4DSJA

Crystal structure of fragment dna polymerase i from bacillus stearothermophilus with duplex dna, dgtp and calcium
Total Genus 186
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
186
sequence length
579
structure length
579
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase
publication title Biochemical and structural insights into the fidelity of bacillus stearothermophilus DNA polymerase
rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 186
structure length 579
sequence length 579
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4dsjA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4dsjA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dsjA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4dsjA01
4ED3A 9ICVA 4I2BA 3VA0A 4CEFA 3QLHA 2YKMA 1ZBLA 4RQ0A 3K75D 3UPQA 4PGYA 1Z3EB 5DQHA 9ICIA 3ZT0A 2OPQA 2Y1IA 3IRXA 3RB3A 1ZQGA 7ICPA 3DLBA 4DU4A 9ICBA 1ZETA 1CXQA 2V4QA 9ICOA 4UAZA 3AVFA 2QXFA 3KKRA 5J0OA 4QZDA 4IKFA 2ZTDA 1IXRA 1KFSA 4RQ6A 2WOMA 2RN2A 4IQVA 3V7KA 4R65A 1HNIA 3FYHA 3SZ2A 4CFCA 1FKPA 4FJ9A 1WSFA 2P66A 4LVSA 3DOKA 2P5GA 3HPOA 4RQ4A 3H8JA 4O55A 3PW7A 4FO6A 1Z25A 2AU0A 1XSLA 3BDPA 1T05A 3PX0A 5DK5A 3C1YA 3RB0A 1BI4B 2ZQBA 3T19A 3T3FA 4DSFA 2R8IA 4PHDA 4OKKA 2IBKA 2IDOA 8ICFA 1A5VA 5DB9A 2MAXA 4I2JA 4GXJA 4BWJA 4E0DA 3CQ8A 4RPXA 4CEEA 4R64A 4KKOA 4RQ7A 4YXMA 4EBCA 2VWKA 3PVXA 4RQ5A 5D46A 2V4RA 3H4DA 4F4WA 2VA8A 4DQRA 4DL3A 3M9OB 5KFKA 2JGUA 3M9NB 4O9MA 4CHOA 4TURA 3NBPA 1D5AA 3C5FA 2NRWA 3OYCA 2FC0A 5CB1A 3S3MA 3JPTA 1KCFA 3ZDCA 4ZHRA 5KFWA 4OJRA 5IIKA 4EEYA 4R66A 4GVMA 4FJMA 4J9LA 4O5EA 4F92B 1S0OA 5CJ7A 3V6DA 3AO4A 4DF8A 5J2GA 3UXNA 3TQ1A 5DB8A 4CCHA 4LSLA 1RDAA 3NGZA 1S97A 2AJQA 2BANA 4C8NA 3UQ2A 4JLHA 3T1AA 4NM2A 4CGDA 4B9LA 4FLWA 1Y88A 2DFHA 4TSXA 1JLGA 1ZQVA 2I5JA 4YR3A 2AGPA 2KW4A 5F9LA 4GLXA 4QZAA 3SUQA 1RBUA 1ZQWA 5CWRA 1NJZA 4YCXA 4LH5A 4CE9A 9ICQA 1ZQIA 5CHGA 4GXKA 4DL2A 5KG4A 1ZQSA 4DFKA 2HHWA 3GDXA 4GXIA 3OY9A 3RMCA 3H08A 3TAMA 3HW8A 1L3UA 2FPLA 9ICXA 2ZUDA 4DL6A 1ZQAA 1UOCA 1DTQA 4FCYA 4KLUA 3QNNA 2FLPA 3NH0A 4F4ZA 3V6KA 2OA8A 1JN3A 2XY7A 2G8WA 4ED0A 4H4MA 5FROA 4TUPA 8ICHA 3H4BA 1NK5A 3UXPA 3V1QA 4KLSA 2DFLA 5KFFA 4BDYA 4ED6A 1YT3A 2LSNA 5HNKA 7ICOA 5KFZA 2XGQA 4I2EA 4YR0A 1H38A 4RU9A 3GV5B 4HVJA 1EXNA 4KMUA 2Z1IA 3RJJA 4I2AA 3ZSYA 2HW3A 1BPDA 5KFYA 4E3SA 3QEXA 5CR0A 4FW1A 4JS5A 5C5JA 2J6UA 8ICVA 4Y1CA 2HHXA 4QWDA 3F73A 5L1LA 4DTNA 2JEJA 4F93B 4UBBA 4DTOA 3K5NA 4DLGA 3TARA 4KRFA 4RPYA 4CGIA 4Z6CA 4XQ8A 4I2DA 2ZD1A 2ZJAA 2J6SA 4CHQA 4YR2A 4H4OA 4L8RB 3VQ9A 4F5PA 3TWHA 2IA6A 2ETJA 2C22A 1RDDA 4DTMA 5DG7A 4RW6A 4QCLA 4DOBA 5CYMA 2F1JA 1ZQTA 4O0IA 4BXOA 1ZQDA 3HYFA 1Y97A 4ECXA 5KFLA 9ICNA 3HPGA 2Z1HA 1NKCA 1I39A 3LWMA 4BWMA 1NJXA 3RMAA 3BQ1A 2JZBA 3K59A 4PGXA 2FBVA 4RNOA 1Q9YA 1VSIA 5J0WA 2G8FA 4FJKA 1VSFA 2RDIA 4DTSA 4EP4A 1TK0A 2JEGA 3SCXA 3ISBA 1AROP 1GOCA 1RTIA 7ICEA 5L1JA 2QKBA 1KDHA 3LWLA 3AVLA 1KTQA 4F2RA 3I8DA 2VA3A 4CJ3A 1I3AA 1HUOA 2RPIA 1TL3A 3MEGA 4NLZA 3TAEA 4FYDA 8ICNA 4DS5A 4BE1A 2LYHA 1ZQMA 3VQBA 5HP1A 5KG0A 5KFNA 3JPRA 3H8SA 2ISPA 1C0UA 2HHVA 3T5LA 1S0MA 3IAYA 4BE2A 4DFMA 3KLGA 4PGQA 4DQIA 4RT3A 4KHYA 4KTZA 3RBDA 3PO4A 4JRQA 3H40A 3VQCA 2BHNA 2ITGA 2G8UA 3ZDBA 2W9MA 4KLTA 5KFCA 1C0TA 1XWLA 3ZDDA 3ZDEA 4Z6FA 3HVTA 4YFUA 4R8UB 2HNZA 1ZYQA 4BDPA 1NOMA 5DQIA 1KFTA 3RJHA 5HRPA 5HRNA 1MQ2A 4I28A 4FJ5A 3ZDAA 4DU1A 3NGYA 4HCCA 8ICSA 2W9CB 3RH5A 4N47A 4KN7A 4DTPA 1D8YA 4CEAA 5JS2A 4DL7A 3VQ6A 4W5RA 3ULDA 1T3NA 1LW0A 3QIPA 2BGGA 4HYKA 4FK0A 2D0AA 4JS4A 4JUZA 5DB6A 1DGSA 2F8TA 5TZVA 4TQRA 1L3VA 5T7BA 4P4OA 1KEJA 4OKJA 3NHGA 2B5JA 3OYKA 3M8QA 3PW2A 4CIEA 3O4NA 4ECQA 3C21A 1EP4A 4NLKA 3NF8A 4JWMA 4UAYA 3Q8LA 3AO2A 1RZTA 3LP0A 3OYDA 4G3IA 4LSNA 4F5NA 1U48A 5KFMA 1R0AA 2MUTB 3C94A 4F2SA 3MR6A 4CESA 2VA2A 5BOMA 4FVMA 3GV8B 5FRMA 2WTFA 5J2KA 2OWOA 3PUFA 2ATLA 1WLJA 4F4XA 5HP4A 3HP6A 4CJTA 4XIUA 3MXJA 4AHSA 4CEOA 3OYNA 3V9WA 5J2AA 4DG1A 4I2QA 4Z4GA 3ETLA 1SZPA 5KT6A 5IIJA 3EPGA 3V6HA 3K4GA 4FM2A 3ZSRA 1K1SA 2HHSA 2C2EA 1ZQOA 3ZT1A 4J2BA 3LZIA 4O3RA 1T4GA 4PH5A 5EOZA 2IMWP 1TAUA 3Q8QB 3TI0A 8ICBA 4FLUA 4I9QA 1D9FA 3L2UA 2C28A 4E19A 4IRCA 3RJIA 2A1SA 3QESA 1FXXA 4QWCA 8ICZA 1Q8IA 5KFRA 1SKSA 9ICMA 1UT8A 4ECSA 3SNNA 2DFEA 5DMRA 3U6FA 1VSDA 3K2PA 1MQ3A 1JLAA 4BGDA 3A2FA 2ZTEA 9ICPA 4ID1A 9ICEA 2KZMA 4M0AA 4BDZA 1BGXT 1CZ9A 4E7LA 3B6PA 4CJPA 4PHAA 1N48A 4FJGA 3AUOA 5DG9A 2BQ3A 3AVBA 2KQ2A 4DTUA 4OKEA 2XY5A 8ICUA 2FMPA 5L9XA 4KN4A 5CZ2A 1XS9D 3AVGA 3HL8A 3L2RA 1ZBFA 2X78A 4CFAA 1HYZA 3V9XA 8ICKA 4KHQA 1Z00A 4FZYA 3NF6A 2PFOA 1CLQA 3VQEA 1KVBA 4RQ8A 1HQEA 4HUGA 3RB6A 3SQ2A 2ASDA 3SPYA 1BCOA 3OS1A 3C5GA 4DQSA 3L3VA 3QEBZ 4F4YA 4YQWA 5BPCA 1A77A 2YHAA 3NH1A 1HPZA 4UAWA 1C6VA 1UT5A 2HVHA 3HT3A 2C2DA 2YNIA 3U3YA 4F5RA 2QKKA 3NE6A 4M47A 4P4PA 3C2LA 5KFAA 1NK7A 4IQTA 4ECVA 3V9ZA 3ZSZA 3BJYA 4KLDA 1U9LA 5DLGA 4DSLA 2E6LA 4C8OA 4J9KA 3MXIA 1ZQNA 2VG7A 1MC8A 4FLZA 4KI6A 4DQQA 4PQUA 3MGIA 2X6SA 1SL2A 1BIZA 1C0MA 3OJUA 3KLIA 1RYSA 3RJGA 3M8PA 1J9AA 2ASLA 1WSIA 4Q8EA 1XI1A 2XC9A 1RBVA 1U04A 3AO5A 4I27A 4CHPA 4ED1A 2PZSA 2HHTA 3KHHA 1HJPA 3UQ0A 4ELTA 2NRVA 2PI5A 3LP1A 2HNDA 4ICLA 3HXMA 3PV8A 4RNNA 2RDJA 1HNVA 4I9LA 4LH4A 3KD5E 1JLQA 3T5HA 4GW6A 4ZH4A 3S3OA 3AVJA 3E2EA 5JUMA 2DPJA 3CYMA 7ICMA 4CJEA 1X2IA 7ICJA 2W9BB 4KITB 3IHQB 3RR7A 4X5VA 9ICLA 3TR8A 1WCLA 3RH4A 1B9DA 4KLQA 3PMLA 4QAGA 4KREA 1SKWA 4FS2A 4FLTA 3AA4A 1TKZA 1WSGA 3AA3A 2HNYA 1WSHA 3SQ1A 1TGOA 5K14A 4YFKA 2P6RA 5J0RA 3L8BA 5DBAA 3Q8RB 3HVRA 4CHNA 4MQ3A 1CZBA 3TFRA 3O3GA 3ISCA 4M41A 3NH2A 1T03A 4Q8FA 1U45A 1ZBUA 5DB7A 2OPSA 3SUNA 5IINA 4PY5A 2V9WA 1TVRA 3OYLA 4FLYA 1S6PA 4OGCA 1KLNA 4QZFA 3AU2A 2XHBA 4QZ8A 3KIOA 2XCAA 1BHLA 1YVUA 1NK0A 4OVLA 1C1AA 1DTTA 4CK1A 2G8KA 3SQ4A 2OPPA 4F91B 4AHRA 4KLJA 4GMJB 4KHNA 3ORYA 4LZDA 4MFFA 1FK9A 1S9EA 5HLFA 2PYLA 1L5UA 3LK9A 4DQPA 3L2QA 5KT2A 1IM4A 4NXZA 4O3QA 4QZHA 4DS4A 5KT7A 1S5JA 4RG8A 1COOA 1LW2A 4QWEA 1QLNA 4FJJA 2BQUA 2FPMA 3ALYA 5KFXA 4CF9A 4ECTA 7ICIA 4C8KA 1Q9XA 1JMSA 4PHEA 2B21A 2FBXA 2G8IA 5E41A 7ICLA 1NK8A 2HHQA 1BPYA 1B92A 5CZ1A 2PI4A 1RT6A 3ISNC 1L3TA 5FRNA 1T8EA 2GBZA 2BCUA 4IFVA 1O1WA 1HQUA 3S3NA 1HYVA 4RUCA 9ICFA 1RT7A 2BQRA 1IH7A 3QIOA 2ATQA 5DKWA 2HHUA 5CYQA 1RT2A 4FS1A 4IG0A 2Y1JA 3BQ0A 4CJSA 4Y1DA 4CJUA 1B9FA 4YD2A 2EHGA 5L1KA 4ED2A 4PPXA 4KLLA 1EXQA 4J9PA 5J0XA 5J0PA 3ZD9A 2W42A 2AGQA 4RQ3A 1NKBA 4DTXA 4IR1A 4CEZA 2E6MA 4NYNA 4AHCA 4CIFA 5CP2A 4R63A 3TABA 3AV9A 1TFRA 3DMJA 4Q45A 2OPRA 4RZRA 4QZIA 4FJLA 3SQ0A 2DTUA 3VQ4A 3PX4A 4DU3A 3HWTA 4FBUA 2A1JA 3WNHA 4CF2A 2D0BA 1ZQKA 4NYFA 1BI4A 5KFBA 3ZD8A 1SL0A 4HUFA 4ED8A 1NK6A 2DY4A 3EZ5A 1JLFA 7ICKA 4M3ZA 5DLFA 5EWGA 4F5QA 2BE2A 1XC9A 4KLHA 1S1TA 3GIJA 4NM1A 4YXJA 1PZNA 1S1VA 1WAJA 3I0RA 2FBTA 4CJRA 1RT4A 2HVIA 1ZJNA 1SKRA 1RYRA 3IM1A 3M9MB 4Z6EA 4Q44A 1JIHA 1ZQFA 1RXVA 1S76D 3JPNA 4N41A 2BCSA 1BIUA 1RPLA 5KFDA 5KFSA 4JWNA 1ZJMA 1NK4A 3DLEA 3SUOA 3V1RA 4DFPA 3SPZA 4RPZA 3LALA 2IOCA 5C24A 1IG9A 4HHTA 5L1IA 2A1RA 2PFQA 1LV5A 1J5OA 2OZMA 3TAPA 1RILA 2KFNA 5J0QA 8ICWA 3CM5A 3M8RA 4CHZA 1TKTA 2PY5A 2OYQA 3BGRA 5IIIA 3MXMA 2GV9A 9ICKA 2UVRA 3ISDA 3FFIA 4B9UA 5KFUA 3OYHA 4QZBA 5J0TA 4ECUA 4ED7A 3DLGA 3EPIA 4KI4A 2VG6A 4M9NA 2ZUBA 3JPQA 5D49A 4YD1A 1T7PA 4BE0A 3Q8KA 2C2RA 4IQUA 4DSKA 4M45A 4DTRA 1A76A 5KT3A 2X74A 1B43A 3NGDA 3ZT4A 1TL1A 4YN4A 4M3TA 5DBBA 4QW9A 1ASUA 1S9FA 4KLGA 4EZ6A 1ZQQA 1RCHA 4EBDA 3SI8A 8ICXA 4J9MA 1VSLA 1JX4A 4MF2A 2VANA 3DOLA 4M2YA 1BL3A 1UAXA 3ZSXA 4LZGA 3CFRA 1X1PA 1KVCA 3G0ZA 3SUPA 3VQ7A 4M6WB 2F1HA 4K4IA 4BACA 2I1QA 3OYAA 2H5XA 1BQMA 1LWFA 3MDAA 1WNSA 3AO3A 4H8KA 1BQNA 4RW7A 4FK4A 9ICSA 1TV9A 2Z1JA 9ICGA 3HX0A 4QZGA 3O3FA 4DL5A 1NKEA 2W8LA 1RBSA 4MFBA 4CJVA 3PMNA 4KB1A 2F1IA 2F96A 3MEEA 4CECA 1S0NA 3DRPA 3P1GA 3BQTA 4YMMA 2W8KA 1LWEA 5D4BA 4NLGA 4J9SA 7ICSA 3KLHA 3NGIA 3DRRA 3THVA 4M3RA 3P83D 4XRHA 8ICJA 1KSPA 3V7JA 3HM9A 1U49A 4MF8A 1KVAA 4FLVA 2I9GA 4UQGA 3K5LA 3MECA 2YNFA 3RBEA 5HMMA 7ICTA 3V6JA 2BKEA 1FKOA 2J6TA 5J29A 3OYMA 4KTQA 4Z4FA 4DOCA 3HPHA 3VQ8A 5J0UA 4YMNA 1Z26A 4QWAA 1KRPA 1VSHA 4FXDA 1S0VA 3AA2A 1RDBA 4PHPA 5KFEA 4EZ9A 2GUIA 5KG5A 2G8VA 4O44A 4AILC 3RB4A 4UB5A 1QS4A 3NFAA 4PWDA 1MSWD 4AH9A 4J2AA 4M9LA 3VA3A 5CY4A 3QEVA 4ZTFA 3TFSA 2Z1GA 1RT5A 2Q0ZX 2PYJA 8ICCA 4KB0A 2ZTCA 4RQ2A 5IIMA 1JXLA 3L2WA 1VSJA 4RW8A 3PX6A 5J0SA 3QZ8A 3IG1A 1QE1A 4O3SA 8ICAA 1ZBIA 3DYAA 3PW5A 5J2IA 3LDAA 3DM2A 3P5JA 5KFPA 3QEAZ 2FLLA 5EWFA 4KLEA 1UA0A 3ITHA 4QWBA 4CEBA 1N5YA 2NRTA 1JXBA 4K4HA 4O5CA 1XU4A 3OYGA 3ZT2A 2IGIA 3VQAA 3L2VA 5J1EA 4B8AB 3C1ZA 3RTVA 4Q5VA 4DSJA 3KD1E 4CF8A 2KTQA 2BCQA 5KFHA 2FLNA 4MEYA 1ZQUA 4KO0A 2AGOA 3C6UA 3LPUA 3T5KA 2G8HA 3DLRA 4E7HA 4UB1A 1A5WA 4CEQA 1JKHA 3OYEA 2ZUCA 5KI6A 2R7YA 3ASMA 1BVSA 3EWAA 5J2EA 3O3HA 4M3XA 3V4IA 9ICCA 1TKXA 3VQ5A 3GILA 1JLCA 5SZTA 4AHVA 1XSPA 3V81A 5KFOA 1IO2A 2PFNA 4J2DA 4NCAA 1S1XA 1GOBA 3OYIA 4W5NA 4R8UA 5C25A 2BR0A 1S1UA 3KLEA 3SYZA 4ECZA 3RJKA 2JEFA 1S1WA 3SV3A 1ZQBA 1QSSA 3PY8A 5HRRA 4UBCA 1HJRA 4TUQA 5KG7A 5F9NA 2W9CA 3MFIA 1GOAA 1S9GA 4OLAA 4I2PA 4N56A 2RF2A 3AVCA 4B9TA 1WN7A 3K5OA 4KHWA 3UXOA 1VK0A 1ZQRA 4M3WA 3N97B 4CJQA 2VG5A 1QQCA 3HO1A 1J53A 3PNCA 2B6AA 2HMIA 3OSNA 1RNHA 3V7LA 3D45A 3KJVA 3KHGA 4QOZB 4E1MA 2R8JA 3I0SA 2IHNA 2KFZA 2IC3A 5I3UA 2XGPA 3AVAA 3HP9A 4FJIA 3V1OA 5KGWA 4NCBA 3QO9A 3KLFA 1XHZA 2FMSA 1ZQCA 4CGJA 5HROA 3TANA 1BPEA 2R8KA 3QEWA 3JPOA 5HHHA 2UVWA 4UB4A 3GV7B 4I2GA 4ID5A 4E7JA 3QETA 1CEZA 2MUTA 4Q43A 5J2NA 9ICAA 8ICMA 4DFJA 1WSJA 3F9KA 4IQWA 2DFFA 1VRTA 5HHIA 4NCGA 2QK9A 8ICQA 1QTMA 4M04A 2KZZA 9ICHA 5KRTA 1RT1A 4KLIA 4DEZA 9ICWA 1WAFA 2HB5A 4KFBA 1U4BA 3SJJA 3ZSWA 3BQ2A 2GWSA 4MFAA 4O3OA 1ZQHA 4KHSA 3AVIA 3HJFA 4RW4A 3LP3A 3PW0A 5FDLA 1XSNA 5J2PA 1XO1A 8ICIA 4F3TA 1ZQLA 2A1JB 4M9HA 1IKYA 1L3SA 1CXUA 1U47A 2YV0X 5KFQA 4CEDA 4J9OA 1TAQA 3ZSVA 1K6YA 2Q3SA 4WE1A 4BXOB 4FJNA 4C8MA 5J2CA 3JPSA 3CFOA 1UA1A 2PFPA 3NF7A 4CF1A 1TVAA 3LPTA 2JZBB 2YNHA 3RAXA 4KLMA 4IRKA 3GIKA 3HK2A 3AA5X 3KHRA 4O0JA 3AVMA 3KHLA 3O4QA 3NAEA 4IRDA 4O5KA 3TAGA 5IIOA 2PXIA 4DLEA 4NY8A 3OS0A 1VSMA 3CFPA 1B22A 4PA1A 1LAVA 3OYJA 2BPFA 2ZJ5A 4DF4A 2AQ4A 4W5QA 1X9WA 4KLFA 4QZCA 5I42A 1TK5A 3PR5B 3QE9Y 1D9DA 9ICUA 5KFJA 1QHTA 1C7YA 1LWCA 4GC7A 4HUEA 3Q8SB 3MR2A 1WCNA 4RUAA 5BOLA 1HYSA 4B3OA 4CGHA 4DO9A 1EKEA 5CA7A 4O4GA 1BPZA 1KFDA 3LAKA 3G10A 3RJEA 4F3OA 1JL1A 1W0HA 3RR8A 3QINA 4E89A 1NJWA 2P6UA 1V9PA 4R5PA 1RT3A 4Z4CA 2NRZA 4EYHB 1XHXA 3M8SA 5JS1A 3L3UA 1CUKA 4I7FA 2X6NA 5J2HA 1YTAA 4FJHA 4JV1A 3SI6A 3QZ7A 1QSYA 8ICGA 2O4IA 3NF9A 4CJLA 3FDSA 2P51A 3OYBA 1ZQZA 4ECYA 1HMVA 2P1JA 3RH6A 2IHMA 1W9HA 2M9NA 3V9SA 4Z4IA 2IS3A 1BCMA 4CJFA 3T5JA 4ECWA 4KLOA 4B9SA 3OSPA 1YTUA 7ICFA 3OYFA 4DL4A 1QSLA 1KLMA 3EW9A 1RBRA 4RT2A 4XUSA 4CJKA 3C95A 4P4MA 5KFTA 5KG1A 5DQGA 3LDSA 4Z4EA 2DPIA 3CG7A 1REVA 1TKDA 3EYZA 4F50A 3G6XA 2BDPA 2UVVA 4HCBA 4CIGA 4FM1A 7ICGA 3OJSA 3EY1A 2BPGA 2ZE2A 1JL2A 4M9GA 4B9VA 4I2FA 5D3GA 4DSEA 4Z4HA 3RJFA 2W9BA 1IKXA 7ICNA 8ICYA 3H8WA 3MGHA 1LAWA 1HUZA 4DWIA 4CK3A 5KRSA 4M42A 3TAQA 4W5TA 5J2QA 4FJ7A 3AO1A 1BPXA 1RTDA 1N56A 5J2BA 4XA5A 3ZCMA 3DLHA 8ICTA 2KN7A 4G1QA 2FPKA 3JPPA 3DI6A 4KV8A 3D0PA 7ICHA 4N76A 2EX3A 3KKSA 3MABA 4EP5A 4RNMA 7ICUA 4O5BA 4UB2A 2R8GA 4F4KA 3GIMA 2FMQA 4J9QA 1JLBA 4NLNA 4AHTA 4ZTJA 3IS9A 7ICQA 1RDCA 4K4GA 1VSEA 4OPKA 4FJXA 1S10A 4CHYA 3B6OA 4CK2A 5J2FA 4TQSA 1C1BA 3C2KA 1IKWA 4I2HA 2XCPA 2RKIA 1EX4A 4E7KA 5DDMA 1K1QA 4JRPA 4K8ZA 2XO7A 5EWEA 5DDYA 3MAQA 4Q0BA 4AHUA 3MFHA 3ZSQA 4B9NA 5DBCA 4I29A 3VQQA 2OZSA 4ELVA 3B0XA 5DGAA 3PW4A 1X9MA 3G6YA 5EU7A 3SV4A 1NK9A 3K57A 1RTJA 4B9MA 8ICRA 4KPYA 1SV5A 4HTUA 3N4MB 3V9UA 2ISOA 3MDCA 4GC6A 2YHBA 3PO5A 4IR9A 4IDKA 8ICLA 4KHUA 4CJ4A 3MR3A 5HRSA 3UIQA 3RMBA 4QW8A 1RBTA 2F8SA 1DOQA 5KFIA 5J2DA 3GIIA 3RWUA 4M3YA 4CFDA 2KZ3A 4B8CA 1HRHA 5IILA 1DLOA 9ICRA 5KG2A 4K8XA 8ICOA 1Z00B 5J2MA 3NCIA 4KTWA 4FBTA 5J0YA 3V72A 1S6QA 3C6TA 1VRUA 2AQ0A 2NUBA 3TAFA 9ICTA 5HBMA 5SWMA 1ZBHA 1TK8A 4CGGA 1S77D 5KG6A 4CF0A 3QNOA 3JSMA 4M3UA 4MFCA 4IBNA 4J9RA 3QERA 2ZJ8A 1SUQA 4N5SA 2JEIA 1ZQEA 4RQ1A 2BCRA 4OLBA 1BPBA 4C8LA 1G15A 4J2EA 3GFKB 5KTQA 3AVNA 1ASWA 3OVNA 1BISA 4ELUA 3NTUA 1RXWA 4E1NA 2YKNA 4FM0A 2D0CA 4O3PA 3MEDA 7ICVA 4B08A 3KTQA 3OGUA 3OHBA 3CM6A 1JLEA 1X9SA 3C2MA 4YMOA 3LZJA 3RRHA 4LY7A 2O4GA 4FK2A 3WNEA 1ZQPA 3Q8MA 4YG2A 4OPJA 4YP3A 1N6QA 2XRIA 3C23A 1A5XA 4CFBA 2D5RA 4P2HA 3KK3A 3G6VA 3VQPA 1JXEA 4FZXC 2IAJA 4OGEA 3PR4A 5J2JA 4DMNA 1NOYA 7ICRA 4YVZA 1UWBA 3HSTB 3RAQA 2B4JA 2WONA 3B0YA 4DTJA 3QEPA 1SL1A 2E4LA 2VWJA 5DGBA 4JV2A 1VSKA 2R8HA 3LANA 5HMLA 2P5OA 3WNFA 3LAMA 2XY6A 4FW2A 1EETA 4ECRA 4CERA 1WSEA 4I2IA 3AVKA 1TV6A 2W9AA 5KFGA 3Q8PB 2FBYA 3OS2A 4J9NA 4IG3A 3U3GA 4RW9A 3H7IA 3AVHA 5KT4A 3VN5A 4E7IA 1MU2A 4Z6DA 5KT5A 4PUOA 9ICJA 4FJ8A 2XY8A 4LD0A 4FLXA 3VQDA 4EYIB 3K5MA 2UVUA 4Z0UA 2BGWA 4JV0A 3AU6A 3RMDA 4MEXA 1LB2B 1IKVA 5C42A 4M9JA 3GQCA 1NOZA 3LP2A 3DRSA 4KAZA 3OHAA 3MR5A 1ZQYA 1F21A 3S9HA 1ZQXA 5KG3A 4CJWA 5KGXA 4YNQA 2BPCA 3QEIA 1D8LA 4TUSA 3MBYA 5DG8A 2BCVA 4QZEA 3JYTA 2NRXA 4IFYA 3ZT3A 4QZ9A 3WNGA 1ASVA 4CGFA 3ZSOA 8ICPA 1NJYA 3KK2A 4DOAA 4CJ5A 4M6WA 3NDKA 3K58A 4O3NA 8ICEA 4F5OA 1C1CA 4I2CA 3DLKA 4EBEA 4F8RA 2YNGA 4FZZA 3E01A 4W5OA 3KK1A 4DSIA 3RRGA 1ZQJA 4JK1A 5KFVA 1RTHA 2ALZA 2JLEA 4UB3A 1ITGA 2ASJA 1J54A
chains in the Genus database with same CATH superfamily
9ICVA 1N32K 1CQMA 2IHR1 5ALGA 1YJ9S 1XMOK 4RQ0A 3UPQA 4WU2A 4CZGA 2Y8WA 4EFAC 4OI3A 3ZT0A 4PYDA 3A8YA 2M0GB 2CQ4A 1HQUB 3OTCA 3VGLA 2W11A 1RT2B 9ICBA 1ZA2B 4IG0B 5MLCV 1GMUA 3K0JA 4BRIA 1GQEA 1JI7A 1BY9A 4IKFA 3VAIA 1IXRA 1KFSA 4RQ6A 4C3MA 2WOMA 4GRSA 1A0PA 4R65A 4HH1A 4ISEA 1YVNA 4JKHA 2Y1LB 3I76A 3S6JA 1I51B 1HKCA 4DR1K 4LVNP 3U02A 2XI3A 2XTJP 4RQ4A 1QQOA 3KWIA 1ZD3A 5AM0A 4FO6A 5KAKA 1XSLA 4NLQA 2B4PA 2R7SA 5AQYA 5DK5A 2YX8A 2KVQE 4JI6K 3RB0A 4DR2J 2HQGA 2RJZA 5AKGA 5B0AA 2IDOA 3NASA 3A8EA 4AXJA 8ICFA 2FC9A 4I2JA 2GHPA 1LOUA 2BE2B 4JI1K 3W2WA 4E0DA 5LMUK 3GJQB 5D3GB 4RPXA 1VQ4S 3NS1A 1VQPN 3T7ZA 4B1YB 3W5XA 5ALLA 1RT4B 4BY9C 1U2CA 4TLQA 3T1HF 2PO4A 2I7NA 2YX7A 2H3GX 2MMYA 3A5OC 1VQNS 4ZP7A 1HNZF 1R6VA 4QIGA 3EXCX 3AOCA 4GKKF 5KFKA 2JGUA 3M9NB 4KAIA 3NBPA 5A8WA 2NRWA 2DGSA 3HLUA 5CB1A 3H59A 3MI7X 2DR8A 2KKZA 3DLEB 3S3MA 4C4TA 1HL6A 2WF9A 5KFWA 2QXLA 1GK8A 4GVMA 2ZBPA 1Q8BA 4WFZA 4RO0A 5E79U 4O5EA 1T95A 1J5OB 5CJ7A 3V6DA 1SVDA 4DF8A 2H5IB 2J9EA 3TQ1A 2MU2A 1WF2A 4CCHA 3QU4A 2AJQA 2DH9A 3TPQA 2E5IA 1RHUB 4CF5A 3QT5A 4PPZA 2DGVA 2DFHA 4KRWA 1UMJA 2ZJRL 2AGPA 3DLGB 3NY0A 4JB3A 2VODA 4BVPA 1H7XA 4QZAA 1RBUA 2L48A 5GADP 1VIXA 1BO5O 1ZQIA 3W5YA 3FZKA 4GXKA 2KD1A 3MD1A 1NGFA 2XMTA 2HHWA 4GXIA 4A57A 3OY9A 2MSSA 2CQDA 3H08A 3TAMA 3HW8A 1SIJA 3CCQS 3AJ2A 2R4FA 1HWIA 2ZUDA 4DL6A 5HJXA 1UOCA 1DTQA 3PYGA 1VDHA 2F9WA 2FLPA 3NH0A 1SB3C 2OA8A 1EQMA 3SDEB 4CLFA 4KH4A 4K41A 2G8WA 3MCMA 1YX2A 3J7A1 3OXLA 2PD1A 4HT5A 2WVCA 2M8DB 4BC4A 2K8BB 2VHGA 4TUPA 1BQMB 1VAZA 2MSTA 2DCLA 5DDQC 5KFFA 3ILLA 3SSQA 1YT3A 1CS4A 5HNKA 5AM2A 3OV7A 1R8HA 5A76A 2EW9A 3THYB 4YR0A 4I2EA 4FWNA 1T6DA 3UO0A 4HVJA 2UUCK 5GADI 3D6HB 1EIYB 2Z1IA 4GVBA 1FKAF 1FF2A 2XLJA 1EJ7L 5B0BA 3ZSYA 3VENA 3Q86A 3KLHB 4HR2A 2K8CB 4W98A 5CR0A 4JS5A 5L1LA 4C48A 4ZITA 4ZP9A 4DTOA 2E8OA 4WBFA 3TARA 3PIPL 3M30B 4RPYA 3G82A 4CGIA 4Z6CA 2OMOA 4XQ8A 2ZD1A 2ZJAA 1B4FA 4CHQA 1NSPA 2E8AA 2Q79A 2YQ0A 1HD1A 1NZPA 4L8RB 3GWCA 3UNYA 4O3MA 1UFLA 1HLWA 5IWAJ 1GT8A 5CYMA 3WXJA 1WWUA 2H3EB 2JH7A 1VC5A 1HIWA 3AY0A 1TMJA 2DHHA 1NKCA 1I39A 2M5YA 3B4MA 1BA0A 3UKUA 3RMAA 1VQ5S 3K59A 4PGXA 3ENAA 4CLSA 2LECA 4GIBA 5AM5A 2HQIA 1Q9YA 1C4CA 2GVZB 1VSFA 2O3DA 2GS8A 5GTHU 2JEGA 1AROP 4X62F 1GOCA 7ICEA 5L1JA 3J80Y 1N5YB 1KDHA 1VYAA 3W1YC 1KTQA 4F2RA 4HACA 1X7VA 3OR2A 3I5BA 2ZH1A 4IOCL 5J1EB 1I3AA 3W9HA 2L41A 4JI7K 1V3RA 3P39A 1KW4A 4BRKA 4WCEQ 2RQMA 3VQBA 3I87A 5BPLA 5FPMA 3H8SA 1VLYA 9ATCB 2ISPA 4MIAA 1C0UA 2HHVA 1S0MA 2HI0A 1S8OA 2APOA 2VQEK 3TADA 3Q8YA 3CCRN 1ZC6A 2YWKA 5AQQA 1S72S 2WCXA 2UUBF 3D3CJ 4JRQA 1W2BM 4GV6A 1L6NA 4X65F 2BHNA 4DDFA 2ITGA 2G8UA 1RHKB 3FBBA 2W9MA 3EJMA 3O80A 5KFCA 1VQ7S 3M5RA 2IOHA 3ZDDA 3JS6A 2JWKA 4Z6FA 1N0VC 1S1XB 5FIIA 2HNZA 1S1UB 1HNWJ 3VEZA 2DNZA 2EG1A 2NSBA 1JALA 5HRNA 2Z2ZA 3M2VB 4HCCA 1W25A 4I2PB 2QA4G 3W66A 1D8YA 1I6JA 4CEAA 2CIMA 3AH6A 3T41A 2VG5B 1CULA 1RAJA 3PJXA 1T3NA 2HMIB 3L5KA 2D0AA 2NS1B 4JS4A 3EKUA 5DB6A 3BYRA 3BS5A 3C7NB 2O5DA 5E3QA 3I0SB 3L09A 2R2TA 2EFGA 1BWVA 1PG5B 2NZ4A 4OI1A 4P4OA 3KNGA 3KZIU 3PW2A 3ZTOA 3C16B 3O4NA 3ONQA 3KLFB 3IDWA 1TL5A 1EP4A 2ZJPL 3M3ZA 1RAGB 2IJRA 1H6KX 3Q8LA 2KJ9A 3OW2M 3HHNB 3C46A 3IUCA 3BBBA 3CQXA 1WORA 2WZ1A 1BWEA 5KFMA 4K5SA 2E66A 2MUTB 3C94A 5J2NB 3OTBA 2VA2A 4LQ3A 4GY2B 5BOMA 3DGPA 3ISZA 4PZNA 3BKUA 2R7QA 3MMAB 2WTFA 2I9SA 2ATLA 1N2XA 4DCCA 1GX5A 2ABYA 1V9OA 3CCSS 4F4XA 4J03A 2OSRA 5H2FU 3OYNA 3JQKA 5GAGU 5E26A 4KFBB 3ETLA 4DV5K 3PJ9A 4M94A 2GMLA 1M1GA 3EPGA 4JI3J 4NWBA 4CLPA 2FJEB 4QR2A 4JD2B 3LDLA 1ZQOA 3ZT1A 1FJCA 5ETKA 3HI0A 2XYGB 3LZIA 3D7SB 5GADU 4EO6A 4O3RA 1T4GA 2EWHA 3GFYA 1S4EA 2CAJA 1WOQA 1LKZA 1YJNS 1XUPO 1F60B 4QNLA 1D9FA 2O01C 4E19A 1QAYA 3RJIA 2MKJA 2GIRA 2R9LA 3H46O 4ZPVR 4QWCA 1FXXA 5LSLA 2D74B 1Q8IA 5KFRA 3ID6A 4H0TB 3R5JB 3EZWA 2ZNYA 1VQ6N 3SNNA 5LMNF 5DMRA 2H65B 2K2PA 5A8KB 4NB4A 1VSDA 1MQ3A 3IWLA 3IFEA 2ZTEA 3ETRA 5AI6A 2O66A 9ICEA 2A6MA 3H45C 5IM0A 3LL3A 2KZMA 5H1SV 2W6KA 4BDZA 1BGXT 3VAFA 1JB0C 1X5SA 1NHUA 2Y1RI 4WFBQ 1OQ6A 2YPYA 1NJIO 2OEJA 3CPWR 2HPUA 5ADXH 3JAMY 3K0SA 1AUDA 5D4OA 4J7CA 3ENVA 2GMJA 5CD4A 3KKAC 1OIAA 2BJ8A 2VOOA 4OJ3A 4JYAJ 4Z2XA 2UXBF 3UI3A 3MN7A 3GFHA 1RABB 4ANEA 1LWCB 1Z4OA 1FT8A 2XG8A 1O03A 1IBMF 1KVBA 3BKTA 4A2AA 2ASDA 3DN9A 3M2RB 1LKYB 2R7XA 3C5GA 2WUSA 2GV1A 5K5MA 1U8SA 1DQ9A 4JV5F 3D3BJ 3ED5A 3IM9A 3W61A 3QGGA 2ZH9A 4X4SA 4CO1A 1FNXH 3A13A 3UD4P 1L8OA 2RHKA 3HT3A 3WKAA 2VFVA 3NE6A 1PIEA 5A8RA 4M47A 3C2LA 3Q24A 3P31A 2YPZA 1BUXA 1NK7A 1U2VB 4DV7J 4IQTA 1MA7A 2EK1A 2W03A 3BJYA 4H0OA 4KLDA 2XS7A 2RILA 1HMVB 4RTFD 3MCOA 3Q89A 1UW4A 4OJ5A 2VG7A 1S7HA 4Y34A 5IC4B 3I1YA 1YI2S 1AFIA 5F8LA 2FVQA 2OH2A 2PDAA 1Q0NA 1Q79A 3D2SA 2WBMA 3AEVA 2X6SA 1RYSA 3MEKA 4XAKA 1J9AA 2ASLA 4CZFA 1TTHB 4Q8EA 3HKZC 1XI1A 1Q53A 4K59A 3LDNA 3CCUS 4DR7F 2NPIA 1U04A 5A0LA 4I27A 3X3UA 1RGIA 3I28A 1NSAA 3FSXA 5JLHA 3KHHA 3BM7A 4QOTA 2NRVA 2EVZA 1NUEA 4LH4A 4D3GA 1JLQA 3KD5E 2IM3A 1QM9A 1KNZA 4QU7A 3AVJA 3CYMA 5JUMA 7ICMA 2ZE2B 1X2IA 1FX4A 1D0EA 7ICJA 2KOBA 2W9BB 1WI8A 4KITB 2DITA 3ZC4A 3OVBA 3RH4A 2EBGA 4KLQA 5AM1A 1HHTP 5DDRC 1XR5A 1NGJA 3MM9B 4FLTA 1X42A 5CHCB 1TKZA 3AA3A 1TGOA 5CYMB 5K14A 3AQPA 4NLWA 2P6RA 3GFZA 5DBAA 2DNGA 4RNHA 4MQ3A 4WPAA 3OPKA 3O3GA 2EFVA 4ZIVA 3H90A 1TL4A 5DB7A 1F44A 1TVRA 2Y0SF 4DJBA 4QZFA 3AU2A 1HWUA 2XHBA 1M5HA 3LVWA 4NA3A 2V7YA 2I8EA 4OVLA 3VAJA 2NYVA 4W92B 3R7BB 3SQ4A 3EUB2 4F91B 3DHWC 2XIDA 2IRUA 2HS0A 2R18A 4KLJA 4GMJB 3E0FA 4LZDA 1ZBSA 1JWWA 1TU0B 2BH1A 4LJXA 2RRDA 1S9EA 4NX9A 2A3VA 4UATA 1E6YA 3MWBA 5HL7Q 4QZHA 2O8EB 1S5JA 4ZLJA 4OD0A 1COOA 3SLCA 2GIFA 4QWEA 2KYXA 4KX5A 2FPMA 3PKYA 3HHEA 3ALYA 3N28A 1F6TA 3MDQA 4MIBA 3KG1A 7ICIA 2LQBA 3OFFA 1JMSA 5H9FK 3F2CA 1Y9OA 2G8IA 3CCEN 4OYPA 3UPFA 1NK8A 2HHQA 5CZ1A 3VF2A 3HSJA 5E2QA 5AM3A 4AP9A 3W9JA 2G2OA 3W65A 3NVMA 2PBDA 2X1AA 3F0NA 1IH7A 1WKKA 5CYQA 1FA0A 2FJWA 3GONA 3FGUA 2RS2A 2JHEA 3BQ0A 4Y1DA 1RAIB 2HBLA 1ZAWA 1P8ZA 2EHGA 2OTJN 1QQ7A 2B4OA 4PPXA 4KLLA 1LOTB 1BU6O 1AZSB 4JMUA 1Y3JA 4FF2A 5J0PA 3W7BA 2L5YA 2W42A 3OL6A 1RFQA 2E1YA 4DTXA 4MLEA 2XMMA 4MN4C 3SBMA 5LT5A 2E6MA 4NYNA 3M1VA 1LFPA 5JMNA 4CIFA 4K4VA 4R63A 4LF5K 3AV9A 1TFRA 2OPRA 4RZRA 3WK9A 1EP4B 3SQ0A 3NRBA 2YCHA 2DTUA 1I5OB 3HWTA 2D0BA 4IO8A 1BI4A 3UN5A 2BJ1A 3H20A 1NK6A 2YXLA 1HLUA 1OUQA 3EZ5A 2W40A 4M3ZA 4FZVA 1JLEB 3GIJA 5J1PA 2P9PB 1QQMA 3NG8A 2FTRA 3N4WA 2DVIA 1VHIA 2ZBIA 1IXKA 2Z57B 1RYRA 3ZO7A 4DOZA 5IC6B 3VEWA 1OYDA 4Z6EA 2ZGZA 1N0UA 1UETA 4KQZA 1RXVA 3CDBA 1NDLA 4WKRA 5HQLA 6AT1B 1SXLA 2ERRA 1D4XA 4NV0A 4Y2VA 2VU5A 3I32A 3MM6A 3OUYB 1NPPA 4JWNA 1DFDA 2HG4A 3V1RA 1H74A 4DFPA 4F71A 1U02A 4RPZA 3LALA 5AQVA 1EETB 1GXTA 3R7NB 4WZMA 1E4GT 2B9WA 4CBXA 2HOFA 3T1HJ 1LV5A 3TAPA 1HNZJ 1RHMB 4RW9B 2KFYA 2F44A 4ZPWR 2PY5A 4GKKJ 1IBCB 3MF5A 5IIIA 5FJ4A 3O9RA 2JFDA 2BM1A 1UPMB 2X1FA 4NXMK 2HHHK 2UVRA 4C3LA 5AIBA 3OYHA 4QZBA 4ECUA 4US9A 2BYCA 2H4WB 4M9NA 3QU9A 3CVKA 5D49A 4Y2PA 5HOOA 3Q8KA 3LP2B 5AK3A 2GQQA 3BUZB 4DSKA 3ZZUA 5KT3A 2ES6A 3WX8A 3ZT4A 1GMVA 1JCEA 4YN4A 4TY9A 5LY3A 1ASUA 3JYTB 1IIPA 3SI8A 1YJTA 8ICXA 1JX4A 1HQ2A 3SQGB 3CFRA 1TL7A 2WAQC 3G0ZA 3SUPA 1DEJA 1JJHA 4HTJA 4K4IA 3WIUA 2ADBA 1YHQN 2I1QA 4QIWD 2CPHA 1SV0A 4B3TK 3FEZA 3IBPA 4CYUA 2ZNZA 2KU7A 1C1CB 3AXMA 1OH5A 2KE7A 9ICSA 4FOIA 2AEFA 4LF8K 1S6UA 9ICGA 1HR0K 1S59A 2E7VA 3D1HA 4DL5A 1NKEA 4MFBA 4BC3A 4CJVA 2ZEJA 3MEEA 1S0NA 4MLHA 5EX3A 1LK5A 3MMBB 5D4BA 2AYMA 4HEA9 4J9SA 7ICSA 1YRXA 4GO5X 4IFEA 5IT9Y 3DRRA 4X64K 3P83D 1HNXF 1J2VA 3M7DA 3V7JA 1NBWA 1I3OB 3VHQA 3BS7A 1FD2A 2DGOA 3CJAA 2CPDA 1XNRF 2MYFA 3IRXB 3WQPA 3J7Z5 1KVAA 5EX0A 3TADC 4FLVA 2CQBA 2I9GA 3K5LA 1YUWA 2IA0A 4A59A 1RDRA 3RBEA 5ALIA 1FWKA 1XIQA 4C4WA 3JXOA 1YIJS 2CQ0A 1PO6A 3IN5A 1NRKA 4YMNA 1Z26A 4QWAA 3VPZA 3QMLA 1R8AA 3OFGA 3POTB 2KDOA 4PKDB 5KFEA 1RDBA 4EZ9A 2Z2LA 2GUIA 4PL8A 3VEOA 1I94K 3BV8A 4V19S 4M8LA 2V8DA 3HVWA 4PWDA 1QS4A 3CPEA 1MSWD 1GMWA 2IY5B 2WC9A 4M9LA 3P5TL 3QEVA 1ZZNA 5AQXA 2J4RA 4KGVB 1U1MA 2BJDA 1RT5A 5IFMA 3ID8A 1RHJB 4I68A 2E9ZA 2YKOA 1CJUB 8ICCA 4KB0A 2ZTCA 5IIMA 8ATCB 1NDPA 3R2DJ 4UOHA 3AARA 1BG3A 1VSJA 3FQLA 3GU3A 4FYWB 5J0SA 3ZETA 1Z4NA 2RUGA 8ICAA 2WHEA 3DYAA 3J81j 2FLOA 4NXNK 1GX6A 2ZDOA 3DM2A 5DDOC 1OXJA 2FLLA 2W43A 2DXEA 2FE9A 2HGMA 4U7UK 3GR1A 2RUSA 2ZIXB 2WSFC 4O4RA 3VQAA 5HR7A 3L2VA 1JNZB 3O5BA 1H73A 4Q5VA 2HF3A 3KD1E 2BCQA 1JROA 1XN9A 2FLNA 1T3OA 4KO0A 2F8EX 5ALKA 3CCZA 3NNHA 4JN4A 2PMZC 2AWZA 2DNPA 3N9UC 3NMAA 2NREA 4X62J 4LBPA 1L7NA 3OYEA 5A2QO 5KI6A 2A3JA 1BVSA 3EWAA 4OYWA 3O3HA 4NPOA 1KBUA 4PXBA 9ICCA 1TKXA 3GILA 3I5AA 5SZTA 3MGVA 5M2PA 2BANB 2PFNA 2LKZA 3DHXA 4J2DA 2J5AA 4CLYA 2XMKA 4P73A 4JI8F 1GOBA 5C25A 2BR0A 1IR0A 1BXNA 2OAUA 3KLEA 3QFPA 3NNCA 3RJKA 3PSIA 1RWVB 3H0LB 4TN2A 4RPFA 1MROA 3SV3A 2YQ3A 4JOUA 3BO3A 1HJRA 1UHUA 1IJJA 4DR5K 1S9GA 4KHPF 2RF2A 4B9TA 2UUBJ 3TP2A 3UXOA 1RLDA 3HRGA 4I6AA 1ZQRA 2ZZTA 5T7LB 4X65J 3HHLA 4HL9A 3U1NA 4F36A 1F9HA 2QRRA 4UASA 3I6PA 2B6AA 1KKHA 4ZVRB 1RNHA 2AD9A 3UCZP 2E8NA 4KX3A 1F5AA 4WTYA 2R8JA 5DO2A 3P49B 1YK9A 4C4RA 2F4VK 2KFZA 5I3UA 3PSTA 4F02A 3HP9A 1FEHA 3PTWA 1BC6A 4FJIA 1GXUA 2XMUA 3H5XA 2MQQA 2KK0A 3C14A 5TISU 2UXDF 3CF5Q 1UFWA 5HROA 3TANA 4ATNA 3BN4A 4C6AA 1IR2A 4OZJA 1Y4ZB 2M88A 3QEWA 1DZ5A 6FD1A 3A3OB 3GJSB 4E7JA 3WK4A 4M5LA 4Q43A 2U2FA 9ICAA 3VERA 2K8AA 3PACA 4USJC 2DFFA 4ZDNA 2QGFB 2QK9A 8ICQA 4HHJA 4EENA 2CPJA 5JVHQ 2UV8A 2UUAF 2XB2D 2HB5A 3SJJA 4C7ZA 3OPXA 2WB1D 1T11A 1P6TA 1W97L 3W63A 4QIFA 1RXOB 5CZVA 2XWYA 4OPAA 1FI4A 2CRXA 2QMUB 1ZQLA 5BN8A 1TYQA 1WUAA 4LR7A 1SCJB 1R59O 3J7YI 1IKYA 4H4OB 1U2FA 3WZ0A 3LM2A 3UM9A 4CEDA 4BC5A 3MAAA 3GLJA 4J9OA 4LIWA 2POKA 3B4DA 2C2ZB 2Q3SA 5H9EK 1MW7A 2EZXA 1Z05A 3CFOA 3KMSA 3GCWP 2PFPA 1EB0A 2FVRA 4WWSA 5AT1B 3UWTA 3BO2A 3CJSA 2NYHA 3HRDD 2CA9A 2B4UA 3HK2A 3SIPB 4Y00A 3Q2TC 3SJHA 2KMDA 3HSDA 4O0JA 5AQTA 3CJ7A 1RU1A 3AVMA 1RISA 1RTIB 3TR5A 3NAEA 4PWWA 1N34K 4BR7A 4DLEA 4NY8A 3FFKB 4CO5A 4KH1B 1VQKS 2G07A 2OFGX 4WFNQ 4ACOA 2AQ4A 1RSCA 5LMNJ 4W5QA 4A8YA 3MCAB 2GC8A 3NWGA 4OJHA 5I42A 2LXFA 2Y9UA 4P10A 1D9DA 5KFJA 4LFCK 2HOEA 2HZVA 3KLGB 4HUEA 4C4SA 1WCNA 4RUAA 5BOLA 1HWLA 3KKFA 3E58A 2VFTA 1BPZA 4KJIA 3LAKA 1P9QC 2DHSA 5BYSA 3VF6A 3C8YA 3MMJA 3AM9A 3RR8A 8RUCA 1S3XA 2MQOA 4DUYK 4ZJOA 3KBBA 2UXBJ 3IG5A 1XHXA 5IOLA 4I7FA 3IFRA 5JJBA 3NCPA 3GP9A 1VQON 3SI6A 3RW7A 1F9EB 2P9UA 4NA1A 5K8MA 1J5EF 1IBMJ 2IRXA 2ZKTA 1Y3KA 3TVZA 3DJCA 4CZJA 3N01A 2CQHA 2P51A 3OYBA 4JV5J 4Y65A 3P4IA 3RH6A 1W9HA 2M9NA 5HQ8A 3MEEB 4KLOA 1WG8A 2B5JB 4DL4A 5GAHP 2KB2A 1QSLA 3OTDA 1KN5A 1KLMA 1RHQB 2HK3A 3VCDA 2RAQA 2AW0A 3K9JA 3PXGa 2W2MP 1ATSA 2HBMA 5KFTA 3LDSA 4LSNB 4RR5A 3FCWA 4FM1A 1KVJA 4EAHD 4MHVA 4AYBD 3OJSA 2A6AA 2BE9B 1M90T 2DL0A 4LVOP 2J9DA 2MHEA 4B9VA 4I2FA 4DSEA 3L9ZA 3RJFA 1YBAA 1IKXA 7ICNA 2KHQA 4Y2XA 3EGWB 5AQWA 4CK3A 4DR7J 5J2QA 4FJ7A 3AO1A 2KJWA 4DG1B 1BPXA 1ZQ1C 2WSCC 3IR6B 5ALTA 2EC2A 3CNQP 1ZXIA 2UP1A 4DCOB 1H0HB 2CJBA 2KN7A 1KS2A 5GAHI 4O8KA 5IWAK 2QEXN 3L6QA 4ZA1A 4QIWF 2ITMA 2E2OA 4O5BA 3BN7A 1U7LA 2YX6A 4NLNA 4AHTA 4ZTJA 1Q95G 1RDCA 4C80A 2M2BA 3KDNA 2FHJD 3ZETB 3HOTA 3B6OA 5EHHA 1IKWA 2RKIA 5DM7Q 2GJIA 1JXVA 1WEZA 3MOJB 2XO7A 3MPUB 5EWEA 5DDYA 4FWMA 4Q0BA 2CNLB 4B9NA 2OZSA 4DCHA 3B0XA 1AXQA 4A62A 2BV3A 1X9MA 2WW8A 3MM8A 3NMUA 3G6YA 3KHYA 2V4JA 1NK9A 3K57A 4PAAA 3UKRB 4KPYA 3CNHA 3TTDA 4OCZA 2ISOA 3AMZA 3FEYB 4IR9A 2F5GA 2IVFB 1SQFA 4CJ4A 1SQKA 2BRKA 2HQCA 4U96A 5HRSA 3UIQA 3RMBA 1FJGF 5A0YB 4QR0A 3JAMO 2ZXHA 4C3KA 2IVPA 3RWUA 2PC6A 4MKBA 3NVVA 4A5BA 3W5ZA 1HRHA 4B02A 1DLOA 4EK2A 2CDQA 3QT6A 1MROB 2DY9A 2ZHAA 4K8XA 2KM8B 2VASA 3NCIA 1BE4A 3J81U 3V72A 3C6TA 2RHQB 1VRUA 1O8BA 2P35A 1NHKL 2NUBA 5KPZA 3TAFA 3HKWA 1QZ6A 1SJ1A 1S77D 4ZJLA 2RU9A 3JSMA 4QJVA 3H8MA 4MFCA 1GLEG 4DV1F 2ZJ8A 1MMNA 1SUQA 3FVYA 2ZWPA 4OLBA 4I6MA 1X4BA 4ELUA 3NWRA 3TX8A 2XI2A 2YKNA 3WEEB 2YBVA 5F3ZA 1MWKA 1CJVB 4K4WA 4IJAA 4L74A 3W2VB 4P7VA 5AI5A 3ILJA 4Y2IA 4G6VB 2MZQA 2CH6A 3WKBA 1X9SA 3HTVA 2M7SA 3LZJA 4ITSA 4DZ6A 1LNQA 5JLFA 2N82B 1F5BA 1UJ5A 4YG2A 5E3PA 4IO9L 3C23A 1A5XA 4ZIWA 3K7RA 5AQKA 4MMOA 1JXEA 1SV0C 3NKYA 4DMNA 4MO4A 4YVZA 3HSTB 2RP5A 1G2EA 2RDDA 3G6EN 1SL1A 2GO8A 1OKJA 3F56A 5DGBA 1VSKA 2R8HA 5AKXA 1FTCA 1TYQB 3CD7A 4ECRA 1ZM3A 4CERA 3CO0P 3KJFB 2FHMA 4F7VA 1TV6A 2UV8G 3H1QA 2V69A 4DCJB 4KPCA 1FRIA 4WF9L 1EZZB 3G2XA 2HNYB 5LJWA 2B7CB 2AA4A 5F3TA 3CUNA 3AVHA 4KHMA 1HD0A 2R7OA 1QVGR 4E7IA 2PT0A 4OQJA 2BBEA 1SJ4P 9ICJA 1B4SA 3LGNA 4FO0A 3LO3A 5ALHA 3RGIA 4UB8U 1X6JA 4JV0A 2IVYA 1RZMA 4H0YB 5C42A 5ETOA 3N6NA 4U67L 3IR7B 3DRSA 1GH8A 1W26A 4KAZA 4WK3A 3MR5A 5B0CA 2YKAA 4BG9A 2OYYA 1F3FA 4ETXA 4ANCA 4YNQA 1D8LA 3N5BA 3T1YJ 2ZJQL 3Q83A 5GAHU 3QFWA 4L3QA 5HLFB 1X5PA 2FJVA 5ALRA 1ASVA 3CJ1A 4HH0A 3CPWM 8ICPA 4DOAA 2VJ4A 2NRRA 6FDRA 4CJ5A 2FF3B 2WB1F 3M8WA 3AQOA 3NDKA 3PIOL 3KOOA 2QM1A 2JSXA 1IQTA 2CQIA 1V3SA 1XQSC 4F5OA 5AK5A 4NL5A 3WT0A 1B7YB 4W5OA 1CJKA 2MKYA 3HM8A 1ZQJA 1ITGA 3FNNA 2F3NA 2XYPB 1L3KA 1HBNA 4OPHA 4CEFA 3QLHA 2YKMA 2AJFE 1VC6A 3TKAA 4FWPA 4NLVA 2HYIB 3O9UA 2Q3PA 2OPQA 4I7FB 4X66K 3GR0A 1B0TA 4IFVB 1FFUA 7ICPA 1UCVA 3HDSA 3ISND 1DHMA 1GEHA 2P9UB 3CCLS 1ZETA 2J9DE 9ICOA 2CPRA 3B9JA 3KKRA 4QZDA 1NB2A 4US8A 2ZTDA 5JICA 3T6BA 2VL1A 1S57A 2NO5A 3FYHA 1HNXJ 3B78A 4Z7YA 4H54A 2DJWA 4A8QA 1XNRJ 3DOKA 2P5GA 4GKJK 3OTOF 3VGKA 4O55A 2AU0A 1OW5A 2QB1A 4Y2CA 3HHLC 1FNOA 2CPEA 4PHDA 4OKKA 4TU9A 1JLFB 3DXKA 2QA4N 1RUSA 3DXSX 2MKKA 4GXJA 2Q1LA 3QU5A 2GFFA 2XHWA 3EGNA 3F5EA 1IKXB 2J0XA 3I0RB 4R64A 3L3CA 4PG4A 4YXMA 4O5FA 1A0OB 4RQ5A 3JSBA 4M5GA 1T9XA 1R31A 4ZP6A 3ENBA 2ASMA 4DL3A 5AE3A 4A8EA 3M9OB 2EFNA 4TURA 2QMWA 2FC0A 4M5KA 1NMNA 2A5XA 1NEEA 2GELA 1WOPA 2OTLN 3JPTA 1VJQA 1KCFA 4ID8A 3ZDCA 4WP9A 4ZHRA 2D1KA 5IIKA 4OX6A 1NH8A 4FJMA 5LJ3Y 1D09B 1UVNA 5AM4A 2DNLA 3PKMA 1N4LA 1HBOB 4A8SA 1NGHA 4LSLA 1RDAA 3NGZA 1ZAVA 2E8PA 4JLHA 4NM2A 4L6V3 3CC4N 5HANA 1RCXB 1JLGA 2EPIA 1ZQVA 4USUA 2HAFA 4PXDA 4YR3A 2DWQA 1N5XA 4LRAA 2VG6B 1WC1A 2P9KA 1SXDA 1X31C 4IQXA 4YCXA 1UWAA 3KZBA 9ICQA 2AEMA 1N5SA 1KQQA 1OSDA 4AYBF 3VGUA 5KG4A 1ZQSA 4DFKA 1IV0A 1N5WA 4RBVA 4OHVA 2QWOA 4F3QA 2FPLA 2W54A 4JI8J 5B0DA 4X2BA 2Q66A 4QYRA 3DOLB 2V6AA 3THPA 4BCAA 3W8GA 1KR4A 2M3DA 4EUVA 1JN3A 1WACA 4ZCKA 3BBCA 2Z2MA 5HAOA 4KHPJ 2QSFA 4H4MA 4QBUA 1UTAA 3U26A 1BQNB 3UXPA 3V1QA 4KLSA 2JLFA 4RW7B 4IOAQ 4ED6A 3VAMA 2LSNA 4KBOA 5KFZA 3K1RB 1H38A 5F0UA 3SD7A 3HX9A 2BZ2A 1SC3B 4H0VB 4I2AA 1VQSA 1TP7A 3ZX0A 4BRGA 2VC0A 4E3SA 2E1PA 3EX7B 4FWQA 5KPTA 1QAXA 1VQ6S 4Y1CA 1M1KT 4QWDA 2UXDJ 4L73A 3CJ8A 4DTNA 3EE8A 2E7WA 2BA9A 3ATVA 3MECB 2YNFB 4OYMA 1YITN 3KOAA 1FKOB 5ALOA 3JQMA 2J6SA 1T02A 3SCJE 3IV6A 3VR1A 4P0PA 3CGIA 5EDWA 2P9NB 4O44B 5D0GA 1OWXA 1WEYA 1T94A 3TWHA 2F9DA 1Z6RA 4BHQA 1RDDA 3D2FA 5DG7A 2UUAJ 2F1JA 1HW9A 3L4BC 4AUKA 4BXOA 3HYFA 3FQKA 4B3SK 1F5CA 2G4BA 9ICNA 3O6QA 3HPGA 2MKSA 4ILJA 2AYBA 4C8ZA 2X3DA 1XNQF 2JZBA 1TFWA 3F2BA 5AJ3K 1QE1B 1LQ9A 4BRCA 2XI9A 1KAYA 2QI2A 1VSIA 5J0WA 4A8OA 3CJKB 2G8FA 1R27B 2O8DB 2RDIA 3ZXWA 4EP4A 2MHNA 1TK0A 1N8RT 2A41A 3ISBA 3FZHA 3ITHB 2HQDA 3GBTA 2QKBA 2MEWA 2X1BA 3VC8A 2XYHB 2CJ9A 5JU5A 4BRQA 4CJ3A 3N7PD 1TL3A 3EM1A 4NLZA 4J37A 8ICNA 4DS5A 1ZQMA 4NLXA 3BZQA 3JPRA 3C6UB 1EWRA 2R7TA 2JOQA 1VC0A 1RM6C 3T5LA 3AGRA 2CQ3A 2VH7A 5T41A 1W2BR 2C1EB 2YMQA 1N32F 3BREA 4JI5K 1R89A 4KHYA 3J7ZT 1XMOF 3RBDA 3HSGA 4PKGA 2VIHA 1GLBG 5AXLA 3TO8A 4CTAB 5G5HA 3O44A 2DO4A 1C0TA 1XWLA 1F2GA 5HATA 4JEPA 2MQLA 2E2NA 1B0VA 3HVTA 4P72A 4NEZA 1R8CA 4URGA 5F2RA 3O2IA 1NOMA 4OYZA 3MAHA 3BGLA 2WBRA 1S1WB 2V8PA 3RJHA 2F8KA 4I28A 1P27B 3ZDAA 3D28A 5GMEA 4FJ5A 3NGYA 5HVHA 2W9CB 1V4SA 1GLLO 4U7BA 2RHSB 1FCAA 4F9OA 2H9ZA 3MHYA 4YB1P 3VQ6A 3QUTA 2PIIA 1U1RA 4W5RA 1OO0B 4KGXB 3ULDA 4OLPA 2MZSA 1X66A 3QYPA 3VOVA 1LW0A 3QIPA 4K4UA 2BGGA 2QLWA 2ZFHA 3M6UA 2G08A 4FK0A 5M2RA 5IXUA 4J5OA 1RWXB 2Z7JA 3KJVB 1HUXA 3IAS9 1DGSA 3ZNUA 2DGXA 2F8TA 4CP5A 4NI2A 2EC0A 2NO4A 1N52B 3ET6A 2C3PA 1L3VA 4OKJA 3I82A 3M8QA 2CQPA 2P2CB 3SMZA 2GAGC 2GGPA 4DPXA 3ADAC 2G9OA 1JUDA 1J5EJ 2MSNA 3TW0A 4JI1F 4LRDA 4UAYA 2CVIA 5LMUF 2GQ2A 1URJA 1RZTA 3LP0A 4ID5B 1VLOA 3OYDA 2GZOA 4F5NA 1U48A 2KICA 3TU5A 3MWTA 2A2DA 4LUBA 4FVMA 5CXTA 2FJBB 2KKHA 3P4UB 5J2KA 2OWOA 2NXEA 1IJEB 2X7IA 3PUFA 5AE1A 3SMPA 4C0BA 3MXJA 1KQSR 4CEOA 3V9WA 4OYIA 3TZZA 4MKYA 4HHHA 1COKA 3V6HA 5A2QU 1ZM2A 4RW4B 3AA9A 4FWLA 3R7SB 4Y2KA 1BNOA 2HHSA 5J2PB 2C2EA 1NHVA 1VBYA 4J2BA 4L75A 4Y2QA 3O8WA 3BSCA 4PH5A 3EXYA 1Q46A 3UFCX 3Q8QB 2GVDA 1U1NA 3CCES 3TZXA 2FJDB 3D1OA 3RSEA 4K0KK 3L2UA 2O8BA 4J90A 5C12A 4U9RA 2GX8A 8ICZA 1SWVA 2P9SA 1KWMA 4DV0K 9ICMA 4GVEA 1UEUA 2DFEA 5HJYA 2KI2A 2VICA 2YNHB 3U6FA 4ZVUB 3K2PA 4BGDA 5L9NA 3A2FA 2DR9A 2ZWOA 2ZF5O 2OTJS 4DV3K 1S6OA 4M0AA 2HKEA 1CZ9A 4E7LA 3B6PA 3E9LA 2JVRA 2GX9A 4FJGA 2BQ3A 2KQ2A 4MAKA 4OKEA 1RU2A 4LRFA 1YBTA 4KN4A 1FNMA 1QAJA 2KSOB 2EKNA 4X4QA 3L2RA 1IWAA 5BRDA 2X78A 4R0JA 3CD6N 3GOIA 1HYZA 2RVJA 3M32A 8ICKA 4IJNA 1Z00A 1YG0A 2MQMA 4DFDA 3JQJA 3NF6A 1UJ4A 2P9KB 3VQEA 2CGKA 3MPVA 1HYSB 4RQ8A 3O6WA 3M6ZA 2CPYA 1HQEA 3PRVA 4IOXA 4ZVFA 1P7DA 3SQ2A 1BCOA 3OS1A 4DQSA 3BZCA 4ZOSA 1FJGJ 4H5NA 4LT6A 4PG8A 5BPCA 1RWNB 3NCQA 3V4MA 1RQNA 4B6JA 4X65K 1HPZA 1C6VA 1UT5A 2DGZA 2HVHA 4QS8A 2YNIA 3CSKA 4P4PA 4BRFA 3FBCA 3MDFA 3V9ZA 3C6AA 2UYTA 1UVIA 3BO4A 1DXSA 1WUUA 1HWJA 1VQMN 2E6LA 3MXIA 1ZQNA 5D78A 2QT7A 3DLLL 5AKEA 4DV1J 4PR6A 3U27A 5ETLA 4PQUA 1XC3A 3OJUA 1BLUA 3RJGA 1T6CA 1KOOA 5EY4A 3QAUA 3OT9A 1PJ7A 3AO5A 3BSNA 2LU2A 1LFWA 1S7IA 2HHTA 1HJPA 3UQ0A 3P96A 1REVB 3LP1A 5CH7B 4RNNA 2RDJA 2P9IB 1HNVA 4I9LA 4BRHA 3EE9A 4TYAA 1EO1A 2NLXA 3UMBA 4OJ1A 2LM1A 2RE1A 5HQMA 2JC1A 3S6EA 2RU3A 1M90O 4X5VA 9ICLA 2VQEF 1EQYA 5G4DA 3MCSA 3AA4A 5CRXA 3SQ1A 5ALUA 2D7SA 3O08A 4YFKA 2GJ2A 2F1FA 3M7VA 4LJMA 2FSJA 4KBIA 1YHQS 4KV8B 3QYYA 3CJRA 3HVRA 4P2FA 3BH7B 3GZFA 3TFRA 3ISCA 1JLBB 2P9EA 4AL6A 3SUNA 3AAPA 3OYLA 5AZJB 2IM2A 4YORA 1M5KC 1KLNA 1C1BB 2EXUA 3IM8A 4UAUA 4ZP8A 3EZOA 4QZ8A 4O0NA 3E8OA 1BHLA 1H1VA 2P9GA 4FL9A 1KD1T 4KSEB 3G96A 4MFFA 1FK9A 1X9JA 4HWIA 3VETA 4RWXA 3LK9A 3L2QA 4HKQA 1I1GA 1Q3VA 1DKGD 4DS4A 2OJ3A 5KT7A 1RTJB 2NRHA 4GV3A 1SV5B 5LMNK 1LW2A 4HI2A 4YOWA 3H2LA 4JK7A 5KFXA 2CNKB 2E5LK 5AXKA 2FBXA 3KVGA 5E41A 3D2NA 4BR4A 2ZG6A 4WYBA 1BPYA 3G25A 2AX0A 1L3TA 3PJWA 4FWRA 5FRNA 2IM0A 4ILLA 5L39A 2HRYA 1TUVA 2BCUA 2OSQA 1HQUA 2ASOA 2ZJRQ 3S3NA 2DPNA 1AB8A 1HYVA 3DOMB 3QIOA 1ZD2P 4UARA 2CWXA 2HHUA 1RT2A 5HBMB 4FS1A 4IG0A 4DZDA 3DDIA 5D0HA 5L1KA 3HD2A 3R3LA 4ED2A 4DV5F 1NGDA 3R6GB 2ZUAA 5J0XA 4U8VA 5FPEA 2BRLA 4E1JA 2OO4A 1TFYA 2AGQA 3THTA 5ALVA 4OJPA 4AF1A 3AODA 5JRTA 3WKEA 2DYAA 3CXCM 4CZMA 4FPBA 3ZEUB 3AN1A 3UVJB 1S79A 2OLWA 1RAFB 1T9UA 3ZTSA 3VQ4A 3PX4A 3LP0B 4NYFA 1JMTA 4DB3A 5KFBA 3ZD8A 4RBTA 2Q1NA 1SL0A 3MEDB 4ED8A 1U09A 2W4CA 7ICKA 5BRHA 4X4VA 1HARA 4F5QA 2BE2A 1XC9A 1S1TA 4YXJA 3RBXA 4P0QB 4A46A 2FBTA 4U7CA 4CJRA 4Y2UA 1RT4A 4G1PA 2HVIA 1SKRA 3OTOJ 1VR6A 3M9MB 1QQ6A 3KK3B 4BBYA 1JIHA 1ZQFA 4YS2A 2F63A 1KBRA 2I6WA 1F2HA 2VUGA 3EMTA 2ZOFA 1BIUA 1FEZA 2WONB 1RPLA 2ZH4A 2KKPA 2JH3A 5AQZA 3DLEA 1KQFB 3ENOA 4PKIA 2ZGYA 1AFJA 4PYAA 1IG9A 4HHTA 5CHIA 5L1IA 2Q2RA 4B1XB 2OD6A 2PFQA 1J5OA 4I56A 2PA8D 3V2UC 4IG3B 3M8RA 4LF4K 3KLVA 1G1XA 2OYQA 4USKA 1WC0A 3R6LB 1MU2B 5KNIA 3LVVA 4L76A 4PUOB 3ZZOA 4F0MA 2NUHA 3WIVA 4IYQA 5J0TA 3DLGA 4U7UD 3CE8A 1XMQK 5E3RA 3JPQA 5AQFA 4YD1A 3B8HA 3FR0A 4DUZK 3TUJC 4HAIA 4PXCA 4C7YA 2ACMA 1BD6A 4M45A 1ZD4A 4OI4A 3NGDA 2GA7A 1ECWA 4DU7A 1A9NB 3G71N 2E1RA 4ZS6A 2CNOB 2Q4TA 4A47A 2W4DA 4EBDA 2DNOA 1WNEA 5MAOA 4J9MA 4IOCQ 1YF5L 4M2YA 1BL3A 1UAXA 3ZSXA 2FXUA 1X1PA 3TTFA 3SDEA 2WTUA 1K8KB 2F1HA 2YWFA 3OYAA 5AI9A 2CYYA 1BQMA 3HSZA 3MDAA 2XHCA 4H8KA 1NG9A 2BTFA 4FK4A 1TV9A 3TWZA 3E01B 1RQ0A 2RS8A 3ICLA 3CT9A 3BEXA 3O3FA 2W8LA 5ALFA 1UZHA 4KB1A 2F1IA 2F96A 2QL7B 4CECA 4C11B 4GVLA 4YMMA 3BSAA 2W8KA 3SBTA 1PSDA 3WX4A 3KLHA 3NGIA 4LRBA 3EKSA 1P90A 2GO7A 4X4TA 3E66A 3HM9A 2V68A 3F9MA 4LF7K 3GG1A 2RT3A 4MF8A 2GW8A 3LDPA 2VBYA 1RCOB 2YNIB 3EE3A 1J27A 7ICTA 2V0NA 2BKEA 1DGJA 1X4FA 3M30A 1FWLA 2VBXA 2QB0B 4KTQA 3OYMA 4Z4FA 1F9FA 3VQ8A 5J0UA 3AAQA 1KXPA 1IQZA 1KRPA 1VSHA 2IVNA 3JTNA 3ZZYA 4RBUA 1HNIB 1SC4B 3OTQA 1FKPB 4UB5A 1VI7A 5D4NA 2DF4B 1J97A 4EGLA 2KG5A 2V2QA 1JJ2R 4ZTFA 1RBLA 2J0WA 2Q0ZX 1WC6A 2J7KA 4NLYA 2PYJA 2WVDA 1HKGA 4RQ2A 3HFKA 1WC4A 1T05B 3F2DA 2ZJPQ 3FK4A 2D4WA 3PX6A 4AL5A 3QZ8A 4O3SA 1IBLK 2KL8A 3LDAA 2GVZA 1NU0A 3P5JA 3H25A 5KFPA 3QEAZ 4KLEA 4KKOB 2EKYA 1N5YA 1JXBA 1O51A 3NVKA 4O5CA 1XU4A 3OYGA 2CZVC 3VF0B 5J1EA 4B8AB 3C1ZA 3RTVA 4NASA 1VQOS 5FP0A 1XNQJ 4IZ9A 3NXZA 2AGOA 1YZ7A 1KDNA 4ZVPB 1VQ9N 2G8HA 1K73T 2IJNA 3DLRA 1QVGM 1X5TA 5AKKA 3RZAA 4C9DA 1KN6A 1HA1A 4PQAA 2ZUCA 1QVFM 4PEOA 1OQ3A 2R7YA 3VQ5A 1R6YA 2DISA 2QYGA 3D1QA 4O23A 3ZTPA 3THWB 1RAHB 3CF5L 4NCAA 4FNHA 1SC6A 2HBJA 1S1XA 1U1QA 3UE5A 1IUJA 1S1UA 5M1FA 1FFVA 2EAOA 1WJ9A 2I5JB 4CWBA 1SJRA 5HRRA 1QCKA 5KG7A 3M2VA 5F9NA 4RU2A 3MFIA 4OLAA 4I2PA 4LF2A 3TUPA 1N32J 2E2PA 2OMLA 4HDGA 2O67A 1XMOJ 3GJTB 1VK0A 4K43A 4CLUA 3UDCA 4M3WA 4UOGA 2WRMA 2ZBCA 2VG5A 1RWKB 5AQRA 4JKFA 1R8PA 3HO1A 4LF5F 4KIAA 3PNCA 2HMIA 3PEJA 3OSNA 4EO8A 2KHVA 1PJ6A 2LYVA 3C7NA 3I0SA 2IC3A 2LU1A 4EMDA 1Z2LA 4FZLA 3V1OA 4YOEA 4ER8A 4BR9A 1PVRA 3C16A 3KLFA 2QEXS 4NMLA 3BF1A 3H7HB 5D8HB 1MN8A 4KHRA 4RLEA 1KP6A 2I1RA 1HKBA 1PJ5A 1RG6A 4Z94A 1CEZA 2MUTA 2HRTA 3A12A 2YX1A 5J2NA 3FZ2A 4AT1B 3EDRB 4C98A 4A48A 2X3GA 4LF9K 3FMWA 2IIHA 3MMAA 5J1NA 5HMZA 4CLKA 2DHAA 2KVIA 3HD1A 1X3NA 1QTMA 1O13A 3O9TA 4P2XA 2EAMA 2DR5A 1WAFA 2ADCA 4JI1J 4KFBA 2IVMA 1M1KO 1KOHA 2VC1A 1U4BA 3H2VE 3TVKA 4TU8A 5LMUJ 1ZQHA 2LA4A 1DBDA 3HJFA 3QJPA 1FRXA 1X3MA 3LP3A 5FDLA 1XSNA 2E20A 1XO1A 4JD2A 4F3TA 1XNRK 3B54A 3TX0A 4M9HA 1Q86T 1L3SA 1CXUA 5KFQA 1UVJA 4R79A 1RK8A 1HHQA 2K1RB 1HBUB 1ZTWA 1ROFA 2A2CA 4RW6B 1VIOA 1S1TB 3FZMA 1K6YA 4C23A 3P45B 2MGZB 4FJNA 1ZRNA 4C8MA 5AZIB 1X0FA 1ZRMA 3PZPA 3BEGB 1Y00A 1UA1A 3C66A 5IT4A 3FLCO 4WJ3B 2BDUA 3PSPA 2YI1A 3QSYB 1CJTB 5A8KA 2JFKA 5B08A 5BPMA 4DR3K 3GIKA 2V9KA 4MTPA 3HJVA 3O4QA 2VV5A 1N8RO 2WK4A 2K06A 4JKGB 5A2QY 1VSMA 3CFPA 1IVZA 3Q8VA 4B3TF 1LAVA 3OYJA 2BPFA 3MEGB 5CE3A 4OZ5A 4AE5A 1RKJA 1DY3A 4LF8F 2AP6A 4ZPBA 2IOFK 5HP1B 5AFUH 4QZCA 5GAGP 5AR0A 2AP1A 1Q1KA 2Z4PA 1TK5A 2OANA 5CABA 2ZM6K 1ZS6A 1WF1A 2GOLA 1T9VA 3CJ2A 2QWPA 1LWCA 2YHXA 3CQYA 2LQ9A 3DRXA 4ILRA 5AQUA 3MR2A 5E7OB 4X64F 4FXVA 3D2QA 4YB6A 4DO9A 5CA7A 3J7ZO 1MG7A 3OR1B 3N7SC 1UAWA 3M2RA 2GEMA 2A1BA 1LKYA 3M1FA 4F3OA 4BX9C 3PRBA 1W0HA 2CRLA 2G0CA 4IKAA 4JHDA 1NJWA 2P6UA 4MYUA 1G4CA 4Z4CA 1MWZA 2NRZA 1IG8A 2UUCJ 4OYXA 5JVGQ 5U47A 1RI7A 2X6NA 1Z1BA 3DKDA 2V7ZA 3TSQA 1SJFA 3Q7BA 1A7GE 1I94F 3G6ES 5GAGI 2Q0UA 2QW9A 2HLTA 1SIWB 3RAMA 1U2VA 4CJLA 1X0PA 3FDSA 4OX9K 3ZZRA 1ATRA 4KHPK 2Y9TA 1FJ7A 1ZQZA 4JBCA 4ECYA 1HMVA 2H3ZA 4LFAK 3EVMA 2IHMA 2YY3A 2ZHOA 3ETMA 3V9SA 1QTNB 3UW1A 2IS3A 4CJFA 3ALRA 1UCNA 4ANDA 2FVSA 1IBKK 1F3VA 1RBRA 4QPXA 4YOUA 4CQ1A 4NXNF 5DQGA 5KG1A 4Z4EA 2DPIA 2RH3A 2ZIUB 2WVFA 3VQTA 4F50A 4HCBA 2BDPA 3SMSA 4CIGA 1SH2A 1R0AB 1T0TV 4ISFA 1NPKA 2BPGA 2ZE2A 1JL2A 4ZVEA 4DN9A 1WTBA 4Q2MA 3C15A 2W9BA 2W7PA 3D6MB 3DDHA 1NGCA 4DWIA 5AKIA 1NZAA 4BS2A 5KRSA 3TAQA 3KG0A 4KE5A 4FYXB 3BDEA 2PN6A 1WDTA 3NMRA 4I2QB 4CZKA 2LP4A 4YY3F 3MM9A 3MX5A 4ZCLA 1DRZA 4M5DB 1FRMA 3DLHA 1YAGA 2FPKA 3W64A 3I56N 1U26A 2PSZA 4N76A 3D0PA 1XR7A 2W01A 3WXLA 4EP5A 5EE3A 5SUHA 1ZH5A 2FY8A 3SAGA 1WSVA 3GIMA 4J9QA 2JRSA 4USIA 4LF6K 2NUUG 4K4GA 4OPKA 2NYIA 4CHYA 3MUTP 3CCLN 1LXNA 1DURA 4OZ2A 1BDGA 3DNCA 1J6ZA 2VQEJ 4I2HA 2XCPA 2VQFK 4DR5F 4RUBA 1EX4A 1GLDG 5EE1A 1K1QA 3VAGA 4K8ZA 5BJRA 3HFVA 3GSIA 3HBTA 3CTRA 5F8GA 3MURP 3VAKA 2HBKA 3MFHA 3CCTA 5TKWA 5DBCA 3VQQA 3EWGA 2DCUB 5DGAA 1JLAB 4FYYB 5ALQA 1N5VA 5ELZA 2ZKUA 2JRZA 1N88A 3MMCB 2O8EA 1OSCA 2F4VF 4B9MA 4CO3A 2F7TA 3V9UA 2YWWA 4OFZA 2Y9HA 3MDCA 1YGYA 3BF3A 5KQDA 2XWXA 1PVPA 8ICLA 3QICA 4DL0C 2D6FC 2VB6A 3MTKA 2F8SA 3ILOA 2V5HG 3O0FA 2MY8A 3OL8A 4M3YA 4OHZA 3AXKA 5CAAA 4B8CA 1TAMA 1PK3A 1SZHA 1RADB 9ICRA 1KL9A 5GIPA 3FGVA 4FBTA 2FHJA 2GTDA 2NLWA 1E6VB 2HBYB 2LPEA 2QA4S 1NH7A 9ICTA 2IJFA 1TK8A 2HHPA 2W4PA 5CEHA 3ZZPA 2MLXA 2P5VA 3QNOA 4OJOA 1X4CA 2LQJA 4IBNA 3BBFA 5AQNA 1AZSA 4J9RA 3QERA 2CUYA 1E3MA 4NA2A 1ZQEA 3ONNA 5C2FA 4WIIA 2IC3B 3GFKB 5KTQA 3BB5A 3IWXA 3WC0A 3WXIA 1ASWA 3G8SA 3QGPA 1T44A 2OTLS 3FEXB 3CCMN 3WHIA 4X4NA 3RUBL 2QO3A 4DV5J 4JI2K 3U8XA 4K4XA 4O3PA 1J5EK 4N8NA 1Q81T 5EVZA 3KTQA 2BVZA 3A0IX 1JLEA 3KLIB 5I3PA 4YMOA 2E1MC 2P9PA 1Y5NB 4FK2A 1ZQPA 3CI5A 3CC4S 2XRIA 3KJQB 2FB0A 4BC7A 3J81O 5LXYA 2HFNA 1NGGA 4ILMA 3PG9A 3VQPA 3KNAA 2HNDB 4ICLB 1N34F 2BUNA 3PYDA 1NOYA 3CHWA 1KQSM 7ICRA 3MCNA 4CH1A 2DKZA 3B0YA 4BRMA 5FDLB 3CERA 5A6PA 4DTJA 3OUYA 4E98A 2VWJA 4PG6A 3MD3A 3LANA 2F3JA 1M5SA 4ENOA 1VLBA 2Z0GA 1EETA 1BA1A 3D5MA 1WOOA 3X1LB 3QU2A 1SJ3P 1IJFB 4WQ5A 1Y0HA 2GHWA 5ETRA 3JSRA 1N62A 2K4EA 1RWUA 3HOSA 4LFCF 3R1XA 4DR4K 2QKQA 4ZVHA 4J9NA 4LFBF 3U3GA 4RW9A 3VN5A 1RA7A 4OZNA 4Z6DA 2QJ3A 3WK8A 3SEIA 2XY8A 4F3MA 4KH6A 3VQDA 3DAWA 2DNYA 4EYIB 1T03B 3K5MA 3PM9A 2OPSB 2PEBA 2AJ2A 4CF4A 2BGWA 1RHRB 4DUYF 1LB2B 1S6PB 4M9JA 3LP2A 1NOZA 5IZHA 3GYGA 3OHAA 1F21A 1SZ2A 1ZQXA 4CJWA 2ZIVB 3AHPA 3QIDA 3QEIA 2JHDA 4QIWC 5DG8A 3JYTA 3VZHA 3CDAA 1X4DA 1KD1O 2C3OA 4FXWA 1YITS 2XICA 3SQGA 3R27A 1D3WA 2YHWA 3D54A 2AJ1A 4OZ3A 4A61A 5ALWA 3M6GA 2WF8A 8ICEA 2XBPA 3OA9A 4I2CA 1C1CA 4EBEA 1DK3A 4BC9A 4CZIA 2MJNA 3RRKA 1UVKA 1MNEA 3RRGA 4JK1A 1RTHA 2IM1A 5AQOA 2JR5A 1RT6B 1M5OC 3H0PA 3MMBA 4I2BA 4Y2MA 2GWKA 5DDPC 4JHDB 1TR0A 3K75D 4PGYA 3M6VA 1Z3EB 5DQHA 2VYPA 9ICIA 4B1ZA 2RMLA 5ETMA 1MMLA 4I6WA 3IRXA 3RB3A 2M52A 3A3PB 2DXDA 3ULEB 1ZQGA 2Z8QA 4MIWA 1VQLN 4F4AA 3EN9A 1RT7B 1Y5IB 5ALJA 4B1UB 3OVAA 4UAZA 2H5EA 2QXFA 2V67A 5AKZA 3NCRA 1NNDA 2CJXB 3POTA 4PL7A 1ATNA 1RAAB 4TY8B 2RN2A 3IKMA 3SZ2A 4CFCA 2J8SA 1WHVA 2V8VA 4ZCMA 3PDNA 3J80U 3HJEA 4M7XA 1WSFA 1N5TA 2FY1A 4UT4A 1MA9B 3HPOA 3DMJB 3ENWA 4JK8A 1K47A 2KLAA 2W2NP 4DV1K 2RRAA 1TUUA 3PW7A 2E1CA 4B3RK 1Z25A 4K7QA 1CJUA 4DX6A 1Q82T 1FDNA 2W7AA 4JI4K 1IN0A 2YMLA 3C1YA 1OYEA 2DH8A 2DNHA 2ZQBA 1B64A 3VF4A 3T19A 3ULHA 2E8MA 3T3FA 1NNEA 5AE2A 4CBWA 2IBKA 1NGIA 1A5VA 4BRPA 5DB9A 2JMGA 2MAXA 2GCFA 3SQOP 1OH8A 1YJUA 4BWJA 3CQ8A 4Y2AA 3C15B 1W2IA 1S1VB 3NAHA 3IBFB 4CEEA 2KHDA 2ZIXA 2V4RA 1NCLA 4WQ4A 1YJVA 2PFUA 1Q7YT 1WUDA 3KJNB 2G06A 4NEYA 3WXKA 3E3XA 1O6XA 4M5MA 2C2OB 5C24B 4UY85 4JAXA 2H51B 4BG8A 4R66A 3W62A 2G8VA 3I4HX 4ZLLA 2XZTB 1NMEB 1FJEB 4LF1A 2BE7D 5K20B 3UR3C 4F92B 1S0OA 3LA0A 3AO4A 3WXMB 1JRPA 1TELA 1TKTB 5DB8A 1EX8A 2BANA 3BGRB 2ZVSA 3UQ2A 1VDVA 3P6YC 2E7XA 3T1AA 1VJ5A 4FLWA 1CG2A 1Y88A 2KYZA 3FC9A 5H9FJ 4TSXA 3FFIB 2V51B 2QTWA 3CC2N 5CCMA 4OI2A 2KW4A 5F9LA 1PK1B 1WD6A 1Q7LB 3S01A 4GLXA 3MN5A 3SUQA 4Y0FA 5CWRA 1NJZA 4OHYA 4LH5A 4HHUA 4PHTX 3ICXA 3UCUP 2FSKA 5ADXA 3M6XA 1FDBA 5T7LA 4DL2A 2BOAA 3TRGA 3MCPA 4AQYK 4C8YA 3GDXA 1TL1B 4CI0B 1KVIA 4YHHK 4CBUA 1L3UA 5RUBA 3O9QA 1LCUA 1L8LA 4M5HA 9ICXA 1VBXA 1UVMA 1OS5A 3AJDA 1ZQAA 2BABA 2DO0A 2I0XA 3G8QA 4KLUA 1PC4A 3DWLA 3R1LA 4GFJA 3QNNA 3OBWA 3V6KA 2MQPA 1SS6A 2JVOA 4CD1A 2ZOGA 2G5HB 3THXB 3U1LA 2L9NA 2HWHA 1LWFB 4Q7AA 4OIXA 8ICHA 5AK4A 4KR0B 5BYQA 1WG1A 1NK5A 3R8YA 4FNIA 3M4XA 3CD0A 3ZYYX 3IG8A 4V19X 2CPIA 1NLKL 7ICOA 4LF5J 2BKOA 2XGQA 3I9ZA 4KY3A 4RU9A 3O1LA 3GV5B 4KMUA 1U24A 2LQ5A 3D0GE 2ZVIA 1LWEB 2HW3A 2UXCK 2CQ2A 2WB1C 2HMXA 3QEXA 2LDYA 4Y2YA 4M63A 1XERA 2RLTA 4FW1A 5C5JA 2J6UA 3VVTA 8ICVA 2HHXA 3F73A 2ZXIA 4UBBA 2F7VA 3H98A 5AHXA 1PBAA 3K5NA 4DLGA 4KYZA 3C19A 4FPIA 3EUNA 4IH5A 4KRFA 3PSFA 4DHVA 3GB0A 1U0SA 1VBZA 1FERA 4TXSA 2CZ4A 1NMDA 2K60A 4H4OA 1D1UA 5EE9A 3GYXB 3VQ9A 2B43A 4F5PA 5K4LA 4CLTA 4CO2A 1T3VA 3RU0A 3NNAA 4NZ0A 4WYWA 4QCLA 4DOBA 1QUPA 1ZQTA 1ZQDA