA 3QYPA 4ZCMA 2FBVA 3H4DA 4C0HA 1T94A 3G71S 2J7KA 1EXNA 2HDOA 2NXJA 1S6QA 3E66A 1FKOB 3PM9A 4LRCA 3C23A 5IIOA 2KT2A 3DOMB 4QIWC 1ZQPA 1XK8A 1SC1B 2HF4A 3CFPA 4M5LA 2NZ4A 3HM8A 2PFFB 4DV3K 4ZP6A 1BL3A 5CAAA 2O8FB 3CD6S 3HSGA 3DLEB 3VQPA 4CO2A 2KVSA 1R59O 3OHAA 5HRPA 4K2XA 1BIZA 5KFBA 5IC6B 2HBKA 3CJ2A 2ASYA 2RQ4A 2E7WA 2EK1A 3OYNA 4DV3F 2BA9A 2HFVA 2WF7A 2IAJA 2G2ZA 2VA3A 1JRPA 5J2AA 3R5BA 2CNKB 3DOKA 4ED2A 4J91A 2A2CA 1I94K 1S72N 3LL3A 2E88A 1Z2LA 3ZT2A 4JI2J 3TUIC 1S77D 3KXDA 3M7VA 5IIIA 2CPRA 3EJMA 2KXHA 3PX6A 1PIEA 2OKQA 3TAEA 2G08A 1C1BB 2AJFE 3MEGB 3CP8A 3DDHA 2LDYA 1YX2A 2YTCA 2IMOA 4B9TA 4CEFA 4GIBA 4ACOA 2YX7A 4QU6A 5HJYA 1FE0A 4E7KA 3J81U 1JN3A 3V1QA 2BKNA 3VERA 3AB2B 3CDWA 3OVAA 2B4VA 4LFBK 3FMBA 1HBOA 2PN6A 4CO3A 4J9OA 1SKSA 4ZLNA 1CC8A 1NCLA 1JQGA 1IKXB 3U26A 3VAGA 3DWLA 4MKVA 2V9KA 4KLOA 1H1VA 4F9OA 3AU6A 2HOIA 2K8CB 2DNYA 4ES2A 4LFBF 2DNZA 3DCAA 1IKVA 2EDUA 3PG9A 4R5PB 4NLVA 4RW8A 6AT1B 7FD1A 4E1MA 9ICKA 4L76A 3D6FB 4CK1A 3N4PA 3MPUB 3HL8A 3QGGA 3AA2A 3FR0A 1TELA 4CD1A 4AF1A 4P72A 5E79U 2ZIVB 2W9AA 5IM0B 3CCRS 5AQFA 3S41A 5M1NA 1ZQWA 4OZ5A 1RNHA 4NLUA 1TTHB 4YFUA 4TUQA 2EQYA 4IO9L 4G9BA 2ASDA 4RNHA 1KXPA 1FDAA 1HKCA 5D0EA 4EFHA 4F25A 3AVHA 4TQRA 2OO4A 3J7Z5 4ZVGA 4ES1A 2BGWA 1T3OA 3BP8A 1QQ6A 1NU4A 1C2PA 3CCVS 1Z1ZA 3PJ9A 3F73A 2HG4A 2CQPA 2PFQA 5ALLA 3L95X 1LOTB 5TISU 1S9FA 4DFMA 2X1BA 4YOYA 2HS3A 1JCEA 1Q0NA 3CETA 2KEYA 4KGMA 1C0FA 2W24A 4OYWA 3BM7A 2E1EA 2DQNB 5HMZA 1KVCA 2KZMA 2Z8QA 3LDSA 3LH2S 2GJFA 3SI8A 3J81j 1PYOB 2FZCB 2AZ3A 1O6XA 1LAWA 3OW2M 9ICMA 3ULEB 1T9WA 2ZF5O 5L1KA 4CVNE 5FD1A 3NVYA 1P1TA 3UKUB 2J5AA 4PGXA 3BSAA 1UTAA 4IOCL 4DR2J 3CIPA 2HRYA 1ZQGA 4JKFA 2AEJA 4YHHJ 4NL9A 5HO4A 4ED6A 1FW6A 4IG3B 2PZSA 3SCIE 5ETRA 3D6JA 2D0AA 3TJAA 3R27A 3FYHA 4ANEA 2EG1A 1NGFA 1FE4A 3NCRA 1MA9B 2G1HA 1NOMA 2ZTCA 2G1DA 4WFNL 4FJHA 4FKXA 4PZNA 5F9NA 3DYAA 3K1ZA 5J2DA 5BYRA 3KK2A 5AQXA 3BR9A 1NGDA 3WXLA 3PYGA 3M6ZA 2P66A 4P2HA 3IMXA 2DGVA 2KHCA 5AK3A 2FJBB 2IC3A 3AO3A 1XBWA 1MWZA 1RKIA 2GVDA 2POKA 3TANA 3QUTA 1H98A 5AKXA 4OZ2A 2OMLA 3BN4A 1RTHB 4FS2A 2KVQE 2Z30B 3CMQA 2ZZTA 1B99A 5IC4B 2VPXB 4RBTA 4BLGA 3SBMA 3EXYA 5C25A 5K20B 5AQTA 4LF9J 3KHYA 5LJWA 5C5JA 2EBEA 3CWJA 4M5DB 1T4GA 4IR9A 2UXDK 2W11A 2D41A 3D4JA 4MDAA 4EZ9A 1FERA 1EKRA 4BS2A 2DNKA 3VCBA 2BJDA 5D15A 2ESEA 1D3WA 2HVEA 2UXDF 2Q1LA 4USVA 3PO5A 3TEGA 1BVSA 4YOTA 2UVRA 4DWIA 3R2DJ 3M05A 4MKBA 5ETVA 3F5AA 1VLOA 3FC4A 4C3MA 3CM6A 3G6XA 2EFOA 5JVGL 5IIJA 3AO2A 1SKWA 1YHQS 3THPA 4UF4A 2PO4A 3SSRA 8ICCA 5AI6A 5IWAK 4K0KK 2E6MA 3OQ2A 1RHKB 4C6AA 3OYGA 2ZDPA 3ZT0A 3L9ZA 2EPIA 1FEZA 2IHNA 2W3SA 2EG2A 3W5XA 3QWUA 2NUUG 5IWAF 1UP1A 4CJQA 4K0KF 2YNGB 1KD1T 3THVA 1GLDG 1WB9A 2H3EB 3CFOA 5BN9A 3TP2A 4ES3A 2W4CA 3M7DA 5L39A 4LMZA 4K7QA 3ZC4A 2WF5A 3LP0B 5EXWA 5ALWA 2IRUA 2BRKA 3QLHB 3I0SA 4DI6A 2FVRA 3QINA 3EL2A 9ICIA 2EC2A 4OLPA 4O4GA 1B9FA 4UAWA 5FDLB 2VD3A 5THWA 4I2JA 3O4WA 2CXEA 3M1VA 5J0WA 4HHUA 4RQ4A 4RQ8A 1KWMA 2D7SA 3N7RC 1HQ2A 2ADCA 4J9SA 4K4VA 4RNOA 2I5JA 5EE1A 3UQ2A 1Y7PA 3WX8A 3Q22A 3LW5C 2ROPA 2KE7A 1S9GA 4Y28C 5IZHA 1NWKA 2LU1A 3S01A 1PO6A 3CJKA 1Y0HA 3CC7S 5I9EB 1ZQLA 4M3TA 4C8MA 2MZSA 4MMOA 3CCQS 2KJWA 1DRGA 3AVLA 4BRQA 4LF8J 4I2DA 2JGAA 2GH1A 4ALZA 3E9OA 3O1BA 3H40A 4DPXA 1VHIA 3ZSYA 1IBKJ 3NGDA 4L74A 3UMCA 3R5GA 3HFVA 5E26A 2YV0X 1JK9B 4ISEA 4PGYA 2DO4A 3O9UA 1WC1A 3AXMA 4NLZA 2XI3A 4OL8A 3NBPA 2FMSA 5ALUA 2AKWB 1KQQA 2CGKA 1JX4A 4CZEA 1T05B 3D1QA 3KLIA 3J8AA 3U1MA 1T03B 4PXBA 2RUGA 5AE2A 4TN2A 4CGJA 1RZMA 1Q16B 2PEBA 1JLAB 3M2RA 4FWOA 1NNEA 1RT7B 2DVIA 1OH8A 4DDFA 2XEXA 3H8JA 4OI6A 5KFVA 3CJSA 3HHNB 2ZKTA 1GAOA 4ZPBA 3EM1A 2GC8A 1XU4A 3PO4A 1TGOA 1FXXA 4HLBA 3LP1B 1ZYQA 2V8VA 2YKMB 3EGNA 4XQ8A 2Y1JA 4DX5A 4HI1A 2DGZA 2DF4B 1KDNA 1U2CA 3UDCA 3C1YA 3DC2A 1X4BA 4PZVA 1VQ4S 5C0YA 4M04A 1LXNA 1BPDA 3NS7B 1WJ9A 4NV0A 1L7MA 2D0OA 2HBLA 5HP1A 3UCGA 2PFUA 3L2VA 4I2FA 1DY3A 1UL3A 3DRPB 2WCXA 2J9DA 2C2MB 4E1NA 3M8ZA 3D66A 8ICLA 3VEOA 3HHKA 3GFKB 5J1EA 3ISZA 4J9NA 3CG7A 8ICAA 3DKDA 2PD1A 2FXUA 2XMAA 2DYAA 2I5HA 2BJ7A 3MF5A 2HZVA 4OYMA 2OLWA 5KQDA 4ZIVA 3WNGA 3MHYA 2HS0A 1N34K 2EH9A 1VBXA 4RW7B 2G8VA 3HILA 3NAIA 2ZIUB 3MGIA 1YJWN 4BGBA 2BQRA 4O5BA 1N34F 5KT4A 3VAHA 4BC7A 5AE1A 3CCTA 1RGVA 1FNXH 4ZHRA 4WCEQ 3R7NB 2AXTU 2HLUA 1KCFA 1M5KC 5AM3A 3AT1B 2OHDA 1T3NA 3HKWA 1CJTA 1U1QA 4CJ3A 3TWZA 3UR3C 3O5TB 4BQLA 1WSIA 2GVZA 5HBMB 4TNOA 1IM4A 2DHXA 2DB1A 4G3IA 1ULRA 3AJ2A 3BF3A 3CJAA 2C22A 1VLYA 4CNQA 3U4LA 3RJEA 1LWCA 1WKKA 1KOOA 2ITGA 3ZTPA 3MMBA 1XERA 2HW3A 2NNWA 4IQMA 4LF2A 2F7TA 3VQTA 1HJOA 4L3QA 2L9NA 1XHXA 2JNJA 1RYSA 4RLEA 2EAPA 2KKZA 3GL1A 1S1TB 2JEJA 2KM8C 3HVTB 1YITN 4I68A 5K5MA 3GTYX 4UT4A 3NNAA 1COOA 2RD5C 1V6HA 2ALZA 2MKIA 3QPIA 4HACA 4DSKA 1IWGA 1WEYA 2XI9A 2I1QA 5B5EU 2MYFA 4PXEA 4MYUA 2FD2A 4FVUA 3CW2C 3B0YA 1K5OA 3I5BA 5LT5A 1HMVB 1GT8A 1UJ6A 3HOTA 2ES6A 1VSKA 3QEWA 3Q24A 3LO3A 2DFFA 3NGIA 2HK3A 1MROB 1DAXA 4CHOA 5D4LA 2KP7A 1NK8A 5BREA 2DGUA 1SV0C 3MR3A 5GAEP 4NEYA 1XQIA 3POTA 4FJ9A 1SQEA 1S76D 2P9KA 5DM7Q 1ITPA 2Z2YB 1U9LA 1R43A 4M5KA 1RBTA 2O8DA 2A1AA 4FWQA 4YCXA 3TNVA 3QE9Y 5HVFA 3V72A 5CR4A 4N5SA 1JXVA 4IO1A 3R1XA 3FZLA 2F4VK 3M6XA 3OTQA 3NMAA 1NBEB 5A8RB 3KD3A 3H08A 2E29A 1HUXA 4XPEA 1W0HA 5DQGA 4MLEA 5ALRA 4NLGA 1FKAF 3ENHA 3FKBA 2F4VF 2K1RA 1S10A 3S6EA 2BPGA 1SJ1A 5M1FA 1BNPA 2JGUA 2F1FA 1MMNA 1AZSA 4CH1A 3KLEB 1VQNN 3H0PA 2GWJA 4FCYA 3D2EB 3DGVA 1EHWA 4O9MA 1YRXA 4CLSA 1OKJA 3QGPA 5CYMA 3ZO7A 2J9EA 2KLAA 4I9LA 3AFGA 4KLIA 2OPSA 4LZGA 3TZWA 4ILMA 1IXRA 3ZETB 3UWTA 3A0BU 3I4HX 3EVWA 3KG1A 3CJ7A 1RDDA 2JFKA 4W92B 4FJ8A 2BMBA 1KLNA 2V7ZA 2FBXA 2F8EX 3I82A 3CERA 2FJAB 3A1YG 4FM2A 1TMMA 4EU0A 2V68A 2CAJA 4JI1J 1HNXJ 4FJKA 3KG0A 1O08A 1S57A 2KO1A 3NMUA 2D8CA 3MZIA 3BS9A 3HHEA 3O9TA 2DHAA 1Q79A 3HHDA 4ELVA 1PZNA 4IOAL 1L3TA 3T1HJ 4CRJA 3HHLD 2YPZA 1ZQFA 4NASA 3QU7A 5D6GA 3IR6B 4XAKA 3Q8PB 2YNIB 3M30B 1YZ6A 3WEEB 4FZNA 4NLTA 5KFMA 4QIFA 4X2BA 1ROFA 4P0PA 4J2DA 3RH5A 2PMHA 4F72A 3RMCA 4ED1A 1BUXA 4CZIA 2RHKA 4P2SA 2VKZG 3HKZC 4F5OA 4HUEA 3KOAA 2RUSA 3WNFA 1C1CA 4B1ZA 1N61A 2BZFA 4LC9B 1JLGB 2UUCJ 3FSXA 3O1WA 4EBEA 5IIKA 2W2MP 4C8NA 2M9NA 4E0DA 3QUCA 1PBUA 3TAQA 4W5RA 2R3VA 2UUAJ 4JI6K 3EWGA 4HTIA 4QR0A 4UOHA 3SQ4A 1PG5B 5ETNA 1BPBA 3TUZC 3LDNA 4LRDA 3L4BC 1F2HA 4JI6F 3UO0A 4LH5A 3QSIA 2I9SA 2PYJA 1VIOA 1SL2A 5AXMA 4C4SA 2B0CA 4NLBA 3AXKA 1U48A 5C10A 2XZWA 3NGTA 4LH4A 4E2FB 3D68A 3C15A 3GYNA 2E1RA 2DGXA 5DG7A 4V19X 2FHOB 2IVPA 4CZHA 3N5FA 1YJRA 4WXOA 2PFOA 2H5EA 1VHXA 2AGOA 4EX7A 4RNMA 2HVDA 4H4MB 9ICBA 4DR6J 3AAQA 4AYBC 2AGPA 3G87A 4FBUA 3T41A 3FZBA 4F92B 1VQYA 3THTA 4FJXA 3K5PA 2XY8A 1XSPA 1Z4NA 1O51A 3D3BJ 4CEOA 3KBBA 1TL7B 4GMKA 4P9SA 1HPZA 3D3CJ 3HT3A 3RMAA 3PTWA 4IFVB 1ASUA 4UB6U 2RIJA 3BB5A 4ED0A 2DL0A 2QX0A 3VQQA 3THXB 5DB6A 4O55A 1SQFA 2RHFA 2PYLA 1GLAG 3I55N 3U1LA 2E3TA 1CZ9A 5EVZA 3KLFB 5KFRA 4IDKA 2D3O1 4KX5A 4M63A 3RF9A 3ET6B 1SXEA 2VICA 5EWEA 1XEZA 3IBFB 3CQXA 4E7HA 4CBUA 4CIEA 2DHHA 1M5VC 4YD2A 4FPIA 1MSWD 2A0FB 4F7VA 3RR8A 4PWWA 4RW9A 3C7NB 4Z4FA 2EEYA 3MM9A 4X62K 1OS5A 1F6TA 4KLGA 3NWRA 4M2YA 1GMVA 3QSYB 1FIQA 3UDLA 1YIJS 3HD1A 2QW9A 3KKSA 4ID5B 1U0HB 3GSIA 4X62F 3NUQA 2GMLA 4A57A 5KT2A 3IG5A 1KHVA 1VQLN 4DR7K 4P7TA 4I6MB 4DU1A 2VL1A 1VRQC 2QL7B 3SUQA 4ZVHA 4KBOA 1NGBA 3PFEA 1RDBA 3H8MA 2GGPA 3BGLA 3VAIA 1JXLA 2HB5A 1W9HA 3KD1E 3T1YJ 4ZTFA 3HF5A 5HP4A 4X65K 3P5JA 1L3KA 3JSBA 1UFKA 3X3UA 3Q0AA 1KTVA 1WACA 1WHWA 1VJ5A 3MFHA 4X65F 5AZJB 3G71N 4U9RA 3JSMA 4QYZJ 3P5TL 2JEFA 3W5ZA 1GK8A 4AM6A 4KHNA 1QCKA 4CFDA 3HSDA 2NZTA 2R2SA 4AQYJ 3EDRB 3PSPA 2QWMA 1QLNA 1NMNA 1WSHA 4E3SA 3SJHA 1HLWA 4FKYA 5B8HA 1VIXA 3CD6N 4QWAA 1HBMB 4OJ5A 1WEZA 2GNKA 3OFHA 3ZEUA 4MF8A 1IBLJ 1K0VA 4L73A 2E2NA 2NYIA 4RQNA 3IFEA 4YR2A 1NDKA 2ZQBA 2O4GA 3FFIB 4PG7A 4K50A 1QZ6A 5AQQA 1FD8A 3R5AA 3I76A 2H5IB 4AD6A 4OYIA 1HQUA 4EYHB 4IO8A 3MEDA 1QUVA 2Q3PA 4BJQA 2BQUA 4YY3K 1DK2A 2ZJAA 1NDLA 4FPBA 4NZ6A 2C2NA 2DCLA 2CJYB 4NI2B 1M90O 3SLCA 9ICCA 4WJ3B 1NGHA 1T3QA 2K2PA 1FFVA 2L9DA 5F3XB 3SQ0A 1KAZA 4YY3F 3N28A 4BVOA 2Q1NA 4WYLA 1XN9A 3P31A 4YUDA 2KOBA 2V34A 2VUGA 3D0GE 3OLAA 5K14A 1U09A 4KH4A 2EANA 1P6TA 2LM1A 3KIOA 1WC0A 1K47A 1VQ8S 3QIPA 4ZOHC 3BV8A 2CZVC 3OTOJ 2FPHX 1C0TB 5KG7A 4BWJA 3B6BA 5D0GA 3VEWA 1RTIB 9RUBA 3FBFA 4WFBQ 4A8WA 4JI3K 2P9IA 3GR1A 2W8LA 4Q0BB 2ZDOA 4URSA 4ZCIA 3LUYA 3VQSA 2JC0A 3HXMA 1IWAA 2G8WA 2KI2A 3D1HA 4ED3A 4IJNA 4DR1K 2HPUA 1UVNA 3EE9A 1BOTO 1U8SA 4DQQA 4JI3F 1ZM4A 4OZ0A 4A59A 1HNVB 1QSYA 4GV6A 1F9HA 4JI7K 3CCRN 2YMLA 5D8HB 3V7JA 2ZBCA 5H2FU 4ZIWA 4DR1F 3VQ4A 2W3RA 3J7A1 3TVZA 3DLLQ 3T9NA 1EARA 4RR5A 4KHMA 4JKAA 2MU2A 1KL9A 2VA8A 3VGTA 4JI7F 3AVMA 3B4MA 1G4CA 2IYGA 3JXUA 1RYRA 4GRSA 2VG5A 1DRZA 3EWAA 4Z6CA 4Y2VA 3GFXA 1U1LA 4YVZA 4EZ6A 4OX9K 2DNMA 2E20A 3GE1A 1RTDB 4A62A 4OJ6A 4NMLA 4N77A 1UQVA 3CCVN 1P27B 4UB2A 4E7JA 1RBOB 4OX9F 2BW7A 2GX8A 3R9LA 1MMLA 4IR1A 3AD8C 2VF3A 4I2IA 1Y97A 1K8AO 4JI0K 2QLWA 4LF7K 1NK5A 3E0FA 3P4IA 4Q2MA 1B43A 1TV9A 4OZ3A 4XO0A 1RQ0A 5SUHA 4LRFA 4TUPA 4OQJA 4MN4C 3OR1B 4RZRA 2BEFA 4FPRA 3RBEA 3SJJA 1A0PA 4LBIA 4JI0F 1DHMA 3HYFA 4G1QA 3VGLA 1ZQNA 2XNQA 3MXIA 1SGGA 3HP6A 3I8BA 2V8PA 4EEKA 2NCKL 5AIAA 2KV2A 3PVXA 1JLQB 3KKAC 4IUFA 3KJVB 2DNOA 2YMMA 4MIWA 1RWMB 3OBIA 5IINA 2U2FA 5AQUA 5M1PA 5J0YA 4KREA 1JUDA 3VGMA 2R7QA 3W1YC 4E98A 3IO1A 2ADBA 4BC5A 2JWLA 1AUDA 3AVIA 3EE3A 5A76A 5TZVA 1RT1B 2MGZA 2R7WA 2QM1A 3DJCA 4JV5K 3QATA 1CXQA 5FIIA 2A1JB 2MXYA 7ICVA 5T7LA 4EIAA 4OI1A 2YMQA 8ICRA 2R8HA 1WN7A 4F0KA 3VN5A 3MUVP 2FYXA 4UY85 4JV5F 1U1MA 1ZBTA 3TARA 3KHGA 4EBDA 4W5QA 4DUZK 1XR6A 3L09A 5AQVA 3OXLA 1X9MA 2XBPA 2V4JA 4Y2QA 4NYPA 4QZFA 3GV8B 9ICFA 2WFBA 3SUNA 1M1KO 3MCMA 5AQPA 4DUZF 2QZ8A 4J37A 2MY8A 3LGMA 3WKAA 2WONB 3DXBA 5FRMA 1QQ5A 2FF6A 4OGCA 4MFAA 4A8YA 2I2YA 3HW8A 1QY7A 3ZDBA 2YI1A 3HX0A 2GBZA 1SIWB 3MDAA 2HHXA 2W2PP 5GAHI 2FGOA 2F1JA 3SMPA 4B9QA 1WAJA 3MI7X 1NZBA 2PMWA 5ITHA 3UCZP 3FSIA 1OY6A 2V5HG 1ZQCA 1SJFA 3BZCA 4TU9A 3EKSA 1IVZA 4QJFB 3C2LA 2DRDA 1BHLA 3GBTA 1TKTA 2IAJB 1N5WA 2LFVA 4QPTA 5GADI 1N8RO 4WQ5C 2ZG6A 4CESA 2F76X 4LR9A 2EBGA 5CYJA 6FDRA 3MEKA 2CQCA 2DGOA 1YHQN 2G0CA 2IVMA 4OFZA 2RJZA 3T19A 4PXDA 1YKWA 1N48A 1U25A 3K2YA 1C6VA 2RHSB 1SVDA 2E1FA 4B9NA 5GAHU 4DS5A 1SZ2A 2W9CA 4U67Q 2G09A 1ZQXA 5CYQA 2BJ1A 3QT6A 3UNGC 7ICSA 3UM9A 2P6UA 4CEDA 1HUZA 3QEXA 1N32K 1SB3C 1KLMA 3NRWA 1M90T 1N63A 4FF4A 4PWDA 1N5XA 3UPQA 3UQSA 3NF7A 1GFWB 2YQ3A 4DZ6A 4USIA 2ZH4A 3V9ZA 4RX6A 2PMZF 1IKVB 3JB9k 3CC4S 4PYDA 1N32F 4RW8B 2GO8A 5GADU 3GWCA 3MAHA 5I42B 1PKUA 4IKAA 3MM6A 1ZAXA 3Q83A 3EZ5A 2B4PA 3D45A 2RRBA 2ZHOA 3J80O 2YH0A 2ISPA 3DXMA 2E1ZA 3PIPQ 3I6PA 3W64A 2YB4A 3HPHA 4U8YA 4TU7A 5HR7A 5KG4A 4CCHA 1RT6B 1KVAA 4HCCA 1OIAA 2XZTB 5AQGA 2QKBA 4DL5A 2AJ1A 2E9TA 3C66A 2UZAA 3CC7N 3MMJA 3ZX2A 3MURP 4DFJA 3CCQN 4JKGB 4PG6A 5EX0A 2HRTA 3ZTRA 3HOSA 2HGMA 3KZIU 1SV0A 3MCNA 1BPYA 2VG6A 1PYSB 3TW0A 5AR0A 1FA0A 1WYGA 2PA3A 2D0BA 2QWLA 3EZOA 2XCPA 2B7CB 4QS7A 3LF0A 2YWWA 4CIOA 3K57A 4BHQA 5A0LA 3IAM9 2UP1A 4NLQA 1R8AA 1FRXA 1V5VA 3NDKA 2MQMA 4J9PA 3IM9A 1X4EA 2GCFA 4ZK7M 1S1XB 1K8AT 4B9UA 5L9NA 3P39A 4U6PA 2LQJA 1CJUA 5AZIA 4ZP9A 3V6JA 3UKRB 4UOGA 5AKIA 4F93B 2N3OA 3MTKA 1JCGA 2CQGA 1I94J 4PL1A 1KFTA 4BRMA 2C3UA 2WVEA 4NCGB 3SCJE 2IJRA 1B4FA 4PHTX 5IV4A 3G4SS 1WOSA 5MLCV 1A5WA 3DYAB 2YX8A 1VQ4N 2YTUA 4IXCA 5EOZA 1V3ZA 4ZVRB 3GYXB 3GQCA 1XUPO 3GG0A 4AM7A 5KFFA 2CJAA 2GQ2A 3AA4A 3RWUA 1HWLA 1X4GA 4CJUA 3HWTA 3EMTA 2IC3B 1TAUA 4ZCKA 1N36K 2GELA 2GVDB 1RAAB 1OVYA 3ZD9A 5HAOA 1OQ6A 4DF4A 2RKIA 2OFGX 2OWOA 2XMKA 5LMUJ 1HIWA 2DXFA 3HVRA 1N36F 4IOXA 2VC1A 2ZBRA 1B64A 5ALEA 3KDNA 4NXMK 4DSIA 1UPPA 2I38A 2VJUA 1D0EA 3M6UA 4C11B 1ZM9A 1U1OA 1FD2A 2JVOA 2CVEA 3HPOA 3RYLA 1VBYA 4DV7K 5JMNA 1H7WA 4JI4K 1S6PA 3L5KA 3M4XA 5CRXA 1OSDA 4NXMF 1EZZB 1M1KT 4JD2A 2Y0SF 2RE1A 1WG1A 2C2RA 4DV7F 7ICTA 4JI4F 3P38A 3AU2A 1DARA 1HBUB 3W7BA 4PHAA 2KU7A 2Z1HA 1DGSA 2ABYA 4ZDNA 2BZ2A 1AFIA 5KFLA 4WE1A 5AICA 2HHUA 5A8WB 2ZJ5A 4UARA 1ZQRA 3JTOA 3QIDA 1GX6A 2VJ5A 1RT3A 1EP4B 1FKPB 1X42A 3MBYA 4TUSA 3SQ2A 1VK3A 4RPXA 2Z1JA 2Y1IA 2E44A 2VQEK 4PHEA 1J27A 5D3GA 3W8GA 4FZLA 4QNLA 3CJRA 4M5GA 3OR2A 3KK3A 1EQMA 3Q2TC 2E5JA 3F9MA 1BQXA 1N8RT 1OJ4A 3K8VA 2VQEF 4P2FA 5F2RA 1ZXIA 3N4MB 3EDQB 2PXIA 2G4BA 1WWVA 2FC0A 1NPRA 3M6WA 1X9JA 2CQHA 2JLEA 1ZTTA 1UZHA 2QL9B 3H8YA 1Y11A 4HDGA 2P9PA 3KG4A 2V2ZA 4QR1A 3J7AP 3BF4A 5B08A 5DG8A 4CHQA 3C94A 1RAEB 3BYRA 3TADA 3AVJA 1L5UA 4NEZA 4B3OA 1K8KB 1R31A 4O4GB 3C5GA 5E7OB 1T9TA 3I96A 3I9V9 1S0NA 4KI4A 5F0XA 4RG8A 3QNNA 2ZIWA 4WQ4C 3A5OC 1GO3F 2HOEA 1URNA 4LUBA 4CK2A 4DCOB 2RB7A 4F0HA 1NH8A 3HX9A 2I5JB 1OY9A 3CMAS 3T5JA 2HQGA 4F4YA 5KRSA 3T3FA 2C3OA 4BRLA 3KHRA 4JKBA 1S9GB 1U2VB 3CCSS 5AQRA 3GYGA 2CXYA 4DUYK 3ZYYX 4PKIA 2GFFA 4DTNA 2R8KA 4AHTA 3LZJA 3BBBA 2A2DA 2DD8S 3SSQA 5IS2A 2XMMA 3AJ1A 1LW2B 4UB3A 4DUYF 3IWXA 4CTAB 3ZFVA 4AXIA 1ZXOA 1RWNB 3L2QA 1OH6A 2CPEA 4MO5A 4F4XA 2H54B 4M6WB 4PY5A 3DFEA 3H3OB 2VOPA 1DURA 2R2UA 2FHKA 2WVDA 3KNAA 4QW8A 4RQ1A 4UQGA 3C2KA 3ONQA 3NBPB 3CDBA 3QEAZ 4XTTA 4ZVSB 1G2EA 1TVRB 2OEJA 4P74A 4RUBA 2N7YA 3L7OA 1AFJA 3WQTA 4DCPB 1VQ7S 4NY8A 2ZITA 3KLIB 4EBCA 4P73A 4A48A 1S3XA 3OYKA 3CRXA 4B9SA 1EJ7L 5J2NA 1QS4A 4FK2A 2XMJA 2EWSA 4HR2A 2IA0A 4DQPA 3TAMA 3M2RB 1GOCA 4IH5A 3LVVA 2QWPA 4M45A 5EWFA 4OHWA 1WNEA 1J5OA 2O3DA 1FEHA 3QIOA 2AW0A 3AAWB 3GDQA 5CH7B 3QJJA 4IOBA 3C19A 3TABA 2UU9K 4USHA 3VALA 3R5JB 2FLOA 3I5CA 1WOQA 3NGUA 4DQ8A 1JLCB 1ZJNA 4NLCA 4DB3A 2WK4A 2R42A 3QRRA 4KLTA 5HP1B 4M8LA 5CA7A 4USMA 3MR7A 4BC9A 2AF6A 2ZJQQ 1N54B 1FXRA 3RJGA 4C4TA 4L75A 3ISND 1FWLA 2JX2A 4GXJA 4AL5A 7ICGA 3R1LA 3I4PA 3L7UA 2DITA 3QERA 3TKAA 1BU6O 1DK3A 3H42A 2QARA 2KG0A 4A4JA 1MC8A 5AE3A 5B0CA 2IRXA 4ZN3A 1LWFB 1UFLA 3FZHA 2G8FA 2CQ3A 1FRKA 2EVZA 4BR0A 3BREA 5HLFA 3TTFA 4EP4A 4HTJA 2MKKA 5E84A 1NGAA 4OIXA 3EUNA 4OI4A 3SDEA 1NXIA 4ZHRB 2G5IB 1L6NA 4DEZA 2XYGB 2KMDA 3W3SA 4M3UA 5J2MA 1YUWA 2Z0GA 4QIWF 4JKCA 3ZZUA 2EFPA 4NM2A 1OVQA 2UUBK 1RU1A 1C4AA 1CJTB 4JI8J 4LF6K 2B4JA 2W7OA 1UKUA 1PVPA 2UUBF 4H0PA 1VJWA 5LMNJ 4QWDA 1HJPA 1LWCB 4WU2A 2Q2RA 4BBYA 1T3VA 2DTJA 2RQKA 2LLZA 4QZIA 2ZM6K 1W2BM 2V63A 2NQPA 4M1KA 1Q82O 3Q8YA 2CNNB 4DV4K 2J6TA 1R8PA 5D78A 2I6WA 4BC4A 1HYVA 4Z4HA 1J54A 2LKYA 3N4QA 3Q8MA 3R6GB 2ZM6F 4CJKA 3IAYA 2YX4A 2I1RA 3PHTA 4LSZB 3G8TA 5JVHQ 4RW4A 2I7PA 1L7OA 2VWBA 5EU7A 4DV4F 1Z2ZA 3SXLA 2QB1A 1HKGA 2IOCA 2WZ1A 1AXQA 5ETPA 4MF2A 3H98A 5J8YA 3MPVA 2VGMA 2LP4A 4TU8A 5BRHA 1K1SA 1FRMA 1JJ4A 1VSMA 5M2RA 1PSDA 5CHGA 3AODA 4LSNA 1T8EA 3O8WA 5J2KA 3ZSZA 2CFXA 2FHJD 3TAPA 3V2UC 4XPCA 4B3SJ 3PIOL 1TL1B 2HHSA 1QDUB 1L7PA 2HQCA 4MYTA 1IKYA 2AQ4A 1B0XA 2IDLA 1GTHA 2JV3A 1VMBA 2ZD1A 3POTB 2NRZA 3QRQA 1YJVA 2HWIA 1F9FA 5DK5A 4M3XA 2E2PA 2OHFA 2CZ9A 5LSOA 2ZE2B 4MAKA 1XS9D 5KQ8A 3PSFA 2WB1F 1PC5A 2ERRA 4F3OA 9ICEA 1J97A 3MR2A 3OPKA 4I67A 4WZMA 2A42A 3G8SA 4X66K 4CLZA 1E6YB 3PDNA 2VHGA 2WVBA 4D3GA 2HZAA 4PR6A 1UWBA 1BCMA 3P8BB 2C2DA 1L7NA 5ALZA 1UEKA 4J9UE 1B3TA 3P5BP 4KY3A 4X66F 1N34J 1KAXA 1AUSL 2H1YA 3MM5A 3MMAA 2B8QA 4IFEA 4HEA9 4N47A 3FAHA 2O8BA 2HWHA 3SCKE 3QB0A 2E7VA 3QT8A 3FCHA 5CYMB 4P7VA 2E5LK 4GVMA 2B9WA 2AHOB 4G65A 3FZFA 2EFVA 5ALPA 5IT9Y 2HFNA 3A3OB 3TR5A 1RTZA 7ICPA 3RRGA 4EGLA 2E5LF 1TKXB 5CJ7A 2PSZA 2YMPA 2FJ6A 2ASJA 2CVIA 2CGJA 4NLWA 5KFAA 4C80A 3ZZYA 3RBZA 1U02A 3BY5A 4KGZB 1VQ9S 4J2EA 4KN7A 2RRAA 2Z58B 2NSCA 4RT3A 3V9UA 1HR0J 4ICLB 2KG5A 2OSQA 2YWEA 4N56A 1QE1B 1G3OA 3VR1A 1NJWA 4QR2A 3H59A 5KFPA 4ECUA 2N1RA 2YWFA 4I9QA 2NPFA 5AXNA 5F1XA 4I27A 4Z7CA 1X5TA 4YOXA 3J7YP 3PV8A 1KR4A 4CJ5A 4LVSA 4AILC 2WTFA 2YHAA 4DL7A 4LFCJ 1OYEA 3TUJC 2XIDA 1SJQA 1WTBA 3L3VA 2ZZNA 2CH5A 2XMTA 3NWGA 3C5FA 5ALTA 2A19A 4WQ5A 4O5CA 1M6YA 4LSLA 4J5OA 4DG1A 2XGPA 3E3XA 5KFCA 2CUYA 1O5JA 3D5MA 3BO4A 4AP9A 2KYXA 3SEIA 4IH7A 4CT8A 5ALXA 1WC5A 1VQ8N 4RPYA 3QRPA 2ATQA 4BR7A 1H0HB 5CEHA 3IAS9 3MDCA 1HKBA 3BQ7A 2HQDA 4DX7A 5KFNA 4ELTA 2NRTA 2OFHX 2WSEC 2AYMA 3NHGA 1H72C 2P9LA 2VQFK 2HHHK 4ER8A 1GLCG 5J2FA 2ZJRL 3UDVA 2OD6A 2JJ4D 2P5GA 4M9JA 1ZD2P 5HANA 2HIQA 2GHVC 4YNQA 4J9MA 3D2FB 2Q4TA 2VQFF 2HHHF 4CHZA 2Q66A 3UE5A 4GKKK 2MKSA 1D9DA 2DWQA 1Q46A 2FI1A 2C3YA 4FN5A 2MA1A 3ISBA 3IGVA 3KLHB 2MJUA 5KGWA 2K06A 3OUYA 4KLUA 1HW8A 3IBPA 1JALA 3BYPA 3DAWA 3PW0A 4QWEA 4OYXA 4GKKF 4FYDA 2PMZD 1TFYA 2QJ3A 3IP4B 2QYCA 4OPJA 2H9ZA 4LFAJ 2HFZA 2I0XA 1Y4ZB 1H6KX 3OYDA 4KE5A 3DRSB 4ED5A 1UOCA 1Q82T 4N7TA 4DTUA 4AUKA 1U6FA 2CADA 3AVBA 2OPPB 2OZMA 3FCWA 4C9DA 4P0QA 1PCAA 4Z6FA 2KSOB 1NZAA 1HPZB 3PRDA 4F26A 2Q0RA 1M1GA 4ELUA 4ILRA 3CQ8A 2AH5A 4X4VA 1UA0A 3DDIA 3GONA 1ZRMA 5AIBA 4TYAA 4J9RA 4KMUA 1TKZA 3WX4A 1RAHB 4HUGA 2H65B 3LK9A 3NL0A 4IDKB 4H0OA 2R7YA 5C12A 2BJ3A 3Q7CA 4DTJA 4KV8A 4CGFA 2Q0UA 1ZBLA 2XULA 4OPKA 3D0HE 2YHYA 3MM9B 2PKEA 2ZXHA 2DY1A 3GFZA 1WHVA 4GLXA 2BCSA 4I6YA 2RU3A 4IQTA 2OPRA 4I6AA 4J03A 4QS9A 3ISCA 1JLFA 4USUA 2P9SA 1SCJB 4DJBA 1Q1KA 1S1UA 3AO4A 4EFAC 2HBYB 2RVJA 3F2DA 4BUGA 1UT5A 3BS5B 3QEIA 4KB1A 3TYTA 3F9KA 2WAQD 1YT3A 3VTHA 4CZGA 4UW9A 1XO0A 2DR6A 2D4WA 4QZ8A 2BQ3A 2N82B 4QZCA 4PXCA 2HWTA 2K7JA 2CPYA 1Q7YO 3VQ7A 3HBTA 2CG8A 4F02A 2DR5A 3EW9A 4K4IA 2HBQB 1NLVA 4AHRA 1S9EB 2F8MA 2P8IA 4DMNA 3LPUA 2YJEA 3OS0A 3W2VB 3KHHA 3GDXA 5I3UB 5HMLA 2CPZA 3S6JA 1CLQA 5L9XA 4X4OA 3TI0A 3NAEA 3QFHA 1AB8A 5AHXA 2RQMA 4WK1A 3SYZA 5J0XA 2KZZA 1HNZK 1XNRK 1F44A 4K4HA 2X78A 3FNNA 3KDOA 5C7PA 2QA1A 3MD1A 3TSQA 3PACA 1WUDA 2CDRB 2XCAA 2DH7A 1HNZF 1XNRF 3I32A 1HQUB 4BGAA 3MEDB 3GIKA 1RYUA 1D4XA 1UJ5A 2GUIA 1FHTA 1FJCA 4ILLA 1RCOB 4BDZA 4P4PA 1M5SA 2BV3A 2B6AB 4BXOA 1EETB 3HO1A 4ID1A 3TO8A 2HCFA 4CI6A 2FJXA 1SV4A 2Y0BB 5EWGA 2Y0SD 2IHR1 3H46O 5KT5A 4W5OA 2IGIA 4UAVA 5K14B 1I6JA 4FZZA 3CF5L 2ACYA 3QIPB 3QO9A 4USWA 3QU2A 4DR5K 1RE1B 2AQ0A 1ICEB 3O4QA 4BRCA 2DKXA 2O6KA 3QNMA 4DTXA 2P9IB 1FK9A 3RSEA 1NB7A 3TA0A 4DR5F 3CC4N 3OL8A 4N8OA 3UD3P 2OTLS 1GLLO 1TL3A 3GG1A 5A2QU 4CGHA 4ZMMA 5HJXA 1SC3B 1UFWA 2PA8D 5M1OA 1D8LA 3FQLA 3MK6A 3FGUA 3NGZA 1IQTA 3K9JA 1OPZA 4O3RA 5BR8F 3CNQP 3RUBL 1NJXA 1CRXA 3H20A 5C24A 7ICFA 3QFUA 4DR7J 1X1PA 1B70B 1ELOA 1X4AA 2EW9A 3QNOA 4O4RA 5KG5A 3U6FA 2X6SA 1RHMB 2F4FA 2VG5B 1KQFB 4WQ4A 4NPOA 3R3LA 4X4UA 2C2EA 1NPKA 4PWUA 3U3YA 1CQNA 2LQ8A 4JYAJ 3H0LB 2MSTA 4RU9A 4YDDB 3LP2B 2ZH5A 3JPNA 1YDLA 4KHUA 1JMTA 4CNZA 2EXUA 2CZ4A 4LF4K 4ZVPB 3EVMA 3QU5A 4QIVA 3SBGA 3QEPA 3M8SA 5F3TA 4RW6B 3UVJA 4WFZA 1FJGK 4CF5A 3G6ES 3EX7B 4Z6DA 3PX4A 2QSFA 4ZLLA 4LF4F 5DO2A 1PC4A 2UV8G 2DGSA 4CECA 1QQ7A 1FJGF 1BQMA 2QYGA 3CD7A 3CJCA 2P9EA 4MK9A 3PHEA 4RUCA 1TV6A 1UVIA 2O8EA 2KIWA 2JVRA 2A41A 3ADAC 3BH6B 1ATSA 4O44B 4USAA 1U45A 5K4LA 4BRFA 4U96A 2OPQB 2W4DA 1N60A 4RL1A 5F8GA 2ZH1A 5GAGI 2V94A 3DEEA 1X4DA 2HGLA 2CYYA 1CS4B 1RT2A 2RU9A 4A2AA 2R8IA 1SQKA 4LBPA 3ZNUA 2RILA 4K4SA 3Q8SB 2GV9A 3H5XA 3V81B 3ENWA 3KLGB 5AK4A 2MQPA 3G4SN 4RKUC 2O66A 2F40A 3K89A 3PR5B 1VK0A 3W0LA 3CD5A 3THWB 1HD1A 3MUTP 2BKOA 2P9NA 1JL2A 3MECA 1SWWA 4IFYA 2V4JB 4Y34A 4YG2A 3H2LA 4CIGA 1T0TV 1N56A 2VONA 3IDWA 4IQUA 4FF1A 2R7UA 4O3SA 3ZZOA 4KR0B 2WF8A 3LDQA 5FLXU 1LW0B 3MEEA 3C6UB 1BISA 3FZKA 4O3QA 3VAJA 2RHQB 5D46A 3MM7A 1L3SA 3JTNA 3NAHA 1DQ8A 3EGWB 4P6QA 1Q53A 2Z1IA 2YY6A 1NEEA 1QZ5A 2HNDA 1V85A 2A40A 2QSWA 5FP0A 3RMBA 2AJ2A 4M3YA 3Q7BA 1HKAA 3AVKA 1Q7YT 1WWUA 1JLBA 2V50A 5AQJA 1OXJA 1UPHA 3E51A 1WI6A 3S3NA 1F5AA 4OV6A 3L2WA 4CERA 2X7IA 3SAHA 2YNHB 5T7BA 1TUWA 2SXLA 4FVCA 3HI0A 3WHIA 3QT7A 1WD6A 5DBCA 3WK6A 4ZPVR 4JHDA 1SKRA 2V2KA 4KMOB 1QD1A 4MIAA 2V69A 3DXKA 4UB5A 3JPRA 3KK7A 2D6FC 2VWJA 1ATNA 4LY7A 3GPAA 4EI2A 2PAVA 2FVCA 2B56A 4LF7J 4FW2A 4CH7A 3GU3A 1YBTA 3C16A 5DM6Q 8ICHA 1U2RA 3O3FA 2W9CB 2ROGA 2RS8A 4Q45A 3C14A 4OJOA 3E01A 3M2VA 5ALOA 2QWRA 5EX3A 5E0OA 3V4IB 4Y2JA 1TUGB 3VQBA 2YPYA 2FC9A 1AW0A 1ZQAA 1NSQA 3H6EA 4B1VA 1B22A 1JKHA 5ETSA 1KLMB 3M8YA 2LQ5A 4QIWD 2HHWA 3V5RA 2E66A 4IQWA 3C6TB 4OHZA 3FBBA 3BUZB 5HOOA 1NHKL 3BEGB 3HKZF 3KHLA 3U7JA 4JI2K 2IHMA 3DLGB 4I2PB 2H4YB 3V9SA 5ETKA 3HZ6A 3FK4A 4Y65A 1W97L 9ICWA 2XO6A 3DXMB 3NVWA 3AUOA 3Q2SC 2V67A 1Q3UA 3EZWA 4JI2F 4C0BA 4JV5J 3QFWA 1DTTA 3CMAN 1SZHA 3QEVA 4Y2KA 2HFSA 4F5RA 2LVWA 4NLYA 3C2PA 1X3NA 4K42A 3CCSN 2OYQA 3ITHB 4QZEA 1RXVA 2BKEA 4NLNA 1CJVA 4DSEA 2ILZA 5L1LA 1VFJA 1YK9A 1TAQA 1S5JA 1U4BA 1ECWA 4DQIA 1F3FA 2GZOA 1F5SA 2ZUAA 2VG6B 4J2AA 1ILYA 4C2MA 2QMUB 2EFGA 5KL1B 1RT4B 2HGNA 2HMPA 5I3QA 2B4OA 1TKDA 3NGKA 1RT5A 5F8JA 5RUBA 4ECWA 5AI8A 4FBTA 4Z4EA 4CM0A 2BOPA 1GOBA 1X4FA 5AQHA 4OPAA 2NLXA 3UFCX 4JMUA 5T14A 5J0OA 5D4PA 4AYBF 1LOUA 3UNYA 5DZ7A 1VQ7N 1LVHA 4ATNA 2CG4A 2GHPA 1C1AA 4DFKA 3O6QA 1VC6A 1RAFB 5DGBA 2YVSA 1LEOA 3W9JA 4NLPA 2UXCJ 1H74A 3O9SA 3VPZA 3L4IA 2HQ3A 3DLKA 3MXMA 2CGLA 1HYSB 5KFUA 4LQ9A 1ZD5A 4FWRA 3AMZA 1NMEB 1AYEA 2E6LA 1AA1B 4JK8A 3M8PB 1RLDA 1WEXA 3MCAB 4OJPA 2M88A 2QLBB 3FCVA 3DOMA 1NZPA 3ICLA 1WF1A 3R1HA 2V2QA 5HHHA 1LFPA 2ASOA 2O8FA 3ILOA 3DLEA 1UVKA 4LRBA 1RAJA 2DR9A 4KO0B 3GIJA 3A0IX 4PYAA 4DR2K 3Q8LA 3HJFA 2LXFA 5HQLA 5B0DA 2HFOA 4YHHK 2KHOA 3QZ8A 2K8AA 4XRHA 4JK7A 3GMGA 1Z05A 1WF0A 4EYIB 3VESA 4G6VB 5IXUA 2RKIB 3MGVA 4DR2F 4WF9Q 4IG0B 4UASA 1GTEA 2B8PA 3NNHA 4YHHF 3D28A 4QWBA 3CCUS 2CQIA 5KAFU 3QMQA 1WBDA 3NF9A 1D9AA 1Y10A 3KK1B 1F1BB 1EIYB 1XNQJ 3QXGA 3G6YA 2OEKA 1S48A 1ACMB 2LI6A 2B0GA 1U6BA 5CCMA 3GZFA 5IQQA 2R7VA 4C3LA 4DV2J 4HT5A 2NRHA 2YQ0A 4RT2A 1WDTA 3ZZZA 3M8QB 4EUVA 1I5OB 3VF6A 3EN9A 3MGHA 4X4NA 3A3PB 3WK9A 4CT9A 1RB0A 5AI4A 4XA5A 5DB7A 5E2QA 2FE9A 5J2JA 3SD7A 3CD0A 4F4KA 2BBEA 4NCAA 3AO5A 2W4PA 3AL0B 3V1RA 2DNNA 3OTDA 3DLLL 2G13A 4JK1A 3E1YA 1F5BA 4MEXA 3NGYA 4KAZA 4R5PA 2ZNYA 3CPWM 4LF9K 2JZ5A 4C0OC 2VDIA 3OYLA 1HHQA 1RHQB 5BOLA 3KK3B 5AQZA 2MQ8A 4OHYA 2F9DA 4LF9F 2KFYA 4DPOA 5GTHU 1S4EA 3MN6A 3KD5E 3BQ1A 3EPGA 3DM2B 2IBOA 2CJ9A 1WSEA 3IN5A 2AX1A 1KHWA 2VIXA 2JFDA 4GKJJ 5DB8A 3FFKB 1VQSA 4RQMA 3LAMA 4CGDA 3OA9A 4OJRA 3PRBA 4OPHA 3MPDA 1ZETA 5ETMA 4QYRA 4XDDA 2JLGA 4B3OB 3V9XA 1PJ6A 3ZZPA 5E3CA 8ICWA 2COLA 1XSLA 3T6JA 5EOYA 1H2VZ 2RQ5A 2LCWA 3SMZA 4MEYA 1UEUA 2DNPA 1D8YA 5J2BA 2AA4A 3PEJA 1M5HA 4NOHA 3WK5A 2EC0A 2LPEA 2D0CA 2DY9A 3PX0A 3TA1A 3DI6B 4B02A 1FVQA 3CB4A 1KFSA 4BQZA 4FJJA 2DNRA 2RF2B 2ZH6A 3L7PA 4M5JA 2XI2A 3ORYA 4ED4A 3ULEA 1OPIA 2QLJB 5LL6Z 2FHJA 2HQIA 3UKUA 2VFSA 2NUHA 3MD3A 1T6DA 2QL5B 1HUOA 1PJ5A 1VSLA 1AT1B 3MM8B 3QJPA 1QJHA 1S1WA 4OKKA 4S0MA 1A9NB 2HEKA 4A47A 2W04A 3WK7A 3FDSA 2HAFA 4EWTA 3UB5A 2DNGA 4CZFA 4FJNA 5M1QA 5CY4A 3MR5A 2KYZA 4YFKA 1HNIA 4CF8A 4YOVA 1NG9A 4B8CA 3CGIA 2WB4A 1JJ2R 1HI0P 3WU2U 2FDNA 5LY3A 1S99A 3FRYA 3SNNA 5J2NB 1XI1A 5ALVA 1ZZFA 1ZQOA 1CUKA 1KNZA 4LF8K 4WIIA 1RQLA 5H9EJ 5ALYA 2ZH2A 1NMDA 1S1VB 3KUHA 2WF6A 3MUMP 1Q8KA 3Q8RB 4DL4A 1SUQA 2ITMA 3THYB 2Q6CA 4LF8F 5KFQA 2DFLA 4YB7A 1JL1A 4PEOA 2DK2A 4BRHA 1VQ9N 1Q8IA 3CC2S 2VC0A 1U1KA 1U24A 4KSEB 4TKTA 1D9FA 1QVGR 2V2VA 4C98A 1Z1BA 1DOQA 1IBKF 1UJ4A 3OY9A 3AB4B 2V9WA 3Q8QB 5DDOC 4Z4GA 3LPTA 1IUJA 1G6BA 2E8PA 1NK6A 3VGSA 3VAMA 4CJSA 2KJ8A 1DEJA 5KFOA 2VWKA 1S79A 2ZC4A 5L46A 2L48A 4WP3A 2XY7A 4DV5J 4DF8A 3RFAA 4OYBA 2LYAA 1OW5A 5AI9A 2KICA 2P6SA 2HVZA 4U67L 4OI0A 4RUAA 3UD5A 5LSLA 3W2WA 3A3NB 3KWGA 1BUPA 2BDPA 3HSJA 2LEAA 4QZBA 2Y9UA 2GO9A 1P8ZA 3HHLB 4BDYA 3S3OA 4UB8U 2GUPA 1ZQIA 2QARB 3TU5A 2K4EA 4FE3A 1A5VA 3IBWA 4R8UA 3MTJA 2NZCA 4LRAA 4CRXA 2QK9A 3RZAA 4CYUB 2WOMA 2QLXA 5HRNA 2YNGA 1QQNA 5KTQA 5H9FJ 2RMLA 5BPCA 2CIMA 3ILJA 4HI2A 3K9KA 3AHPA 3IBCB 3NVKA 4B3MJ 4E19A 4BX9C 5J2MB 3QBCA 3OSPA 1WSGA 1LWEA 3I0RB 4US9A 3SV4A 3QLHA 4OX8A 3PEHA 3TAFA 2UUWA 2IOFA 4FWKA 1LKYB 2PY5A 4O8KA 5J29A 1VQ6S 4PL2A 4BCAA 1ZD3A 3T1AA 1SXDA 2NREA 5LXYA 2GTDA 2IVYA 3PYFA 4DV1J 4F4ZA 1M5OC 1UW9A 3LAKA 3DLJA 2J8AA 5AKKA 1R8CA 1E4FT 3B78A 1WG4A 4DN0A 4NYNA 1GOAA 1OY8A 1B92A 1PVRA 1RBLA 4AE5A 4KITB 3BKUA 4AHCA 3E8OA 5A6PA 2HAIA 4MQ3A 1VSFA 3O2IA 4JV1A 4H03B 2OELA 1KQGB 4ZVEA 3C0BA 4CJFA 2HZCA 3PUFA 3E58A 4FJ5A 2HNZA 2OEMA 3E9PA 3DLHA 3CULA 4WTYA 4ZLPA 2NXNA 5DMRA 2UU9J 4LIWA 4MFFA 2XTJP 4Q7AA 2G0AA 2M3DA 2VG7B 3LWMA 1KC8O 1REVB 3GIIA 4LJXA 1WG5A 4B1WB 3BEXA 1Z4OA 2P5VA 1YLXA 3WDOA 2IS3A 3CJTA 1T05A 2JEIA 2YHXA 3LGNA 5IQ6A 1T03A 1LQ9A 5AQYA 4ECYA 3DRRB 5DBBA 3HFZB 1HNWJ 3M6GA 4CLWA 4I2AA 4FWPA 3H7IA 1IXKA 1JLAA 1TL4A 4BGDA 1RT7A 3IG1A 4H0XB 4PG8A 5CD4A 4UTGA 1WELA 1RBSA 3N79A 1UWBB 1K0TA 2W42A 4A8OA 2RDJA 3T79A 2KN7A 3CJ4A 4WK3A 2YKMA 3M9OB 1ZA1B 1PAUB 1ZBFA 4KLJA 4M5HA 4RO0A 4CJEA 1IJJA 4DTSA 2EZYA 4B3RJ 2O8BB 3IR7B 4F0MA 2XHBA 2WBNA 1FDDA 4P4MA 2AD9A 1HWJA 3X1LB 4MIBA 1AROP 2BH1A 4FYWB 5AKLA 2L5YA 3DRPA 3ASMA 2XGQA 1SXLA 3ZSOA 1BXNA 3GR0A 5DG9A 4OMFG 5GMEA 4W90B 5FPMA 1U1PA 4LF6J 9ICAA 2NRWA 2UUTA 3HULA 1MQ2A 1YRUA 2B7BB 1DTQB 1MU2B 4AH9A 2CPHA 5AQMA 3AD9C 4RW7A 4QZVB 1NKCA 2FQQB 5B0EA 2E1YA 1KAYA 3RG6A 2BR0A 5ETQA 4J2BA 4PPXA 2ZIUA 4RPFA 1H38A 1X9SA 2ZJ8A 1BQNB 1SAZA 4DN9A 4ED8A 1YRTA 3MCOA 2QA2A 2A1SA 1T9UA 5D4NA 4EELA 1PK1B 5HMYA 5C15A 4KRFA 3C6AA 4FLWA 2BE9B 1B7YB 3NCQA 4OZLA 4UQTA 1T7PA 2MLXA 3LANA 5F9LA 2KHDA 5HBMA 5HI7A 1HNXK 1ZBSA 1Z25A 4CDIA 4Y0FA 4KTQA 4CHPA 1JLEB 3HVAA 4LF5K 1RG6A 2XSFA 1IBCB 1J2NA 2EZXA 2L08A 3GLJA 1ZQJA 1HNXF 3T1HK 3EZUA 3IFRA 2J76E 3AA9A 3V1OA 4LF5F 2YWHA 4FLYA 4ILGB 3AO1A 4RNNA 5DDQC 1X7VA 4KC5A 3T1HF 2YKNA 3UXOA 1V4TA 1S1TA 4M3WA 5ETOA 1UA1A 2E8MA 2YBVA 5G4DA 2OTLN 2G8KA 5D0RA 3LPYA 2BPCA 1ZTWA 2VOOA 4DQRA 1NBWA 1CI4A 3UI3A 5AKYA 2HLTA 3QETA 3R5CA 4NX9A 4B6JA 2IFXA 3HP9A 1S0MA 4V1Ak 4R25A 4C4WA 3NRBA 1MN9A 4M0AA 2UUCK 1HMVA 4C1NI 4AL6A 2MEWA 1COKA 3OTBA 3SMVA 4KB7A 4JKDA 3G82A 1RCXB 8ICKA 2LSNA 1HJRA 2F2AB 4DFDA 2ACMA 1RK8A 2UUCF 1EX4A 1NM2A 3HKZD 1TUVA 1Y88A 1RTJB 2UUAK 2WW8A 3L6QA 2E5LJ 3Q8VA 2MLYA 3MXJA 3DHWC 2IVNA 1HQEA 5HROA 3N97B 3UN2A 2UUAF 3OPXA 3G86A 1M0SA 2B9EA 4ZKAA 3G6EN 2NS1B 3V6HA 4P0QB 2E1CA 2FMPA 5A8RA 4FJLA 4D3HA 3VHQA 3SENA 5J2IA 1P9YA 3CI5A 5HVGA 2HBRB 3C3LA 4CFCA 4K4XA 4B3TJ 1FRJA 3N6MA 3QESA 5E5NA 1VC5A 2B43A 1TKZB 3JPQA 4C8YA 1QHTA 3JAMY 2CPDA 2RP5A 1UW4A 4NL9C 2Z4PA 1DFDA 4EK2A 3D2EA 1E4GT 2O5DA 2CRLA 5HQMA 3M5RA 2PEHA 4K5RA 4Y2TA 4DR6K 3FE1A 3VF2A 4W5NA 1MWMA 5IV3A 2XMUA 3RB6A 1UAXA 4HHTA 4F2RA 1RA6A 5CCLA 3VENA 4X84A 5JTIA 1FNOA 2OPRB 4QCLA 7FDRA 4DR6F 2OUGA 2ISOA 4I28A 2D1KA 3SFUA 2KVIA 4WU3A 4KFBA 1HBNB 4Y2RA 3ZXWA 4PL7A 3FLCO 1S1UB 5DGAA 3MXHP 4H0YB 1XJWB 4AYBD 2QTDA 2ZJQL 1VYAA 5GAHP 5JUMA 4CNYA 5BOMA 3R9KA 5FPDA 3F44A 1YJNS 3Q8UA 2KJ5A 4Y2XA 1T02A 3Q89A 1VBZA 3DMJA 7ICMA 4L8RB 2VDHA 1K73O 1C0GA 4CJVA 5AKGA 3ZCMA 3CJBA 2YNIA 2C2KB 3M30A 3WEEA 4K5SA 1T95A 1RAGB 3EVOA 4JB8B 1GMWD 2DEJA 5GADP 2WC9A 5J2QB 2U1AA 3RB0A