4DSJA

Crystal structure of fragment dna polymerase i from bacillus stearothermophilus with duplex dna, dgtp and calcium
Total Genus 186
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
186
sequence length
579
structure length
579
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical and structural insights into the fidelity of bacillus stearothermophilus DNA polymerase
rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA polymerase
total genus 186
structure length 579
sequence length 579
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4dsjA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4dsjA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dsjA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4dsjA01
4RPXA 5KFKA 3AVMA 3RH5A 4FJXA 2AJQA 3RB4A 3RRGA 8ICUA 1FXXA 1BPXA 3CFOA 3QEAZ 1NK4A 7ICJA 1NOZA 4N41A 2VG7A 2G8WA 1A5XA 3KIOA 3L2WA 2I1QA 8ICNA 4FO6A 4BACA 4E89A 4YG2A 1JLAA 2AGOA 3OYKA 1UAXA 4ZH4A 5IIKA 3VQQA 4FXDA 4IRKA 2DFFA 4BDYA 2WTFA 4FLUA 3SCXA 3OVNA 1S97A 3OYCA 2JZBA 1Z00A 3IM1A 1U48A 1D9FA 3SPYA 5KRTA 2RDIA 3QESA 1Z00B 4NLZA 3S9HA 3DI6A 3SQ0A 1L3VA 3PO5A 7ICRA 2YNHA 3PMNA 3V6KA 3L2UA 1R0AA 1RCHA 1XSPA 2FBVA 4KLTA 3ISNC 3V1QA 5SWMA 3M8RA 4I7FA 5CHGA 1Y97A 5J2IA 1TL3A 4J9SA 3AA4A 4KHUA 4CEQA 5HNKA 9ICHA 4F50A 4HYKA 4IDKA 1LB2B 2GBZA 4J9PA 3CQ8A 2W9CB 4JWMA 4CEEA 2PFQA 2ATQA 4EYHB 5EWEA 4KPYA 1N56A 4O4GA 5J2JA 1ZQFA 1U04A 2D0AA 3N97B 4KB0A 3V6JA 2OWOA 1ZQPA 1HYZA 3HT3A 2JEJA 3AO4A 4QZIA 5D46A 4M47A 3SI8A 1BL3A 4AHTA 3B6OA 3K59A 5J0RA 2E4LA 3TAMA 4KFBA 4MQ3A 3KKRA 3AVLA 3HSTB 4C8LA 1HNIA 1ASWA 1YTUA 4JV2A 4R8UA 3JSMA 4K4HA 1B22A 1HUOA 2PZSA 1V9PA 4YD1A 4DFPA 4KHYA 1JMSA 2AU0A 2IA6A 2ITGA 5KFYA 3H4DA 4YFUA 1WSFA 2XHBA 3OSPA 3DLHA 4DFKA 2ISPA 8ICVA 4M6WB 3V9UA 4O3PA 3RMDA 3OS1A 8ICYA 4GW6A 1WNSA 3JPTA 4CJQA 1UOCA 1TVRA 3SQ1A 4FS1A 1J54A 3ZSVA 5HLFA 2XGPA 2ZUDA 3M8PA 9ICNA 4K4GA 3VQ8A 4PH5A 3JYTA 1G15A 5DB6A 4KLOA 3TAGA 4NLNA 3AU6A 5DBCA 3QO9A 1BVSA 3FFIA 4PPXA 1XWLA 1LW2A 4M9JA 8ICIA 4M3XA 3ZD8A 1FKPA 3BGRA 2FBYA 4DU1A 2BGGA 4OKKA 1WAFA 4DEZA 4YNQA 4NLKA 4FLVA 4FBTA 4F5RA 1L3SA 1UT8A 3TAEA 3DRPA 2ZTCA 4AILC 3C5FA 4R65A 2KN7A 3MAQA 2ZQBA 4H4OA 3VQDA 8ICEA 3SV3A 3K4GA 1LWFA 1X2IA 2V4RA 4MEXA 2FPLA 4DSJA 1S77D 1TKXA 4PA1A 2DFEA 3NDKA 7ICIA 7ICSA 8ICFA 3N4MB 4I2HA 2F8SA 1XS9D 4FJLA 2JLEA 4I9LA 4XA5A 2VA8A 3AA3A 4DTJA 4W5RA 2X74A 1ZBLA 1NK5A 4J9QA 4BXOB 5DGAA 3MECA 3RB0A 1L3TA 1LW0A 3HW8A 2Z1HA 4KKOA 4ECSA 1S9GA 1UWBA 4TQSA 2ATLA 1C0MA 3HPHA 4MFBA 2BQ3A 3E01A 3AO3A 3QIPA 5KGWA 1IM4A 4H4MA 5BOLA 2ZTEA 4F2RA 5KFOA 2NRXA 3QEPA 5KTQA 2BDPA 2MUTA 5BPCA 3ZSQA 3G0ZA 4Q0BA 1MQ3A 5J2EA 4FLTA 3M9MB 4BWMA 1VSLA 4TQRA 4O9MA 4I2DA 3BQ2A 3AU2A 2W42A 3PR4A 4R64A 2XC9A 3C94A 3SI6A 4M9NA 5IIMA 4ELVA 4CK2A 1S5JA 5J2QA 4BE2A 1TGOA 4J9LA 4B9LA 4ECTA 5DMRA 3D0PA 3ITHA 5KFRA 1KVBA 5HMLA 4CF2A 3LP2A 1A76A 1ZQLA 4FLWA 2W9BB 4RG8A 7ICOA 8ICPA 4KLIA 1JKHA 4RQ0A 3MXJA 3M9NB 2M9NA 3AVNA 4RQ2A 4I2GA 4M45A 4NCGA 3BJYA 4E7IA 4ZTJA 4ECXA 5HRSA 1W0HA 5C25A 4I28A 1WN7A 3SYZA 2KZ3A 3LANA 3V9XA 2XY6A 5J0QA 1CZ9A 4B9MA 3MEGA 2LYHA 5KFHA 4ECWA 2W9AA 3EW9A 3CM6A 4HUGA 4C8NA 4FVMA 4YN4A 4B08A 1S76D 3SZ2A 4JWNA 4B8CA 2F1HA 4OJRA 1RDAA 4CIFA 3Q8LA 4RQ8A 2ALZA 1I39A 4CJKA 3KHGA 5IILA 7ICVA 5KFMA 3LPTA 4JK1A 4FJ9A 2BANA 3VQPA 4P4PA 1EX4A 4DL2A 4F4WA 5DDMA 3QETA 1RBRA 4DL6A 3QINA 3T5HA 4M04A 4FK4A 2NUBA 5CYQA 1ZQBA 5EWGA 4EEYA 4DL4A 3P83D 2R8IA 4CJFA 4F4XA 4KHWA 3KHHA 3DRRA 4TUSA 2BCUA 5HROA 3RJEA 1JXEA 3BQ1A 3PW7A 4CJ5A 4W5QA 4DG1A 2A1SA 3V4IA 3KTQA 3LP1A 2HNZA 5DQHA 4DFJA 3MEDA 3C6UA 3BQ0A 4IQVA 9ICTA 1J53A 1NK6A 1K6YA 9ICMA 9ICVA 4I9QA 4FW1A 9ICWA 4JRQA 5J2DA 4YD2A 2XCPA 3O4NA 2NRWA 1DTTA 4PGYA 4F3TA 3RAQA 3CFPA 4J9NA 3QEWA 3LZIA 5J2FA 3KLGA 3G6YA 1ZETA 4F4KA 5DGBA 5L1JA 5I3UA 4I2JA 1JLEA 2I5JA 4M42A 2RDJA 4X5VA 1ZQHA 1BI4A 4LH5A 1MSWD 2ETJA 3D45A 4QW8A 1I3AA 1ZBFA 2JEGA 1COOA 4CJ3A 4NYFA 3TAFA 3GV8B 2FC0A 1KEJA 4O44A 4CJ4A 3QERA 3B0YA 5F9NA 4CGDA 4CFDA 4RQ5A 3MDCA 3PMLA 5J2BA 1KSPA 3NH1A 4PQUA 1ZQDA 3P5JA 4O3SA 3KLFA 3HJFA 1Z25A 7ICGA 4BE0A 2OZSA 4CGJA 4E3SA 3AVAA 4R66A 2UVRA 2OA8A 3TAQA 2W9CA 3ZDEA 4ID5A 4KLSA 4DTOA 1JL2A 5DB7A 3FYHA 4F5OA 1VRTA 1B9DA 1ZBUA 4QZ8A 1TAUA 3HVTA 3GIJA 1KVAA 4DTSA 4DOAA 5DB8A 4ED6A 2JEIA 3KKSA 4J9OA 7ICLA 3QEVA 5DG9A 3M8QA 4YMMA 1QHTA 8ICBA 4CESA 4PGQA 4F92B 3CG7A 4PHPA 5J2KA 4KI4A 2FMQA 4RNMA 2KQ2A 2G8UA 8ICAA 9ICSA 3B6PA 4F5NA 2FMPA 7ICNA 1A5VA 4DU3A 3QIOA 1Y88A 2BCRA 2G8FA 3S3NA 2GWSA 1XSLA 3ZDDA 4RZRA 4DSFA 2ISOA 2HMIA 3KLHA 1N5YA 1NJZA 5KI6A 4UB2A 4FM1A 3KK3A 1U49A 4DTPA 3ZSZA 3B0XA 4QZFA 3HWTA 5J0XA 1ZQXA 3AVFA 5J2AA 5KG3A 1CXQA 1T05A 4YR3A 9ICRA 2KW4A 3ALYA 2HHTA 4GVMA 3HYFA 1KRPA 2VWKA 4CJEA 3F9KA 2IS3A 1PZNA 3MGIA 2WONA 4DQQA 2YNIA 3VQAA 3DRSA 2X6SA 4CIEA 1VSEA 4B9SA 4ZHRA 3RJFA 4KTWA 3GIMA 3RWUA 4NCAA 1S0MA 2Y1IA 3ZCMA 3NF8A 5IIOA 4CFAA 4ECYA 2C2RA 4R5PA 5DQIA 2VA2A 2YKMA 3MR6A 7ICEA 3L8BA 5TZVA 2Q0ZX 4RW6A 4CGGA 3IHQB 2QK9A 3I0RA 1ASUA 4RPYA 3QZ8A 2J6TA 2WOMA 3EZ5A 1IXRA 1VK0A 3MGHA 2RKIA 3LWMA 3GIKA 4CFCA 4KHQA 5HMMA 2R8KA 3C5GA 3KD1E 3LALA 4BDZA 3LAKA 4IBNA 1RT7A 1ZQYA 3TWHA 3THVA 1RT6A 2DFHA 1DGSA 4UAWA 3KK1A 4P2HA 1IH7A 4YVZA 1DLOA 3I8DA 1T8EA 2YV0X 1EETA 2E6LA 2VA3A 3UQ0A 1Q8IA 2NRTA 4XQ8A 5KT5A 5J2GA 2HHUA 9ICGA 4BE1A 2XGQA 3SV4A 4ECQA 4ED8A 5KFLA 3KHRA 4HTUA 4CHZA 1L3UA 4QWEA 2R7YA 1RTJA 4BXOA 1O1WA 2YHBA 3V1RA 4AH9A 4FJ7A 3RH4A 4ECUA 1KVCA 3SQ4A 2A1JA 4YR2A 1NKEA 4AHSA 4FJKA 3SUPA 5JS2A 2F96A 1BCOA 4KO0A 3PW4A 1VSDA 2YNFA 9ICBA 4LSLA 1C7YA 4KLFA 4EBCA 4E0DA 4FYDA 1U4BA 4EZ6A 2MUTB 3NE6A 4IFVA 1JN3A 1D8YA 4RQ1A 4ID1A 2F1IA 3RBEA 2A1RA 4Z4IA 1JIHA 1N48A 2W9MA 9ICXA 1BPDA 1RILA 3H7IA 4DSKA 4NM1A 3TR8A 3S3OA 4Q44A 3OYFA 4LH4A 4M3ZA 1TK5A 4UBCA 4EP5A 3RMBA 4Q5VA 4KLLA 3IRXA 3IS9A 4FZYA 4B9UA 4NLGA 4CGFA 3KK2A 3NH0A 5L1KA 4CJLA 4DMNA 4Z6DA 3RBDA 2V9WA 5IIIA 1J5OA 4Q45A 2DPJA 3AVCA 2X78A 1JL1A 5HHIA 4AHRA 3OY9A 4QWCA 4MFAA 5CB1A 1BI4B 2NRZA 2XCAA 4FJ5A 4I29A 3V7JA 4ECRA 2DY4A 9ICFA 2P51A 3GFKB 4M9LA 3IG1A 1WSIA 3CYMA 1VRUA 5C24A 3ZT0A 1RNHA 4E7LA 2DPIA 5KFXA 4CE9A 4IG3A 3K2PA 1T7PA 4DL7A 4CJWA 4J9MA 3IAYA 1JLQA 3OYNA 2FBXA 5DQGA 4I2QA 2P5GA 4Q8EA 2B4JA 3TQ1A 1RTHA 4J2AA 3VQ6A 4CJRA 3RH6A 1SKRA 3ORYA 5KG0A 1S1WA 3ETLA 8ICGA 5KG5A 5E41A 3C6TA 4DSIA 5KT3A 4NY8A 2RF2A 4QOZB 5J2MA 4M3UA 4FZXC 2BHNA 4N76A 1KLNA 4LZDA 4KAZA 2OPPA 3V9ZA 2HHXA 4LSNA 3H4BA 3RR8A 2HVIA 3JPNA 1EKEA 3QNNA 1ZQNA 3NGZA 3C2LA 3MXMA 2O4GA 4I2AA 4DQRA 5DKWA 1XHXA 1YT3A 4NM2A 1ZBIA 3EPIA 3L2VA 1LV5A 1ZQSA 1SZPA 4YFKA 3SJJA 4DTRA 2A1JB 3HO1A 4F5QA 4FJNA 2AQ0A 1TV9A 4KN4A 3G6XA 4CFBA 3ZDCA 4P4OA 1ZQAA 4J2DA 3PW5A 9ICKA 1ZQGA 1FKOA 1ZQQA 4YXJA 1RT1A 2ZTDA 3NHGA 1JLCA 3PX0A 3RMAA 2C2DA 3OGUA 4O5EA 4L8RB 4KTQA 8ICMA 1ZQTA 4QZHA 3F73A 3HM9A 3AA5X 1TKTA 5CZ1A 4ICLA 3Q8MA 8ICXA 1S6PA 2PXIA 1D5AA 4MF2A 4B3OA 1BGXT 3OYDA 2VWJA 4FM0A 4B8AB 3H8JA 3V7KA 4N47A 3KLIA 1S10A 4FLYA 4I2IA 4O5CA 3NAEA 2ZJAA 3MEEA 2Y1JA 2KZZA 1WAJA 3M8SA 1XSNA 2FPKA 4WE1A 5BOMA 4G1QA 1QLNA 4UB3A 3OSNA 3PUFA 4DO9A 1QE1A 3V6HA 4KRFA 3M9OB 2D0CA 5DG7A 1BCMA 1QQCA 2IAJA 7ICMA 1B43A 3ZSYA 2YNGA 4AHVA 4PY5A 1RDDA 3DM2A 2HHSA 4GXIA 5KFBA 3P1GA 4FZZA 1S0NA 3HX0A 2QXFA 1L5UA 5KT4A 3DYAA 4KV8A 3Q8SB 1X9WA 1Z3EB 1RBSA 1WCNA 4DSEA 4Z6CA 4DS5A 3LDSA 1T03A 4TURA 5J29A 1LAVA 4OKJA 2P5OA 4QWDA 4MFFA 3UXNA 3CM5A 4FLZA 4OVLA 4QZGA 5C5JA 1DTQA 3H40A 1REVA 3V9SA 2UVUA 4CJSA 4FJHA 4I2BA 8ICKA 1RBVA 3RRHA 2BPFA 4CF1A 3RJGA 5CA7A 1RXVA 2IC3A 5KRSA 1ZJNA 4F3OA 4M3RA 2AQ4A 4KLQA 3KD5E 2HNYA 2IDOA 4OGCA 1SL2A 3AV9A 4FJ8A 4KHSA 4ED0A 5J0OA 3K75D 3AVBA 1T4GA 4M3YA 4P4MA 1H38A 1CUKA 4J2BA 4O3OA 1RBTA 1QTMA 1LWCA 4KLEA 8ICRA 3SUQA 2XY7A 2B21A 4NYNA 3PV8A 1RDCA 2HW3A 3LZJA 3K5LA 1C1AA 1SUQA 3U3YA 2GUIA 4RW7A 3WNFA 1JX4A 4GMJB 1CEZA 1NJYA 3U6FA 3LAMA 1Q9XA 1CLQA 2HB5A 1KFSA 2P6RA 5KFFA 4DF4A 3OHAA 3PY8A 2GV9A 3G10A 1ZQMA 2HNDA 2Q3SA 5L9XA 1SKWA 3MFIA 4DTXA 4RQ6A 7ICTA 2B5JA 4JV1A 2BKEA 1XI1A 2YKNA 2ASLA 1TK8A 2BE2A 3UPQA 3UXOA 1KDHA 1K1SA 2D5RA 3C2KA 3WNEA 5KFEA 3Q8KA 5CP2A 3UIQA 4M9GA 4QZCA 3ZSWA 3ZSRA 4PGXA 1FK9A 4CGHA 2NRVA 2VG6A 3T19A 2KFNA 3ISBA 3GIIA 3V6DA 2ZJ8A 1HYVA 1WSGA 1B92A 1NK7A 5JS1A 2OPRA 2MAXA 3EPGA 4Y1CA 3LK9A 5EWFA 8ICQA 3DLEA 2IOCA 1X9SA 2HHVA 3TI0A 4R63A 3RJJA 2FLPA 3S3MA 4CHNA 3ULDA 1CXUA 4O3NA 1HQUA 1VSHA 3T5LA 2HVHA 5J0SA 4CECA 2ZE2A 2FLLA 5D4BA 3SNNA 2RPIA 1TV6A 1RT2A 2X6NA 2R8JA 3CFRA 4IFYA 4DOBA 3MFHA 4MF8A 1KFDA 1JLGA 5DBBA 2BCQA 4BDPA 5KFDA 3Q8RB 3JPRA 1BIZA 8ICZA 4AHCA 5C42A 1BPBA 3OYJA 4ECZA 4HUEA 4KLUA 4J9KA 3OS0A 5DK5A 2H5XA 2P1JA 4JLHA 2XRIA 1ZBHA 3QLHA 3AA2A 3PVXA 3VA3A 3HK2A 3EWAA 4RUCA 4C8OA 3V7LA 4EBDA 4KB1A 3C2MA 2HHWA 9ICJA 3GV7B 3MXIA 5KFSA 4DWIA 1ZYQA 1XHZA 4QZEA 2PYJA 4YR0A 3JPSA 5KFGA 4DTNA 1RXWA 4CERA 3K57A 5J0TA 3VN5A 3EYZA 5J2HA 4K8ZA 5J2NA 4UBBA 4PHAA 3RTVA 3DLGA 3I0SA 2C2EA 1HQEA 3HPGA 4QZAA 1QSLA 4DQIA 4DTUA 4KREA 4O0IA 4B9NA 3T5JA 1B9FA 8ICOA 3FDSA 1S1UA 3WNHA 3PW2A 4DU4A 1JLFA 2BCSA 3Q8PB 1UA1A 4FK0A 5IIJA 4FK2A 4JS4A 4EP4A 1IKYA 4RT2A 4Z6FA 1C1CA 7ICKA 2ZD1A 3TFRA 4KLHA 4RW8A 4E7JA 3C1YA 3SUOA 1S1XA 3ZD9A 1EXNA 5HHHA 4E1NA 1UT5A 1KLMA 1TL1A 1D9DA 1WSEA 4YMNA 2YHAA 5CZ2A 4QAGA 3HXMA 5DBAA 4YMOA 4FM2A 3JPQA 5DLGA 2OPQA 3V81A 3C1ZA 2HHQA 3NF9A 5KG1A 3TARA 2J6UA 4F93B 4ED3A 3AVGA 1QS4A 1MU2A 1RT4A 3RMCA 1XU4A 4ED1A 4QZDA 1ZQWA 5FRMA 3TANA 4HUFA 1W9HA 2LSNA 3O4QA 4I2PA 3GILA 4HHTA 1SL1A 3RB3A 4XUSA 4RNOA 3T5KA 1YTAA 1WCLA 3QZ7A 4Z0UA 4GLXA 4RQ7A 3HL8A 5KFJA 3AVJA 3RJKA 3LWLA 2QKBA 5CJ7A 1RDBA 4J9RA 5J0WA 4QWAA 9ICIA 4HCBA 3PX6A 4CK1A 7ICUA 4DQPA 1ZQKA 9ICUA 1JXBA 8ICJA 2W9BA 5K14A 1U45A 1UA0A 5HP4A 4EYIB 2ASDA 4F8RA 4YCXA 3LP3A 3HVRA 1F21A 3L3VA 3VQCA 8ICWA 9ICQA 1WLJA 4W5OA 5T7BA 3MR3A 3C23A 4FCYA 3PNCA 1IO2A 1EXQA 2PFPA 4M9HA 4CEFA 3QEBZ 3ZT2A 5KFUA 1S9EA 4TSXA 4M0AA 5EOZA 5KT7A 3RJIA 1ZQOA 3K5OA 4E19A 2W8KA 3NF6A 2G8HA 3GDXA 2PI5A 3QE9Y 1ZQEA 5SZTA 3ZT1A 3ZDBA 3L3UA 4QWBA 2W8LA 1ZQIA 2XO7A 2BPGA 1LWEA 4K4IA 4PUOA 2FMSA 3ZSXA 5DG8A 5J0UA 5F9LA 1TK0A 4HVJA 1IKWA 5I42A 4OPJA 1VSMA 4IQTA 1X1PA 4CJUA 1T3NA 5KFWA 4CEBA 7ICHA 4FW2A 1RYRA 5IINA 4FJGA 4CF8A 1ZQJA 3PX4A 4ELTA 4M3TA 1XO1A 2G8IA 4CIGA 5KGXA 2OZMA 3O3HA 4LZGA 5J0PA 2BGWA 2C22A 4UAZA 4O0JA 2PY5A 2IMWP 3C21A 2PYLA 4CHOA 1BHLA 3OYGA 3OS2A 2I9GA 4IR9A 4O3RA 1WSJA 4CEDA 4QCLA 3TFSA 3O3FA 3DLRA 1TKZA 3TABA 5KT6A 2JEFA 4Z4EA 4IRDA 4UQGA 7ICFA 4CEAA 2KFZA 2JGUA 4CEOA 3GV5B 2XY8A 3LP0A 1U47A 4MEYA 4OLAA 4ED7A 4IRCA 4DLGA 1NK9A 4OGEA 4RW4A 4I2FA 3KJVA 3UXPA 3DOKA 4CJTA 4RUAA 5KG6A 2Z1GA 1BQNA 1TAQA 4AHUA 1RYSA 4QZBA 2JZBB 4PWDA 1HNVA 1KCFA 1SKSA 1J9AA 5HBMA 4UB4A 4ED2A 1CZBA 3DLKA 5FRNA 4RW9A 1S6QA 3VQ7A 3QEXA 3V9WA 1RBUA 5J2CA 1ZQZA 3DLBA 2C28A 2Z1IA 2EX3A 5J2PA 2R8GA 3SQ2A 4Z4GA 5JUMA 5DB9A 1Z26A 1ITGA 3L2QA 3VQ5A 2B6AA 1Q9YA 5KFCA 2EHGA 9ICOA 3NCIA 4GXJA 4IQWA 1IG9A 4N56A 4I2CA 3OJUA 4XRHA 3PR5B 1NOMA 4RPZA 4QW9A 4CF9A 3LPUA 2ASJA 3C95A 5J0YA 5CR0A 2IHNA 8ICTA 4GC7A 4E1MA 3KHLA 4RQ4A 1VSJA 4LD0A 4UB1A 4YP3A 5KFIA 4N5SA 4DL3A 8ICLA 4RU9A 4I27A 4CGIA 3RAXA 1NJXA 4CF0A 4M41A 2IBKA 5KFZA 1HJRA 1NKCA 3SUNA 4DLEA 3OYEA 4FLXA 1BPEA 2PFOA 1HRHA 3ZT3A 2BR0A 4DF8A 4F2SA 1C6VA 4R8UB 1RT3A 3NGIA 1K1QA 5KFNA 1N6QA 7ICQA 9ICPA 3G6VA 2O4IA 3MR5A 2P6UA 1HUZA 1GOAA 4IQUA 4Z4HA 1VSKA 1U9LA 4CJPA 1SL0A 1ZQRA 3AVIA 1XC9A 1S0VA 4DTMA 2ZUCA 2ZUBA 4EZ9A 4Q43A 3NH2A 4Z4FA 4FJMA 5HRRA 3LDAA 1D8LA 4OLBA 3MABA 4FJIA 1NK0A 4M3WA 4TUQA 1C0TA 1QSYA 4KHNA 3OJSA 2FLNA 4DS4A 1WSHA 4GC6A 3ZDAA 5CY4A 2IHMA 3RB6A 1RTIA 1JLBA 1VSFA 4Y1DA 5HP1A 2OPSA 5KT2A 3AO2A 1TFRA 3ISDA 3ISCA 5CYMA 4BGDA 3JPPA 4IG0A 3K5NA 4F5PA 2Z1JA 3U3GA 1IKXA 1JXLA 3UQ2A 2F8TA 5KG7A 9ICLA 4B9TA 1NOYA 2BQUA 2VANA 4G3IA 1ZQVA 4FS2A 4CHQA 3HP6A 4KLDA 3AVHA 4RNNA 3VQEA 1MC8A 5KFQA 3QEIA 9ICCA 2IGIA 3MBYA 4HCCA 3EY1A 4QZ9A 3RR7A 1GOCA 1AROP 5L1LA 4ELUA 3AO1A 4JRPA 3NGYA 4JUZA 4M2YA 5KG4A 3JPOA 5DLFA 3ZT4A 5EU7A 9ICAA 3QNOA 3OYIA 5D49A 8ICSA 4OPKA 3PW0A 3NTUA 4KMUA 1C0UA 1ZQCA 5KFTA 4JS5A 4YQWA 1TVAA 3WNGA 3TAPA 4TUPA 2BPCA 3NF7A 1HYSA 4BWJA 3NFAA 4LY7A 4KI6A 4Q8FA 3OYMA 4C8KA 5HRNA 3HP9A 3NGDA 4CHYA 3T1AA 5FROA 1S9FA 2PFNA 3PO4A 5DDYA 4NXZA 4IKFA 3BDPA 2P66A 1ASVA 1A77A 1RZTA 3ASMA 3RJHA 4F4ZA 4M6WA 3BQTA 2F1JA 3OYLA 2OYQA 3OHBA 3H8SA 5L1IA 4DQSA 4KITB 2V4QA 3DMJA 1GOBA 4I2EA 2FPMA 4KN7A 3OYAA 1X9MA 3VQ4A 2FBTA 1RTDA 4Z6EA 4DSLA 1VSIA 1S1VA 2ZJ5A 1ZJMA 4UB5A 4KLJA 1YVUA 3MDAA 4JV0A 1NJWA 1BPZA 4DOCA 2DFLA 2BQRA 4O5BA 3V1OA 4Z4CA 5CWRA 1QSSA 4NCBA 1KFTA 1S1TA 1LAWA 4CCHA 2XY5A 3NBPA 4FBUA 1DOQA 2AGQA 5HRPA 5D3GA 2KZMA 1RPLA 3K5MA 5KG2A 4F91B 3VQ9A 5KFVA 2E6MA 4CEZA 4DFMA 2BCVA 4E7HA 4F4YA 3VA0A 4O5KA 5FDLA 3AO5A 7ICPA 1HMVA 1EP4A 1A5WA 4PHDA 3H08A 2R8HA 1KTQA 1C1BA 3SPZA 3OYBA 2RN2A 5KFAA 1NKBA 3ZSOA 3Q8QB 4B9VA 4ZTFA 4J2EA 3KLEA 4FJJA 4DL5A 3E2EA 4O55A 4W5NA 4CHPA 4EBEA 1S0OA 8ICCA 3H8WA 3O3GA 4KLGA 1SV5A 4RQ3A 2UVWA 4CK3A 4ECVA 1RT5A 2KTQA 1ZQUA 2D0BA 4O3QA 3OYHA 9ICEA 4YXMA 4OKEA 5KFPA 1HJPA 3K58A 3DOLA 1HPZA 4CJVA 4KTZA 1NK8A 4UAYA 2G8VA 4KLMA 1MQ2A 3L2RA 1TKDA 2PI4A 2DTUA 2AGPA 3AVKA 4C8MA 3VQBA 1BIUA 4PHEA 4K8XA 2QKKA 8ICHA 3AUOA 4W5TA 4LVSA 3T3FA 2G8KA 3MR2A 2J6SA 4E7KA 4IR1A 4XIUA 3GQCA 3V72A 1BISA 3HPOA 1BQMA 4RT3A 5J1EA 1IKVA 4GXKA 2VG5A 4H8KA 1BPYA 3A2FA 2UVVA 4MFCA
chains in the Genus database with same CATH superfamily
2QI2A 1VQNS 2KG1A 2ASOA 5JLFA 2FJBB 2AJQA 4JI2F 3RRGA 1FXXA 1TUWA 1BPXA 1FO4A 2RRAA 3CFOA 3QEAZ 3VESA 4OX9J 3HBTA 1UWAA 3CMAN 1IBKJ 2G8WA 2B4UA 3L2WA 4JD2B 4E89A 1NB2A 3LVWA 2VKQA 5IIKA 4F3MA 4IRKA 1T3VA 1S97A 2EC0A 3JB9k 4IJNA 1Z2LA 4UF4A 2JZBA 3FC9A 2F9TA 4EWTA 4PWDB 1GEHA 2IVYA 2W4DA 2RNEA 4CLZA 4BS2A 5KRTA 2GVDA 3DI6A 3SQ0A 2A40A 3SQGA 3RBZA 7ICRA 3V6KA 3L2UA 4ZPAA 1XSPA 2GHVC 2DNMA 3CTRA 5H9EK 2XI9A 1S12A 1TL3A 4J9SA 2VFUA 4KHUA 2EFOA 2VQFF 4IDKA 3IBCB 4ANCA 2C3YA 2W9CB 2CPFA 3F44A 4BGBA 1YX2A 1XBWA 4EYHB 2VG6B 2RQCA 2NXUA 4O4GA 5J2JA 1V5IB 3M8YA 1U04A 3N97B 1A6LA 4QPTA 4ATNA 2OWOA 1EKSA 1U1NA 4M47A 2APOA 4LR9A 3FSIA 2XMMA 3Q22A 1XNRJ 4OX6A 2VWBA 2YTCA 1SJQA 4KFBA 4OHYA 2PMZD 1YTUA 4JV2A 4HVZA 2AJFE 1HUOA 1IR2A 3QBWA 3RSEB 2WSFC 5RUBA 3KJQB 1J5EK 2CQBA 1HWKA 2IA6A 3T69A 1YWXA 2B9WA 2ZH5A 4A46A 2HFOA 4MYTA 2XHBA 3OSPA 2D41A 4DG1B 4DFKA 3CETA 4K4ZA 4CRJA 4O3PA 4Y2QA 3OS1A 4OI3A 5ALYA 2B7BB 3CJ3A 4GO7X 4CJQA 3SQ1A 1E4FT 4FS1A 2HHHF 3IM8A 4KE5A 2V51B 2XSJA 3PYDA 3NKYA 3UVJA 9ICNA 3P5TL 2M70A 2DEJA 4IQMA 2J9EA 4PH5A 1G15A 3TAGA 1ZTWA 2H9ZA 2GV1A 5FPNA 3OW2M 4A62A 2OTLS 1LW2A 3GJRB 4M3XA 1N33J 3RRKA 2FBYA 4B3TJ 4OKKA 4B3MK 1DRGA 3Q7BA 2NR0A 2HFUA 4DV7K 4CM0A 4C7QA 2QMWA 1YJVA 3W8PA 2F3NA 3SV3A 1I94K 5AKJA 4LR8A 1ZAWA 4W4MA 4U8VA 5A8RA 4A47A 3K4GA 1N5SA 1LWFA 1S57A 3GZ7A 3R7NB 5AM1A 4DSJA 3F5AA 4PA1A 1UCVA 2M2BA 3H8MA 2A10A 1HIWA 4XA5A 3FQLA 2VA8A 3H2VE 2J4RA 4W5RA 1OS5A 1NK5A 3CQYA 5D4PA 3D2EB 5IOLA 3IAS9 4IOCL 4PXBA 3QT5A 1BQXA 2GO8A 1VQLS 2RT3A 2G0JA 2XLIA 1UTAA 3EX7B 2ACYA 4CDGA 1FERA 8ATCB 1FKOB 1Z1VA 1QUVA 1C0MA 4CIOA 3E01A 1UJ5A 1P9YA 5KGWA 3PZPA 1IM4A 3DLLQ 1MMLA 2NRXA 3G71S 1MU2B 2VKZG 3T6JA 5JICA 2D69A 5LOQA 1NGAA 3KWIA 5ALJA 4AQYK 2HNZB 3AD9C 1HW9A 3G0ZA 3M9MB 5DZ7A 2ZJQL 4LF6F 3GG1A 4BWMA 3JXOA 3CCVN 1VSLA 3QUTA 4M5DA 3LGMA 3PR4A 4QIFA 4R64A 2XC9A 4PPZA 3C94A 2O8BA 3LQVA 4CK2A 2WVDA 1DT9A 4KHMA 4TU9A 1EHWA 1JCEA 2VDIA 3HMJG 2ALYB 1KVBA 4NPOA 3CCMN 1VQ6N 1E4GT 2W9BB 2AWZA 5K14B 2WZ1A 3BBCA 1GLFO 3BB5A 2EG2A 5A2QU 2YWEA 3W3DA 3WZ0A 3MXJA 2M9NA 1DQAA 2D3DA 4QQBA 3UD3P 4E7IA 3BJYA 1OQ3A 3QQCD 4ZTJA 2KHOA 2BJ8A 2JLGA 5C25A 2GVZA 4I28A 1WN7A 3SYZA 2FJWA 2Y0SF 1NU4A 4QR2A 2UV8A 3QXGA 1OQ6A 1M1KT 3KFWX 3K1RB 5KFHA 4CGZA 2G06A 4C8NA 4FVMA 4ALZA 4B08A 1JLFB 3GIRA 4OJRA 2F1FA 3JQKA 3BH7B 2E8NA 4CIFA 2WF9A 4DB3A 4X84A 3D4JA 3HVTB 2YB1A 2OANA 1RT5B 2NREA 1U7LA 1SWVA 3U1NA 2D74B 3L4PA 4NA1A 3VQPA 3TQEA 2LU1A 4F4WA 1XN9A 3QETA 3QINA 4C11B 5HMXA 2Q6CA 1K0VA 3THWA 1NNEA 4NWIA 1N32K 2D1CA 4CJFA 2E1FA 2EZXA 5B0EA 4KHWA 1M6YA 4J03A 4NLWA 4V19S 3TTDA 4KH1B 3VEWA 4NLUA 2DR8A 4EMDA 5HROA 2OYYA 2KI2A 3ETOA 3BQ1A 4JNEA 3PW7A 4W5QA 3KK3B 3IR6B 5HOOA 3BP8A 4H0TB 3LP1A 4DFJA 4C9DA 3MEDA 3QU7A 9ICMA 9ICVA 5J2DA 2XCPA 3AODA 3O4NA 5FPMA 2EH9A 3QBXA 2BRKA 1RHQB 5E33A 3P49B 3GYNA 4DV2F 4M5JA 3LZIA 5CH7B 2LQ8A 3G6YA 1ZETA 5AE3A 4J7CA 1PCAA 2I5JB 4HHUA 4I2JA 2OJ3A 2I5JA 3KK7A 4IDHA 2RDJA 1FEEA 1O0PA 2NRHA 1BI4A 2HRTA 3D45A 2P9LB 4QW8A 4JI1J 3DOMA 1TELA 4ZVQB 1COOA 3KDNA 2VGNA 3TAFA 2FC0A 2ZH1A 4ISEA 1ZPVA 3PMLA 1KSPA 3IRWP 5AQXA 5KPRA 1TU0B 4BE0A 2OZSA 3QU2A 2A2CA 4Z2XA 5FDLB 3ZXWA 4L72B 2GUPA 3G4SN 3AVAA 5AKGA 4R66A 2LPEA 2W9CA 1NDLA 3ZDEA 2IRXA 4EFAC 1JL2A 5DB7A 2CPDA 2ZWOA 1DY3A 3ZYYX 4QZ8A 1TAUA 4MYUA 4DTSA 4K0KK 1AQ6A 2R7WA 7ICLA 5DG9A 4X4PA 4LF9K 2V7YA 4FWNA 4CESA 2KHQA 1Q1KA 3U26A 3GSIA 2EZYA 2QSFA 2O6KA 2XG8A 5J2KA 4G65A 2FMQA 2NRRA 4RNMA 2KQ2A 2V67A 4ZOSA 3UE5A 1VQ4N 4CLYA 4BHQA 3L9ZA 3QIOA 2GAGC 5AJ3J 4KO0B 5EXWA 3S3NA 1N5YB 1KN5A 1RWXB 2ISOA 3M1FA 3NGUA 3KLHA 1NJZA 2G13A 3UMGA 4UB2A 2OUGA 1U49A 4IFVB 4FYWB 2ZHAA 1ZQXA 2DJWA 2LLZA 4MHVA 3JS9A 5KG3A 2BOAA 5ETNA 1Q81O 4BVPA 2BMBA 4ZVFA 1ZXIA 4ICLB 4GVMA 2KVIA 2I38A 1CJTA 1Q46A 3R27A 3H46O 1VQMS 4ED5A 2B7CB 4U7BA 3AL0B 2LKZA 1VRQC 4MO4A 2WFBA 4HACA 4C8YA 4OJ5A 3UDVA 3ZX0A 2GJ2A 2F5GA 3VPZA 1SH2A 1W2BM 1C20A 4HACB 4B9QA 4DV2K 3RJFA 3DXSX 3R97A 3GIMA 1S0MA 3CXCR 3NF8A 3HFZB 3ZZRA 3ZCMA 4CFAA 5F3ZA 3AFGA 5DQIA 7ICEA 5A8WA 5A0LA 3L8BA 1QQMA 4DR3F 3IM9A 4DU7A 3IHQB 2XMUA 4Y2PA 4NCGB 2QK9A 3EWGA 4NI2B 2J6TA 1ZXOA 2Y9TA 3EZ5A 2KIVA 4PQUB 2RKIA 4CYUA 3GIKA 5E7OB 3TX8A 3KD1E 1U8WA 4PXEA 1RT7B 2HQDA 5AQQA 1X6JA 3AQOA 1RT7A 4KY3A 1KVJA 2HHPA 4X4QA 2DFHA 4DZ6A 3WKBA 5IXUA 1DLOA 2YV0X 1NHUA 5AI8A 4C0ZA 3KK1B 2E6LA 1N32F 2CWXA 2NRTA 5J2GA 1Q8IA 2HHUA 4BE1A 3SV4A 3UR0A 3AM9A 1XEZA 5LT5A 2KJ8A 3O80A 2R7YA 2EFQA 3EE9A 3DDNA 2YHBA 2P35A 1KAZA 2G07A 1S5ZA 3L3FX 4FWPA 5CD4H 1QAIA 2C2OB 2CZ4A 3SUPA 1LQ9A 5JS2A 2V94A 4LSLB 4MIWA 3W9JA 3FZBA 4KO0A 1VSDA 1NPKA 2YNFA 1VQ7S 4DV0F 3LP1B 3RF9A 1VQSA 1U4BA 3FGVA 3V5RA 4CI6A 3NE6A 2CPYA 1D8YA 4RQ1A 2F1IA 2XMJA 4N8OA 4KSEB 4CD3A 2DNPA 1N48A 2JXJA 1S6OA 3I9ZA 4IJAA 2NO4A 1RHJB 4AD6A 4NM1A 3TR8A 1IN0A 4LH4A 1LVHA 3OFHA 3BR9A 3OXFA 4JB8B 2R18A 1TVRB 1AYEA 1F1BB 4KLLA 2GMLA 4JD2A 4FZYA 4NLGA 2H65B 4B3RK 4DMNA 2V9WA 2GEMA 5IIIA 1J5OA 3QBCA 3SMPA 3AVCA 4AHRA 1SS6A 4QWCA 2ZF5O 4PABA 1T9VA 4BCAA 2XCAA 2VPYB 4YN3B 4I29A 2UUCK 8RUCA 5AT1B 3W62A 4FXWA 2HOIA 1TL5A 2DY4A 2P51A 3GFKB 4NLRA 4M9LA 1WSRA 4NRTA 1I3OB 3ZT0A 3UDCA 3KZBA 2DPIA 5KFXA 2ZZTA 1G6BA 3ISZA 2E66A 3TUIC 3K2PA 2WC9A 4RW9B 2CFXA 1SQKA 4DL7A 5A2QY 4CJWA 4CZJA 3FEZA 2ABYA 4I2QA 5HR7A 3O8MA 3TTFA 2UXBK 1IBLF 3GTYX 1XNQJ 1NJIO 1S1WA 1HNZJ 4NA3A 5KG5A 3C6TA 2N4DA 2E2NA 1EP4B 4GKKK 4QOZB 5J2MA 3HSZA 2KG5A 3L5KA 1X5TA 1FDAA 2HHXA 4LSNA 2XVTA 2UU9K 2HVIA 2N4CA 4OI0A 3QNNA 3IN5A 2K4EA 3ADAC 1M90O 1ILYA 4C7ZA 3X1LB 3VZIA 5DKWA 2K4IA 1XHXA 5F8MA 4NM2A 2IYIA 4BRKA 4H0XB 1SZPA 2I7NA 3SJJA 3CRXA 3HO1A 2AQ0A 1TV9A 2MPUA 2HSTA 1M5KC 1FTRA 4C4TA 4A5AA 5IM0A 2ZJRL 2MSNA 3D1HA 1VDVA 1KOHA 1RWUA 4USKA 3TA2A 1RT1A 1JLCA 4USJC 3RMAA 1Q82T 2NZ4A 4O5EA 3S41A 3H2LA 3PIOQ 3SMZA 1ZQTA 2H3ZA 1A6SA 4A8WA 3F73A 5AKZA 4DV0K 3M7DA 1NH8A 1Y4ZB 4NLSA 4W90B 4UQTA 1UVKA 4F0KA 5GAHI 4DCCA 1WUUA 2XTJP 4MF2A 3OYDA 2VWJA 1VQOS 3O5TB 1URNA 1CLFA 2FGCA 4FLYA 4DUYK 2KDOA 3NUQA 3AOAA 3NAEA 3D66A 1P7DA 3O9UA 2HQFA 2R7QA 1AUDA 4WCEL 1A7GE 3JYTB 3ATVA 1OVYA 4LF6K 1VQ8N 2FPKA 4ETXA 3OSNA 4USAA 3CXCM 1YJ7A 4KRFA 1SCJB 4LBPA 1QQCA 5D0GA 3CCJN 2IAJA 5CQGA 5M1OA 3ZSYA 4AHVA 2PFUA 1IBCB 3LGNA 1HHSA 4FO0A 4CF5A 4LF8J 5IT9U 3EUNA 3J80U 3P1GA 4WJ3B 2QXFA 4DV6F 3F2DA 2V8VA 4F71A 3NCQA 3Q8SB 3O6QA 1X9WA 1CG2A 2UUBK 1DRZA 3KUGA 3HLUA 2D3OR 4LBIA 4XH1A 3LDSA 5AQIA 2RRDA 1Z05A 1LAVA 4TNOA 2RF2B 3QAEA 3BPSP 3EXYA 4OKJA 4OVLA 4QZGA 3L7PA 3GYGA 3MF5A 3H40A 3V9SA 4FJHA 8ICKA 1RBVA 3RRHA 2BPFA 5LJ5Y 3FCHA 4CF1A 2KHCA 2RQ5A 3BS7A 1Y3KA 2W2PP 4U7UD 1O6XA 1IUJA 1ZJNA 4F3OA 3E3XA 4KLQA 2EAMA 3MMCA 2IDOA 3IMXA 2IMOA 4FVCA 4DR2J 2NCKL 4J5OA 5AZIA 1RDWX 3AVBA 2M4MA 2V8HA 4C7YA 1T4GA 4M3YA 4J2BA 2EKYA 1RT1B 3IBFB 4AQYF 3MZIA 2Z4PA 4QYZK 4N8NA 8ICRA 3I55S 4IKAA 4YOWA 1RHMB 2FZCB 5B0AA 2XY7A 3NXZA 3VAJA 3BGUA 2PGCA 4TKTA 1WOQA 1R8PA 4FL9A 1VQ7N 4ZCIA 4JI7K 3BN4A 1YBTA 4P52A 2ZH9A 2E5GA 4KT0C 5CYJA 5H1SV 1RAJA 2I1RA 5C0YA 2GUIA 1FNMA 4RW7A 3RW6A 1URJA 2HBJA 1UEVA 4USTA 2CDQA 1WDDA 2CQCA 3M2VB 1KXPA 2HB5A 1KFSA 2D3O1 1PJ5A 2HBRB 2A6MA 2YWFA 2DK2A 3MCPA 2VBZA 3PY8A 5K8PA 1SAZA 2HNDA 3VGVA 4DR5K 1HW8A 2IRUA 4OYAA 4I2QB 5M1FA 1NG9A 3D6MB 5EX0A 6AT1B 1I1GA 1Y64A 2UZAA 1V4SA 2YKNA 4NMLA 2ASLA 1NBEB 4Q7AA 1UPMB 1FRJA 4JHDA 2KL8A 3KBBA 4JYAK 2KXFA 4NLTA 5GTIU 3UIQA 2B8QA 2LDIA 2CQ3A 4GKJK 2NRVA 2G5IB 3FNNA 3AB2B 2WSEC 3T19A 3ISBA 2KKPA 3TEHB 1FK9B 1VRTB 1SJRA 2XLKA 1WSGA 1B92A 5JS1A 2OPRA 1MN9A 3DRYA 3VENA 4R63A 1V38A 1CXUA 2P9IB 2DYAA 2HVHA 4PR6A 2ZE2A 4LF9F 4TVAB 3S6JA 1BG3A 3SNNA 1ZD4A 3ZZPA 2G4BA 4LRCA 1G2EA 1RT2A 2J0QD 2B3TB 2A0FB 1DGJA 4JI7F 2NLWA 2MYFA 2DL0A 5EN1A 2V2KA 4EELA 2EG1A 2BCQA 4RR5A 4C1NK 1RLCL 3CJKB 2K7KA 3EEQA 1HWLA 1TFWA 1TKZB 5GTHU 2X3GA 4BRLA 4P75A 3OYJA 3VEOA 4HUEA 2POKA 2QZ8A 2HG4A 4DQ8A 3OXGA 4F36A 1U24A 2P1JA 2MB0B 2XRIA 4H5NA 3QLHA 3HRDD 2UV8G 2LHTA 1F44A 2K4PA 4BGAA 3J7AP 3GV7B 1EQMA 1ZYQA 2HAIA 4NL9A 4KYZA 4Q2LA 3JPSA 1RXOB 4DTNA 5IV4A 3K57A 2RJZA 1VCTA 4OQJA 2HYIB 2F9JA 1HNXJ 3WUHA 2VQFK 2W11A 1VQ8S 3IKMA 3I0SA 3MURP 4QZAA 1QSLA 4DTUA 3WK4A 1YLXA 4O0IA 2UXDJ 4BRGA 4B9NA 3CCJS 3AHPA 3CT9A 3M8WA 2P8IA 4EGLA 4ISFA 4IH6A 3PW2A 4KRWA 1YF5L 2EBGA 1IIPA 3DCAA 4PKGA 1QAJA 2BCSA 1XQSC 3ET6B 3PHTA 3CD6N 5IIJA 3CW2C 4JS4A 2BX6A 1AT1B 3UFCX 2IDLA 5AQTA 3TFRA 2CPHA 4RW8A 3CD7A 4E7JA 2K3IA 4ES3A 3OVBA 3KZXA 2DH8A 1BA0A 2MSSA 4E1NA 5JVHL 1BMQB 3R5JB 2YQEA 2XZDB 2P9IA 3HXMA 2R2TA 3QGHA 2RRBA 4ZPCA 4FM2A 2OPQA 4DCHA 3V81A 2M8DB 3C1ZA 2MJUA 3E01B 3UB5A 1R6YA 4F93B 1FD2A 3QU9A 1FA0A 3AVGA 1ECWA 2B9YA 4IOAQ 2QYCA 4JI1K 2PIIA 2CQ2A 3LTOA 2WB1F 5HL7L 1T6DA 1W9HA 2ZDPA 3AQPA 2O8DB 3W2VA 2HVDA 3GILA 2F9WA 1SL1A 4ZLNA 3NNAA 4XUSA 3PTWA 2ZVSA 4JAXA 1JUDA 4M8LA 1VC0A 5ALWA 1VQYA 4GLXA 4RQ7A 4OCZA 5BR9A 1VQPN 3LWLA 5I4MA 3M6WA 5AKEA 3A8JA 3PYGA 3RJMB 4QWAA 1X4CA 2V5HG 3HDSA 3C8YA 3PX6A 1NZAA 4CK1A 7ICUA 1UJ4A 1SVDA 1ZM9A 3VGKA 4DQPA 2F8HA 1PAEX 3AQFA 4EYIB 2ZM6J 3LP3A 3N7PD 4KH6A 3N5FA 3L3VA 2B9XA 1OIAA 1RWWB 3FSYA 1GH8A 1VRUB 5AR0A 2DY9A 5ALUA 1GLEG 2O8CA 2MZRA 4NWBA 2ZM6K 5IC6B 3DYAB 4CH7A 3H3OB 5ALKA 1G3OA 3PNCA 1IO2A 4DPTA 1X4EA 2RKIB 4A8QA 5J2PB 4OI2A 3UI3A 3UO0A 8AT1B 4TSXA 3RJIA 3A1YG 5HVHA 2RILA 3NF6A 2Q1NA 4PKIA 4FFDA 1F6TA 3MN9A 3D6JA 3HD2A 3HHEA 1FCAA 3ZDBA 3D6RA 2FLOA 5GVQA 1RADB 4NYPA 4PUOB 1N60A 2XO7A 1LWEA 1KQSR 5J0UA 2VJ4A 1IKWA 1VSMA 3M8ZA 2VPZB 1X1PA 5EX3A 3S8SA 2DY1A 7ICHA 3QU5A 4DI6A 1Z6RA 4FW2A 3BREA 3HHLC 1M1GA 4QR0A 2J8AA 2Y3YA 4CF8A 3PX4A 1HQUB 1WWVA 2EC2A 1VQON 1HARA 4M3TA 2P9KB 1CC8A 3LVVA 4PG7A 4HR2A 2CQPA 4UAZA 2J0XA 2IMWP 2PYLA 2YJEA 3S01A 1GTHA 3VAKA 3R8EA 4XPEA 3TPQA 4NRUA 3ENQA 3EL2A 4PWUA 2I9GA 4KGXB 4O3RA 2IVPA 4QCLA 5ETKA 2I6XA 4RBTA 4NXMF 3UDEA 3TABA 5KT6A 1D4XA 4CZFA 3TADC 4CO2A 4UQGA 7ICFA 2V7ZA 5AQNA 4CEOA 3T6BA 4DUZK 1U47A 4IRCA 3OL9A 1H74A 1DJ0A 3KJVA 3IV6A 3DOKA 4CJTA 4RUAA 3L09A 2BOPA 1O51A 3L7UA 4RNFA 2Z1GA 4IXCA 4CBUA 4CE6A 4LREA 4PKHA 1IBLJ 3KWGA 1WWHA 1P9QC 4HEA9 1KCFA 2ZIVB 1SKSA 5HBMA 2VHGA 4UB4A 1S6QB 4ED2A 4H5RA 1KHWA 2FVPA 5BREA 2MQMA 3TP2A 3FRZA 4D3HA 4YY3F 2Z1IA 2EX3A 4Z4GA 4PL2A 4BREA 3NCIA 4I2CA 5A0YA 3T9NA 1S1UB 4LIRA 4C80A 3O1LA 1HR0F 4BQLA 4UB8U 1L7PA 5J0YA 4GC7A 4MAKA 2WVFA 3KHLA 2WF7A 4OIXA 3MECB 5KFIA 4PG4A 4RU9A 4CGIA 3I5BA 3RAXA 2VB6A 2FVSA 4RQMA 2CPIA 3CMES 2IBKA 3SCIE 4M41A 5KFZA 5D4OA 3J81O 3QWUA 1HJRA 2Y1RI 3OTCA 3SUNA 5LXRA 3OV7A 4G1PA 2PFOA 3ZT3A 1M5PC 4F2SA 3AGRA 4R8UB 3MUTP 3WU2U 2EK6A 2OMLA 2AA4A 5KFNA 2KXNB 1WNEA 2MKCA 3U4LA 2OSQA 4H03B 1JROA 9ICPA 5DETA 1GFWB 3HFKA 2ZBQA 4ZVPB 3C7NA 2P6UA 1HUZA 2HVEA 5HMYA 1S4FA 1KONA 3CJCA 2BZFA 1CJKA 3TOQA 1KDNA 1ZRNA 1W26A 2WCXA 1Q7YT 4EZ9A 4FWKA 3VF6A 1ROFA 3CJ2A 4ZP6A 3M8PB 3H0LB 4X4OA 5IQQA 4K25A 5HRRA 3D1OA 2UUAK 3ENBA 2RS8A 3EGZA 1CJUA 3TNVA 3UD5A 2QLWA 2R7UA 3FVYA 4QIEA 1DK3A 3UN5A 4E2FB 4CT8A 2NXNA 1B64A 3EKUA 3R6GB 1KKXA 3A5OC 3VETA 3ZDAA 2F8MA 5CY4A 1VFJA 3RB6A 1QVGM 1X31C 1JLBA 3QFPA 4FNIA 1RWVB 2E8AA 3AB4B 5BRDA 2ZH4A 2BM0A 4JI2K 1ZM3A 2OPSA 5KT2A 3AO2A 5D15A 3ISCA 5AK6A 4LRFA 1CVJA 1IKXA 4CQ1A 1PO6A 1MA7A 1XMQK 4OD0A 4CNYA 4EFHA 2BQUA 5B7WA 2Q36A 4HAIA 1ZQVA 2M9KA 3DDKA 3HP6A 1MC8A 3TX0A 9ICCA 3MBYA 5BRFA 3ULHA 3EY1A 4M95A 4QZ9A 4CO3A 2G5HB 4IQXA 5L1LA 4RX6A 3DOLB 4DR1K 4JRPA 3SQIA 1SQGA 2FVQA 3BPDA 3M2UA 5EU7A 1S7HA 2MLZA 2WAQF 5D49A 2UXCJ 3P96A 3M2UB 1PILA 2P9KA 3N79A 2Q31A 4OYBA 2NUHA 3CC7S 4ERDA 4KMUA 3UD4P 1ZQCA 4NLPA 1X4BA 5AI9A 2YMMA 1TVAA 4ZPWR 3PJ9A 2DXEA 3TAPA 2O8FB 3OUYA 4BWJA 4FPRA 2KKHA 1RKJA 3OTOK 5H1SQ 1TL7A 5DDYA 1IG6A 2YI1A 4NXZA 3WHIA 3C2PA 4PWWA 1YJ9S 1NM2A 1RZTA 2B4OA 1JALA 1MMDA 5TISU 3QB0A 1SUQB 1M90T 2F1JA 4DR4F 2GWKA 4M5DB 3GSDA 2V4QA 5D77A 2KRRA 1HKAA 3KLIB 4I2EA 2AZ3A 2FPMA 2NQPA 1MN7A 4MIBA 3OYAA 3VQ4A 2R7RA 5KL8B 3D54A 2KB2A 1UFLA 1VSIA 3UMCA 1T9XA 1S1VA 1ZJMA 3QWPA 4KLJA 4JV0A 1NJWA 4O5BA 2DFLA 2BQRA 2DPNA 2XZWA 2RDDA 1X4FA 2P9LA 5CWRA 4NCBA 2FY1A 1UVIA 1S1TA 2QO3A 2ZJPQ 1CQNA 2GC8A 3NBPA 1YHQN 3BS9A 3DLKB 2NXCA 4JKBA 3MWTA 5HRPA 4ZS6A 2KZMA 4UOCA 2RQKA 1RPLA 3F2CA 1WBDA 3GFZA 5GADP 1UZHA 4JI8K 4U67Q 1IVZA 2YY6A 2E6MA 3WQTA 4E7HA 3VA0A 2EQYA 2YMPA 7ICPA 4ES2A 3MCMA 1FDBA 4DV4J 2IIHA 2Q0UA 1KTQA 1C1BA 3HZ6A 3SPZA 2RN2A 4WIIA 3ZSOA 5A0YB 4ZTFA 4J2EA 2N82B 3G2XA 4NLOA 3CCQN 3H8WA 4CK3A 2UVWA 3ISND 3H20A 1RT5A 3UQSA 2HBZB 1Z4OA 4O3QA 2G0IA 5HL7Q 4DX5A 4JI7J 5BN9A 3CPEA 9ICEA 1WJ9A 2LMRA 3C0BA 4KGVB 1LW0B 3ULEA 4X62J 4KLMA 4Y28C 1TKDA 2GMHA 2FY8A 2P9UA 4BC7A 2EZZA 4A8MP 2PC6A 4C8MA 4KHRA 3VQBA 1M5OC 3C15B 4NYZA 1RT3B 1KN6A 3V81B 4LVSA 2G8KA 3MR2A 4P72A 2EANA 4H0VB 1FRXA 3V72A 1BISA 4TLQA 5EHHA 2G9OA 1SQEA 2NPIA 4C3MA 2CQ0A 1ICEB 4RT3A 5AM0A 3FJ2A 2FJAB 4RPXA 3FGUA 2HQCA 3ZZZA 1ZC6A 3I6PA 3RB4A 3M3ZA 8ICUA 3CCLN 1B70B 2ASPA 4YY3K 2CPRA 1MMNA 1KD1T 7ICJA 1YI2N 2NSCA 1FJEB 1QVFR 5HVFA 1VQ9S 4FO6A 4URGA 4BACA 1N4LA 5E0OA 1FJ7A 3H0MB 2MQLA 4ZH4A 4FXDA 3VVTA 3VQQA 1WACA 1IV8A 1FRIA 2KJ9A 3MN6A 3SCXA 4QNLA 2B4PA 4ENOA 1U26A 2W2OP 1Z00A 4MK9A 3IM1A 5AM4A 1D9FA 3SPYA 3NGSA 1FWKA 1Z00B 2QARB 2WBNA 3S9HA 3IDWA 2DKOB 3CCLS 2XS7A 3IG1B 1WHYA 2FDNA 4CM2A 2JC0A 5T7LB 3W3SA 2CDRB 2OH2A 2GWJA 3PO5A 1VQ9N 1RAIB 4DUZJ 4IZ9A 1N8RO 5SWMA 3M8RA 1NGBA 5CHGA 4O8KA 2W7PA 5J2IA 2GCFA 3AA4A 1SZHA 2AYGA 3A8KA 3R5BA 1XQIA 1KNZA 3CDWA 2I6WA 2WB4A 3W64A 5B5EU 3CQ8A 3N6LA 3CCTA 2HOQA 2MGZB 2PFQA 3VC8A 2ATQA 2JFDA 3MC1A 4KPYA 1N56A 2QWQA 3POTA 4YOYA 2BABA 3V6JA 2X1BA 2CG8A 3WKAA 5C2GA 1G99A 1HYZA 2JEJA 4OJOA 1NRKA 1S1XB 2QG9B 4K4VA 2W01A 3I1YA 4JI8J 2E5HA 2QLXA 2L08A 2N7CA 2E1RA 5J0RA 4FF1A 2E4LA 3TAMA 3GDQA 4LF4K 1R8HA 3NP5A 1HNIA 4ZOHC 4F72A 1HNIB 2B6GA 4K4HA 1B22A 5GAHU 1GTEA 4DV1J 2PZSA 2VZ9A 2F4VF 5KOWA 4DFPA 2Z2LA 3QAUA 4KHYA 2DR9A 2ITGA 5KFYA 3C6AA 4IOCQ 3UKRA 4YFUA 4X65J 1WSFA 2NS1B 5DDQC 1NGIA 3DLHA 4KX5A 1BY9A 3UPFA 2ISPA 3E8OA 4M6WB 4DV3F 2OEHA 3RMDA 3SCLE 2RH3A 4ISGA 4Y2VA 2WVBA 1X0PA 4ZCLA 4DV5K 3BS5A 1J54A 2HDOA 2E2QA 3NCPA 3TVZA 1CJTB 1V85A 1LK7A 4GNIA 3DMJB 2C3OA 5EOYA 2HGLA 4F7VA 2XYGB 5DB6A 1VIXA 3AU6A 4FPIA 3FFIA 2QL7B 1S59A 2GLEA 3PSTA 2MZ1A 3TYTA 2IA0A 1XNQK 2RVJA 4DHVA 3VEVA 3ZD8A 5T7LA 1FKPA 4Z37A 4F0MA 2HFZA 1WAFA 3I31A 3LF0A 4CVNE 4FBTA 4F5RA 3TAEA 2K8GA 2VASA 4I7FB 1FVQA 2BJDA 1Q7LB 4H4OA 5C10A 1ZTTA 2UUCJ 1T03B 4OYPA 1VHIA 4P2FA 1EB0A 3SJHA 1RGVA 2HCFA 3ELHA 2R7SA 2BKOA 2V4RA 4MEXA 1CQMA 1Y10A 2VIHA 4ZVEA 3G8TA 2JWNA 2A6AA 5D0EA 8ICFA 2DTJA 1XS9D 4FJLA 2JLEA 3M8QB 2AYBA 1Z19A 2FJEB 3M4XA 3AA3A 4DTJA 4AT1B 4KH0B 2GGPB 1ZBLA 4BRIA 4J91A 4UZBA 5DGAA 3I56S 1UMJA 3CJ9A 1L3TA 2HQGA 5CYQB 2F7TA 3HW8A 1IBKF 3EDQB 4XPCA 3TW0A 1S9GA 2E5LK 5KQ8A 4TQSA 4FYYB 1QHAA 3SDEA 2R2UA 3RGIA 1FNXH 4NMXA 2FD2A 1LKYA 2P9SB 4H4MA 2JJ4D 1GLJO 5BOLA 2ZTEA 4F2RA 3VGSA 3QEPA 1SC6A 2MUTA 3KKFA 1RCXB 3K0JA 1F9EB 1F5SA 4UASA 4QS8A 3UCUP 2E5IA 4BG8A 1H2UX 4OMFG 3DDHA 3I56N 1JNRB 1VQ5N 2KVCA 3O0FA 1VJQA 4RO0A 3C65A 4JBCA 4TQRA 2LEPA 4I2DA 3BQ2A 2P9GA 4BC3A 3LYSA 2CZ9A 1O8BA 4RW4B 1S5JA 2FSKA 2BJ9A 5J2QA 1RTZA 2VQFJ 1TAMA 4ECTA 5DMRA 3ITHA 4K4XA 3GONA 1X5SA 5HMLA 2GNKA 2HHHK 4OZJA 2KFYA 2KG0A 3NS6A 1JKHA 4RQ0A 1LNQA 3G86A 1QQ6A 2CJYB 3M9NB 2L41A 3AVNA 4M45A 4I2GA 4ECXA 2CG4A 1W0HA 1LKZA 2KZ3A 5DM6Q 1TL3B 3SBGA 1PAUB 2E9RX 3V9XA 1RUSA 2YKPA 4UAUA 4B9MA 2L3MA 1C4CA 3MEGA 2B8PA 2W9AA 2CJXB 3EW9A 4HUGA 3HVWA 1DTQB 4YN4A 4CLSA 3SZ2A 3M6KA 1U0HB 2FSJA 2ADCA 3AXKA 3AD8C 3GCWP 1RT6B 5F8GA 1N61A 4CJKA 1SJFA 5KFMA 2Y0SC 1C4AA 4UT4A 4WFNL 2A3VA 1HKGA 2DQNB 2CRLA 1RQLA 4P4PA 5ETSA 2CNNB 4DL6A 1KD1O 3TWZA 3B4MA 4YB7A 3T5HA 2W7OA 4HT5A 2NUBA 2K8CB 5CYQA 2BM1A 1ZQBA 2HHHJ 4EEYA 2GS8A 1WKJA 1X4GA 4L73A 3HZGA 1XNSA 1Q8KA 3MMJA 4CLKA 1N34J 3KHHA 3NGTA 2RE2A 3I28A 2Z7JA 4TUSA 2BW7A 3OTEA 3QJPA 4L3KA 4RNHA 4CJ5A 3FEXB 1X4DA 3KTQA 4MMOA 2HNZA 4CZMA 4XDDA 3C6UA 2E8MA 4IQVA 1CC7A 9ICTA 3V4IB 1J53A 2GELA 1NK6A 3OL8A 4O23A 1K6YA 1X6IA 4WFBQ 2E1PA 9ICWA 1T05B 2VF3A 1DTTB 2AKWB 1OW5A 2G08A 1UFWA 3H98A 4A8KA 3QJLA 3RAQA 2V0NA 3THYB 3QEWA 2MA1A 2ROGA 3QO9B 4PZVA 1X5PA 2IHR1 5DGBA 3CIPA 5I3UA 3FEYB 4DR5J 1VBZA 4M42A 4X5VA 3MPYA 3T1YK 1ZQHA 4IEIA 2MHEA 2DR5A 3HKZF 2VPXB 2BKNA 1I3AA 3G8SA 2UUAF 3AOCA 4HKQA 4ZIWA 2F44A 4PKDB 3R3LA 1R0AB 3NH1A 5JMNA 4O3SA 2H3GX 5ALHA 5EE0A 4PL8A 1Z25A 7ICGA 1RHKB 2FI1A 4E3SA 3HKZC 1KEKA 4ZLJA 2YB4A 2BJ1A 5ETOA 2HPUA 4ID5A 3OLBA 4N7TA 1VR6A 5AKHA 2QFIA 3Q2SC 4F4AA 1G1XA 1V9OA 3FYHA 1VRTA 3Q89A 1U1OA 3PKYA 4X4RA 1GMVA 4IWVA 4DR1F 5ALMA 4X64J 1KVAA 1ULRA 1IG8A 2Z2MA 1FFVA 1DARA 5A6WA 2JNJA 3QEVA 4DHYA 4PGQA 4F92B 2K60A 2ZWPA 4ILGB 4CH0S 3IBWA 4KI4A 2DGTA 3KLVA 2ZHOA 2DNQA 3B8AX 4YOEA 1WELA 4F5NA 4Y0FA 3FR0A 4U95A 2ILZA 3D9BA 5CZVA 1A5VA 5AZIB 4DU3A 3J81j 2BCRA 3EZUA 5TKYA 3KLHB 3ZDDA 4RZRA 1UCNA 2Q79A 1N5YA 5KI6A 4URQU 3LUYA 3NNCA 3TTCA 4FM1A 1G4CA 2ZEJA 1KBRA 3ZTPA 4UAVA 2HOEA 1FWLA 3AVFA 3L4QA 2QTWA 3C7NB 1CXQA 2IOFK 2U1AA 1TUGB 3EMTA 3IR7B 1L8LA 2KW4A 1SIJA 2B0GA 4X2BA 2DCUB 1NGGA 1LFWA 3KG0A 4CJEA 2VG7B 4P9SA 1JJ2M 3Q8VA 1SZ2A 3MM9B 2IS3A 2FF6A 2P2CB 3KJFB 2WONA 4H4KA 1I94J 5GAHP 2YNIA 5JLHA 5I3UB 4CIEA 3JAMO 4B9SA 1T94A 5K5MA 3GE1A 4BVOA 4KTWA 4G1QB 1ATNA 3RWUA 2YNGB 2Y1IA 3D3CJ 3QMQA 2C2RA 1UKUA 2K1RA 2YKMA 3MR6A 4YEAA 2WOMB 2AW0A 2OTJS 3QZ8A 4KHPK 2ITMA 4K43A 3MGHA 1M0SA 4RBUA 4CFCA 5HMMA 2QA4S 2HFVA 2CNKB 3AOBA 1D9AA 3MUMP 3LAKA 2QEXN 1FDDA 1PVQA 1ZQYA 3D7SB 3THVA 1RT6A 1DGSA 3KK1A 1B0XA 4P2HA 4YVZA 5FP0A 2YMQA 4ZP9A 2VA3A 2GIFA 9ICGA 1J2VA 1VYAA 4ECQA 1QQNA 2Q43A 1ESVA 3QUBA 3KHRA 5I42B 2DUYA 4CHZA 2CPEA 4BXOA 3CCSS 2QFJA 2W6KA 4H54A 3V1RA 2Y9HA 1AA1B 4YR2A 1HEKA 4LJXA 1NKEA 3CGIA 5AM3A 3KUHA 2AT1B 2FZKB 1DZ5A 2DNNA 3CCWA 1BCOA 2ZIXA 3PW4A 4CRXA 2XSFA 1K8KB 1UW4A 5BJRA 1QJHA 4H0YB 1ZPWX 1C7YA 1F5BA 1RQNA 2LMIA 1RDUA 3PIPL 4E0DA 4EZ6A 2MUTB 3CC2S 3EM1A 2CQGA 3QT6A 4ID1A 2YPZA 4Z4IA 1JIHA 3OBIA 1LWCB 2W9MA 4JI1F 1WWUA 3J80Y 1PVRA 4WQ4A 2CPZA 3RMBA 4I6MB 4Q5VA 2XMTA 3IRXA 4QOTA 3KK2A 3NH0A 4Z6DA 3RBDA 1ZQ1C 3ILIA 1QCKA 2DBYA 3T79A 2C42A 2F8KA 1VLBA 5CB1A 4DUZF 4FJ5A 1S48A 2KN4A 1NDPA 2WK4A 9ICFA 1QUPA 2W4PA 2ZIVA 1Q4RA 1Y7PA 3FSXA 1VRUA 3OXLA 2E1MC 2YKOA 5C24A 3Q8UA 1RNHA 3UE2A 2H5EA 3PYFA 4LR7A 3GOIA 5DQGA 3I0SB 2P5GA 1CSJA 4BR5A 3DV9A 4B3MF 1RTHA 2GO7A 3OTDA 1FXLA 1YK9A 1U25A 3B78A 1WG5A 1SKRA 3QSIA 5KG0A 2O67A 3ETLA 4ZLLA 2RHFA 4WFZA 3PHEA 4JI8F 2RF2A 4O4RA 1C0FA 2BHNA 1ZA1B 3CJ4A 4YB5A 4EHUA 5BPMA 2RUSA 4CZGA 3CD5A 2ZIWA 5CXTA 4ZPTR 3RR8A 1KQSM 2EVZA 3JPNA 5JVGQ 1RGIA 5TKWA 3R9KA 3C2LA 2O4GA 3NRZA 4DU8A 3C14A 1ZBIA 1LV5A 3FBEA 2M7SA 4Y2YA 4CLUA 1TL1B 2A1JB 3R9PA 4F5QA 2KM8B 4U67L 3ZDCA 3J7AN 4UB6U 1O08A 9ICKA 3FCWA 2VBYA 4MLEA 3SBMA 4A57A 3QDKA 1Z2ZA 3JAMU 3EUB2 4YDDB 3PYEA 3O08A 1SXLA 2A1AA 1RI7A 2KT5A 3AA5X 2HGNA 5ALRA 4AYBF 1RFQA 2K4HA 1I5OB 3GFHA 3WXKA 4EK2A 1RAFB 4ICLA 8ICXA 4G6VB 1N2XA 4LF5J 1D5AA 3OTOJ 2N7YA 4GKKJ 1SWWA 2GX9A 3F41A 5GMKa 3V7KA 4N47A 2FTRA 4USMA 5I3QA 1GQEA 3MPDA 4O5CA 2BVZA 2AJ0A 5E79U 3MEEA 4C4WA 1GLCG 4M5MA 2Y1JA 2AJ2A 4C0OC 3M8SA 3L4IA 4WE1A 3L6QA 4NB4A 4OJ6A 4XH4A 4UB3A 3MM8B 5B08A 4DO9A 2WB1D 4L3NA 2DGOA 3V6HA 1SPBP 2WRMA 3M9OB 5CA5A 1BCMA 1VISA 2CUYA 2YNGA 3PFEA 4USUA 3DM2A 4WQ5C 2HEKA 1FTCA 2HHSA 4GXIA 2IDEA 1HNWJ 1L5UA 3LDQA 2YNHB 2A18A 4KV8A 1Z3EB 4JKGB 4K4SA 4Z6CA 4DS5A 4WK3A 1T03A 5LSOA 2VCPA 2HFSA 2P5OA 3O9SA 5LSRA 3UXNA 4FLZA 3KLEB 1DTQA 1PC5A 3V2UC 1RISA 4CJSA 4I2BA 2C3MA 3QPIA 5ALXA 2ZJPL 3CDUA 3H8YA 1PG5B 3UW1A 4M63C 1HI8A 1IBKK 1RHUB 2JVRA 1RXVA 2XM3A 1RP5A 3QNMA 1NUEA 5AJ3K 2WVCA 4M3RA 4I67A 2AQ4A 1C1CB 3EDRB 2NV3A 1NZBA 3P45B 1PUZA 3U9DA 5L1MA 2ZUGA 3LPEA 4FJ8A 2Z30B 1SV4A 2ZXIA 2C1EB 5M2RA 2DNHA 3U1LA 3P4UB 5IM0B 4K0KF 3R7BB 4BC4A 5JXSA 1VQNN 1N8RT 1H38A 2G0CA 2K06A 4O3OA 3V4MA 3KXDA 4TLRA 4QU6A 3FUYA 3CCZA 1RBTA 4KLEA 5LJ3Y 1VI7A 2OELA 2B21A 4OZNA 1FO1A 3QRPA 3PV8A 1RDFA 5E26A 3LZJA 2K8BB 2IPOB 2B51A 4WP3A 1C1AA 2ZC4A 3ENOA 5C2DA 1JX4A 2BACA 1CEZA 1XNQF 4GMJB 3VGLA 3U6FA 4USHA 3CWJA 2QLBB 3OTBA 2VODA 4LFAF 1QZ5A 1UVLA 3THYA 4DV0J 1HNZF 4CO4A 1L7NA 2G0AA 4NEZA 3OBYA 4DF4A 2LQ5A 3OHAA 3GPAA 4C3LA 5IWAK 4I1TA 2GHWA 5KPTA 2E1EA 5L9XA 2KSOA 3MFIA 4F9OA 4B1VA 5LL6Z 4I56A 1XC3A 2BKEA 5IWAJ 2V4JA 1XI1A 2E9ZA 1YIJN 3NWRA 3HSDA 1TK8A 2BE2A 3DU6A 3SAHA 1HLWA 2FJVA 1S1WB 2BE9B 2VKRA 4ID8A 2KJWA 4KH4A 2HWIA 3ZX2A 5F8IA 5AFUH 5ETVA 4FKYA 5KFEA 3Q8KA 1VBXA 3CJTA 2ZIWB 2J9DA 1P27B 1RWPB 3ZSWA 2IVMA 4CGHA 4P2XA 2CJQA 3ZO7A 5GADU 1OUQA 1B4SA 2D9PA 3N7RC 1SC3B 5J8YC 4LSNB 3S1TA 4PPDA 2ZBCA 3BGFA 2PMWA 2HHVA 3TI0A 2Y0BB 2ZE2B 3ULDA 1HQUA 1VSHA 3T5LA 1DFDA 5J0SA 2M52A 3MTJA 2YQ3A 5D4BA 4IO8A 4WFAL 3WK9A 4TYBA 3UKUB 1C0UB 3CFRA 5D0HA 4PQAA 2D4WA 4OZ2A 1KC8T 4YHHK 3M5RA 4BDPA 3BF3A 4NXMK 1Z1BA 2QXLA 3TZZA 4OHZA 5C42A 3DDIA 4JI3J 1BPBA 3JTOA 1WB9A 2QYGA 3OS0A 5C42B 1L6NA 3CJSA 5AJ3F 1ZBHA 3A8YA 3JSYA 5ETPA 1XJWB 3OFGA 3EWAA 1H2TZ 2YPYA 5LM7E 3B8HA 4RUCA 2YHWA 4C8OA 4NL5A 4KB1A 3NAIA 2ZBRA 9ICJA 1YVFA 1EO1A 3D28A 1XHZA 3THPA 2PYJA 5KFGA 3IXQA 2QEXS 2LVWA 3DOKB 4U9RA 4CERA 2ZZMA 3OD2A 5J0TA 1AB8A 2XNQA 4Y2TA 1TL4A 5J2NB 3PSFA 3BKFA 3R2DJ 4K8ZA 5J2NA 3I32A 5EX5A 4FOIA 3RTVA 4L76A 3G25A 1BDGA 1VK8A 2YKNB 3PG9A 2LKYA 2XWYA 2KH9A 4HI1A 4USVA 3CCES 1HQEB 3D2FA 2EFPA 1B9FA 5BR8K 5CYMB 5ELZA 5ALOA 4BLGA 1S1UA 3J7YI 4K4WA 4M5LA 4GV6A 5AM2A 3OFFA 2MZSA 1S49A 2HURA 1VIOA 4OHVA 4E98A 1IKYA 3CC2N 5AFUA 3FM9A 4A8XA 2HSZA 1HIYA 1GX5A 2CH6A 1KLMB 3C1YA 2OP5A 4QR1A 3SUOA 1NGHA 2WVEA 1EXNA 3P4IA 2CQDA 1AFJA 2Y9UA 4YMNA 2JMGA 2HSEB 4C11A 4QAGA 4JI0K 4YMOA 1S9GB 3JPQA 2MQ8A 2C2ZB 2HHQA 2DEIA 3NF9A 3THXA 4DV3K 5KG1A 2J6UA 1U0SA 2A5XA 4MDBA 1CJVB 2QLTA 1NDKA 3W2WB 1RT4A 3RMCA 4FN5A 5HROB 1UVJA 5FRMA 5AXMA 4DDFA 2F4VK 3O4QA 5DZ6A 4RNOA 4OHXA 2MMYA 4MKYA 4ES1A 4Z0UA 1HWIA 4HDHA 5KFJA 3TADA 3RJKA 3AVJA 4LRAA 5E3CA 2QKBA 4O5FA 2AH5A 3OR2B 3J7Z5 4U96A 3R2CJ 1NPPA 1K47A 4C23A 3E51A 4HCBA 1J5OB 4PXDA 3D6HB 3W9HA 1JXBA 1UL3A 8ICJA 2W9BA 1R8CA 2IJFA 1U45A 2VV5A 5K14A 1ZA2B 3L0QA 1KQFB 3JTNA 4GVLA 4DL0C 3FFKB 4V19J 4ZPDA 3HVRA 1J97A 1R89A 4A8SA 3TSQA 1OYEA 5JVGL 4DCJB 2ERRA 3C23A 1UFKA 1EXQA 3ZTSA 4B1YB 3IA0A 3ZT2A 1S9EA 3DRXA 3GR1A 2HZVA 2DO0A 4M0AA 5DDRC 1ZQOA 4E19A 3IDHA 3WXMB 1IXKA 2G8HA 3GDXA 2R7VA 4WU2A 2FUG9 1X8DA 1NO8A 3ZT1A 2PBDA 2WFAA 2BJEA 3L3UA 2W8LA 2XQCA 4B1UB 4K4IA 1NMEB 5DG8A 5F9LA 5H2FU 1COKA 5I42A 4RW8B 2O3DA 2DH9A 1T44A 4Y2UA 1OXJA 5HANA 4CJUA 4OYXA 1PK1A 2LU2A 4WU3A 3ENHA 2LQJA 4MN4C 2MLXA 1OY9A 1ZQJA 2DNGA 4JI5F 3H45C 4H5VA 3SENA 4DMZA 2YY3A 1XMOF 2HIQA 4LZGA 5E84A 3SDEB 5IT4A 4O0JA 2W7AA 4ZKAA 2PY5A 1NHVA 3C21A 2FVRA 1S5LU 3OYGA 1RYUA 4EO6A 4DR4K 2KEYA 4IR9A 1C2PA 3W2VB 3HT0A 4KX3A 1HNXF 2QN6B 4LRDA 3NOCA 4J37A 4WTOB 3WK7A 1X42A 4DR6K 1U2FA 2WBRA 4X66F 3LP0B 1S4EA 2KVQE 1B0PA 2LA6A 2XY8A 1J2NA 3TO8A 2P9CA 1HHQA 4ED7A 3GL1A 3KD3A 1NK9A 1FRLA 3G6ES 5F0WA 4RW4A 3MEEB 3M1YA 3WX4A 2WONB 4C1NI 4BQZA 4BRDA 1B3TA 3VF0B 2J9CA 1IR1A 4B3MJ 3SIPB 2VYPA 4BJQA 1N33K 1HNVA 3NMUA 1J9AA 1FE0A 4BRAA 2FHJD 3BGRB 1SB3C 4KHPF 3DLKA 3W63A 4F25A 3VQ7A 4TU7A 3QEXA 1H2VZ 1GX6A 3J7ZO 5C15A 5J2CA 4RWXA 2AV5A 5J2PA 3G6EN 1QQ7A 2R8GA 3MMAB 1OKJA 1XMQF 3VQ5A 3D2FB 1Q9YA 4IQWA 4N56A 3M1VB 4P6QA 2DXDA 2ZNYA 4CJ7A 4LF8F 3VMFB 4RPZA 4CO5A 1WC5A 1U0HA 4KBIA 1IKYB 4PXCA 4DV6J 1SJ3P 4CF9A 1SKUB 2ASJA 1Q3UA 2G2ZA 5CAAA 4IOXA 2F7VA 2P5VA 4AM6A 2DIVA 1UQVA 4E1MA 2QWNA 3IFRA 3ALRA 2RE1A 4GY2B 3ZETA 4IH7A 1VSJA 2ZKUA 4LD0A 3OFEA 2G09A 3TVKA 4YP3A 2CPJA 3MCAB 2L9DA 8ICLA 4I27A 6FD1A 1NJXA 3UDLA 4CF0A 4GV3A 2ZBIA 3ENAA 4WFXA 5M2PA 1N5WA 1WC6A 5DDPC 5C7PA 4WP8A 2BUNA 5ETTA 2ZIXB 1C6VA 5HJYA 3OTOF 3ICLA 2DNZA 3JQJA 1X9XA 2BEFA 2BRLA 1JCGA 4DPXA 5IT9O 4X66K 2C2NA 1BQMB 2WAQD 4R25A 1NGCA 4B02A 3K8WA 1ZQRA 3WDOA 4WP9A 3HHNB 2XICA 2FHJA 4KB7A 2YCHA 3AVIA 4X64K 1XC9A 1S0VA 2QLFB 1UPPA 3A0HU 2R7OA 3LDPA 4DTMA 2ZUCA 4QS7A 4QYZJ 3W8GA 5ADXA 3RZAA 4UY8T 4Q43A 2UUTA 4FJMA 3LDAA 1D8LA 3WK5A 1XMOK 1N88A 3FCVA 2ZKTA 2KM8C 1MWYA 2QB0B 1KP6A 4J9VA 4D3GA 4DR2K 4ZN3A 2VFTA 4ZPBA 1OSCA 3M7VA 4RLEA 1RDRA 2ZJQQ 3M2RA 4UW2A 3F5EA 3OJSA 3UR3C 2MRLA 1MWZA 1RWNB 4NE9C 2I0XA 2GVZB 3J7YU 1RTIA 5AK5A 4P0QA 4JKDA 3Q83A 5HP1A 3B82A 1RTHB 3H3NO 3CJQA 2JVOA 5KAKA 4F5PA 3N4PA 3O44A 1JXLA 4NASA 4Y65A 3UQ2A 2GMJA 5KG7A 3S6EA 1NI3A 2ZGYA 4G3IA 3NS5A 1XUPO 1IKWB 4KLDA 4OJHA 4KBOA 3QEIA 2KK0A 5KFQA 2M88A 1KQGB 4LF8K 3WKEA 3B6BA 4MIAA 5B0CA 3NGYA 4JUZA 4M2YA 4TXSA 5DLFA 3BEGB 3N6MA 3QFWA 1N63A 1Q95G 2DGVA 4OPKA 4L3QA 4KGMA 3P39A 1JWWA 2FHMA 1C0UA 3OUYB 4JS5A 1S6UA 4TUPA 1DAXA 2BPCA 3NFAA 4LY7A 3MR7A 5HRNA 4DFDA 4LFCK 1BU6O 3ZX3A 1S9FA 3PO4A 3I8BA 4IKFA 1TKTB 2P66A 1ASVA 4Y6IA 4AE5A 3ASMA 3RJHA 2RB7A 3BQTA 5FLXO 1G7CB 3OYLA 3OHBA 3IRXB 1GMWA 2L5YA 1K0TA 5HJXA 1GOBA 4I0WA 3KLGB 2LYBA 1P8GA 1L7MA 4Z6EA 3PIPQ 1HFEL 1WF1A 2ZJ5A 5E3QA 1RLDA 1YVUA 3O9QA 3MDAA 4EX7A 2VGMA 1LWXA 5EUHA 3V1OA 3HFVA 4K42A 1KFTA 2DHAA 3SCKE 1ZH5A 3WIUA 3FBCA 2B4VA 2AGQA 5EE3A 5A8KA 5F3XB 2DCLA 5GMDA 3I0RB 4F91B 2W24A 3J81U 2BCVA 1Q82O 4WXWA 2IM0A 1HMVA 3H08A 1S72N 4JOUA 3HHLA 3PXGa 3Q8QB 2IFXA 2OPPB 2KHDA 5BR8F 2E88A 2KVSA 4YDUC 3EZWA 2YWWA 5C2FA 8ICCA 2AIRB 1DLOB 4O4GB 3R5CA 3GFXA 1VQKS 2HF3A 2GGPA 4B1ZA 1ZQUA 3BYRA 4YXMA 4OKEA 5T41A 1UZDA 3TJAA 3DOLA 1HPZA 3SD7A 4WBFA 1QQ5A 3W61A 2P9PB 2O1PA 1MQ2A 4EAHD 3G71N 3ENWA 2XIDA 1KOOA 1OSDA 4BRFA 2XMWA 2PI4A 1K8AO 4P7TA 5D8HB 2HFNA 2OGUA 4K8XA 3MMBB 2C3PA 4W5TA 3T3FA 4ILJA 3GQCA 2W1BA 4QIWC 2V34A 3TSUA 1VQKN 5BPLA 3ZZ0A 5J1NA 4UARA 3K5PA 4U8YA 4EO8A 5J1EA 4LQ3A 2A3ZA 4FSVA 4GXKA 2MZTA 2VG5A 1BPYA 3A2FA 1QH9A 4MFCA 5KFKA 3AVMA 2OHDA 2ZH3A 3RH5A 4FJXA 1DEJA 4KR0B 3C66A 3MAAB 3EE8A 1NOZA 4AXIA 1FFWB 4MK7A 3TZWA 2LECA 3CCMS 4N41A 4C8ZA 3LPYA 2VG7A 5ETMA 4OX9K 3HOTA 1A5XA 4KGKA 2I1QA 3N7SC 4YG2A 2PN6A 2SXLA 1S8OA 2ZIUA 3I4PA 1JLAA 2QJ3A 2P9NA 4ZJLA 1HWUA 2DFFA 3VR1A 2ZOMA 1BQNB 3P31A 4FLUA 1Z4UA 3OYCA 1SXDA 1ZM2A 3ITHB 2DKXA 4X4UA 4DUYF 2XNRA 2FC8A 1L3VA 3NG8A 2JGAA 5LSLA 1SBRA 2YNHA 4KV8B 2B5JB 4JI0J 1D8ZA 3ID6A 5FD1A 4AL6A 1RCHA 1CPZA 2FBVA 4I4BA 2DGXA 4IG0B 4I7FA 4HH0A 3QT8A 5A6PA 4QZVB 3LM9A 3IUCA 4HYKA 1LB2B 3PJXA 4BUGA 4J9PA 3DNCA 4JWMA 4ID5B 4DX7A 4CEEA 1FRKA 2HWHA 1NSQA 2OLWA 5EWEA 1MLAA 4I68A 2JSXA 4WWSA 1ZQFA 2CN1A 2CAJA 4Y2JA 1ZQPA 1LWEB 2OAUA 1IWGA 1JB0C 4FF4A 2HS3A 3ULEB 1WOOA 1P1TA 3K59A 4B3SF 3PDNA 4DR4J 5F8HA 1H0HB 3ED5A 3AVLA 2KJ5A 3FKBA 1X0FA 1ASWA 3JSMB 2R7TA 2FJ6A 3KYLA 4R8UA 3OT9A 1V9PA 1E6VB 5AQMA 5LMUJ 1JMSA 3KKAC 1NDCA 5AI5A 2AU0A 3HKWA 2E1CA 3H4DA 1P8ZA 2KYXA 5ALFA 1VJ5A 4C97A 1OO0B 8ICVA 3V9UA 2UXBF 2DNYA 3MEDB 1NLKL 4IO1A 8ICYA 1WNSA 4OX7A 1UOCA 2WHOA 1BWFO 1YAGA 4C2MA 3MD3A 1F5AA 4KGZB 2XGPA 2ZUDA 3M8PA 3TUPA 3VQ8A 1CULB 3O6WA 3JYTA 4NLNA 3DGPB 1AFIA 5DBCA 3Q8YA 4NXMJ 3HJVA 4ICAA 3CP8A 4BX9C 1SJ1A 3CCRN 2ZBPA 4NV0A 4F02A 1TQLA 2D6FC 3BGRA 4DU1A 3HI0A 4ZVRB 3R5AA 4YNQA 4AP9A 4FLVA 3FZFA 3KG4A 1L3SA 1UT8A 3F5TA 2ZTCA 4F67A 4AILC 3C5FA 1RACB 3MOJB 4JKGA 3IWXA 4R65A 1YGYA 2KN7A 3K9JA 4BG9A 1VQLN 4LIWA 1OVQA 3CCRS 5ETLA 3D6TB 1X2IA 3GG0A 4CNZA 1YTYA 2YH0A 2DNKA 1TKXA 1H1VA 2DFEA 7ICIA 1EAYC 7ICSA 4YY3J 2AP1A 4I2HA 1BE4A 1HUXA 2GAHC 3UCGA 2DF4B 4GRSA 2X74A 4FZLA 2AXTU 1FRMA 4J9QA 4DUTA 3O1WA 2CADA 4DX8H 3MM5B 3CSKA 5BXIA 4IL6U 1YXQA 5JU5A 3J80O 1QM9A 4KFBB 1FT8A 2NXEA 4Y0WA 4DN0A 2QIFA 1UWBA 1Y5IB 3DEEA 1DXSA 1MWMA 3HPHA 2BQ3A 3M30A 3AO3A 3QIPA 3TZXA 2CA9A 2CVEA 4WKRA 5KFOA 1RZMA 2B43A 5KTQA 2BDPA 3GB0A 2ZNZA 1FW6A 2NPFA 4V1Ak 5ITHA 3OTQA 5BPCA 1OWXA 4F3QA 3O5BA 3ZSQA 3BO2A 2HQ3A 3U9ZA 4DX6A 1EIYB 1NWKA 1VQ6S 4JEPA 4Q0BA 5J2EA 1FDNA 4I6WA 3F53A 1LOTB 3CE8A 3MM9A 4DR7J 3AU2A 3BQ7A 4GO5X 4BBYA 4KHPJ 3SI6A 2IVFB 5IIMA 4ELVA 4LRBA 3N4QA 4DV5J 3KJVB 5IV3A 4J90A 3WEEA 4J9LA 3H1VX 2MQNA 4B9LA 3AARA 5L46A 3D0PA 2Q4TA 2OEKA 3H7HB 2QMXA 4CF2A 2HBYB <