4DSLA

Crystal structure of fragment dna polymerase i from bacillus stearothermophilus with duplex dna and calcium
Total Genus 191
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
191
sequence length
579
structure length
579
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase
publication title Biochemical and structural insights into the fidelity of bacillus stearothermophilus DNA polymerase
rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 191
structure length 579
sequence length 579
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4dslA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4dslA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dslA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4dslA01
5J2NA 2G8FA 3L3VA 4FLTA 2GWSA 2Z1HA 3MR3A 3JPPA 3C2LA 1Y97A 3B0XA 4RU9A 2F1HA 2EX3A 1RBVA 3KLHA 1S10A 3RRHA 4CGDA 3N4MB 4DOCA 2YHBA 2C2EA 3UPQA 1B43A 3U3GA 3CM6A 2X6SA 2ZJ8A 4KLMA 4QCLA 4M47A 2OZMA 2BPFA 1ZQSA 5L1IA 4B8AB 4FJJA 1T8EA 2HVIA 4OKEA 4O0IA 5DQHA 2ATLA 1J54A 5KG2A 4CJ4A 2RN2A 2KN7A 3PW5A 4ECWA 1RDBA 3NHGA 1H38A 5JUMA 4RW9A 3VQQA 3LAKA 2B5JA 5CYMA 4GLXA 4DQRA 1UA1A 5L9XA 4JUZA 3HK2A 3WNEA 3LP3A 4YR2A 2ASJA 1EP4A 1ZQDA 2HNZA 4RQ8A 4DFKA 1ASWA 3P83D 3SPYA 8ICXA 2UVWA 3QINA 4KTQA 1NK4A 4O3PA 3AV9A 2W9BB 1WSFA 4FM0A 4I9LA 1L3TA 4ECSA 4MQ3A 1KLMA 3ITHA 1RDDA 3AUOA 1TKDA 2AU0A 5HRSA 3SYZA 4YR0A 4RG8A 3OYJA 1JLFA 3Q8SB 2Y1JA 3H8JA 4QZGA 3CM5A 3Q8LA 3V9SA 4CERA 5C42A 3T1AA 4KMUA 4E3SA 1JMSA 1CZBA 5DG8A 3G6VA 3V72A 4M3TA 4Z6FA 3PW2A 2BR0A 1Q9YA 4AHTA 1BVSA 4KHSA 4EYHB 1HMVA 8ICSA 1WSEA 3Q8RB 4KLDA 2IS3A 1MU2A 2ATQA 1CXUA 4RQ0A 2JGUA 5F9LA 3UXPA 2IDOA 4H4MA 1S0NA 2BQ3A 4CE9A 4CF1A 1VSKA 4OGCA 4RPYA 3PR5B 1LW0A 8ICTA 3GV8B 4I2JA 3ZDAA 7ICIA 2DFHA 1VSIA 3H08A 2P66A 4CJFA 5J2BA 4DQSA 5KG1A 3K5OA 3AA2A 4UQGA 3NFAA 1UT5A 4E0DA 4E7JA 1S9EA 2ZE2A 3BQ1A 4RUAA 2KZZA 3DMJA 4IRKA 4FJKA 4R63A 4C8MA 5J0TA 4GW6A 2KTQA 4KHWA 4K4GA 2PFPA 1QLNA 1B9FA 3M8SA 3OJUA 3GIKA 1RT2A 1Q9XA 3VQ8A 4HTUA 5DBBA 3SCXA 1HQEA 4FJ5A 4M9HA 4YXMA 3RB4A 3K4GA 1UOCA 4O3RA 3VQPA 4KB0A 1QSLA 1UT8A 3JSMA 3OY9A 3H8WA 3RJHA 5F9NA 2QKKA 4EBEA 4J2AA 1BPDA 1LB2B 3MDCA 4N41A 3TABA 9ICAA 3OYCA 2RF2A 3LALA 3TARA 1VSDA 1SL1A 4CJPA 4E7KA 4DF4A 3RB6A 1BISA 2NRXA 4DU1A 4FJ9A 3OS1A 2W9BA 1TVAA 1JXBA 4XIUA 2FPMA 3FDSA 2VA3A 3EW9A 4YMNA 4E19A 3OYAA 4F3TA 2PI5A 4CFCA 1CLQA 3LPUA 3KLGA 1A5VA 1FK9A 3V1RA 2NRVA 1U9LA 1SL0A 3SQ2A 3MDAA 4KREA 1U49A 4FVMA 4W5NA 5HMMA 4J9NA 4Z0UA 5HNKA 4BGDA 2P1JA 4Z4GA 1U48A 4YXJA 1S1UA 3DLEA 3HW8A 4LH4A 3B6OA 9ICJA 3C21A 2QXFA 3KHGA 4CJRA 5I42A 1C7YA 1ZQFA 3LAMA 2PYLA 1D9FA 4YN4A 2BE2A 1ZQWA 5CHGA 3OSPA 2ZJ5A 3V1QA 3ZDDA 4FK4A 2YHAA 4Z6CA 3RH6A 4Y1CA 2G8HA 9ICVA 4CHOA 1N56A 3IHQB 3CFRA 3LDAA 4FBUA 3M9MB 3ZSRA 3AO1A 3PW7A 3AVAA 4I28A 4PGQA 3GIIA 4ELTA 2BPGA 4B9TA 2KQ2A 3GIJA 2QK9A 1QSYA 4GMJB 4JK1A 3HPOA 1QSSA 3KLEA 2HHTA 7ICHA 2RDIA 1IKVA 2ISOA 4OVLA 2IBKA 2FBVA 4CJEA 4ECTA 1MSWD 4ECXA 4NYFA 3OS2A 1ZQTA 4MFAA 4PPXA 3G6YA 1JLAA 3MEGA 1C0UA 1BPEA 1TKZA 3T5LA 3QIOA 1S1VA 3O4QA 4CF8A 4C8OA 3EZ5A 5HP4A 2MAXA 5FRNA 3VQ4A 4DOBA 1VSEA 3UQ2A 3BJYA 3FYHA 3V6JA 4KLLA 3V81A 5J2MA 1GOBA 3SZ2A 2GUIA 1ZQQA 3V4IA 9ICIA 1BIZA 3O4NA 2I9GA 2AJQA 1RT6A 5J0RA 4EEYA 3JPQA 4DSFA 1TKXA 3D45A 1S97A 3LWMA 4DL5A 4DTJA 9ICUA 2B21A 4YD1A 5KFFA 4DMNA 4CJUA 5DBCA 3SI6A 3MABA 1Y88A 2LSNA 4OGEA 3PMLA 5KT7A 5IIKA 4FLVA 5J0QA 5DB6A 1ZQKA 2AGOA 1KRPA 2BQUA 4NCBA 1WSJA 3VQ9A 4P4OA 1KVAA 5KT2A 3DLKA 2XY8A 8ICRA 4CGGA 3RAQA 2PYJA 4JS4A 4M9JA 4RNNA 4KLSA 2F1IA 4KAZA 2Q3SA 1JX4A 1TV9A 4CF9A 4CCHA 3OYEA 1RBSA 3DLHA 5DQIA 1XU4A 4BDPA 3MXJA 4KLOA 4QZCA 2GBZA 3SV3A 3K59A 1ZQXA 4NM2A 5J2PA 1R0AA 4M0AA 2VWKA 4J9KA 1U4BA 5DQGA 3L2WA 1JLGA 4DSIA 1J5OA 4ZTFA 2FBXA 4H8KA 4DTUA 3KLIA 4K4HA 4I2IA 3T5JA 4KLEA 4W5RA 3JYTA 4BE2A 4F4KA 3PW0A 5EU7A 4Q43A 5KFVA 3PMNA 2YV0X 2D0BA 1SUQA 4MFCA 5KT3A 3DRRA 3LK9A 7ICPA 2WTFA 4X5VA 3GILA 3HPGA 1CUKA 7ICEA 1D9DA 1L3VA 4EP4A 3H8SA 1C1AA 1S1WA 2UVVA 1QE1A 5D4BA 2OPQA 1RILA 3UIQA 2DFEA 5T7BA 3PY8A 5J2HA 5KT6A 1NKBA 1WCNA 2ZTCA 5DK5A 3M8RA 3HPHA 5K14A 1Z25A 4F3OA 5DDYA 4M3XA 4FJMA 4P4MA 4IQTA 3IS9A 1WCLA 4CEFA 4GXIA 1BQNA 1PZNA 4KLQA 3UXOA 2I5JA 2KW4A 3KK3A 1ZQVA 9ICHA 4AILC 1ZQYA 7ICUA 3MEDA 1L3SA 3RJKA 3CG7A 3AU6A 3OYNA 3NCIA 2A1JB 4IR9A 2PFNA 1J9AA 4CFBA 3SUNA 4IFYA 3VQEA 3MXMA 1REVA 4I2DA 4W5TA 1JLCA 2IAJA 1AROP 1YT3A 4LZGA 4OPKA 4OPJA 2RKIA 2X78A 2YNIA 8ICJA 2WOMA 3U3YA 4RQ4A 3MAQA 3V9XA 2C22A 1S1XA 1XSPA 2ZQBA 3NH0A 3QEBZ 9ICTA 3DLRA 5FROA 4QWEA 3VA0A 3LZJA 1HJRA 1D5AA 2KZ3A 5CJ7A 1JLEA 5J2CA 3M9OB 4O44A 3RB3A 4CJTA 1RPLA 3EPIA 3S9HA 2ISPA 4FJ7A 4TURA 4IG0A 4FJLA 1RTJA 3LP2A 5EWEA 4I2BA 1S0VA 4TSXA 1ZQRA 5HMLA 4F92B 3G10A 4M6WB 1LWCA 2ZUBA 4CJSA 3M9NB 3QE9Y 4JRPA 3KIOA 4B08A 1X1PA 3L2UA 1X9MA 1BI4B 3B6PA 1LV5A 2G8IA 4C8KA 1JL1A 2HHSA 5CR0A 3V6KA 4XUSA 4UB5A 4J2EA 4P4PA 9ICNA 3AVFA 4RW4A 4EBDA 4M9NA 2VG5A 1WSIA 4IQUA 4DTMA 4Z4FA 1WNSA 1JXLA 4B3OA 5KG6A 4XQ8A 1VK0A 8ICKA 5KFPA 4P2HA 4XRHA 3C1YA 2BGWA 4YD2A 3NE6A 3ISCA 4CJQA 2XGQA 1COOA 3HL8A 3GV5B 4RQ2A 1IKXA 4BE1A 2XHBA 4JWMA 3MECA 1GOCA 1XSNA 9ICEA 4MFBA 4FXDA 4F2SA 2C2RA 4FK2A 3T5HA 2OPPA 1ZJNA 2G8UA 5KG7A 5KGWA 1HYVA 4B9NA 4LSLA 4JS5A 4EBCA 3KHRA 5CWRA 4AHCA 3ORYA 3THVA 1I3AA 3ASMA 4LZDA 4BACA 4PGXA 3HM9A 2W9MA 3K5NA 1DTTA 2A1JA 4E89A 4ID5A 3TANA 8ICLA 4CIGA 4DTPA 4K8ZA 4CJVA 2G8WA 1WSHA 2XCPA 3KHLA 4YG2A 3TAFA 2DFLA 2FLPA 3F73A 2BANA 3SUQA 7ICFA 3C1ZA 4ED8A 3HVTA 5KTQA 3NGYA 1ZBUA 3HX0A 4QZ9A 4QOZB 2BHNA 1T4GA 5CP2A 1LWFA 3HP6A 3KK1A 2NUBA 5KFTA 1S76D 3AVJA 4TUSA 1G15A 4YMOA 2AQ4A 4R5PA 4R64A 7ICJA 3RJIA 4TUQA 2PXIA 3RJEA 1LWEA 3TFRA 2HNDA 5KFEA 5KG5A 5J2AA 3IRXA 5C24A 3SI8A 1SKWA 4M2YA 3ZT3A 1XO1A 4M6WA 2D0CA 3HP9A 3Q8QB 1KFDA 2B6AA 2ITGA 4JRQA 3OYIA 1BCMA 3JPSA 3RMAA 3HSTB 4RPXA 1BI4A 4FO6A 4QZFA 5BOMA 3C95A 2OZSA 1S0MA 5L1LA 1N6QA 1MQ3A 3AO5A 4J9QA 5DDMA 2OWOA 4KPYA 3QERA 2M9NA 3HWTA 4KV8A 2YNFA 4ZH4A 3OYMA 2DTUA 5KFYA 5J0OA 4O5KA 3V6HA 4NM1A 3OVNA 1ZQCA 4F4XA 3DRSA 4E1NA 3H40A 1Q8IA 4YR3A 4F5RA 3PW4A 2VA2A 5IIMA 3RBDA 4UB1A 4QZIA 1SV5A 1XHZA 4QZDA 1F21A 1WSGA 1RTDA 3QEIA 5DB8A 4KHQA 2A1RA 2VANA 4M42A 5DLGA 4F8RA 5KFQA 4RNOA 4M3ZA 4CJLA 3HJFA 4PHEA 2Y1IA 2AGQA 2BDPA 1TAUA 1RYRA 8ICBA 1HUZA 5E41A 4ED6A 4MEYA 4O55A 9ICQA 4QZAA 3TAGA 3O3GA 4NYNA 5SWMA 3SQ1A 4LD0A 3OHBA 3RR7A 1HPZA 3C94A 2C2DA 1NKCA 4CECA 1VSLA 4ECRA 4RZRA 4YNQA 4GC6A 4I2EA 8ICQA 2BPCA 2AQ0A 3EYZA 2HMIA 2J6UA 2V4RA 4W5OA 8ICCA 4O4GA 2ZTDA 4CHNA 1I39A 3S3NA 4NLNA 2V9WA 1RBUA 4QZ8A 2X6NA 5KFSA 1X9SA 1QS4A 4KLTA 2F8TA 4DU4A 4YCXA 4RQ6A 5KFBA 4IBNA 3D0PA 3RMCA 4YFUA 3E01A 4QZEA 9ICMA 1S77D 4DL2A 2PZSA 1N5YA 2KZMA 4M41A 1KDHA 3VQ7A 1XC9A 2DPJA 1KFTA 3HO1A 4BDYA 4AHVA 4PY5A 2FMQA 3PX0A 1S0OA 4BE0A 2A1SA 2IHNA 5KRTA 2PFOA 3CFPA 2FPLA 3EPGA 3ZT0A 1TL1A 4RNMA 4EZ9A 4E7LA 2VG7A 4HUFA 3T3FA 4Y1DA 5FDLA 8ICHA 9ICLA 1FKOA 4PQUA 3VQAA 1HRHA 3LANA 2PFQA 4JV1A 1RBTA 3NTUA 4F91B 3AVKA 4F5OA 1KTQA 1S6PA 3QETA 5JS1A 5DGBA 3NH1A 7ICLA 2B4JA 4IG3A 1O1WA 4F4YA 4DTNA 4IQVA 4KLGA 2HHXA 3H4DA 3KKSA 3PO4A 4J9LA 1ZJMA 1MC8A 3F9KA 3NF7A 5J2JA 2PY5A 2XY7A 4CF0A 1RT5A 1BHLA 3IM1A 4ED3A 4ECVA 4DFMA 4F5QA 5HP1A 2V4QA 5BOLA 1VSFA 3G0ZA 4KHYA 3DI6A 5FRMA 2NRTA 2VWJA 8ICUA 4B9LA 3QEAZ 4RT2A 3SNNA 4EZ6A 3MR2A 4CHZA 1XSLA 3MEEA 4CHQA 4FZXC 2OYQA 3AVHA 2X74A 1D8LA 5C5JA 3MGIA 3GFKB 3M8PA 4KTWA 4ZHRA 1DGSA 5KFNA 4R65A 3DLBA 1RT1A 4DS4A 3ISBA 1DLOA 5KFDA 1GOAA 3NF6A 4CEAA 5DKWA 4O3NA 2W9CB 4HUGA 5IIOA 2UVRA 4AHUA 3UXNA 2HVHA 3SV4A 1QQCA 3PVXA 1TAQA 4CGFA 3B0YA 3AVCA 5J0WA 1EETA 3ZSQA 4KHUA 1JXEA 5HHIA 3ALYA 4DEZA 4FLXA 5J29A 1TV6A 4N5SA 1IKYA 4DOAA 1UA0A 4RW8A 4MF2A 4QAGA 2IMWP 1NK8A 2XY6A 5KT5A 1KEJA 1TL3A 5DG7A 3ZSZA 1ZBFA 4O5CA 3VA3A 4DLGA 2BCQA 4KLUA 4UBCA 4CEQA 3K5MA 1ZQZA 4RPZA 4ECZA 1RBRA 1VRTA 2ETJA 3OYGA 4TQSA 3AVBA 1L5UA 1J53A 3Q8MA 4CEOA 3PX4A 3IAYA 2FBTA 2E6LA 3NGIA 3FFIA 2HHQA 4MFFA 4JV0A 3OYBA 4CGJA 3K58A 4Q8FA 3C5GA 1NOMA 4CFDA 5J0SA 1C0MA 4N76A 1ZYQA 8ICVA 3RMDA 5J2FA 1DOQA 2XO7A 4B9MA 1RCHA 1MQ2A 5KFWA 4I2GA 4PH5A 3C6TA 4CK1A 3HYFA 3ISNC 2ZUCA 3MFHA 4OKKA 4HCCA 7ICTA 3RH4A 5TZVA 3G6XA 3H4BA 1NKEA 4O3QA 2D0AA 2ASDA 1K1QA 1QTMA 4Q0BA 5J0PA 4NLKA 3DRPA 3PX6A 2R8JA 4H4OA 4UB2A 2IA6A 1TK5A 4CJ3A 4CEZA 4F4WA 4M9LA 1IKWA 1TK0A 5KI6A 4DSKA 5KFIA 1NJYA 3LPTA 4J9OA 4R66A 3NDKA 1VSJA 4CIFA 3V7JA 4RW6A 9ICGA 3C6UA 3RWUA 4HVJA 1HJPA 7ICSA 8ICAA 3V1OA 4I7FA 5J2KA 7ICGA 3AA4A 2UVUA 4DO9A 1HQUA 3KTQA 1IH7A 2W9CA 4FZYA 2XRIA 3ULDA 4CEBA 1KSPA 5CB1A 4CJKA 3KD5E 1RT3A 4IDKA 4K8XA 4O5EA 4JWNA 4CHYA 3ZSVA 8ICOA 3QEVA 4LSNA 5DLFA 3TAEA 1BIUA 1Z26A 8ICEA 1K1SA 1BPZA 3K75D 5SZTA 4Z6DA 3BQTA 2Z1IA 4DSLA 3QO9A 4F50A 1KLNA 3TAQA 5KG4A 2HB5A 4YVZA 4NLZA 2HHVA 1NJXA 2R8IA 2JEGA 4FBTA 3CQ8A 5BPCA 2XY5A 3RJFA 4G3IA 5DGAA 3OGUA 3WNHA 2XC9A 3SPZA 4FZZA 1DTQA 4IRCA 4E1MA 2W8KA 2ASLA 1JKHA 4CESA 5JS2A 2I1QA 7ICOA 1JIHA 4DL6A 3TAMA 1X2IA 4NXZA 9ICPA 4QWDA 1NOYA 1D8YA 4E7HA 4CK2A 2LYHA 2R8HA 1CZ9A 4CJWA 2RDJA 1RTHA 4OKJA 5DMRA 4TUPA 1C0TA 3KHHA 2ZUDA 2H5XA 3MR6A 1A5WA 4Z4HA 4FLZA 4DTXA 2AGPA 9ICRA 2P6UA 4NCAA 1W9HA 1XWLA 5KFZA 4J2BA 3SJJA 2P51A 3ZDEA 3V9UA 3KLFA 8ICFA 4GXKA 8ICGA 1KFSA 2ZD1A 4FJXA 4PHPA 5DB9A 5J1EA 4O0JA 3N97B 3AVNA 4GXJA 4DF8A 1NJZA 4M45A 1T03A 4Z4IA 2Q0ZX 4KHNA 3JPNA 4CJ5A 7ICRA 5KFLA 4DSJA 2PI4A 2HHUA 3HXMA 4UB4A 1RNHA 5J0XA 2XGPA 4JLHA 3QLHA 9ICXA 4F93B 4FJNA 1LAWA 4IRDA 1A5XA 7ICVA 1WN7A 3BGRA 3L2QA 4DQIA 1NOZA 3QESA 1XHXA 9ICBA 3QEXA 4IKFA 2JEFA 4DSEA 4M3RA 3EY1A 3VQ6A 4J9RA 2IHMA 1FKPA 5DB7A 4Z4CA 3K57A 1JN3A 1K6YA 1KVCA 2FBYA 4FJIA 2KFNA 1LW2A 4O3OA 3P1GA 3ZSWA 4I2HA 8ICMA 4GVMA 4QWCA 1NK7A 1UWBA 3QNOA 5KFGA 2R8KA 3AA5X 3PV8A 7ICKA 1U47A 1BPYA 3NAEA 3MR5A 3AVGA 3OSNA 1ZQJA 3AO3A 4LY7A 1B92A 4OJRA 4KRFA 4Q45A 2MUTB 4NCGA 3SQ0A 3V7LA 1WAFA 9ICFA 4FM1A 1L3UA 4FW1A 3VN5A 3ZD8A 2DPIA 3V6DA 5IIIA 3AVMA 1RT7A 3TR8A 1RXVA 4PHAA 4DQPA 3DLGA 3TWHA 1XI1A 3LWLA 4DS5A 3MXIA 3TFSA 5KFCA 3V9ZA 2BCUA 2FPKA 1B22A 1W0HA 5KT4A 4FCYA 4PA1A 5KFHA 4HUEA 5HLFA 4CHPA 4CGIA 4AHRA 4QZHA 4AH9A 1TK8A 2Z1JA 5J2QA 4I2PA 2YKNA 4ED1A 8ICNA 5HROA 3ZSOA 5HRNA 3TQ1A 4NY8A 4ECUA 2OPRA 4ECQA 3RRGA 2JEJA 4J9SA 4YP3A 3OYKA 4DQQA 4BWJA 9ICKA 1SL2A 1EXQA 1ZQGA 4RUCA 2W9AA 1BPXA 2OA8A 4KLIA 1BCOA 1HNIA 4YQWA 2BQRA 4KLHA 3PNCA 1BGXT 4ED2A 3TAPA 2XCAA 4KFBA 4LVSA 8ICYA 5CY4A 2E4LA 1TGOA 4ICLA 3ZD9A 3ETLA 4C8LA 8ICWA 4B9UA 4M3YA 8ICZA 5HRRA 4K4IA 3HT3A 2F8SA 3AVLA 4UB3A 3NGDA 5KFXA 4CEEA 1ZQUA 3T19A 3T5KA 3O3HA 4FLYA 2ZTEA 1ZQBA 3K2PA 4FJGA 1YVUA 1ZBIA 1ZBLA 2YKMA 1RDCA 4Z6EA 4GC7A 1RZTA 5KG3A 3QIPA 3VQBA 3GV7B 4M04A 3CFOA 4RW7A 3OYFA 1NK0A 3DM2A 2G8KA 3C2KA 3MFIA 1CEZA 3O3FA 4DL3A 2W42A 3QZ7A 3V9WA 5EWFA 5IIJA 1ZQIA 3LP0A 4QZBA 5IINA 3H7IA 2C28A 2MUTA 3NGZA 4B8CA 2GV9A 3PUFA 4TQRA 3ZT2A 4FM2A 4DFPA 4KLJA 1U04A 5J2IA 9ICWA 4UAYA 2VA8A 3JPRA 4ED7A 4UAWA 4CFAA 3L2RA 2E6MA 5KFRA 1IG9A 3IG1A 3TI0A 4RQ5A 4I27A 1NJWA 2O4IA 4DL7A 2FMPA 1ZQPA 4E7IA 4PUOA 1EX4A 5IILA 4F5PA 1ZBHA 3L2VA 3PO5A 1HNVA 4HYKA 1TVRA 3P5JA 3KD1E 3KJVA 3NH2A 4I2CA 4PHDA 3I8DA 5CA7A 4F5NA 4KN4A 3GDXA 1Z00B 3WNFA 4MF8A 3GQCA 3C23A 2O4GA 3BQ2A 1BQMA 1BPBA 4BDZA 1IO2A 4F4ZA 4I2AA 5CZ1A 1SZPA 1ITGA 3EWAA 5KRSA 2P5GA 1V9PA 1ASUA 5KG0A 4L8RB 1U45A 1ZQHA 4FLWA 5D49A 2JZBB 3LDSA 3U6FA 1EXNA 4KTZA 4FS2A 1ZQEA 3RJJA 1S6QA 3K5LA 3E2EA 3ISDA 3OS0A 3OYHA 3ZDBA 1VSHA 3WNGA 5I3UA 1TKTA 3ZT1A 4N56A 3Q8KA 4F2RA 1ZQMA 1RXWA 9ICCA 2G8VA 4Q5VA 1S9FA 4RT3A 1FXXA 2HNYA 3A2FA 7ICQA 1S1TA 4ECYA 4DWIA 3GIMA 4DG1A 4KO0A 4M3WA 4J9MA 3L8BA 1TFRA 1C1BA 1RT4A 4R8UB 4M3UA 2BCSA 3VQCA 3I0RA 4FJ8A 3ZSYA 4NLGA 2W8LA 3CYMA 4JV2A 2BKEA 4LH5A 1KCFA 4FK0A 1C6VA 5HBMA 3RJGA 4HHTA 2FLNA 1KVBA 4I2QA 5J0YA 3ZSXA 1RYSA 3ZCMA 4YFKA 4KI6A 4RQ1A 4DTSA 2P5OA 3QEPA 8ICIA 4B9SA 2NRZA 3RR8A 2DFFA 3NF9A 5EOZA 1RTIA 4DTRA 3OJSA 1RDAA 3BDPA 3AU2A 2JEIA 1YTAA 3Q8PB 2F96A 2YNHA 1T05A 3LP1A 4DTOA 4I2FA 4KITB 4M9GA 2HHWA 4OLAA 4G1QA 4Q8EA 3C5FA 4KKOA 2ALZA 3NF8A 3ZDCA 4CEDA 2ZJAA 2EHGA 1NK9A 4YMMA 4DL4A 3HVRA 3DOLA 1Z00A 3I0SA 4AHSA 2RPIA 4DFJA 4BXOB 4OLBA 2BCRA 1A77A 4XA5A 3QNNA 3L3UA 5D3GA 2P6RA 4MEXA 4I9QA 1S5JA 3S3MA 2QKBA 5J2DA 4HCBA 3AO2A 4CGHA 5KGXA 4I29A 2OPSA 2VG6A 3UQ0A 3S3OA 1YTUA 4ID1A 2JZBA 4O9MA 3AVIA 3KK2A 3SQ4A 7ICNA 1HYZA 4J2DA 5DG9A 4J9PA 2Z1GA 3KKRA 4PGYA 5C25A 4Q44A 1Z3EB 2J6SA 1ZQOA 4RQ3A 3NBPA 5J0UA 3RMBA 3JPTA 3MBYA 2R8GA 5KFAA 2FLLA 5J2GA 5J2EA 4DU3A 3C2MA 3BQ0A 3LZIA 1WAJA 3OHAA 4ED0A 5DBAA 1QHTA 3RTVA 4CIEA 5EWGA 2HW3A 4R8UA 1XS9D 2DY4A 8ICPA 1B9DA 3DOKA 1NK6A 2JLEA 4KI4A 1ZETA 4ZTJA 3SUPA 2IGIA 1CXQA 1LAVA 5CZ2A 3M8QA 2R7YA 4KLFA 1VRUA 4EP5A 4QW9A 5KFUA 4Z4EA 4ELVA 4KB1A 2FMSA 2FC0A 7ICMA 4BWMA 3RB0A 1T7PA 4FLUA 3OYLA 3QEWA 5L1JA 5KFOA 4QWAA 1IXRA 3AA3A 1UAXA 4W5QA 3MGHA 1BL3A 4EYIB 2YNGA 3OYDA 1JL2A 2D5RA 3PR4A 1HYSA 3VQDA 2KFZA 1A76A 2J6TA 1IM4A 4IR1A 3ZT4A 1ASVA 4CK3A 1HUOA 4ELUA 9ICSA 9ICOA 4UAZA 1C1CA 2BCVA 5CYQA 1SKRA 1SKSA 3AO4A 1X9WA 2IC3A 4QWBA 2F1JA 4IQWA 1WLJA 4RQ7A 1JLBA 4WE1A 3V7KA 4C8NA 5KFJA 4O5BA 4N47A 1ZQAA 3VQ5A 1NK5A 3JPOA 3RH5A 3QZ8A 1S9GA 1JLQA 3SUOA 5KFKA 3RBEA 4BXOA 5L1KA 4FYDA 5KFMA 4FW2A 2IOCA 4B9VA 2WONA 3DYAA 5HHHA 5D46A 1VSMA 4UBBA 1EKEA 4PWDA 1N48A 4KN7A 4QW8A 1T3NA 4IFVA 3RAXA 5HRPA 1ZQLA 4CF2A 1ZQNA 4FJHA 2BGGA 4DLEA 2NRWA 4O3SA 4FS1A
chains in the Genus database with same CATH superfamily
3MOJB 4CLWA 3C2LA 1Y97A 1AFJA 3B54A 3RRHA 1S9EB 2ZE2B 4CGDA 3N4MB 5D4PA 2C2EA 1M5HA 3QRRA 4DL0C 3UQSA 3N5FA 4NLUA 5ETLA 1VQLS 3U3GA 3CDBA 2YMPA 4AM6A 2UUAJ 4KX3A 4PYAA 2ZJ8A 4WYLA 5ETSA 1RYUA 3S8SA 2XQCA 5E84A 3NOCA 1DY3A 4LJMA 1E6VA 1FVSA 3M4XA 3PHTA 1YIJN 3JS6A 1KDNA 4FJJA 1AYEA 1ECWA 1SVDA 4OKEA 3C29A 1NAQA 5DQHA 4OJHA 1R43A 3GBTA 4PG7A 1RDBA 1IXKA 5JUMA 4PXDA 3VQQA 1L6NA 4MK7A 2VKRA 3POTA 4DQRA 1KNZA 5AM4A 4LIRA 4JUZA 3H8YA 3HK2A 2DNKA 5EX3A 2FSKA 4YR2A 2V2KA 1EP4A 4BLGA 4P6QA 8ICXA 4BC4A 2FJVA 3BS9A 4O4GB 2MJUA 4O3PA 3BPDA 4GV3A 2V7ZA 5MLCQ 4I9LA 2AYEA 4LJXA 2E8OA 3ITHA 4ZP9A 2XG8A 1RDDA 2WAQC 3GONA 1VDHA 5HRSA 4J9VA 4YR0A 1RKIA 4OHYA 1ZM2A 3MURP 3QBWA 3OYJA 1SV0A 2NYHA 2CPDA 3E9PA 1CJUB 3K0JA 1S1UB 4E3SA 1OXJA 1JMSA 2VV5A 1CZBA 4UASA 4M3TA 1B70B 2VCPA 1DQAA 2O8BB 4B17A 2C2NA 8ICSA 4WK3A 4BC9A 2I7NA 1OH8A 4MLEA 3WZ0A 2IS3A 5D77A 2UUBF 3UXPA 2CQCA 2MY8A 4K5RA 1SH3A 2CPYA 3R3TA 1HBNB 1LW0A 8ICTA 4NEYA 2I0XA 4I2JA 5DDQC 1VSIA 3IO1A 2EKNA 2WHOA 3EXYA 2P66A 2OP5A 1WUAA 3HD2A 3K5OA 4F7VA 2W2PP 4UQGA 3NFAA 1FRXA 5A6WA 2CPFA 1S9EA 2ZE2A 4C4TA 4I6YA 1WWHA 3MDFA 3BQ1A 3KLEB 2P9PB 3IMQJ 4U67Q 4OZ1A 4C8MA 4GW6A 2K7KA 4O8UA 3SAHA 4KHWA 2HBJA 2PFPA 1K73T 4OYOA 3R6GB 3OJUA 1JLAB 3G8TA 4C97A 1YG0A 2XTJP 2XSFA 4C2MA 4FJ5A 3U1LA 4NLWA 4DV0K 1S7HA 2IBOA 2Z7JA 3H8WA 1RWNB 3V81B 3RJHA 2W04A 1SC6A 1WHVA 3M8YA 3MPVA 4EBEA 4J2AA 3JQJA 4NZ0A 3TW0A 2JFKA 2UXCK 1IWAA 4ED4A 2DR7A 1VC6A 1UETA 3LALA 5K5MA 1OPIA 1VSDA 2VFUA 3A12A 1WORA 3KKAA 2A3JA 1NNEA 2CAJA 1Q53A 4E7KA 1OVYA 1BXNA 2MZQA 4XPCA 1M5OC 4BCAA 2YJEA 1RGVA 4DV3J 2KJ8A 1MN9A 2B4PA 2W03A 3O4WA 3FDSA 5BREA 2EPIA 2RQKA 4DR7K 4YMNA 4E19A 2A1AA 2PI5A 2FD2A 3MR7A 3ELHA 1NRKA 2NUHA 2RS8A 1SL0A 3TJAA 1X4AA 3LO3A 2PFDA 1CJUA 3DLKB 4Z4GA 1S1UA 1L8OA 1UVMA 2O8BA 2M52A 2YQEA 2QXFA 2GVZB 2EI5A 1C7YA 3R5BA 2PYLA 2E5GA 4YN4A 1RZMA 2DGVA 2ASMA 2BW7A 3ICXA 3PSIA 3OVBA 3I33A 1HBNA 3BS5B 4Y1CA 4ACOA 2W1BA 2DWQA 4CHOA 2LXFA 3SK3A 5GAGI 2H3QA 3GIIA 4DV5F 4C80A 1Y4ZB 2R2SA 1Q7YT 2KQ2A 1Q79A 4OHZA 4JK1A 3HPOA 2FZCB 3KLEA 1WI8A 2P9PA 2AYMA 3SFUA 1HI0P 1SUQB 4ECTA 1MSWD 4ECXA 5DO2A 1I6JA 2V52B 4NYFA 3A5OC 2YXLA 4C0OC 3G6YA 1JLAA 1BPEA 1UPMB 5K9FA 1S1WB 1X9JA 1QE1B 2Y1RI 3QIOA 3O4QA 5HO4A 4DOBA 3OLBA 2XZDB 3R8YA 1VSEA 3UQ2A 3K9KA 2CH6A 4ZVRB 3V81A 3UCZP 2GUIA 3VC8A 5ADXA 3KNAA 9ICIA 5JVGQ 2ES6A 1X40A 1BIZA 3O4NA 5J0RA 3JPQA 4GKJF 3PRBA 3D45A 5DM7Q 2CG8A 3CIMA 3IS9B 4DL5A 1NJIO 1BQNB 2QC3A 1QUPA 3CD0A 1OWXA 2GMLA 3C6UB 4LF9J 5C10A 3D0GE 5KT7A 4TLRA 5AFUA 5DB6A 3WUHA 2KNJA 4O0NA 4PWWA 1GLBG 4IFYB 1WSJA 1JLCB 5E0OA 4A8FA 4P4OA 2MEWA 3VQ9A 2GC8A 1F5SA 2VODA 3DLKA 8ICRA 4LRBA 1TFWA 1N88A 1S1XB 3CCES 3MZIA 1HWUA 2GVZA 4RNNA 1HNWF 2EAPA 2F1IA 4KAZA 5ALTA 1TUVA 1RBSA 4BDPA 4A48A 1ZTTA 3SV3A 3BS5A 1N0VC 2HSTA 1KONA 2E1AA 2HBYB 1R0AA 2CGLA 2VWKA 4JBCA 5DQGA 4ZTFA 4JKGB 2CPZA 3UE5A 4DTUA 3K17A 4K4HA 2VPYB 3UNGC 4A47A 3PW0A 4Q43A 4JI7F 3PMNA 3EGVA 1RDFA 2GO9A 2DRAA 2D0BA 1SUQA 4MFCA 1RWUA 7ICPA 2U1AA 2K8BB 5F8LA 2VPWB 2XYGB 4P2MA 1CLFA 4CO5A 5KPTA 1CUKA 5GAGP 1T9VA 3NP5A 1L3VA 3IG8A 1VBZA 4C1NK 2K8CB 1S1WA 1QE1A 1WACA 1ZM3A 3EXCX 4WQ4A 4IL6U 2PC6A 2ZEJA 2FHOB 2VJUA 2AZ3A 5T7BA 1FEEA 2ZF5O 5J2HA 5AM2A 5KT6A 1HWKA 2ZVSA 1NKBA 4TVAB 5B09A 2GHVC 1UVKA 2HS4A 4P2FA 1U2VB 1QDUB 4FWPA 4MFBB 2OKQA 4F3OA 5DDYA 3WDOA 4ICAA 2OPPB 4DR6J 3IS9A 1B0XA 4CEFA 2E1RA 4QJFB 4FXVA 2BOAA 1BQNA 4LSLB 4KLQA 3RAMA 9ICHA 1VCTA 3WKCA 3I4PA 3ONNA 3MM8B 3AGKA 3NCIA 1VJ5A 4IR9A 2J8AA 4ID5B 5AQVA 4OYWA 2LCWA 3SUNA 4IFYA 3MCAB 1JLCA 1AROP 4LZGA 4OPKA 2ZM6K 2RJZA 5F41A 2Y9HA 2X78A 8ICJA 4RQ4A 2BVZA 2XB2D 4USMA 3MOZA 4Y2UA 1IR2A 1Q81O 2C22A 1S1XA 5HQMA 4CVNE 4GO7X 2VHGA 3F44A 2FGCA 9ICTA 3CMES 1X4BA 1RXOB 2GAHC 1LWFB 5KL8B 4PXCA 1FCAA 2AJ0A 1D5AA 1HJRA 4R5PB 5JJBA 1H3DA 3NUQA 4QYRA 2IRXA 2KVSA 2FF6A 3AARA 4O23A 3D1HA 3EPIA 3GYXB 1W26A 2ISPA 4R79A 1WDTA 3BZKA 3R7BB 1PJ6A 3CWJA 1KQGB 4U7UK 4JKGA 2UU9F 1S0VA 1S8OA 3CULA 5HMLA 2KIVA 3GYNA 2ZUBA 1X1PA 2Q2RA 4DX6A 3QMLA 5T7LB 2JX2A 3K8VA 3CF5L 5EGYA 2BE9B 4HAIA 4IKAA 2G1HA 2XYHB 2YNFB 5TKYA 2COLA 1G4CA 4B3OA 4XQ8A 8ICKA 5KFPA 2CXEA 4P2HA 3NE6A 3ISCA 5THWA 2AEMA 2P9LB 3IMXA 1URJA 4EX6A 2XGQA 2KG0A 5AI5A 4OI1A 3HL8A 3GV5B 4RQ2A 3VERA 4KGZB 2W01A 3U8XA 1U2VA 2AXTU 5AE1A 9ICEA 1DZ5A 4MFBA 2FVCA 2C2RA 2G0CA 2HRYA 2LXIA 2OPPA 1ZJNA 4JI5K 4ZDNA 3A3PB 4J91A 4USIA 1Q7LB 1IWGA 4AM7A 4LSLA 4AHCA 3TA2A 4I6AA 4X4UA 3U26A 4LZDA 1NSAA 1YITS 3ED5A 4PGXA 3AXMA 1FJEB 2F4FA 2W9MA 2HZCA 7FD1A 5M1OA 1SPBP 3MM8A 2KDOA 1R0CB 4E89A 4ID5A 3TANA 4CIGA 1RAJA 1HPZB 3CGIA 2KI2A 2DBBA 3KHLA 3GG4A 1SJ4P 3A8YA 3D2SA 3ZZPA 1OUQA 1NGIA 3EICA 1ZBUA 3S01A 4US8A 2R7SA 1N36K 4QZ9A 4BRMA 1IJFB 3G8QA 3CCUS 1BE4A 4YOTA 2BHNA 2PT0A 1T4GA 4DV0J 1QQ6A 3TZXA 5CP2A 5TKWA 1IBKK 1LWFA 3G96A 3CEDA 3C46A 3VAMA 1G15A 2Q6BA 2AQ4A 4R5PA 4RCHA 1TU0B 3A1YG 1SJ1A 1WG8A 1M5KC 7ICJA 3RJIA 3T1HJ 2ZKTA 3QIPB 4UY85 1RP5A 2O3DA 2AH5A 3TFRA 3I87A 3KKFA 4WCEL 4WF9Q 4GIBA 3LQVA 4K4VA 2RHKA 5ALIA 1KHWA 2QLWA 4C3LA 5KFEA 5KG5A 4DPOA 4U6PA 2OSQA 3E01B 4JV5F 2VDHA 2RT3A 5AQRA 4L74A 3HP9A 3ZNUA 1R3NA 3Q8QB 2ITGA 2QMXA 1BCMA 2BM1A 5ETQA 3UD3P 4QZFA 5BOMA 3TX8A 3C95A 4UQTA 2E20A 3I31A 3P96A 1MQ3A 1SQGA 4J9QA 5T7LA 4IQMA 3CJ2A 3BO4A 2VJ4A 3QERA 4IOCL 3HWTA 3CMQA 5D78A 2PDAA 2D3OR 2YNFA 1WC4A 2VG7B 4J7CA 4AUKA 2B3TB 4RBTA 5J0OA 2CJQA 4J8FA 5FP0A 4NM1A 5E3CA 2P9LA 2FHKA 1RQNA 5C2GA 4C7ZA 1S6PB 3HKWA 2DGXA 2VA2A 1RWKB 4MT1A 5IIMA 4Y2CA 3ILIA 1YF5L 4UATA 2A1RA 2E8MA 2G5IB 4M42A 4ZOHC 2CZ4A 4F8RA 2AJ1A 4RNOA 1M0SA 2P2CB 2Y1IA 2AGQA 2BDPA 1RFQA 4DFDA 1RYRA 5AQIA 1B0PA 4MAKA 2M8HA 1X4DA 3SQ1A 3P5BP 5SWMA 4KE5A 4LD0A 4OPAA 3O3LA 2H5JB 2YQ0A 1HPZA 4DKWA 2WF9A 3OTOF 1NKCA 5KOWA 3VAFA 4RZRA 4YNQA 2HIYA 4CRJA 4GC6A 4I2EA 4KHPK 3NGKA 2G13A 1K8AT 4H54A 3QFHA 5F0UA 8ICCA 5D4NA 1JCFA 2OHFA 4ZHRB 2ZTDA 4CHNA 3S3NA 1B0VA 1RT1B 1BG3A 1EQMA 1RBUA 4CI0B 1J5EF 5AK5A 1RSCA 2WSCC 3IKMA 3I9V9 3MAHA 3FFKB 5KFSA 1MWYA 3M6WA 4KRWA 3FAHA 1URNA 2H3IA 3C14B 4YCXA 3CCRS 4RQ6A 4AQYK 3FMBA 3KG1A 3RMCA 4BRHA 3HX9A 2RQCA 1BWVA 3E01A 3CJAA 5IQ6A 1UW9A 2IMOA 2NRHA 5HSPA 2HFNA 2ZH4A 2PZSA 5H1SV 1NM2A 4FPIA 1DHMA 1RB0A 2KZMA 3C66A 2H3GX 3BUZB 4E1JA 2XLIA 4HH0A 2FMQA 1S0OA 1HNXF 4BE0A 1BUXA 2IHNA 4OFZA 2A1SA 3I5BA 4RNMA 4AE5A 2AX0A 2IJNA 2VG7A 4OI0A 4ZVUB 3N4PA 3T3FA 5HJXA 4Y1DA 4B3SF 1RAHB 9ICLA 2W3RA 2KJ9A 2PFQA 2WRMA 1NHKL 2V8DA 1RBTA 4FZNA 1KTQA 1S6PA 2C3YA 3SMVA 3H2UB 3DDIA 1WG4A 3R1LA 2EDUA 2D74B 1CI4A 3GE1A 1XO0A 4WTYA 4DTNA 3D5MA 1F3VA 3VHQA 3MPWA 5C2DA 1HHQA 3PO4A 4J9LA 1SAZA 3FRZA 1MC8A 2AD9A 3NF7A 1U24A 4OX6A 3GG0A 2F9DA 3IV6A 3H42A 2ACMA 3Q86A 4X62F 2FC8A 4ECVA 4F5QA 4JI6K 3D0HE 3BH7B 1VSFA 3I28A 3X3UA 2Q43A 1NO8A 4Q0BB 2VJ5A 3HULA 3CMAN 2Y8YA 1GLDG 4FKXA 3Q0AA 4AL7A 4JK7A 4CHQA 2DIVA 2OYQA 4Y2MA 5C5JA 1D3WA 3MGIA 3GFKB 1PCAA 4HHJA 1N5WA 1ITPA 2MQOA 2ROPA 3BBBA 4ZHRA 1V85A 1EARA 1LQ9A 1RT1A 3NS5A 3D1QA 4M5KA 4NRTA 2BE7D 1SIZA 2OEMA 3OLAA 2W9CB 1UTAA 3C14A 2FJWA 2KKVA 2UVRA 1QAJA 5AXKA 1QQCA 3AVCA 1U1MA 2I8EA 5J0WA 2VOPA 3MC1A 1JXEA 2BJ3A 4DEZA 4DXLA 5ETVA 1YJUA 3QAUA 4LSNB 3D7EO 4H0VB 5GMDA 4WP8A 2BEFA 1HYSB 3ZO7A 2VIHA 5DG7A 3G71S 4UBCA 3K5MA 2ODGA 3BBCA 1RBRA 2ETJA 1VC0A 2R2TA 2L41A 2O8FB 1YWXA 2Y0SC 1J53A 3ATVA 3IAYA 2ZIUB 1VGYA 2HHQA 3OYBA 3Q23A 1SZHA 2WZ1A 3K58A 2BRKA 2B7CB 4I67A 1GXTA 2A2CA 4KHMA 4R0EA 4BRCA 1V4TA 3CRXA 3NCPA 1TE2A 1WG1A 3CCQS 4B9MA 1FDDA 1ZAXA 4DR2K 1RCHA 3O8WA 5KFWA 3WXLA 3UPFA 3HYFA 2PGCA 1C0TB 4HCCA 2EBGA 3B4DA 4NA2A 2F4VJ 3RH4A 2R2UA 3W5ZA 4LF8F 2ZH2A 2OELA 1OSDA 4L72B 2V2QA 3H4BA 5B0EA 5MAOA 4K4ZA 3MCMA 1K1QA 3KYLA 4JI3F 3NVKA 4Q0BA 5J0PA 4NLKA 4Y2SA 5ALNA 3QAEA 1NDLA 1LK7A 2IA6A 4XK8C 4DV7F 2C2KB 4F4WA 4M9LA 2RIJA 1HR0K 1NHVA 1IKWA 1SBRA 4ZITA 5GAEP 4WWSA 3NMUA 5KI6A 4DSKA 5KFIA 4I56A 1VQ7S 1VSJA 3V7JA 9ICGA 1HPMA 2J9CA 4HVJA 3TOQA 1C4CA 7ICSA 5BXIA 2KV2A 3AA4A 3KZIU 4F25A 2UVUA 3VESA 1A9NB 3HI0A 2W9CA 3FBCA 2YN4A 2OM6A 1JXVA 4FZYA 1G3OA 5E7OB 2XRIA 1G1XA 2MZRA 1NLVA 4CJKA 1T11A 2QEXS 2RU9A 4OJ3A 4JI5J 4HDGA 2HYIB 1XUPO 3ZSVA 4WTOB 2BA9A 3VCDA 1N32F 1SXEA 4FN5A 8ICOA 4LSNA 1Q78A 1ZD3A 1OVQA 4RUBA 1Z26A 4BRQA 2WB4A 3CDEA 5LMNF 3EVMA 1GAOA 2D3O1 5LJVA 4Z6DA 3BQTA 3W2WB 3H6EA 2E29A 3FCHA 1BU6O 4LIWA 1Q5YA 1YBTA 3NVWA 2HHVA 1X4CA 3ZYYX 2JEGA 4OJPA 4ZVSB 5BPCA 2O8FA 3DDHA 3ET6B 2VICA 3QU7A 2PFUA 3D6RA 2JMGA 3LDNA 2ZIUA 1HI8A 3OGUA 4LRCA 3WNHA 3ZZ0A 3SXLA 2ZHOA 4A2AA 3X1LB 2QV6A 2GH1A 5L38A 1N36J 1JLFB 4CESA 7ICOA 1FJ7A 3GU3A 4NXZA 1IBKJ 3CJCA 1D8YA 1AB8A 4E7HA 2IYIA 2ROEA 4BG8A 1S6UA 1RDUA 2J0SD 3MMAB 4CJWA 5G0RB 3LF0A 4F3MA 5DMRA 4TUPA 1C0TA 4DV1F 1VQ5N 5AQTA 1UP1A 1A5WA 4USHA 1N5QA 3K9JA 3OXFA 2CRLA 3BSOA 3AD9C 1W9HA 2P51A 3F5AA 3ZDEA 3V9UA 3HOSA 1H98A 5J2QB 4ZLPA 2DNLA 5DZ6A 3N97B 3AVNA 2F7TA 4FZLA 1NCLA 4DF8A 3OV7A 4Z4IA 1YRXA 2VB6A 4JK8A 4CJ5A 2CQ3A 2VFRA 1GXLA 3ETMA 4EHTA 2E9ZA 4CDIA 2Z2MA 3VEXA 2XGPA 5GIOA 3QBXA 4CE6A 4F93B 4ICLB 4USUA 1A5XA 4YB1P 2KM8C 7ICVA 4OYZA 3L2QA 2RQ5A 1MA7A 3R3LA 1RWWB 3TUPA 2JZ5A 4JI4J 1SWWA 5KQDA 2M0GB 2EFNA 2A6MA 2UUCF 3QEXA 3GYGA 1C0FA 1SB6A 3VQ6A 3D3BJ 4Z4CA 1M1GA 1KVCA 3MI7X 2DNYA 2KFNA 5M1PA 4O3OA 2GJIA 3CD6N 2G1DA 3P1GA 2R7OA 4P0QB 3W2WA 4GVMA 2K8AA 4QWCA 3O2IA 3B8AX 4OLOA 2KB2A 4USKA 3AA5X 1PC5A 1U47A 3ET6A 1VS3A 1V5VA 2P35A 2NV3A 4LY7A 4FVUA 2OTLS 4KHPJ 3FM9A 2VU5A 4OJRA 3SQ0A 3ENQA 4FWKA 3FGVA 4KGKA 1O03A 2E1CA 3AVMA 2HQCA 3K89A 2ZXIA 3TR8A 2MKHA 1RXVA 3MMAA 1CC7A 3JXOA 5G0RA 1WUDA 3TFSA 3Q83A 2Q0UA 2ZH3A 1WF2A 2J9DE 3QUCA 2WHEA 2WVEA 4OI4A 4C6AA 5AHXA 3N0VA 1I94K 1WJ9A 1Q1KA 4CHPA 3CCMN 2F8KA 1TVRB 4AHRA 2H51B 4EMDA 1VLBA 4JP8A 5J2QA 2KJWA 1QQMA 1Y7PA 3UDEA 1SGGA 8ICNA 3I9ZA 1NGHA 4NY8A 2HG4A 2OPRA 2JEJA 4JI1F 4BJQA 4YP3A 2A40A 1EXQA 1BQMB 2IM3A 1ATNA 4FOIA 2JC0A 2F9JA 2XM3A 4KLIA 5L39A 4LF5F 1VFJA 2BQRA 4P71A 2AP1A 1BGXT 1BQXA 2R7QA 5CD4A 4LVSA 8ICYA 4Y3CA 4M5IA 3MAAA 2E4LA 1TGOA 1EHWA 4ICLA 3ETLA 2AEFA 1S6QB 4M3YA 4PRFA 4FSVA 1EKSA 5ETOA 2WK4A 4ZLLA 3L3CA 2KHQA 2FHJA 5KFXA 1TZ0A 1ZQUA 3T19A 3LM9A 4DR1K 1FNXH 3T5KA 2QL5B 5LSOA 1T9WA 2ZTEA 3W9JA 1PAEX 4FJGA 4JI6J 2XZWA 2HBRB 1QUVA 4FVCA 1C1BB 1RWPB 4R0JA 4ZK7M 5KG3A 4P0QA 3VQBA 3I0RB 1WC3A 2B56A 2J0XA 2GLEA 3CC7N 4RKUC 3PG9A 1NK0A 5AQJA 2NXUA 2VASA 3AOAA 1CEZA 3TJ9A 1MW7A 5F8NA 4WKYA 5EWFA 5IIJA 4QZBA 5IINA 4Y2XA 2K60A 1L7NA 2BJEA 5IT0A 2GV9A 4TQRA 9ICWA 3CC2S 2X7IA 2WB1C 4ED7A 2FJAB 2HRUA 2IRUA 4UAWA 4CFAA 1IG9A 2QW9A 5ALPA 3W62A 1NJWA 3TKAA 3NY0A 2O4IA 4HDHA 3ZNJ1 4DI6A 4E7IA 4DB3A 3ZTSA 1TVRA 2YCHA 4MYUA 2YWHA 4NO7A 1MLAA 1P27B 4KN4A 3GDXA 2IVYA 3GLJA 2CQPA 1Z00B 2AEJA 2E1MC 2E5JA 3C23A 4Q2MA 5ALHA 3KNGA 2O4GA 1VQ6N 4ZCIA 1IBLJ 1BQMA 3KG0A 4BDZA 2MTLA 4I2AA 5CZ1A 4KH5A 3UR3C 4DJBA 1FJGF 1ITGA 3CJKB 1N8RO 1OQ3A 1H73A 1ASUA 4Y2YA 3CCZA 5JVHL 4PL7A 3QNMA 1S6QA 3K5LA 3N4WA 4EFHA 4A8EA 4CO1A 3R9LA 2O8EB 5LM7E 1F1BB 4CTAB 1O8BA 5IT9O 3WK7A 2ZJPL 1KD1O 4C9DA 4N56A 4ZJQA 3Q8KA 5IM0B 2J0QD 2LYBA 2RUGA 4CRXA 2EFGA 3AB2B 3KUHA 3A2FA 7ICQA 1X0FA 4ECYA 2VFVA 3GIMA 2ZJRQ 4M3WA 3L8BA 1VQ8N 1T44A 3DRYA 2VQEJ 1TFRA 1C1BA 5L9NA 4YY3F 3ALRA 3MXHP 2BCSA 2MKJA 3I0RA 2E66A 2O67A 4NLGA 3QRPA 3DC2A 1KCFA 4FK0A 4PABA 3TTDA 2ZC3A 2AYBA 3SDEA 3CUNA 4CZEA 2RE2A 1HR0J 5GTIU 4YFKA 4RQ1A 3QEPA 8ICIA 4EEKA 3RR8A 2DFFA 3GPAA 1F2GA 2JDJA 2N4DA 4RPFA 4DTRA 3C6HA 2ZZNA 3FVYA 3FJ2A 4OYBA 2JEIA 1YTAA 3Q8PB 4WFZA 2YKPA 2LYAA 2PMZC 5KNIA 1FX4A 4NLYA 4KITB 1A6LA 3C19A 4M9GA 1ZM4A 4Y2AA 2E2PA 4DR5K 3F2CA 2I1RA 1YTYA 4DOZA 1NBWA 4NX9A 3CC4N 2EHGA 1NK9A 4YMMA 2IOFA 2CZ9A 3HVRA 3O1BA 1CSJA 4QIVA 4X64F 4ZVFA 1Z00A 1JLQB 1YK9A 3IM9A 4DFJA 1NH8A 2QWOA 1P9YA 4V19S 3DYAB 2BCRA 3QNNA 4QR2A 3CXCM 2R7XA 2P6RA 4I9QA 1S5JA 2QKBA 3CJKA 5CAAA 3LDLA 2NQPA 4HCBA 2V4JB 2QLFB 4I29A 3TEHB 3I5CA 4WQ5C 1O5JA 4FYXB 1YTUA 4DR3K 1JUDA 3AVIA 2YQ3A 4J2DA 3VETA 2O8EA 3KKRA 4CTAA 2DPNA 3TSQA 4B3RK 4PYDA 3W60A 4EI2A 4FF2A 1JWWA 2ZZTA 5IM0A 4WFAQ 2FLLA 5J2EA 2E5HA 2LA6A 2EZZA 1SJQA 1LOUA 2E5SA 2W55A 4OJ1A 1WAJA 4ED0A 1WUUA 1U1NA 3E1YA 5DBAA 4CBUA 4DPXA 1VQOS 1D8ZA 2CQ4A 1B9DA 4ZJLA 1YJWS 4QPTA 1NK6A 3J81O 2D7SA 2F8EX 5CCMA 2IGIA 1VQ4S 3MMCB 2ZDPA 3TU5A 4ZVHA 1ZQ1C 4KLFA 4EP5A 3WKDA 4X4QA 5GAHP 4G65A 3BF1A 5FJ4A 5BYSA 2XWXA 5LT5A 5KPZA 3VGUA 1UL3A 4DV6J 3F2DA 3VVUA 1IXRA 3AA3A 4RW9B 1UAXA 3MGHA 3N7PD 2B5JB 3IG5A 2D9PA 4EYIB 4FOEA 3OYDA 1K44A 3VQDA 4AYBF 1ZRMA 2EBEA 1ASVA 4CK3A 2Y0BB 1R8BA 3MWPA 3RJMB 4HTJA 3DRXA 1O51A 2MHEA 1Q95G 4UAZA 2BCVA 2C2OB 2DHXA 5AE2A 1BOTO 1SKSA 3TUZC 4CZLA 2FZGB 4QWBA 2F1JA 3VF0B 2DGZA 3V7KA 4LF4J 1FX2A 4C8NA 2GIRA 2YX4A 4O5BA 1K0TA 4BY9C 1WKLA 1ZQAA 1XMBA 3KWMA 5CEHA 1PJ5A 1JLQA 4F3QA 1VBYA 5L1KA 2APOA 3RZAA 3DYAA 4UBBA 1EKEA 4KHRA 2YMLA 1TYQB 2ZDOA 1QHAA 4NLSA 2QL9B 2V4JA 4H4MB 5ETTA 2FJ6A 4L76A 2DNGA 3NNAA 4ZP6A 3MMVA 4CO2A 2NO5A 2JL9A 3R1HA 4FS1A 4KIAA 3KBBA 1FESA 3L95X 1MA9B 5AFUH 2G8FA 4FLTA 5J1NA 2GWSA 1X8DA 4Z37A 1R27B 3JPPA 4IOBA 1U6FA 3WK6A 2HRTA 2MJNA 1S10A 5A0YB 3CCVN 3EZWA 4DOCA 1R8HA 2HZVA 3HHLC 4A57A 1B43A 1E4FT 4B1UB 2X6SA 1I1GA 4N77A 3CIPA 5C0YA 1RTDB 4DHVA 4CLFA 4BGAA 5E3AA 5EY4A 2A6AA 1RT2B 1HQEB 1H7XA 5L1IA 4M63A 1F9HA 3MMCA 2HVIA 2D6FC 4O0IA 3JSMB 4F4AA 1YZ6A 1CG2A 3J7AN 2KN7A 1RWMB 2XIDA 1UVIA 1VQNN 4RW9A 2B5JA 2RF2B 5A8WB 1D9AA 4GLXA 1UA1A 1OY6A 4C11B 2YHXA 3T9ZA 3WNEA 2EAMA 3LP3A 2L9WA 2V67A 3PFOA 4RWTA 3SPYA 1X31C 2CGKA 3WXMB 3I76A 5EN1A 4USVA 4K25A 1B7FA 3AV9A 2W9BB 1YGYA 1WSFA 4FM0A 4K4UA 2DY9A 1L3TA 4ECSA 3QWPA 3KLGB 3BYRA 3SYZA 2UUAF 4DR1J 2FXUA 1A7GE 1JCEA 3BS7A 3ZTQA 3H8JA 4QZGA 1NH7A 4J37A 3CM5A 3EUNA 2IVOA 3Q8LA 4IQXA 1N34F 2V9KA 4PPDA 2BBEA 1WDDA 5DG8A 2YKQA 1VLOA 3PW2A 2HHHJ 2MQLA 4KHSA 1BVSA 1E3MA 4EYHB 5DM6L 1WSEA 1TYQA 1H74A 4C3KA 5I42B 4LFCJ 2BE2B 2E88A 5F9LA 2IDOA 4H4MA 2CJXB 4YDUC 1IV8A 4K2JA 1P90A 4RPYA 3Q89A 3V4MA 4H4KC 3GV8B 3EN9A 4MDAA 3ZDAA 3H08A 3I55S 4CJFA 1U1OA 5J2BA 4DQSA 1VQON 2R7TA 2MZTA 4QR0A 5A0YA 1LWXA 2UUBK 1FD2A 2GGPB 1NU0A 1FO4A 3BGOP 1FFWB 1X6IA 3QU9A 5AI0A 4I64A 2KZZA 4HKQA 4P7VA 4LT6A 2KTQA 3VWSA 4K4GA 2E7XA 5E3QA 2QA2A 3GJQB 2RHFA 1B9FA 1IG8A 3M8SA 1RT2A 2EFPA 4HTUA 3TO8A 3PTWA 1HQEA 1S1VB 4M9HA 2OMOA 4OJ6A 1FRLA 4ZVPB 2WC9A 4KB0A 3JSMA 1YJ9S 4PHTX 1X5OA 4A8XA 5ETKA 2ADCA 4U9RA 3BYPA 3WXKA 1U1QA 3IC1A 2FZKB 1LB2B 1KQKA 1GLCG 2CNLB 2J7UA 3OYCA 2RF2A 5A8WA 4KC5A 4C11A 3LPEA 4BR5A 1WELA 1M90T 4PKGA 2ACYA 5BR9A 4GY2B 4PL2A 3SMSA 5CABA 3TUJC 4OX9J 2NSBA 4UB6U 2W9BA 1TVAA 3MM7B 4XIUA 2FPMA 5LMUF 4PQAA 1Q16B 3OYAA 1CLQA 3KLGA 1I5OB 1RAOA 3GL1A 3LPUA 4K42A 3CPWM 2NS1B 1U9LA 2A6OA 3IAM9 4KREA 4KY3A 2UP1A 4FVMA 4MKAA 3UD4P 4ZPCA 1X4GA 2ZBRA 1HLWA 4BGDA 3CXCR 4YXJA 3HW8A 2LI6A 2DGWA 5IOLA 3RW7A 2G9OA 4AFFA 4NB4A 3B6OA 3KHGA 3AGRA 5K4LA 2N82B 5I42A 2BE2A 3OSPA 2GAGC 1M1KO 3R7NB 1RWVB 2DH7A 2G2YA 5I4MA 2M0NA 3SFGA 1UWAA 3RH6A 1V3ZA 2KO1A 3CCSN 2G8HA 2YQ1A 1IUJA 1N56A 3CFRA 4QS7A 1N63A 2EG1A 3PJWA 4I28A 3R5GA 4IXCA 3CCLN 2XMWA 2BPGA 2Z0GA 2GGPA 4DV3F 3GIJA 4GMJB 3PRVA 3BEXA 2CQGA 1V38A 2FBVA 4CJEA 1V3SA 1YJTA 1UHUA 1OKJA 4KYZA 3NGRA 4EO8A 3BR9A 4DV5K 4M5DB 3F5TA 1S1VA 4CF8A 1RLCL 4C8OA 2OPQB 1KAYA 2B4VA 5HP4A 2CG4A 3Q8YA 2BACA 3IDWA 2NPIA 1S3XA 3OL8A 1Q8LA 2VC1A 3S6EA 3WK4A 4KLLA 5F3TA 4ENOA 1BNOA 3SZ2A 4LQ9A 3A0IX 3TADC 5K14B 1JK9B 3DRPB 2I9GA 3R97A 4QIWC 4DSFA 2O8CB 1S97A 2GV1A 2XI3A 2E1YA 4F04B 5JXSA 3PIOL 3L3FX 3DDKA 4DR3J 5KFFA 2I5JB 3PACA 3SI6A 2KP7A 2WFAA 2QO3A 3MM7A 3SENA 3MABA 4B3RJ 4OGEA 3PMLA 1C0GA 4F71A 4GKJK 4FLVA 2NRRA 3HVWA 4M8LA 1A6SA 3W8GA 2ZH8A 1U1KA 3QFWA 2DHAA 4NCBA 4OZ3A 2IAJB 1OH7A 1Y3KA 3D2QA 2M88A 1BWEA 2F9TA 1M5PC 3DDNA 2WOMB 4KBIA 1VBXA 1NMDA 5CXTA 1T3VA 3FR0A 1O13A 2QN6B 4KLSA 2K4HA 1MWKA 1VQPS 4CF9A 4LVOP 3GFYA 3WKAA 1DAXA 3N5BA 5DQIA 3KMSA 3ENWA 1XU4A 3MUTP 1UZDA 4BRGA 2PFFB 3K59A 2WMMA 4YEAA 4NXNJ 3W9IA 4NM2A 1MG7A 3M6KA 4CH1A 2FLOA 4ZPBA 2A5XA 4ZPTR 3KOOA 5ELZA 1Q18A 4X66F 3MCSA 1TP7A 1LKZA 3M7DA 5DM6Q 4F4KA 3AQPA 3OQ2A 5EU7A 4NL9C 4LF9F 4CZCA 5EE1A 3B9JA 2YV0X 2CQ2A 2BJ1A 2IPOB 4FDFA 2WTFA 3AN1A 3GILA 3HPGA 7ICEA 1KWMA 3KXDA 1D9DA 4DR4F 2W40A 2V68A 4EP4A 2G09A 1CJVB 5FPNA 5HMXA 4M5DA 1C1AA 2UVVA 3A3NB 1QVGM 1S72N 2OPQA 3AM9A 1N52B 5AM0A 3L4IA 3R2DJ 3UIQA 4FF4A 5I9EB 2HAFA 1VMBA 3UFCX 4JHDB 1IKXB 1YDLA 4RBVA 5DK5A 5K14A 2DRBA 3D6MB 2H65B 1Q82T 4M3XA 2O8CA 5ALEA 5A0LA 2GO8A 3KK7A 3IWNC 4H5WA 2GJ2A 3FQKA 3G87A 2I5JA 5GVQA 1ZQVA 2QSWA 1PYSB 2F77X 3Q2SC 4AILC 1BHNA 1K9MT 1OH5A 4FO0A 3AQOA 4CLYA 4WFXA 5ALQA 1PK3A 3RJKA 1IV0A 1DTTB 3CG7A 3CETA 2A1JB 3K0SA 3VQEA 4I2DA 2IAJA 1YT3A 3WQPA 4OPJA 2WOMA 1XMQF 5B8HA 3VAIA 1LEOA 3OTEA 1BNPA 1XSPA 3Q2TC 2ZQBA 2B51A 4E2FB 5FROA 2HQ3A 1FT8A 3L4PA 4I68A 1XNSA 3LZJA 4W4MA 2KZ3A 5CJ7A 4PG4A 5J2CA 1UJ5A 2QWQA 3P49B 2ZHAA 3QJLA 1RPLA 3S9HA 3MD1A 3U9DA 4DR6F 3VGKA 1KBRA 3WX8A 4FJ7A 4TURA 3TPQA 5FPMA 5ALDA 4F92B 4A2BA 1N5TA 3G10A 3GJSB 4M6WB 3GB0A 4G1IA 2XNRA 4JRPA 4CO4A 2MQQA 1X9MA 4NZ6A 3UO0A 1N33K 1WC0A 4YB5A 1N6QB 5CR0A 3V6KA 4UB5A 4J2EA 4P4PA 3HJVA 3IRUA 3AVFA 1OYEA 1CJVA 5J1PA 1X3MA 3AJDA 4RL1A 3Q22A 2UU9K 3T41A 3AHPA 3PM9A 2ZGZA 1Y00A 5E3PA 4IOAQ 2JC1A 4XRHA 1W2BM 4CJQA 2ZG6A 3JQKA 4JHDA 1G99A 1BLUA 4ZP8A 3VCBA 1IKXA 3PKMA 2XHBA 1Y64A 1ZOLA 1GOCA 3NVMA 1XSNA 4IEEA 3IGVA 4JB3A 4DCCA 5M2PA 4YOVA 2G8UA 2UYTA 4HH1A 5KG7A 5KGWA 3P4UB 4OYIA 3I56S 3MN6A 2DEJA 3CSKA 4JS5A 1YBAA 4EBCA 3EVOA 3KHRA 3ORYA 3THVA 4PL8A 2G0IA 3CPWR 3PNIA 2KYZA 4BACA 4WFYA 4K4SA 3VGMA 5HAOA 3CJTA 1DTTA 2MGZB 4CZJA 5CZXA 4ALZA 2A1JA 3IBWA 8ICLA 4DTPA 4K8ZA 1WSHA 1SWVA 5ALRA 4YG2A 2POKA 2DFLA 4DCOB 1XNQJ 2BMBA 3MM5B 4JK9A 3PIOQ 1JCGA 2DGUA 4OV6A 2RVJA 4KB7A 1J2MA 2I5HA 2HQGA 3FZBA 4ED8A 3TP2A 3HX0A 2DXDA 3EE8A 4WPAA 3HP6A 2Z56B 1HL6A 1VK3A 1S76D 3AVJA 4TUSA 4R64A 2JOQA 3WIUA 3CCJN 1ZPWX 3RJEA 2XMMA 2O8DB 3M7VA 2DGOA 2VJVA 4QQBA 3QGHA 3IP0A 4H5NA 5ETRA 3VAKA 1FI4A 4M6WA 2D0CA 2XYPB 3A8EA 2C42A 4JRQA 4F26A 2M4MA 3HFVA 1UCVA 3NKYA 4RPXA 4FO6A 3SMZA 4LF6K 2BDUA 1YJNN 2LKZA 1N6QA 2KG1A 2L08A 2JXJA 4JV5K 1U2CA 2UZAA 4OLPA 4HR2A 5AKKA 4CZGA 4QIEA 2B9XA 5FDLB 5D8HB 3V6HA 4UF4A 3N4QA 1W25A 2ZOGA 2Y8WA 1WBDA 2OGUA 1RBAA 4E1NA 3WT0A 4YR3A 4F5RA 3SD7A 5FPEA 1FFGB 2NNWA 3RBDA 4QZIA 1XHZA 2BJ7A 3T1HF 2BOPA 1F21A 1WSGA 3QEIA 2IFXA 2NXNA 4KHQA 4ILJA 2G5HB 4XDDA 3HT0A 1WNEA 3VAHA 4M3ZA 3W2VB 5H2FU 1V3RA 5HP1B 3ZTPA 1TAUA 3DI6B 5E41A 2W43A 4O55A 4JKAA 3PKYA 3O3GA 3EGZA 5A2QY 2MGZA 3UMCA 1KKXA 4NYNA 1QAYA 2VIXA 4DUZJ 3BP8A 2C2DA 5L46A 4ECRA 1X5SA 3MEEB 2HI0A 2OO4A 3MM5A 3VGSA 4CF5A 4CBWA 3CJ0A 2K2PA 2J6UA 1GLAG 4B1ZA 3M8PB 4DV5J 2HQDA 4NLPA 1I39A 1V5IB 2IVNA 2PBDA 5H9EK 5AKYA 3OTOK 1GNKA 2KSOB 3UCGA 3O6QA 2JHEA 1DGJA 2CNOB 1QS4A 3SBMA 4UY8T 2O8DA 3JTOA 5KFBA 2GJFA 2NYIA 3C2PA 3R8EA 2LVWA 4EU0A 4DL2A 1K47A 1J5EK 4M41A 5F0WA 3HO1A 2DPJA 4BDYA 3FZLA 1NGDA 1N5VA 1QVGR 4ETXA 3QATA 3WX4A 1JNZB 2PD1A 4GKJJ 4JNEA 1TL3B 5KRTA 4JB8B 1D4XA 2FPLA 2J9DA 2V8HA 2WBRA 4H5VA 2QA1A 4E7LA 2ZBIA 4HUFA 4Y2VA 5FDLA 2QX0A 8ICHA 2LBOA 1S5LU 3LANA 1P8GA 4HLBA 4JV1A 2EZYA 1WHXA 2DNQA 3FFIB 5C2CA 2GHPA 1B0TA 1SH2A 2V8PA 4F5OA 3PHEA 4D3GA 4ED5A 3NH1A 3LA0A 2B4JA 3HDSA 1O1WA 3A5LC 1LNQA 2E7VA 1K0VA 2QFIA 3KKSA 3F9KA 2YTUA 4B3SK 5M1NA 2K7JA 2XY7A 3TYTA 1RDRA 2QRRA 2FVPA 4ILHA 2FPHX 3D2NA 1OIAA 3CD5A 3W64A 5AJ3J 1IBMK 3W2VA 1DFDA 5HP1A 2V4QA 3DU6A 5D15A 2HF3A 3DI6A 2OPSB 3RRKA 3HVAA 2A42A 5DDPC 1JJ4A 2VWJA 2K4EA 1NEEA 2YB1A 4U96A 3SNNA 4EZ6A 1VQMS 3MR2A 2QWLA 4X62K 4H4OB 5LY3A 3MEEA 3DCAA 2LHTA 1D8LA 3D1OA 1RGIA 4IO9Q 2R7VA 3MPYA 5JLHA 2GA7A 3M8PA 2RE1A 2ZH1A 3KHYA 4KTWA 2X3DA 2F7VA 4ZVOB 1SJFA 2GQ2A 3FSIA 1NPRA 3M5RA 1P1TA 2HSEB 3ISBA 2KSOA 2KMDA 5KFDA 5C12A 2ZWOA 4CEAA 4O3NA 3G4SN 1WC1A 1AT1B 1YRTA 5DRKA 2DCUB 2W11A 1RT3B 4IDKB 2XMAA 5B0FA 3ALYA 4O5FA 4N5SA 3S1TA 3SMPA 4Y28C 4MKBA 5AKXA 1V97A 4QAGA 2A0FB 6FD1A 1NK8A 3HSJA 4J5OA 1TL3A 3ZSZA 4GRSA 2BYCA 3B4MA 1W2BR 3VA3A 4DLGA 5CD4H 4AF1A 4BR9A 4CEQA 4WU3A 1YRUA 4P2XA 5B0GA 3AVBA 2CVIA 1QJHA 2GFFA 3QXGA 3PX4A 2DD8S 2E6LA 2F2AB 3FFIA 4ZCLA 5CH7B 4CGJA 1MWQA 1QZ5A 4C7QA 4B1YB 3OUYB 2OAUA 1QZ6A 3TAMB 2PEBA 1ZYQA 3R9PA 8ICVA 3RMDA 2XS7A 3AB4B 2FTRA 3CJBA 1MQ2A 3E66A 4I2GA 4CK1A 3ISNC 3H90A 3O1LA 2I6XA 1RA6A 4MYTA 2GX9A 2KHOA 3AA9A 2ZH6A 5AXNA 1NKEA 4O3QA 1V9OA 3W9HA 4RR5A 3UWTA 4WKRA 2DR6A 3JSYA 1PVQA 3NRZA 3M6VA 1PGZA 2R8JA 5J1EB 1D1UA 1N33J 4H4OA 2BM0A 1I3OB 1TK5A 2F8LA 2NXCA 3KUGA 3SCJE 1T03B 4LF8K 3M6ZA 8ATCB 1TK0A 3FSYA 1NJYA 2UU9J 4NV0A 5HQ8A 4R66A 3NDKA 2BW2A 5AM1A 1L7MA 4JI3K 4CIFA 3PXGa 4MO5A 4ZLJA 2W2NP 1K73O 3DLLQ 7ICGA 2CQHA 1DT9A 4DV7K 4DO9A 3HSDA 2PO4A 4P52A 3GZFA 1AQ6A 3BGRB 1YHQS 1AUSL 2OTJN 5CB1A 5B0AA 1NXIA 1RT3A 4IDKA 4O5EA 2F4VF 1IVZA 4M5HA 1FKPB 2IA0A 5DLFA 3TAEA 1Y5NB 1EB0A 3GR1A 5LJWA 5A6PA 3K75D 5SZTA 1RABB 2NXEA 2IIHA 5LJ5Y 2Z1IA 5AM3A 4PR6A 3TAQA 2HB5A 1Q8BA 1NJXA 5J8YA 1N32K 4NLQA 1WHYA 5AQSA 3CQ8A 3HM8A 4I6MA 5SUHA 3RJFA 5EDWA 2XC9A 1E4GT 3SR6A 1F5CA 2Z4PA 2UV8G 4NCGB 2QJ3A 4E1MA 2XS2A 3OUYA 5JS2A 2I1QA 4DL6A 3TAMA 2LDIA 9ICPA 4QWDA 1RT7B 1RKJA 2HVZA 1NU4A 3ENAA 4OZ2A 2OEHA 3US5A 2R8HA 2CA9A 2E5LJ 5D0GA 2ZIXB 4A5AA 4Z4HA 4DPYA 4G9BA 3A3OB 5ALZA 4DTXA 2AGPA 9ICRA 3LPYA 2FHJD 5HLFB 1KD1T 4CLSA 4GXKA 8ICGA 1MN7A 2YKNB 1SQFA 5DB9A 5J1EA 1RHKB 3SSRA 4LF6J 2LYVA 1Q7YO 4DV1K 1ZH5A 4CQ1A 4M45A 3GWCA 1T03A 4DV4J 4JV5J 1B4FA 4IWVA 2A3ZA 1PVRA 4DSJA 2MKKA 3QUBA 3SLCA 1YI2S 4FWQA 3AL0B 3HXMA 4UB4A 5J0XA 1FKAF 2C2ZB 3HHNB 1M6YA 2JVRA 1IJJA 4RUHA 1LAWA 1IBKF 2VBYA 3BGRA 1FDNA 3MPDA 4DQIA 3HCXA 3MX5A 1Q0NA 4AXIA 3Q8UA 1AUDA 4U8VA 9ICBA 2MPUA 4IKFA 3DEEA 2P8IA 2JEFA 4DSEA 1ZXOA 3EY1A 3N79A 2IHMA 1FKPA 3J7ZT 1JN3A 1ZA1B 2X1GA 2ZJQQ 1CULB 1NMEB 1T3QA 4I4BA 4DQ8A 1WF0A 1H1VA 2HOFA 1T95A 3ZTRA 2UUCK 1X4FA 1NK7A 1NZBA 4XH1A 1UWBA 2VOOA 4FXWA 3KWGA 3QNOA 4NYPA 5KFGA 2CQIA 3DM2B 3TTCA 3NAEA 4WIIA 2E2OA 2DNPA 4UW2A 2PEHA 4ETZA 4YOWA 2XO6A 1G2EA 4NCGA 3V7LA 3WEEB 4FM1A 5IXUA 1L3UA 3VN5A 3LH2S 1NGJA 2M3DA 5H9EJ 1RT7A 2YH0A 2L9DA 3LOUA 1U6BA 4Y2KA 1B99A 4PHAA 3H5XA 3R5DA 3MXIA 4JI4F 1TL5A 5KFCA 4TU8A 2ZIXA 2IVPA 3HKZF 3OVSA 2ATCB 4ZLNA 2FPKA 1B22A 1W0HA 4PUOB 4OI6A 4KSEB 5ALWA 4FCYA 4LF1A 4NXMF 5HLFA 4H0OA 2OFGX 4QZHA 1J5EJ 5CQGA 2YKNA 5HRNA 3TQ1A 4ECUA 4ECQA 3J7YU 5AKIA 2R7WA 3H46O 1YHQN 4X65J 4BX9C 3RBXA 1XNRJ 2L5YA 1ZAWA 4A8SA 5D0HA 3PNCA 1LVHA 1DXSA 2XCAA 2LMRA 3QT6A 3OW2M 3TTFA 5CY4A 2ZHBA 4JI1K 3OFGA 2CJKA 8ICWA 2DKOB 2ROGA 2XNQA 3T69A 8ICZA 2PMHA 2Z2YB 1Z4NA 2IYGA 3NEKA 5I3UB 4LF5K 3KJQB 3ZFVA 4DUYK 4CEEA 1ZD2P 2CWKA 3MUVP 1Q4RA 3U1NA 1F5AA 1IBMJ 4FLYA 2EKYA 1ZQBA 2HNYB 2IHR1 3JAMO 1CULA 1FVQA 2D0PA 3MN9A 1J2VA 2D3ZA 1S57A 4GC7A 2Q79A 2I7PA 1KTVA 3OTCA 3UCUP 3GV7B 1VC5A 3KZXA 5HBMB 1U09A 5HVHA 3OYFA 3DM2A 1VQ9N 4X62J 2G8KA 3C2KA 4JI8F 3QZ7A 4ZN1A 2X51A 1ZQIA 3M05A 2C28A 3WEEA 1NNLA 3Q7BA 3O5BA 4NPOA 2NZCA 4FM2A 4CF4A 1U04A 2KYXA 2VA8A 5M2UA 4AT1B 1T05B 3F41A 3L2RA 2E6MA 5KFRA 3NOGA 3LP1B 3HILA 3MK6A 3ZX3A 3G25A 3O9RA 1Z2LA 3F56A 2ZFHA 4DL7A 2OIHA 1ZQPA 5HATA 4PUOA 4F5PA 1ZBHA 4X4SA 1VQLN 1SQKA 3M1FA 1A0PA 4NLBA 5IT4A 3KD1E 4WFNL 3I8DA 5CA7A 1HARA 4FPRA 1R0AB 4B3TF 5BR8J 4MF8A 2M7SA 2QA4S 4ZN3A 3AJ2A 3GQCA 4H0XB 2DL0A 5DJBA 1BPBA 1IO2A 2VBXA 5C15A 1D0EA 4KGMA 4CNZA 2KEYA 1IR0A 2VG6B 3Q24A 4ANEA 1ZQHA 2KXHA 2J8SA 4M94A 4HHUA 2JZBB 1EXNA 5BYQA 4KTZA 3RJJA 1WOOA 3ISDA 3OS0A 3OYHA 1VJWA 2OANA 5I3UA 1ZS6A 1BMQB 4GMKA 4K50A 3NBPB 1OJ4A 3DHXA 1VI7A 1TUUA 2G8VA 4Q5VA 4A8OA 4ERDA 1S9FA 2O66A 1H0HB 4DX8H 1QQ5A 1FXXA 2HNYA 1PILA 4X4VA 3N6MA 2HIQA 5CRXA 5ALYA 3SJHA 4FYWB 5JMNA 4B3MJ 2GZOA 4KH6A 1BO5O 4AD6A 2W8LA 1NPPA 4LH5A 1UQVA 1C6VA 5HBMA 2IM0A 4NMLA 1IBLF 4LFAJ 2G0AA 1KVBA 3M8QB 1VRUB 5AK6A 2IRYA 4HI2A 5J0YA 3PFEA 3J80Y 1C20A 4KGXB 2RSQA 3ZSXA 2W25A 5AI4A 2P5OA 5EX0A 4XAKA 5BPNA 5RUBA 4YY3K 5EOZA 2EK6A 1QTNB 4ZIVA 4JI3J 3FC9A 2BJ8A 4C3MA 3C0BA 3WC2A 4M7XA 1HNZJ 1P9QC 4LRAA 1RDAA 3BDPA 2F96A 1T05A 1UFLA 3LP1A 3QBCA 5ITHA 3VENA 1C1CB 4Y00A 2HHWA 1PC4A 4Q8EA 3C5FA 1UCNA 4MKVA 4YHHJ 2NXJA 2HFVA 5IQQA 3ZDCA 4C8YA 4CEDA 2VKQA 4DL4A 2ZNZA 1TFYA 2DH9A 2VQEF 1SKUB 1S9GB 1ZD5A 3D2FB 1ZZNA 2HMPA 4NLTA 2XMUA 1A77A 4K0KJ 4PWDB 2KM8B 3HOTA 3H0MB 2YTCA 4ER8A 1ATRA 2FGOA 3S3MA 1N32J 4DCHA 3H1VX 1KEKA 2QLBB 1NB2A 3THXB 2VG6A 3AY0A 4X64K 3UQ0A 3S3OA 4ID1A 2JZBA 3SQ4A 1T02A 1TQLA 4B3OB 2Z1GA 1Y0HA 4NEZA 2LQBA 3HJEA 1ZQOA 2DNHA 3KLHB 5DS7A 4RQ3A 3NBPA 3G6ES 3IUCA 5J0UA 3BSCA 3MBYA 1RAAB 3NS1A 1PG5B 2J7KA 2FJEB 2U2FA 5AQHA 3IWXA 5IT9Y 4LRFA 1TUYA 5E5NA 3MCPA 5EWGA 2YX8A 1XS9D 4UAVA 2DY4A 2V0NA 5H1SQ 3UN5A 4C0ZA 1DURA 1NGGA 2KJVA 4ZTJA 4R25A 1LAVA 3M8QA 2R7YA 1VRUA 5KFUA 3R7SB 2I2YA 2DUYA 2FC0A 7ICMA 3SQIA 1T7PA 4NYOA 1HJOA 1SC1B 3CQYA 5L1JA 4B6JA 4QWAA 2DNOA 3DXSX 1IG6A 3HTVA 1BL3A 3FEZA 5CYMB 4WP9A 4DV2F 1WKKA 3QRQA 1JL2A 1MN8A 2KFZA 2HVDA 1K8AO 2F40A 2I38A 1IM4A 4Z7CA 9ICSA 2HNZB 3ETRA 5KAFU 2M70A 3BO3A 2RUSA 1C1CA 3OFFA 2JLGA 5AXLA 1EKRA 1GLEG 3HHDA 3EGNA 1VQYA 3AO4A 1KLMB 1WLJA 2OEKA 3CI5A 2RRNA 2V2ZA 2WAQF 4N47A 3CNHA 4GKKF 3CTRA 1VQKS 1NK5A 1N5SA 1S9GA 4BS2A 5C42B 3RBEA 1KS2A 3D2FA 1GMWA 5KFMA 4B9VA 3CPEA 3NS7B 5HMYA 4PWDA 2UUCJ 4QW8A 2M5YA 3OW2R 3RAXA 5AQZA 5AQGA 2HDOA 1HKBA 3GG1A 2RH3A 4OZLA 3THXA 3TACB 4DV6F 2QTWA 4PJ0U 1WBBA 1UEUA 4O3SA 1KVKA 2ZKUA 3HKZD 5AI6A 5IWAF 3HRGA 2FUG9 3C15B 1RAEB 2VBZA 1OQ6A 3W7BA 3C3LA 2DTJA 2Z1HA 3BM7A 4WZQA 1YQHA 2XEXA 3ZZZA 4CLPA 5FLXY 3B0XA 4RU9A 2KKZA 4BRAA 2EX3A 3KLHA 4Z7YA 2DYAA 5FIIA 4C4SA 2O6KA 2YHBA 3QT5A 2QYCA 2CVEA 1UEKA 3WK5A 2MB0B 4ISGA 3C7NB 4LF4F 4MMOA 2F44A 3NVZA 2OUGA 4OCZA 1KKHA 4M47A 2OZMA 2BPFA 1FDAA 4USAA 5A2QO 1ZQSA 5F8JA 4OJ5A 4B8AB 1T8EA 3O8MA 2DNZA 4PWUA 3SBGA 3CCEN 1J54A 3CJ1A 3DN9A 3EZUA 2RN2A 1FD8A 4UOGA 4HHHA 1YZ7A 3PW5A 3J81Y 4NOHA 5LL6Z 4IZ9A 3TVKA 3LAKA 5CYMA 5IS2A 1KVIA 5L9XA 2V51B 4HI1A 2JWNA 2HSZA 2N7YA 2ASJA 1ZQDA 2HNZA 4FE3A 1N5XA 4JI1J 1ASWA 3C16B 2CJYB 3SSSA 3HI9A 3VALA 3NNHA 2HVEA 2MKIA 4KTQA 3T79A 1NK4A 2KL8A 4EGLA 5JICA 2J7WA 4LF5J 2JHDA 3DFEA 1KLMA 1RTZA 1TKDA 4MIAA 4DUYJ 1QQOA 1ZRNA 5CYJA 4AL6A 4CNYA 3QT7A 2AJ4A 1X6JA 3ZZUA 2Y1JA 3VGVA 2UXCJ 4CERA 5C42A 3T1AA 3PCOB 3DLEB 4KMUA 1WF1A 2DIUA 2EWSA 3G8SA 3V72A 5F2RA 4P73A 2BR0A 2BKNA 4I69A 4RWXA 2D69A 1U1LA 4JKHA 2UUAK 3QU2A 4RQ0A 2JGUA 3VF2A 4GO5X 3P38A 3DU5A 2EAOA 4LREA 4CE9A 4DR7J 2LM4A 1N34K 3PR5B 1SB3C 3MCNA 2B4UA 5HN0A 2DFHA 5HQLA 1RM6C 3C15A 1Y9OA 4OZJA 1RHJB 3GJTB 5KG1A 4YDXA 1UT5A 4E0DA 4E7JA 2EW9A 2UUTA 4RUAA 4CO3A 1QAIA 4FWLA 3D68A 1YAGA 4IRKA 4FJKA 5TISU 3C7NA 5J0TA 4YB6A 3T6BA 2H48B 4MHVA 3A0BU 1Q5VA 4NLCA 2WSFC 2HS3A 3ISND 4OX8A 5KQ8A 1Q9XA 1C0UB 4H5RA 1TKZB 1RE1B 5DDOC 1DQ8A 2DB1A 4YXMA 1HQ2A 3IM8A 3RB4A 3K4GA 1HHTP 1P6TA 2GEMA 2HHHF 5KAKA 4LFCF 2QKKA 3UMBA 1BPDA 3CMEN 3V4IB 3N9UC 3TABA 1RT6B 9ICAA 4QS9A 1VK8A 1TKXB 5ALGA 3TARA 1JI7A 2HBQB 2GS8A 1PBAA 4DF4A 3I96A 1BISA 2NRXA 3C16A 1JB0C 3FCWA 2H3VA 3I32A 2VPZB 3EW9A 5IV4A 4CFCA 2WF7A 5LXYA 5IV3A 5E2QA 2RB7A 3A5NC 1S6OA 4USJC 2GWKA 5GMEA 3MDAA 4HT7A 1U49A 4W5NA 3P3DA 5HMMA 3P5TL 2MQMA 4Z0UA 1U48A 3DLEA 2JR5A 4LH4A 3FBFA 1Q86T 5LMUK 2ZH9A 9ICJA 2LEBA 3J81U 4CJRA 2VZ9A 5M1QA 1ZQFA 3LAMA 3AA8A 2M9KA 1ZD4A 3WK9A 2BJDA 2ZJ5A 3V1QA 1UVNA 3GU0A 4FK4A 1HBUB 2YWKA 1PVPA 2MHNA 1HEKA 1WEYA 1NBEB 5J2PB 4OO1J 4FBUA 3KWIA 3M9MB 1J5OB 3AVAA 1B3TA 3PLAA 3JSBA 5HL7L 1JJCB 4B9TA 4OX9F 1KN5A 2QK9A 1QSYA 3ZX0A 2DGQA 2HHTA 4EELA 4OVLA 1HBMB 4DX5A 3I6PA 1YITN 4ES2A 1XBWA 3ULEB 1SC4B 3DRRB 5K20B 1ZQTA 4ZKAA 3LM2A 3WXIA 1X42A 3CF5Q 4PPXA 1UMJA 1C0UA 1TKZA 3T5LA 4EWTA 2B7BB 3BH6B 4QPXA 1T6DA 1HHSA 3DHWC 3VTIA 3FNNA 3LUYA 5L8RC 5BN8A 3QGIA 3TNVA 4F36A 2NZ4A 3BJYA 3FYHA 3M32B 4NI2B 1RISA 3O1WA 2GNKA 3CCUN 2GO7A 1H7WA 3CIZA 5J2MA 1NWKA 3NCRA 1GOBA 4JKCA 3V4IA 4DZDA 4Y2TA 4B9QA 3N7SC 1RT6A 4EEYA 4KX5A 3F53A 1TKXA 3RU0A 2YWWA 3H98A 5AZIB 2ITMA 4C23A 4JOUA