4DSLA

Crystal structure of fragment dna polymerase i from bacillus stearothermophilus with duplex dna and calcium
Total Genus 191
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
191
sequence length
579
structure length
579
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical and structural insights into the fidelity of bacillus stearothermophilus DNA polymerase
rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA polymerase
total genus 191
structure length 579
sequence length 579
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4dslA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4dslA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dslA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4dslA01
8ICVA 3ZCMA 8ICPA 3Q8LA 7ICIA 4O0IA 2IHNA 3KKRA 5D49A 4M41A 4EZ6A 3UQ2A 1JX4A 4B9TA 5CR0A 2ZTCA 3OYEA 1TK0A 3D45A 3RAXA 4FK0A 1QS4A 4IQTA 2BPCA 5IILA 5C24A 3SI6A 3TFRA 4CHPA 1XC9A 4XQ8A 1SL2A 4OJRA 4IQVA 3TFSA 1RBSA 2YNIA 1J5OA 5F9LA 7ICFA 4N5SA 5DB6A 1IO2A 3RBEA 3ZDAA 4F4XA 2VA8A 4C8NA 4TQSA 1W9HA 1C1AA 3KD5E 4M3ZA 2C28A 2P1JA 3OYKA 2BKEA 4J9MA 3EW9A 3CFOA 1Q9XA 4UAZA 2DPJA 3C1ZA 4PHDA 5DBBA 2HNDA 1L5UA 3EY1A 7ICHA 3F9KA 2KQ2A 4F50A 2YHAA 3VQEA 4RW6A 1FKPA 1U48A 2DFLA 2FPLA 2BPGA 2ALZA 1NKBA 1HUZA 4CIEA 3DM2A 4YD2A 3KJVA 3IHQB 4BXOA 3NTUA 4W5RA 3RJKA 4FXDA 1D5AA 5J2GA 3K58A 2AQ4A 3V1QA 1LAWA 4MQ3A 4OKEA 3KHHA 1SL0A 1S0OA 4CHOA 3HT3A 4ECQA 4DFPA 4FJMA 3DLBA 4FS2A 2ATLA 1XO1A 4BWJA 3U3GA 3LDSA 5IINA 2VA3A 4J2AA 4GXIA 5L1IA 3V6HA 1MU2A 4YN4A 5DDMA 1RTDA 1SZPA 2E6LA 4LD0A 5HHIA 5JS1A 1S1VA 3OSNA 1ZBIA 4FS1A 4CGDA 3QEIA 3OYHA 4M04A 4EP5A 5KT4A 3LWMA 1Z25A 1BPBA 2FLPA 5C5JA 5FRMA 3CM6A 5KFTA 4AHCA 3OYIA 3AA2A 5SWMA 3MDCA 2JGUA 4E7HA 4DTXA 2PFPA 4QZHA 1RT3A 3TQ1A 3K5NA 1QHTA 2ETJA 1HYZA 4QZ8A 1NK9A 1U45A 4ECYA 1A5VA 1JMSA 4DTMA 1BPYA 2KFNA 5J0RA 1QE1A 2RDJA 4HCCA 1FKOA 1S77D 4GW6A 3QE9Y 3DRSA 4I2QA 4KHUA 1RDDA 3O4NA 4EBEA 1KLNA 2I1QA 4BGDA 4G1QA 2FBVA 4KLDA 5KFKA 5DLGA 3MDAA 3ZT0A 3SPYA 2AJQA 1S5JA 4KLQA 3T5KA 4KLSA 4DTPA 2O4GA 3AO4A 8ICFA 3LPUA 1NKEA 3OGUA 5DMRA 4DF4A 5KGXA 3TAQA 4HUGA 4FLYA 1UT5A 3V9XA 4ECWA 3T3FA 1B9DA 1VK0A 5KT3A 4Z4FA 4DSEA 4B8AB 3EWAA 4DU3A 5DB9A 3AVCA 5J2JA 4I2JA 4C8MA 4M47A 5IIKA 1B43A 2A1JB 5HMMA 2QXFA 3LZJA 4IKFA 5KFOA 3KLFA 1TK8A 3AUOA 1B9FA 1DLOA 2NRXA 1WSGA 3WNEA 4F5PA 4QZ9A 1YTAA 2RF2A 4DL7A 4TSXA 1TVAA 4BXOB 4CJKA 1F21A 4PGXA 1S1TA 1RBUA 4IFYA 1N56A 4JRQA 3M9OB 1YTUA 3PY8A 4E89A 5KFFA 3H4DA 2ZTDA 2C2DA 3T1AA 4FJLA 5L1KA 4BE0A 5KFSA 8ICXA 3ZSYA 1ZQFA 3ZDDA 4RPXA 5J29A 4GMJB 9ICNA 5J0PA 4P4PA 5CP2A 1ITGA 2FBTA 1KVBA 1RT7A 4F4KA 4DL3A 3AV9A 2FBYA 3QNNA 2YKNA 3LPTA 5JUMA 4R66A 1RT2A 3TR8A 9ICMA 3SCXA 1J53A 4QWEA 4KLHA 3H7IA 3RJGA 1XU4A 3C2LA 5IIOA 4CJVA 2F1HA 1AROP 3HL8A 4ED1A 4Z4EA 1IKXA 1ZQTA 2X6NA 4CF1A 4NCAA 3ZDBA 2P66A 4DSJA 4J9OA 3H08A 2F8SA 5KT2A 5D46A 5J0YA 2W9AA 1U04A 1LWFA 2KTQA 1LW2A 1JN3A 3DMJA 4Z6EA 3AVFA 3MEEA 4YG2A 4K4GA 1RDBA 4FJ9A 2IS3A 5J2EA 4ECTA 2HHTA 4OLAA 3C2KA 4RQ2A 4DMNA 4R65A 5BPCA 5DGAA 1RPLA 4DL5A 3WNHA 3O3FA 4ZH4A 1NJYA 4NLGA 5J2HA 4QOZB 4QWAA 2HVHA 5KTQA 1VSHA 1KEJA 5J2KA 4J2DA 3QZ8A 3CQ8A 2Y1JA 4TUSA 4J9PA 3PO5A 2FMQA 4F91B 3VQ7A 1ZQDA 4CF0A 4KPYA 4B9MA 1ZQLA 9ICBA 4DSFA 3NH0A 1KVCA 4DS4A 3GV7B 1ZQIA 4QZAA 8ICJA 2PI5A 4CFDA 1GOCA 1EXNA 5EU7A 1RNHA 5CYQA 5J2NA 1L3TA 4DFKA 1KFDA 1TL3A 3AVAA 4OPKA 3ZSZA 4NYFA 1QTMA 5CY4A 3P5JA 4Q5VA 1EP4A 1MQ3A 3SUOA 1HNVA 1S1UA 3L2QA 4E3SA 1ZETA 2A1JA 4M3WA 4O3QA 4DO9A 4DQSA 3OYLA 5J2DA 4QWDA 4FZYA 1TKXA 4PY5A 3MEDA 3QEWA 3SJJA 4Z6DA 1FXXA 2BPFA 1LV5A 1T03A 3MGIA 1ZYQA 2MAXA 5J0QA 3PW5A 2HB5A 1TKZA 2XC9A 3M9MB 4KITB 2KZMA 4QZEA 2PFQA 3DRPA 4RW9A 1Z00B 1RXWA 1KVAA 2HVIA 3NGZA 4CJFA 3BQ1A 1RXVA 4H4OA 2IDOA 4OGCA 1JIHA 1D9FA 1QLNA 2ISOA 1KSPA 1C1BA 1BVSA 1DGSA 4H4MA 4DQIA 1S6QA 2AGQA 1U47A 4DL2A 3AO3A 4RNNA 3OYGA 2W9CB 4CGHA 5I42A 9ICKA 9ICAA 1QQCA 3PW0A 4YXMA 3HO1A 4Z4IA 4RQ0A 3IAYA 2HHWA 3JSMA 4IDKA 2F8TA 1NK6A 1SKWA 2J6TA 3C21A 4JUZA 1JLQA 4R64A 4M9HA 5EWGA 4J9SA 3C2MA 1VSMA 4DOAA 9ICVA 1BI4B 4P4OA 4LZGA 5EWEA 1N5YA 4M9NA 3ZT4A 4BDYA 3SZ2A 1G15A 4R8UA 1ZQQA 3L3VA 4M6WA 3PNCA 3NGDA 3AA4A 5KFYA 2FLLA 4IQWA 3LP1A 1Z26A 5DB8A 1XHXA 5CZ1A 8ICGA 3QEVA 1IG9A 4ICLA 2YNHA 2IBKA 5KFJA 1DTTA 2DTUA 4DF8A 4KLTA 4CECA 5SZTA 2BQUA 2C22A 3SUPA 4RQ6A 3H8JA 4ELVA 4JS4A 4J9RA 2VG5A 4KLFA 3TAEA 3S3NA 2BCQA 2J6UA 5KFAA 4EYHB 2XY5A 1RDAA 4YNQA 4RQ3A 8ICSA 2OYQA 4YQWA 2E6MA 2O4IA 1SKSA 1HUOA 5DLFA 1RCHA 4CF2A 2Q0ZX 3MECA 3NH1A 3GV8B 7ICSA 4HVJA 3K4GA 4KHWA 4LY7A 1KFTA 2XO7A 3HW8A 2KN7A 3QO9A 7ICRA 4QZCA 2ATQA 2G8HA 2OPRA 2G8UA 4AHSA 4PWDA 1S76D 3AO2A 1RT6A 4QZIA 2WONA 4RZRA 4KHQA 2YKMA 3VQ8A 3OVNA 1RBRA 2RPIA 5J2PA 3VQ9A 4QW9A 3VN5A 1NJZA 2NUBA 1TKDA 3DOKA 3TAFA 1RYRA 1QSSA 4DEZA 2R8GA 3BQ0A 1BQMA 5J0SA 5J2FA 3PR4A 1X9MA 9ICGA 4HCBA 1ZQMA 4I9QA 3HP6A 1UA0A 2UVUA 3RJIA 3AVNA 4ED0A 3LAMA 4KREA 1C0MA 3V6JA 1JLCA 4UAYA 4RQ7A 2AGOA 8ICRA 4RW8A 4JK1A 4FJ8A 4GVMA 3PO4A 1I39A 2D0CA 4B9SA 7ICNA 3CG7A 4F92B 4P2HA 1C7YA 5KRSA 4FJJA 4LH5A 5DBAA 4RPZA 4J9KA 1HPZA 3QEBZ 5FROA 4RQ4A 1JKHA 4CEZA 4CJ3A 8ICOA 3PV8A 2XCAA 4E1NA 4CJ4A 1J9AA 2D5RA 1K1QA 4M3XA 1ASVA 4JWMA 5HRSA 3AVKA 1UA1A 3JPSA 1VSJA 3DI6A 3UXOA 2HNZA 5KFIA 4BWMA 9ICCA 1RT4A 1RT5A 4PQUA 1HJRA 4CJTA 3NF9A 4AH9A 2AGPA 2HHVA 2ASLA 4F5NA 4CJSA 4GXJA 9ICFA 3LDAA 3K5OA 1BI4A 4CK1A 3QETA 2W9MA 3ZD9A 2OZMA 1Y97A 4H8KA 1NOMA 5D3GA 1WSJA 3E2EA 2NRZA 1NOYA 8ICIA 2UVRA 1CXQA 2ZD1A 4ECSA 9ICTA 3LP0A 2BGGA 4J2BA 3TAPA 9ICEA 3JPOA 4W5OA 1A76A 3ZDCA 1BPEA 5CB1A 2PXIA 8ICCA 3SNNA 4IRCA 3MFIA 5J0WA 1T7PA 2RDIA 4NYNA 4KLUA 3HVRA 2V9WA 1SL1A 3AVIA 2YNFA 4FLVA 4CJQA 1S9EA 4BDZA 3AA3A 3PX0A 4KB0A 4DWIA 8ICWA 1EETA 3ASMA 2W9BA 1IKWA 4QW8A 4F4WA 2GWSA 3VQ5A 1HQUA 4AHUA 4O5EA 3OHBA 3ZT2A 3DLGA 3MR3A 5CZ2A 3UPQA 2BCRA 2XGPA 3BJYA 3OJSA 3K2PA 4EYIB 5KFWA 1JXLA 4ECUA 4NCBA 3ZT3A 4O3OA 3T5LA 4FLTA 1BISA 1TVRA 5J2MA 3M8SA 4KTZA 2X78A 1CEZA 4FK4A 4F2SA 4M3UA 1ZQEA 4I2HA 4O5KA 5CA7A 1VSEA 3OYDA 4CJLA 4F5QA 3ETLA 3G6YA 3WNFA 1FK9A 4PUOA 3V72A 1VRTA 5KFMA 3EZ5A 3SYZA 3P1GA 5FDLA 3K57A 1DTQA 5J2BA 4E0DA 4WE1A 4DLGA 1T3NA 1WAFA 3EPGA 4O5CA 4CERA 1X9SA 5KFNA 2JEFA 4DU4A 3ISCA 1K1SA 1U4BA 1NOZA 3L2RA 3KLGA 5CYMA 3UXPA 3FDSA 1EXQA 3MGHA 4CCHA 3QIPA 2FMPA 2W9CA 4KHNA 4IFVA 7ICJA 4PA1A 1RBTA 4LZDA 1RTJA 2ZQBA 4I2FA 4GLXA 4QWBA 3T19A 3OS0A 4Q44A 3RR8A 2OZSA 3RRGA 3VQPA 1MQ2A 2B5JA 1NKCA 3ZD8A 3OYNA 3LALA 2ZJ8A 3TAGA 7ICTA 4KLIA 5KRTA 3RBDA 2KW4A 1S0NA 3QERA 1EKEA 4Z4GA 4C8KA 1ZQVA 3KHRA 1GOBA 4XRHA 4CEEA 5F9NA 2OPSA 4DLEA 4MEYA 3M9NB 2JEGA 3PW4A 4O3RA 2FPKA 1CXUA 1RTHA 2UVWA 2PY5A 3DLEA 4B3OA 4YMMA 3KK3A 4YR2A 4M2YA 4NCGA 4F5OA 1XSNA 3AVHA 4JV0A 4B8CA 3PVXA 4YVZA 5KG7A 4E19A 1HYSA 2HHSA 4IBNA 2PYLA 4NM1A 3HPOA 3QNOA 2ZE2A 4R63A 4KB1A 4I29A 1O1WA 4F2RA 5DDYA 4FLWA 3THVA 2R8KA 4FJKA 4R8UB 4PGYA 3I0RA 3OY9A 3QLHA 3QEXA 5J2IA 3Q8MA 5DQHA 4QZBA 1ASUA 2R8IA 4F93B 1X1PA 1NK8A 1ZQKA 4EBCA 3MR5A 4I9LA 2P5GA 4NLNA 5J2CA 1RILA 1A77A 5J0OA 2A1SA 4Q8EA 5KFBA 4XA5A 4UAWA 4N41A 2AU0A 3K59A 3MFHA 3DRRA 3V6KA 4FM2A 2RN2A 4CJEA 3KLEA 3KTQA 3DOLA 3M8PA 3KKSA 4CGFA 1ZQBA 1ASWA 1S0VA 1A5WA 4UQGA 4W5QA 1C6VA 1LB2B 3NF6A 3NGIA 3Q8SB 2VWJA 1REVA 3S3OA 4YR0A 9ICOA 3SPZA 4HYKA 5L1LA 4KMUA 3MXMA 3RH6A 1L3UA 4CFCA 3QINA 3LAKA 2M9NA 1IH7A 3RTVA 1JLGA 4RU9A 3ISNC 4DTJA 4PHAA 2G8WA 5KFCA 2W8KA 3F73A 1BPZA 4MEXA 4BE1A 3V1RA 4KV8A 4FCYA 3SI8A 3OYBA 3OYFA 1WNSA 3ISDA 1LW0A 4R5PA 4L8RB 2KZ3A 4PHEA 4DSLA 2JLEA 3V7JA 3SV3A 4DOCA 1RYSA 1RBVA 1TAUA 2UVVA 8ICNA 2H5XA 5KFRA 3QESA 3OYJA 4FLUA 1IKVA 4YMNA 2PI4A 5KT7A 1EX4A 3D0PA 3LZIA 8ICEA 1VRUA 4I2PA 2GBZA 4W5NA 3Q8KA 4RNMA 2FC0A 3HPHA 4FW1A 3MR2A 2OA8A 4FJHA 5DG7A 5FRNA 1JXEA 4JLHA 7ICVA 4Z4CA 3B0XA 1X9WA 1LWCA 5BOLA 4J2EA 1YT3A 4JV2A 1ZQWA 3BQ2A 1COOA 1Z00A 9ICWA 1JL1A 4TQRA 3LK9A 5C42A 1LWEA 2JEJA 5I3UA 4CEFA 1XSLA 2MUTB 1ZQOA 3OS1A 1WCLA 2XCPA 1HYVA 3VA3A 9ICPA 1Z3EB 3HM9A 3QEAZ 1ZQAA 4FBUA 3RMAA 2IAJA 3K75D 3RJFA 4FK2A 3VQBA 3KIOA 4FYDA 3ZSOA 2ZJAA 4UB3A 4KLJA 4N47A 1WN7A 3M8RA 2B21A 4FZZA 4DTRA 3EYZA 3AU2A 2W42A 3RMBA 2V4QA 8ICLA 4NM2A 2F1JA 3OJUA 1TFRA 1UOCA 1B22A 4F8RA 5CJ7A 1S97A 5KFEA 3TI0A 1BQNA 4RQ1A 4DFMA 4I2AA 3SQ0A 1UAXA 3HVTA 5TZVA 3ZSVA 3SQ2A 1XWLA 1NK4A 9ICXA 4XIUA 5J0UA 2X6SA 4Q45A 2C2EA 2ZJ5A 4YR3A 3HXMA 1Q9YA 3RR7A 1CUKA 4PH5A 2PFOA 3AO1A 5EOZA 2MUTA 4E7JA 2QKBA 5J1EA 4OKJA 4IQUA 3KLHA 4DTNA 2XY6A 2IOCA 2C2RA 3JYTA 5E41A 4KTQA 1ZQGA 4ECXA 4KLMA 3SV4A 4Q0BA 5J0TA 4UB2A 3DLHA 4KN4A 2HHXA 4CGIA 5KFPA 2EHGA 3LP2A 3HPGA 1XSPA 4DL6A 5DKWA 5L9XA 4M6WB 4O3PA 3A2FA 4QZGA 4FJ7A 4O3SA 4DTOA 3OHAA 4DQQA 4RW4A 4M9JA 4IRDA 4UB1A 4Z0UA 1KTQA 3C1YA 1C1CA 1RZTA 4ED3A 4M3TA 1HNIA 2JZBB 3PW7A 2DY4A 1Q8IA 3N97B 1C0UA 3HYFA 5KFUA 4DTSA 2VA2A 4DL4A 8ICZA 1CZBA 1UWBA 1ZQRA 4Y1DA 3CYMA 3GIIA 5DGBA 1NK0A 3SQ1A 5DK5A 4J9NA 4YFUA 5CHGA 7ICOA 4QCLA 4P4MA 2OPPA 4TUQA 4B9LA 1WCNA 1QSYA 2B6AA 3NDKA 3U6FA 3MABA 3RH5A 1JLAA 4MFBA 4EEYA 3QZ7A 3CFRA 1TK5A 4EZ9A 3OYAA 3V4IA 1VSLA 3I0SA 3RB4A 1IM4A 4FM1A 1BHLA 4CHZA 3GDXA 1CZ9A 4Y1CA 4ED2A 4PHPA 5J0XA 5KGWA 4M42A 5KG2A 1WSEA 1HJPA 1HQEA 1ZQJA 4MF2A 3H40A 2BANA 9ICIA 2V4RA 1HMVA 2ASJA 3ULDA 4QZDA 5KG0A 2Z1HA 1TAQA 4I2BA 3MAQA 4YP3A 2KZZA 4GC7A 1V9PA 2BCUA 4ZTFA 3OS2A 2Z1GA 3GIJA 4F4YA 1ZQXA 2HHQA 3PUFA 5KFDA 1RT1A 2G8IA 4DG1A 1VSIA 3LANA 4I7FA 3SQ4A 4RQ5A 2D0AA 4IG3A 3BQTA 2G8VA 4ELUA 4M45A 4HUFA 2W8LA 2BE2A 1GOAA 2Z1JA 4O4GA 2BCSA 4KHYA 9ICJA 3MBYA 3KHLA 1BPXA 4DS5A 4CJWA 4K4HA 2ZUDA 2J6SA 4CK2A 2BQRA 5HBMA 3GIMA 4YXJA 4AHRA 3Q8QB 1BGXT 3VQAA 4ECRA 2P6RA 1I3AA 1S9GA 4FW2A 3SUQA 3IS9A 4UBBA 4CESA 1KFSA 1VSFA 4IG0A 2PZSA 4Z6CA 4N56A 1NJWA 2KFZA 5JS2A 5HROA 3HSTB 3NCIA 4FJXA 5DB7A 1S1WA 2OPQA 4CJPA 4I28A 4CJUA 5K14A 4YMOA 3JPRA 3VA0A 1KRPA 1IXRA 2P5OA 4KLGA 3PR5B 3B0YA 4DQRA 1Y88A 3OYMA 4K8XA 3RB0A 4Z6FA 4C8OA 1VSDA 2HW3A 4M0AA 4FJNA 2XY7A 4I2GA 1ZJNA 4CGGA 4CK3A 5DG8A 4MFFA 4NY8A 2NRTA 1W0HA 4KI6A 4KRFA 4O9MA 1U49A 8ICTA 8ICAA 3AVJA 3MR6A 4AHTA 5KFHA 1TV9A 2VG7A 4X5VA 1JLEA 4ZHRA 2FMSA 3RB6A 3WNGA 2EX3A 4LSLA 3EPIA 3VQDA 4PPXA 3VQ4A 3JPTA 1MC8A 4M9LA 3V9WA 4DQPA 8ICKA 4IR9A 1BIZA 3AVGA 4CEBA 3GIKA 3O3GA 3OSPA 2QKKA 2YV0X 4MF8A 3G0ZA 2G8KA 4DOBA 1QSLA 3ITHA 2BQ3A 4I27A 4FBTA 1BL3A 2IA6A 4O3NA 1TGOA 1R0AA 3TARA 2VWKA 3AO5A 5IIIA 3UQ0A 4RG8A 4CEOA 2PYJA 4O44A 4MFCA 3IRXA 5KFQA 9ICUA 2QK9A 2WOMA 4KN7A 4FO6A 5DQGA 4F3OA 2HHUA 1DOQA 9ICLA 3H8WA 4CGJA 3NBPA 3G6XA 3E01A 5HRRA 3RJEA 4I2CA 2JZBA 3C6UA 3PW2A 3S9HA 2RKIA 2I9GA 2NRWA 2F96A 4KLLA 3ISBA 3T5JA 2ZUBA 3ORYA 5DBCA 3K5LA 3B6PA 3KD1E 3BGRA 2R8JA 2WTFA 3TANA 4HUEA 5KG3A 1RDCA 3NH2A 3V9UA 2IGIA 4CHYA 4RNOA 1KCFA 3IG1A 2BHNA 3T5HA 3Q8PB 4G3IA 2E4LA 1UT8A 1S1XA 3Q8RB 2Z1IA 3S3MA 3GILA 4UBCA 9ICHA 3L2UA 5KG4A 4I2IA 1VSKA 4FJIA 4CE9A 4KAZA 4F4ZA 4ED7A 4AHVA 2BR0A 3NE6A 2ZUCA 3GFKB 8ICUA 2VG6A 2NRVA 3KLIA 4FLXA 4YCXA 3GQCA 2P51A 4I2DA 3G10A 1S10A 1PZNA 1ZQPA 5HP1A 5KFVA 4CF9A 1SKRA 9ICQA 4XUSA 3V9SA 4IR1A 3K5MA 3RRHA 1C0TA 2I5JA 4B9NA 1N48A 3HP9A 7ICLA 3HK2A 3NHGA 1WLJA 4CHNA 3PMNA 2XY8A 3TWHA 2YNGA 4RQ8A 4RUCA 1S9FA 4F3TA 4HHTA 3NAEA 4CFBA 3TABA 7ICUA 1JXBA 1TKTA 7ICPA 3V7KA 2IMWP 2ZTEA 2P6UA 3G6VA 4E1MA 1NK5A 4CFAA 7ICGA 5BOMA 1K6YA 4I2EA 4NLZA 2HMIA 3SUNA 3NFAA 2IHMA 1LAVA 4FJGA 2B4JA 1ZQNA 2DPIA 1D9DA 4B9VA 4OGEA 4EBDA 1ZQHA 1NJXA 1JLFA 5HMLA 5DG9A 2DFEA 3AVBA 1ZQYA 4B9UA 2GUIA 3AVMA 2BGWA 4Z4HA 4LSNA 4BACA 1SV5A 3L8BA 5KT6A 4J9LA 3UIQA 4W5TA 1JLBA 3L2WA 1RTIA 3L3UA 3DLRA 4Q43A 3RWUA 2FBXA 4UB4A 4LVSA 4K4IA 3MXIA 7ICEA 1ZBFA 1ZQSA 3RJJA 3N4MB 3RAQA 1TL1A 4CJRA 1CLQA 3V6DA 4O0JA 3O3HA 1XHZA 2D0BA 1ZBUA 2W9BB 5L1JA 4DFJA 3DYAA 1D8LA 1WSFA 4KKOA 4GXKA 4UB5A 4FVMA 4B08A 5HHHA 2FLNA 3C23A 4J9QA 5IIJA 3U3YA 5HRPA 4ED6A 7ICQA 4ID5A 5J2QA 1L3SA 3RH4A 4CEQA 5HNKA 4M3RA 8ICMA 3JPPA 4KO0A 3AU6A 3C5GA 4M3YA 5DQIA 4RW7A 4RUAA 3C5FA 4E7LA 4O5BA 1NK7A 4DTUA 1MSWD 3NF8A 3HJFA 1J54A 4JRPA 2BCVA 1ZQUA 3KK1A 3RB3A 4YFKA 4O55A 4CF8A 4ID1A 9ICSA 4JS5A 4OPJA 2OWOA 7ICMA 5KFGA 2VANA 4ECZA 3ZT1A 5KG6A 2DFHA 4C8LA 4QZFA 5KI6A 1ZBHA 1JL2A 4RT3A 1XS9D 1WSIA 4K8ZA 4BE2A 4ED8A 8ICBA 1BIUA 1D8YA 4FJ5A 2FPMA 4KHSA 1SUQA 2ASDA 3HWTA 1KLMA 4Q8FA 4M9GA 4MFAA 1XI1A 2ISPA 4JV1A 3UXNA 3CM5A 3GV5B 4AILC 2X74A 1ZQZA 3M8QA 1S0MA 2XHBA 5HRNA 3LWLA 9ICRA 5KG5A 3HX0A 1BPDA 4DSKA 4PGQA 4FZXC 3DLKA 1X2IA 2Y1IA 1S6PA 3RJHA 1ZJMA 2YHBA 3RMCA 2A1RA 1ZBLA 2DFFA 3ZSXA 5EWFA 4E7KA 1IKYA 5KFLA 2LSNA 5D4BA 1B92A 5KFZA 3PMLA 3BDPA 1L3VA 3O4QA 3KHGA 3JPNA 4CEDA 3V7LA 5IIMA 4DSIA 3ZSWA 8ICQA 2AQ0A 3QEPA 3AA5X 3VQCA 3MEGA 3NF7A 2XGQA 4CJ5A 1WSHA 1BCMA 2JEIA 4ECVA 3L2VA 1YVUA 2R7YA 3IM1A 4KLEA 4RT2A 3LP3A 5CWRA 4E7IA 4NXZA 3JPQA 2LYHA 5J2AA 4F5RA 3RMDA 3C6TA 3V9ZA 7ICKA 3KK2A 3V81A 3B6OA 5HLFA 3MXJA 1U9LA 3C94A 3FYHA 8ICHA 4OVLA 4OLBA 3V1OA 5C25A 4YD1A 4CEAA 2R8HA 4IRKA 3I8DA 2GV9A 5KG1A 4OKKA 4CIFA 1TV6A 1H38A 8ICYA 4KFBA 2PFNA 5KFXA 4KTWA 4TUPA 4KLOA 3CFPA 4RPYA 2G8FA 3QIOA 4CHQA 3PX6A 4QWCA 4TURA 3AVLA 1BCOA 3ZDEA 4JWNA 3VQQA 1T4GA 2BDPA 2IC3A 4ZTJA 3ZSRA 3TAMA 3P83D 4GC6A 1T8EA 4DU1A 5KT5A 4FLZA 4KI4A 4HTUA 4CIGA 1T05A 5HP4A 2HNYA 3VQ6A 4BDPA 3ZSQA 1N6QA 4LH4A 5T7BA 2F1IA 3C95A 3OYCA 1HRHA 3PX4A 4QAGA 4ELTA 2ITGA 3ALYA 2XRIA 3NGYA 1WAJA 4N76A 1KDHA 4NLKA 3FFIA 1A5XA 4EP4A 3H4BA 4FM0A 1ZQCA 3H8SA 2Q3SA
chains in the Genus database with same CATH superfamily
1XQIA 5AQVA 4JI3F 4YY3K 1UVIA 3AY0A 2DK2A 4ZMMA 3LVWA 7ICIA 5EY4A 2IHNA 4EZ6A 4H5NA 2HS3A 2FJEB 4X65J 1YKWA 1LVHA 2I8EA 3RAXA 4FK0A 2NV3A 4CI6A 4V19S 1QS4A 4BR2A 2YB4A 2DNPA 5IILA 4ZN3A 2HCFA 3PDNA 3OTOF 4WKRA 1XC9A 3DLKB 5C2CA 1SWVA 1KC8O 2KH9A 4OJRA 4PWDB 1RE1B 2VBXA 3EZOA 2FGOA 3TFSA 4FWPA 4N5SA 3MM8B 1IO2A 2KD1A 2V69A 2KDOA 1W9HA 4P73A 1C1AA 2LQ8A 2OJ3A 3ZZTA 2QA2A 4KGXB 3HRGA 4YHHF 2XTJP 2QMXA 2BJ8A 3KMSA 4O44B 4UAZA 2DPJA 3LDLA 1Q18A 4PHDA 1LWCB 3EY1A 5RUBA 7ICHA 3ZZ0A 3F9KA 2KQ2A 4F50A 1N32J 4DV4J 4CIEA 3MCNA 4A61A 3PXGa 2BE2B 3NTUA 1WOQA 2OLWA 5K8NA 2G5IB 2IVMA 2RF2B 3K58A 2H3QA 4M63A 2F40A 1BA1A 3OTDA 4MQ3A 4CZHA 2OM6A 1S0OA 3MI7X 4ECQA 4DFPA 2GGPB 3FRZA 4B3OB 4FJMA 4ZVGA 3DLBA 2BJ3A 4ZPBA 3W2VA 4IUFA 4BWJA 3EICA 3J81j 2GC8A 5IINA 4QIEA 2LHTA 3HVTB 3QRPA 4HLBA 4CDGA 2RLTA 2E6LA 2VASA 4OX9K 1U1OA 3L5KA 4LD0A 5HHIA 3ZEUA 2DUYA 2H3ZA 5TKWA 3OSNA 3SFGA 3E51A 4FS1A 4CGDA 2UYTA 1KDNA 4EP5A 1OSDA 4JI4J 4P52A 1IUJA 1F0XA 3LOUA 1HKBA 5C5JA 4AQYF 5KFTA 3GZFA 3OYIA 4E7HA 2PFPA 4QZHA 5FIIA 1O08A 1RT3A 5FLXO 3G8SA 4DFDA 2ETJA 5ETVA 1NK9A 5JVGQ 4ECYA 5AFUA 3SAHA 4HACA 3D68A 2XS7A 1QE1A 3NASA 1FKOA 1S77D 1GX5A 2VBZA 2O8FB 4EBEA 3CIPA 4OZLA 1WDTA 2I1QA 4G1QA 2FBVA 5KFKA 3MDAA 3WQUA 1UL3A 2ZIWB 4KLQA 3SDEB 3AO4A 4M5NA 3A4TA 2J0WA 2OO4A 1X0PA 2ES6A 3OGUA 3B8AX 1NGBA 4ECWA 1DGJA 4H5WA 3QSIA 4USMA 4Z4FA 1VLYA 4DSEA 2GMLA 4LF7F 4TKTA 4BG8A 1I1GA 5DB9A 4CZEA 1XQSC 1U6BA 2BDUA 3ZI4A 2QWQA 3L7PA 4DV7K 2EW9A 3FBFA 2Y0SD 4ILJA 2EZYA 4B3RJ 3QU5A 1DLOA 5C10A 3U8XA 4WFXA 2Q66A 1Q8LA 2PIIA 4F5PA 2Q2RA 1KKHA 4LRBA 3PKMA 4WJ3B 1CULB 1RBUA 1WUAA 4IFYA 2HOFA 1RHKB 5LJ3Y 2Q4TA 3M9OB 3CCEN 3PY8A 4E89A 2QLBB 2Q0UA 1PKUA 1RGVA 8ICXA 4QIWD 4DR6F 3NGTA 4RPXA 1FHTA 1FJGJ 4RW9B 3KKFA 3IN5A 1XNRF 1Y5NB 2KXHA 2GVDB 3WXKA 1YBTA 3I87A 3H98A 3LPTA 4R66A 1RA7A 3KWGA 3H90A 3SCXA 4URSA 2E2NA 4DV0K 1IBMF 3H7IA 2ZD1B 1XU4A 4JYAJ 3AA9A 5IIOA 1YHQN 3BS5A 4WF9L 2ILYA 1RADB 3NCQA 1IKXA 4Z4EA 5HJXA 3K17A 2X6NA 4FWLA 4X64K 4CF1A 2H5EA 1Y64A 5F8JA 2G0JA 3DXBA 3NOGA 4J9OA 2R2SA 5KT2A 2F8SA 1NSQA 3D28A 2DR5A 1KR4A 2XWXA 4U7BA 3AOAA 1UJ6A 3HRDD 4Z6EA 4WCEQ 2ZUGA 3N5FA 4KAIA 3ZZRA 1R8BA 1ZS6A 1RDBA 4FJ9A 3IR7B 1K8AO 5GTIU 2DIUA 2ZXIA 2LYVA 3C2KA 4RQ2A 3ZZOA 1SJ1A 2K1RA 3IV6A 5DGAA 1RPLA 4DL5A 2EI5A 2UXCF 1NJYA 4NLGA 3KDNA 4X4RA 3VEXA 5ALRA 2B4UA 1VSHA 1KN5A 3EM1A 2N7CA 1O03A 3C3LA 3CQ8A 2Y1JA 2KI2A 2RUSA 4TUSA 2FMQA 2K8CB 2YNHB 3DM2B 4RNHA 2P9LB 3AJ1A 5HMXA 2MQLA 4CF0A 1PK1A 9ICBA 4DSFA 1KVCA 4DS4A 2BEFA 2LFVA 5AICA 4P0PB 2PI5A 5IOLA 1W26A 4Z7CA 2DNRA 5EU7A 3L3FX 2R7QA 4DFKA 4YB7A 4NASA 3GTYX 2BZ2A 4ANCA 1TL3A 4OPKA 3ZSZA 4ZA1A 2XHCA 5M1KA 4Q5VA 3SUOA 2DWQA 2OELA 4A8OA 4K2XA 4FFDA 3QBWA 3M6KA 4PJ0U 3POTB 3HZEA 1HD1A 3AQOA 3OYLA 5J2DA 3B9JA 5E3RA 1RWMB 2YKMB 1TKXA 3CQXA 4BC5A 4PY5A 2I5JB 3QEWA 4WK1A 1X5SA 4J90A 1YJWN 4NWIA 1T03A 3MGIA 2W40A 3VZHA 1ZYQA 2MAXA 5J0QA 1HBMA 3HKWA 5F3TA 4OLPA 4B17A 2G07A 2AEFA 3M9MB 2R2RA 1HWIA 1X4FA 2F1FA 2QA4N 1Q81O 3FQLA 1X0FA 2P5VA 4DZDA 1RXWA 2HVIA 4D3GA 2ALYB 1GNKA 5IT4A 3O6WA 2ROPA 3DHXA 1QZ6A 1RM6C 2B0CA 3LP1B 1C1BA 2MZRA 1DGSA 4QNLA 1DURA 4ITSA 1BE4A 4DL2A 1O0PA 4U96A 1ZM9A 2QMWA 2CG8A 4NLOA 4KHPF 3PIOL 3TEHB 2HHWA 2IM3A 3QIDA 3Q8YA 1IR0A 5AKZA 4LFAJ 2BRKA 2AA4A 4DV0F 3DRYA 2P9NB 2K4IA 4P2FA 1WB9A 3C21A 4B1WB 4R64A 3L6QA 3UQSA 4WKYA 4J9SA 3C2MA 1NPKA 4DOAA 3I31A 1MWQA 3JTNA 4M9NA 1DTQB 4BDYA 2GLEA 4RLEA 5BN8A 3EN9A 1A6SA 2VQFK 3UDCA 3R9LA 5AHXA 2OKQA 3L3VA 4CH7A 4KIAA 3VCBA 2FLLA 2DITA 1VQ4S 1Z26A 2KXFA 5DB8A 3SR6A 1SQGA 5CZ1A 2W2MP 4Z37A 3ULEA 5M2PA 4B1YB 3K0JA 2YMMA 1OY6A 3NRWA 4DV6J 4PZOA 1QJHA 4DV6F 5BPMA 4LBHA 3HSCA 5AT1B 1KQSR 5AZJB 4NO7A 4X4TA 3RUBL 3SUPA 2UZAA 1KONA 3M6UA 4JS4A 2ZBRA 4OJPA 4J9RA 2VG5A 1R8AA 3TAEA 3S3NA 2BCQA 2J6UA 4QR1A 4KBOA 2FI1A 3NS5A 4YNQA 8ICSA 4NLXA 4YQWA 2AIRB 4M1KA 1XNQF 5CD4A 3G9CA 2FZKB 1RCHA 1SCJB 3M7VA 3GV8B 3H2UB 1SZHA 2BYCA 4KHWA 2GJIA 2WK4A 1N5QA 4LY7A 1A6LA 1NGAA 3SBTA 3HW8A 1LKZA 1DFDA 2V5HG 3SDEA 3QO9A 7ICRA 2OPRA 3N6MA 2G8UA 4PWDA 3AO2A 2D1KA 2WONA 5CE3A 4RZRA 3CCMS 4KHQA 5DZ6A 1RBRA 2Y9TA 2NUBA 1XMBA 3IR6B 1RYRA 2NYIA 2IOFK 1P9QC 4ZVRB 5J0SA 3CJ9A 1NM2A 5J2FA 2RE1A 3N7RC 2HHHJ 4CO2A 4EAHD 9ICGA 2JV3A 1AUSL 2HVEA 1FA0A 2N82B 6FDRA 4KREA 2HSEB 1C0MA 3UE2A 2HS4A 3KJVB 3VF2A 1I94F 5D3GB 4F3MA 4FJ8A 5TKYA 3CG7A 1ILYA 5KRSA 2F63A 3NUQA 2VKRA 4FJJA 4X64F 1Y3JA 1X4HA 3TQEA 5GADU 4O4GB 4RPZA 2RSQA 4JI6K 5FROA 3MMBB 1GX6A 4OHXA 5E0OA 5AQZA 3BO4A 4CEZA 1S7HA 1LXNA 2H3FA 2UUCF 1WSRA 1GLBG 1VMBA 2MKJA 4CJ4A 1EKRA 1J9AA 3L09A 2B4PA 2D5RA 4M3XA 1ASVA 2D3ZA 4RKUC 3QT8A 1YUWA 3JPSA 1IR2A 3A8EA 2ZIXA 1KC8T 5KFIA 4BWMA 1MMLA 1RT5A 2AF6A 3H1VX 2HBLA 1C0TB 3ID8A 3NF9A 2AGPA 4F5NA 2DR9A 3TZYA 4FSVA 3O2IA 2VODA 4GXJA 1NNEA 3EE3A 1Y5IB 2FF3B 2DHGA 4CK1A 4RTFD 2OZMA 1HBUB 4NL9C 1Q16B 4Y2YA 4H0OA 3A0IX 2A1BA 1NOMA 4AL6A 1JLGB 2KL8A 5D3GA 2R7SA 3ZZUA 2EC0A 1WSJA 2QA4G 3E2EA 4ILGB 3TJ9A 3VGVA 1S5ZA 8ICIA 2L9DA 4Z94A 4JI1J 4Y2PA 3T6BA 3TW0A 2F44A 2W3SA 3TAPA 9ICEA 3JPOA 3F2CA 4C1NK 2HKEA 4MIWA 1TR0A 2HYIB 1BPEA 1HQEB 2IVNA 3SNNA 5KL8B 3QT6A 3NCPA 4OI0A 2YQ0A 2WB1F 5LY3A 4EFHA 2IRYA 1SL1A 3DMJB 1PVPA 5FD1A 3AVIA 2Y0BB 1SV4A 3DRPB 2XBPA 4BDZA 4JK8A 8ICWA 1EETA 1IKWA 2XZDB 1WD6A 3C65A 3SQOP 2GWSA 1WWHA 5HMZA 5CA5A 4AHUA 1CJUB 2QWMA 2QC3A 3I28A 3W9HA 1NSPA 1RAGB 4NMLA 1NG9A 2AKWB 1PO6A 3J81O 1JXLA 4QOTA 3CIZA 1UWBB 4FLTA 3PHTA 2YKAA 5J2MA 3M8SA 4WFYA 2F3JA 1Z4NA 1X4GA 4QIWF 2YKOA 1KL9A 1WC3A 4CT9A 3H59A 2M7SA 4IZ9A 2A3JA 1VI7A 4M3UA 1N5VA 3ZZYA 5C2FA 4EEKA 4E1JA 2LXIA 2WAQC 3WNFA 3HI0A 5E79U 1RGIA 3PZPA 1MA7A 1S1TB 5FDLA 3P1GA 3K57A 3M2RB 1DTQA 3EGNA 5B66U 1WAFA 3EPGA 4V19X 4O5CA 2F7VA 2JHDA 2CPHA 4LF5K 1T03B 2R7RA 5IV3A 1NOZA 5CYMA 4QU6A 3K89A 1X9XA 4FXVA 1GLJO 1WOOA 2ZUAA 4YDUA 8AT1B 1GMWD 3RJMB 3JAMY 4I2FA 1LW2B 5HN0A 4W90B 2W2OP 4NL9A 3RR8A 1FIQA 2DKXA 3RRGA 4XH1A 3N28A 2ASOA 4UATA 2KEYA 1HPMA 3BP8A 3UFCX 2KW4A 2DKOB 4Z4GA 4WQ4C 2CQ2A 4UAVA 2BW2A 2E5LK 1WTBA 3DLLL 4LRCA 5CQGA 2OPSA 3ICXA 4MEYA 3M9NB 5BYRA 4O3RA 5JMVA 1UJ5A 1LFPA 5CAAA 3DLEA 2IJFA 4YMMA 1S3XA 3UNYA 1X5TA 2FXUA 4F5OA 3AVHA 1SC4B 1IIPA 1FNMA 3H2LA 5KG7A 1QD1A 2HQ3A 2HHSA 4IBNA 2K89A 3C14A 2RRBA 3HPOA 3KMQA 3QNOA 3MDFA 4JI5K 5CZXA 3VAGA 4RUBA 5LSLA 5DDYA 1E6YA 1RAIB 4FLWA 4KQZA 3NMRA 4R8UB 4PGYA 3I0RA 5HMYA 3QLHA 2F8KA 1RWPB 5EX0A 4DDFA 3KG4A 1OVQA 2R8IA 2MKIA 4F3QA 2MY8A 1NU4A 2ZKTA 1U1KA 3VWSA 3MR5A 2KMDA 5T7LB 5J2CA 1KQQA 3QBXA 2ADBA 4JB3A 3C6TB 2GVZA 4UOFA 1REVB 5KFBA 3KOOA 3DRSB 3ZTPA 3VZIA 2HOQA 2DO0A 1QAIA 2D8CA 2WHEA 3K59A 3MFHA 3ETRA 3V6KA 3P8BB 3HHNB 4MAKA 4CJEA 1HR0F 2B8QA 3HI9A 1YDLA 3KLEA 3KTQA 1SPBP 4EENA 3H25A 3DOLA 1HKCA 3M8PA 3KKSA 3WKDA 3G8QA 1OUQA 2AEJA 4DV7J 2RS8A 1VQ7N 1YLXA 3FKBA 3CCLS 1VHXA 1WHYA 3VTHA 3SPZA 4DCOB 2CIMA 3DLJA 4HTIA 3MXMA 1L3UA 3QINA 1HUXA 2BJ1A 2Q31A 4USJC 1OY9A 1NGEA 1YJ7A 5A0LA 4PHAA 4G1IA 1JJHA 3ZC4A 1YJ9S 1WC0A 3R2DJ 1BQMB 4BE1A 2JRSA 2UXBF 4R5PA 3J8AA 4L8RB 2KZ3A 1UEKA 3DEEA 1YRTA 2JFDA 3AFGA 4CZKA 2LQJA 3KBBA 2JLEA 3V7JA 3SV3A 3Q22A 2ZBQA 1RYSA 2XLJA 5KFRA 2K60A 1KOHA 3OYJA 1MW7A 1IKVA 2IFXA 2FSKA 1UVNA 3T69A 2EFVA 3D0PA 3LZIA 4I56A 1KHVA 2H9ZA 1U25A 4DPOA 3MTJA 5HVGA 4OZ3A 4ETZA 4W5NA 4PL2A 3ILJA 4Y2QA 4RNMA 4JYAK 2CA9A 1FF2A 5DG7A 3MMCA 5ETLA 1K73O 2HHPA 1X9WA 1LWCA 5BOLA 2BVZA 4J2EA 1ZQWA 3BQ2A 1Z00A 2O8DB 1Q78A 9ICWA 1JL1A 2E7VA 3LK9A 2CZVC 3WKAA 4FN5A 4M8LA 3QU7A 4DUYJ 2FY1A 1RCOB 3OS1A 1WCLA 2GQCA 1NLVA 9ICPA 1IG8A 3QEAZ 1NMEB 1N33F 1X5PA 3TAMB 5IQ6A 2E1YA 3RJFA 3R8EA 2VKQA 5B8HA 5HVHA 3ZSOA 1LW0B 2DGXA 4KLJA 1WI6A 2RAQA 2VB6A 1FCAA 3CCTA 5ADXH 3CC4S 3DWLA 2BW7A 3ELHA 4BRLA 4A47A 1H2UX 4KC5A 1YHQS 5ALOA 2ZC4A 5MLCQ 4ZCLA 4F8RA 5KFEA 3TI0A 4DFMA 3SQ0A 5IXUA 3HVTA 5TZVA 3ZSVA 3SQ2A 2VPZB 3AOBA 1M90T 3EKUA 4HR2A 4Q45A 2C2EA 2FUG9 2C3OA 1CJTB 4K2JA 2OGUA 4PH5A 5KQDA 4OJOA 3F5TA 5EOZA 5J1EA 7FDRA 1LFWA 2HQCA 3TNVA 2IOCA 1WKLA 1T9VA 4NCGB 2MLYA 3BBBA 3SV4A 3JAMO 1HPZB 4CLKA 4KN4A 1WG1A 3I9ZA 3O08A 4B3MK 5KFPA 3CCVN 2ILZA 4ZVTB 3AJDA 4C8YA 4DL6A 1YSJA 3UDVA 1N60A 1BY9A 2UV8G 4DQQA 1FEZA 1LWFB 4UB1A 1K5OA 4Z0UA 4P0QA 4EGLA 1C1CA 3NS7B 2RU3A 2A3ZA 3E9PA 4DV3J 1RZTA 3DXMB 4M3TA 1F1BB 1RT5B 1NO8A 1E3MA 2DY4A 3MWBA 3KZBA 1J5EJ 2LQ9A 4OHYA 3HYFA 3VENA 3ZTQA 4DL4A 3QFPA 4CYUA 4A5AA 4Y1DA 4LBIA 5IQQA 4NLUA 3QRRA 2BTFA 5BR8K 5CHGA 1B0PA 4QCLA 3CJCA 3H6EA 4QU7A 3AAWB 4NLWA 2ZH3A 1WOPA 1S22A 3WXJA 1TYQB 2OH2A 4DV5F 2BJDA 2YMPA 2E2PA 1P7DA 4JKGA 2K8GA 5HP1B 2YNFB 4BRGA 1IM4A 2WHOA 4FM1A 4DR7F 1BHLA 2Z4PA 4TLQA 1NHVA 4CHZA 2UUCJ 1CZ9A 4Y1CA 5K8PA 4ED2A 4K50A 2A19A 4OYPA 1ZQJA 5A2QO 2V4RA 2ASJA 1Z05A 2Z1HA 1TAQA 4XTTA 4WTOB 5L38A 3IAM9 3MAQA 2KZZA 3NVYA 5DDOC 2BJ9A 5AKHA 4M95A 4YOUA 3P38A 2Z1GA 5D0EA 1TKXB 4F4YA 2X1AA 1MROA 1C0UB 5KFDA 4USWA 2G8IA 5L9NA 2CGKA 3E0FA 2YKNB 2KSOB 3MMAB 1JJ2M 4I7FA 2EWHA 1PJ6A 5E26A 4M45A 2NXNA 4FKXA 5CYQB 3BH7B 2BE2A 4AF1A 2PO4A 4CLYA 1BPXA 1WYGA 2QEXN 4DS5A 3MPDA 3WUHA 2M8DB 3N7SC 2YWFA 4K4HA 3ZTOA 3KLVA 3TKAA 3GIMA 3Q8QB 1BGXT 3VQAA 4ECRA 3OTQA 4DR7K 2JLGA 1TTHB 1VSFA 1VQPN 5ALZA 1PAUB 5JS2A 1JCEA 3IGNA 2JVOA 5DB7A 2QMUB 4I28A 2YN4A 4JK9A 1NRKA 5K14A 4LF9J 4BRMA 2P5OA 1DT9A 4IC9A 1Y88A 3OYMA 2CNNB 2XG8A 2OPRB 4Z6FA 4DV2J 2HHHK 5A8RB 5AKGA 3KZIU 2QLTA 4QIFA 4XDDA 1WOSA 2HW3A 1VSDA 2XY7A 4N77A 4CK3A 2BZFA 3NP5A 2XWYA 4NY8A 2CPXA 2NRTA 3ENQA 4M5LA 4O9MA 1OYEA 3N0VA 1COKA 4XPCA 3KLGB 4JI6J 2VG7A 2DD8S 1JLEA 5C15A 1IWGA 4Y6IA 3RB6A 3WNGA 4QZVB 1YJWS 2EX3A 2CNLB 3QT5A 4LSLA 3IKMA 2IDEA 3GZ7A 2VL1A 3LM2A 3VQ4A 2JGAA 3HD2A 4Y2CA 2UUAF 4DQPA 3CO0P 3VGUA 3TZXA 3HSZA 1OS5A 5AKEA 4A4JA 1DTTB 1T6CA 3O3GA 3OSPA 4MN4C 4DV5K 2O6KA 3WEEB 2YV0X 3G0ZA 1QSLA 2IM1A 4J37A 4CD1A 2IA6A 3OHRA 1VQKS 2QKQA 4KE5A 4X4NA 1GLLO 3GJQB 4DPWA 3AO5A 4ZLNA 1N34K 3UQ0A 1SBRA 2PYJA 3A0BU 3C14B 3TADA 4LFCK 5KOWA 4MFCA 5AKXA 9ICUA 3FNNA 4LUBA 9ICLA 3KUHA 2A0FB 4IH5A 4K4SA 3RJEA 4I2CA 1JLEB 3PW2A 2W2NP 2CXEA 2NRWA 3L0QA 2V8VA 3DKDA 3LO3A 3PYGA 2QSWA 2J9DE 3T5JA 1N33K 4WXOA 5DBCA 3B6PA 4I64A 3M32A 3AGRA 2KNJA 3NH2A 4LSLB 1OPIA 1N63A 4RNOA 1KCFA 4LF5J 4WZMA 3Q8PB 1UT8A 1S1XA 2CKWA 1GLDG 3S6JA 4UBCA 2W7PA 2W7AA 3F2KA 1T3QA 2XIDA 2V9KA 4KAZA 4ED7A 5I3UB 3A0HU 3NE6A 2ZUCA 2GVDA 3TUPA 1XBWA 2NRVA 1JLFB 4LF7J 1T9TA 3MX2A 2WTUA 5J2QB 3GQCA 4ZVQB 3CWJA 4AD6A 2K2PA 3UPFA 1HNWJ 1S10A 2DB1A 5LMUF 2OFHX 2HMIB 5JVGL 2F4VJ 3KZXA 1TUUA 3SCIE 1XNQK 4CF9A 3IRWP 1BWVA 3M6XA 4UTGA 4U9RA 3LGNA 5AQGA 2M4MA 3VEVA 1VRUB 4KFBB 2W3RA 2MLXA 4C3LA 5JJBA 4OJGA 4OYWA 5AQMA 1FRJA 5IT0A 3FBEA 2I0XA 1N5SA 4C3KA 1DHMA 2FD2A 3CPWR 1WLJA 1MROB 3E9LA 2KJ8A 3RFAA 3ZLJA 4RUCA 2JVRA 2WAQD 4MK8A 5AM1A 1KBRA 3D1HA 5BRHA 5FPMA 1VISA 4UF4A 2VJ4A 7ICUA 1SC1B 1SUQB 1TKTA 4IH6A 4TVAB 4CH0S 2YPZA 4BC4A 3NXZA 3U27A 1NSKL 4UB8U 1K6YA 4I2EA 3BYRA 4NLZA 3WK7A 2Q1LA 3SUNA 1R6VA 1LAVA 1ZQNA 2F65A 1VBXA 3M8YA 4H54A 1F2GA 1UVMA 2CGLA 2CNKB 5IT9O 2DFEA 4LR8A 1ZQYA 4EK2A 4YB6A 3AVMA 1FO1A 2QEXS 2RP5A 2GMHA 5B09A 3TOQA 3A13A 3U4LA 4K4YA 4MK7A 2ZOMA 4TLRA 2E5LJ 3I5CA 3EGZA 1ZA2B 2DPNA 3ET6A 3MR7A 1ZBFA 4OZJA 3N4MB 5FP0A 5A2QY 2Q1NA 3O3HA 3BGLA 4LSNB 5L1JA 1M5VC 2E1EA 3MZIA 4DFJA 3DYAA 1YJNN 2MZTA 4KKOA 2DRDA 4UB5A 1YQHA 4B08A 5GAEI 4IOXA 1KQGB 2VBWA 5IIJA 4ED6A 4ERDA 4ID5A 3KK2B 4U8YA 2RRAA 1HNZK 1D1UA 2PMHA 5FJ4A 1IBLK 3C5GA 4LF4J 3FGVA 4Y2UA 2GQ2A 1Q79A 3R3LA 1O5JA 4CF3A 2M52A 1NHUA 1H98A 3GE9A 4DTUA 1MSWD 4A8KA 3HT0A 4PWUA 3MM9A 1GTHA 1DLOB 5EE0A 4YFKA 1F5CA 3WHIA 4CF8A 4ID1A 1V3SA 3B4DA 4BC9A 2W41A 4JS5A 3HKZD 1IQTA 2VANA 4AE5A 1TUGB 1YVNA 1NAQA 4DR5F 4DV1K 5KI6A 1HBUA 2V50A 1JL2A 1XS9D 3DU6A 5ALNA 4UY8T 1T3OA 4ED8A 3R5DA 1RU1A 3FEYB 1L7MA 4KHSA 1HARA 4M5JA 1IKWB 4HT5A 4IG0B 4HTLA 3KNAA 4Q8FA 2KM8B 9ATCB 3AAPA 4JD2A 4M9GA 4JV1A 1MN8A 2E66A 4OI6A 4AILC 2EBGA 1AW0A 2XHBA 3P4IA 2Q6BA 4NRTA 3HSGA 3R5JB 3D54A 3DLKA 3IFRA 4TU7A 1I6JA 1X8DA 1D8BA 2JR5A 2JWLA 2GW8A 4GIBA 3CQYA 5KFLA 2MTLA 5IFMA 1GXTA 3CMQA 4IL6U 4KY3A 3O1LA 5GINA 1Q7YO 2H4WB 5AQPA 4CEDA 2E44A 4ZPCA 1UMJA 5DS7A 1JB0C 3IR5B 3AA5X 3VQCA 3NF7A 5ADXA 4YOEA 4GNIA 2BJ7A 3L2VA 4GKJF 5LMNJ 1YVUA 2E3TA 4WPAA 3LP3A 5CWRA 4E7IA 3FCHA 5AJ3K 5J2AA 4YY3F 4JI3K 1HLWA 2QWNA 3V9ZA 7ICKA 3V81A 3M6ZA 4RUHA 3OBYA 3M8QB 3W2VB 1WG4A 2ZIVB 2X7IA 4OLBA 1XNSA 1E6VA 5T7LA 1JNZB 2A1AA 2KYZA 4HKQA 4DUYK 2IM0A 4IRKA 2GV9A 5ALXA 4CIFA 2ZJRL 5HQMA 4NRUA 4ED4A 5KFXA 1WC4A 1HNXJ 3KHYA 3PYEA 2AZ3A 3AVLA 3ZDEA 3CE8A 4N8NA 2IRUA 4DV3K 1IBMK 4X66J 3ZSRA 4TU8A 1U1MA 2UUBK 2HFVA 2E7XA 2HMPA 2YVSA 4BDPA 3DOMB 4IFEA 3ZSQA 2U1AA 1H2TZ 4AXIA 4C11A 4LH4A 5LXYA 1N8RT 2DXFA 3GCWP 2ZHBA 4CLPA 5T7BA 1Q81T 3BEGB 4QAGA 1PCAA 1S72S 4FWSA 2VKZG 2XRIA 1WAJA 4J9VA 4NLKA 3FFIA 1S8OA 1ZD2P 1VC0A 3OPKA 1A5XA 4F4AA 3D66A 2Q3SA 4Z7YA 5B0BA 4F71A 2Z2YB 4C0ZA 8ICVA 1B0TA 4YB5A 2IDLA 3IO1A 3OR1A 4O0IA 3KKRA 5T14A 5D49A 4RBVA 1SGGA 1JX4A 1WORA 4X62F 3KJFB 3QGIA 5CR0A 4H4KC 3R7NB 1WG5A 3OYEA 2YQ3A 2DT9A 1ZD5A 5ALTA 2FSJA 2QARA 5H2FU 1FE0A 1VLBA 3SI6A 2KLAA 2N1RA 4CDIA 2V4JB 2DGTA 2JZ5A 2AJ4A 3W9IA 4CH1A 4WJBA 3ETOA 3QUBA 5DB6A 1KBUA 3RBEA 1SXDA 4C8NA 1J5EK 4YHHJ 5IZHA 1MNEA 4JI7J 3CFOA 4EU0A 3ULHA 2R42A 3IP0A 3C1ZA 1V9OA 2HNDA 5F3XB 2HG4A 3VQEA 1VGYA 3MF5A 1FKPA 1U48A 4DV4F 3VAMA 4PEOA 3DOLB 1L7NA 2M70A 5J8YA 1CS4A 1YAGA 3IUCA 4W5RA 4F72A 1CQMA 3OW2M 3B4MA 3V1QA 4GV3A 3DN9A 1LAWA 1Y0HA 1SL0A 4AYBC 1S9GB 2J4RA 4IKAA 3RSEA 2D0PA 1XO1A 3ZX2A 3BYPA 4RW7B 3G71N 3I1YA 3LDSA 3D0GE 3EGVA 2VA3A 4GXIA 3V6HA 3GIRA 2K3KA 1MU2A 3CCJN 3EXYA 4DR4J 4G1PA 2IVOA 2CJKA 2LU1A 1JJ2R 2I1RA 3FLCO 2YWWA 2FGCA 1S4EA 3QEIA 1VAZA 4Y2XA 2DL0A 3L9ZA 3OYHA 4X4UA 5KT4A 3LWMA 2XYPB 3FEZA 3ZO7A 1Z25A 3IXQA 3A12A 5FRMA 1HLUA 4DR3K 2QLJB 4M5IA 1GAOA 3PRVA 5SWMA 2JGUA 1IBCB 3HHLB 2WFAA 2VFUA 3K5NA 2QO3A 2CZ9A 1HYZA 2ZF5O 1P1LA 1YI2N 4CO4A 2ZDPA 3MC1A 1CQNA 3BN4A 4HCCA 2VQFF 3BO3A 1RXOB 2XMTA 1KLNA 4BGDA 3CERA 3OTBA 4BRPA 2B0GA 4DV5J 2IVYA 4EWTA 3CJBA 4KLSA 3IFEA 3QU2A 3HHLC 4OJHA 3HKZC 3MN5A 8ATCB 8ICFA 3LPUA 4ZVEA 1NKEA 5KGXA 3OR1B 3PNIA 1FEEA 4HUGA 4JV5F 1N34J 3V9XA 3T3FA 1VK0A 1ZD3A 3F5EA 1LWXA 4LF9K 3IM8A 3T1YF 3EWAA 4LFCJ 3VC8A 3I56N 4I2JA 3FZKA 1VQNN 7FD1A 4DV2K 4C8MA 4M47A 4XH5A 5IIKA 1B43A 2KVSA 5E5NA 1T11A 4IKFA 3RF9A 3AEVA 5ALDA 2GAHC 2PN6A 1WSGA 3NVKA 4IQXA 3WNEA 2CUYA 3A3OB 3PSIA 1WDDA 3KK3B 4TSXA 3WX4A 4CJKA 3J7A1 2XMAA 2VDIA 1N56A 1AXQA 1ACMB 2EC2A 4J91A 2YX8A 3T1YK 4FNHA 3UKUB 3H4DA 2C2DA 1M5KC 1BNOA 3ZSYA 4C7YA 3ZDDA 1KAYA 4GMJB 2BUPA 4U95A 5J0PA 4P4PA 5CP2A 3H5UA 1KVBA 1X66A 4F4KA 1NHKL 2FBYA 2EDUA 2NYHA 2YKNA 5J1EB 1VHFA 2JWKA 1RT2A 1TMJA 4TXSA 2CYYA 4CTAA 4PPZA 4ZHRB 1RWVB 3OQ2A 4U67Q 3C2LA 3R5CA 4JI8K 3G82A 2E8PA 2BE9B 4TN2A 4ED1A 3F0NA 3D2SA 4X65K 2G4BA 3PCOB 2F9WA 4ZIVA 3ZDBA 3VHQA 2MKCA 2DY1A 3NGSA 2V8DA 1N36J 1U04A 1LWFA 3RG6A 2J9DA 1SV0A 3I5BA 3OXFA 4YG2A 4BG9A 2QT7A 5J2EA 3OUYA 2HK2A 4ZPTR 4OLAA 4BHQA 1QE1B 4DMNA 5DDQC 3Q0AA 4C98A 3OVBA 5K4LA 2QG9B 3WNHA 3O3FA 5J2HA 4RO0A 5E2QA 4FWOA 1MDUB 1NGHA 2HZAA 1QHAA 1TVRB 3UVJB 1G2EA 1F9HA 4ZVOB 5AI6A 1BOTO 3GV7B 3SLCA 1FT8A 8ICJA 1R89A 1RTZA 5D4OA 1GOCA 4YOWA 4NZ7A 1EXNA 4A8XA 5CYQA 5JICA 3SMSA 1VK8A 3T79A 3AVAA 2F76X 2Q43A 4WK3A 4MT1A 4NYFA 2E1FA 5CY4A 1Z1VA 1AYEA 5K20B 2A10A 3MGJA 1BO5O 1I51B 2F4VK 4K25A 2B9EA 5GVQA 4DO9A 4DQSA 4E2FB 3AHPA 5AK3A 4QWDA 1OH7A 4PXDA 2HAFA 3FCVA 3ET6B 2O01C 3SJJA 4Z6DA 4P7VA 3BY5A 1FXXA 3LDPA 4F02A 4PL1A 5HL7Q 4I6MB 5G5HA 4H4MB 1HW9A 3PW5A 2HB5A 3GOIA 4KITB 7AT1B 3DDIA 5A0YA 2EBEA 1ZPWX 1Z00B 1KVAA 3PFOA 3VETA 4A8MP 3BQ1A 3O44A 4G65A 2KIVA 1D9FA 5E3AA 1HR0K 2MGZB 2VG5B 2DGVA 4FF2A 2AGQA 2YNIB 4DR6K 1U47A 2XMUA 3AO3A 3ETMA 9ICKA 4RQMA 1P1TA 2YKQA 3MX5A 5AXMA 4YXMA 1V4TA 4RQ0A 3UCZP 2JSXA 4ZP9A 1MWYA 4IDKA 1Q46A 2ZIUB 3HJEA 1SKWA 2J6TA 4F26A 2QLXA 4M9HA 2CPEA 3CCWA 3IDHA 5EWGA 1HYSB 3M5RA 4DCJB 4BRAA 1VSMA 5F0XA 2CPRA 4DV1J 9ICVA 1BI4B 3Q8VA 2K7JA 1ZBTA 5EWEA 4A8YA 4QS8A 4EX7A 1KS2A 2EG1A 1TZ0A 3W3DA 4R8UA 3KXDA 1ZQQA 3GU3A 3A5LC 4M6WA 3PNCA 3V2UC 3NGDA 3AA4A 3HFZB 3LP1A 3CJ2A 3MD1A 1XHXA 2MLZA 1IG9A 1FI4A 4ICLA 2AYMA 1QAXA 3IWXA 2HQGA 1JQGA 4AP9A 4LVNP 1J2NA 3ZNUA 4GKKJ 1SAZA 2CQ3A 2HNYB 3DDKA 2F7TA 1TFWA 2C22A 4RQ6A 3H8JA 3N4WA 3I4HX 4H0PA 4I68A 1UTAA 2DJWA 3WK9A 4KLFA 1YRXA 2PEBA 2LLZA 1YITN 1RDAA 4CZIA 5J2PB 4RQ3A 2B3TB 4FF4A 3SBGA 2WSFC 3J7AP 1HUOA 4ES3A 3ZX3A 1NLKL 3M05A 2E9TA 3MECA 3NH1A 4CO5A 2Q3PA 1HHTP 4O8UA 4OJLA 5C12A 4QZCA 2ATQA 2G8HA 4HHUA 1RT6A 2CPDA 3CF5L 3O8WA 3VQ8A 2P9KA 5J2PA 4QW9A 1FWKA 1TKDA 4DEZA 4DR1F 2OPQB 2R8GA 3BQ0A 1WELA 3BDEA 1GLAG 3ONNA 1HNVB 1S1UB 3P96A 1RWUA 2ROGA 2EZXA 1ZQMA 4M7XA 3HP6A 1UA0A 2JL9A 2PMZC 4ED0A 3LAMA 3N4QA 2V2QA 3LA0A 3MCAB 1JLCA 4PUOB 3HF5A 4UAYA 4RW8A 4GVMA 1I39A 2A6OA 2D0CA 4F92B 1WWVA 4P2HA 1N5WA 4LH5A 1T94A 4JP8A 3SQIA 3ITHB 2VHGA 4J9KA 2NO5A 4RQ4A 3E3XA 4YMEA 2MA1A 1RTDB 5BYSA 1ROFA 2XYHB 3BV8A 3PV8A 4C11B 2XCAA 4X62K 5B5EU 2GO7A 2W43A 3F44A 2HGMA 4O0NA 3AVKA 2OIHA 1WG8A 2ITMA 1UA1A 2EFGA 1H72C 5GAHI 3U1MA 1HNXF 1RT4A 1F5AA 4YB1P 2W4PA 4PQUA 5ITHA 3SIPB 2A2CA 3GYXB 1HJRA 1WC6A 4JKCA 2HHVA 2ASLA 4ZP7A 2GJ2A 4AYBD 3FZLA 4CLTA 9ICFA 5EE3A 3K5OA 1BI4A 3LP0B 5JRTA 3QETA 1NWKA 3IGVA 3IG5A 2A2DA 1FJ7A 3CT9A 4RW8B 4RWXA 5LL6Z 3FBCA 3CJ0A 3OL8A 3B78A 2XZTB 2NRZA 1GXUA 2R7WA 5LL6d 2P9IA 1NOYA 3CVKA 1CXQA 3CXCM 1U8SA 2ZD1A 3VEWA 1FKOB 3OVAA 9ICTA 3HX9A 2W55A 2F8LA 2PD1A 1CSJA 1IBMJ 1SC6A 4JYAF 2VDHA 2GWKA 3MEDB 3MFIA 1UEUA 1N62A 5J0WA 2UUBJ 1RT4B 4A46A 4JI7K 5B0GA 3EZUA 4X4OA 1K0TA 3CMAS 1VQ9S 2ZHOA 1FXRA 1S9EA 1DXSA 4IOAL 3U02A 2GNKA 3SK3A 1LK7A 2BM1A 4DWIA 1N54B 2LDYA 1OH5A 1X9JA 3US5A 4C4SA 4CQ1A 2DGUA 1NBEB 2W9BA 4IFYB 5D4NA 4QW8A 4F4WA 2YWKA 3QLHB 1SVDA 5D77A 3VQ5A 3ENHA 1HQUA 3AXMA 3GCXP 3WKBA 3X1LB 3OHBA 3KWMA 2ZBPA 5CZ2A 3UPQA 4R0JA 3RZAA 4LVOP 3BJYA 5HL7L 3J7ZT 4ECUA 4WU2A 4YS2A 4WYBA 4L6V3 3MOJB 5E7OB 4O3OA 1BISA 1TVRA 2OMOA 1VQMS 2N3LA 3ILOA 2E1MC 2FC9A 2O8EB 5BRFA 2WRMA 2X51A 4F2SA 4I2HA 2P2CB 5CA7A 4QJFB 2IHR1 2P9PB 3PG9A 2DCLA 3AY9A 1NGCA 2QXLA 1JLCB 3V72A 2BJEA 4PUOA 1VRTA 2K3IA 3C19A 4JBCA 1VQ6S 2GH1A 1ZRNA 2RVJA 4E0DA 3B82A 5AM2A 1B70B 4DLGA 1T3NA 2CQ0A 4IO9Q 3KUGA 4Q2MA 4ZVSB 1QQNA 4ILMA 2D3DA 2HQIA 2JEFA 4DU4A 4MK9A 4W98A 5E3QA 1FRXA 3WX8A 2BA9A 1U4BA 5HLFB 1ZTTA 3QUTA 3W63A 5LSRA 3MGHA 5HO4A 2K7KA 3QIPA 4PA1A 1RBTA 4LZDA 3CCJS 4QWBA 2E2QA 2WF7A 1R8PA 2MU2A 1MQ2A 2B5JA 2YTUA 1NKCA 2B4OA 3LALA 5DDPC 3C15B 7ICTA 2XS5A 1ECWA 2QTWA 3RBDA 2VU5A 1EQYA 1EKEA 3GMGA 4C8KA 4KRWA 4XRHA 1RCXB 5F9NA 4N8OA 3D2EA 1QCKA 4DLEA 2AW0A 3MMJA 2M2BA 3PW4A 2KG5A 4NZ6A 2NLXA 1RTHA 5BN9A 2UVWA 4B3OA 1B7YB 4F25A 1TUVA 4NCGA 2HVDA 3OTOJ 1NCLA 4YVZA 4E19A 1HYSA 3TVKA 3ENBA 1BQXA 2PYLA 4CYUB 1JCGA 1RU2A 2AX1A 5BPLA 3KFUF 4KB1A 2NPIA 4OD0A 3OD2A 4LRDA 1O1WA 4QYZJ 1RG6A 4JMUA 4JI8F 4OMFG 2VF3A 4I6AA 4HDGA 1VQ9N 4PPDA 2J5AA 1KAXA 3VF4A 2P6SA 3VOVA 5J2IA 5AQNA 3KD3A 4XPEA 5DQHA 3D2NA 3D2FB 4F93B 1X1PA 3GSIA 1E6VB 3W61A 2B43A 3UCUP 2ZIVA 3AH6A 3QQCD 1GLCG 4AQYK 4I9LA 4NEZA 1T44A 1WEZA 1RILA 3NMAA 3TSPA 1ATNA 2ERRA 4DPUA 2ZZTA 2JMGA 5A6WA 4P6QA 2FHJA 4WFBQ 3DRRA 4FL9A 1ZAVA 4EUVA 4A2AA 4CGFA 3UCGA 4ID8A 4WWSA 4LF1A 3MXHP 4W5QA 3NF6A 3I33A 2VWJA 1T05B 3MUMP 1N36K 1P8ZA 2NXEA 5L1LA 4M94A 4MIBA 2CDQA 2P8IA 1PC5A 1BUXA 2M9NA 1KVJA 1IH7A 2VG6B 3ISNC 4DTJA 1UCVA 3R8YA 1UPMB 5DM6Q 2J8SA 2G8WA 2H65B 3EDRB 4F0MA 1YBUA 3NWRA 1KQFB 4KV8A 4FCYA 1F9EB 4LREA 4DR3F 5J8YC 3ISDA 1LW0A 3AAQA 3L7OA 4PHEA 2FF6A 2BRLA 4DOCA 2I6XA 2FVQA 2MQ8A 4ZCIA 1RBVA 4DUZF 2H5XA 4J9UE 3J80O 3QESA 3L4IA 2QB1A 3MPWA 3QJPA 4FLUA 2W4DA 4YMNA 5AZJA 1C1CB 4UW9A 4ZIWA 2PI4A 3QYYA 2B56A 4YOXA 2MYFA 2XVTA 4R5PB 1AZSB 2CAJA 2RNEA 2W6KA 2GBZA 3Q8KA 1HHSA 3O9UA 3IBPA 1AT1B 4RW6B 4U7UK 2CJ9A 2OA8A 7ICVA 4Z4CA 1WHVA 3KG1A 1HHQA 2HIQA 2DVIA 4JV2A 2CZ4A 1XNRK 4ILHA 1HWUA 3UN2A 2B5JB 3R5BA 5BRDA 1LWEA 4CEFA 2RJZA 2NLWA 3THYB 2C42A 2XCPA 4QR0A 2FJVA 1Z3EB 4FBUA 3FC9A 2OFGX 3K75D 2YHWA 5A8WB 2D69A 3VQBA 1EWRA 3X3UA 1PBUA 4IDHA 3PFEA 2LVWA 3WEEA 4OYMA 2MSNA 4N47A 3QO9B 2B21A 3HFKA 4MDAA 3EYZA 3AU2A 1Z6RA 8ICLA 3BBCA 3W3SA 1TFRA 2Z30B 2I7NA 2XS2A 1UOCA 3MTKA 5T41A 5CJ7A 1F9FA 3PHEA 3VCDA 1XWLA 2UXDJ 2CJXB 4ILRA 2ZJ5A 4JI1F 1QQOA 3E9OA 4ZPWR 1YZ7A 4AT1B 3AO1A 1UZHA 2PGCA 2GCFA 2QKBA 3OLAA 3THYA 4IQUA 4X66F 1FWLA 3KLHA 4DTNA 3VVUA 4CLFA 3BGOP 1XO0A 2C2RA 3D0IE 3THTA 5E41A 3KDOA 4K4UA 2O8BB 4ECXA 5AE2A 4K4ZA 5AKIA 1AUDA 2UXBJ 3GJSB 3DLHA 3SBMA 1X4CA 2HHXA 4NLVA 1ATSA 1YF5L 3LP2A 1VQMN 3HPGA 5L9XA 3MN9A 2FHKA 3A2FA 4L74A 2NS1B 1RB0A 4QZGA 4FJ7A 4OYOA 1CJKB 3OHAA 2QV6A 5G5GA 1D4XA 2KVIA 4Y0FA 3C1YA 3OFFA 2LYBA 3MEKA 1K9MT 4ED3A 1MLAA 4K41A 1HI1A 1HNIA 1GTEA 3PW7A 1SJ3P 3N97B 4IO8A 3GFZA 5DM7L 1TP7A 3EEQA 4JK7A 8ICZA 1ZQRA 4DKWA 3TX0A 4NA1A 5DGBA 4DPXA 4BC3A 2YBVA 3VQSA 3SQ1A 1V6HA 4J9NA 4YFUA 2D74B 4USUA 4P4MA 1NGIA 3AD8C 1RTIB 1CJKA 1TUYA 2B6AA 4ZPAA 2W6LA 4P74A 4B3SF 2PE8A 1RHJB 4DN9A 1S6OA 3CFRA 5AI9A 3S7RA 3K1RB 5H9FJ 5BPNA 4HT7A 3V4IA 3OYAA 4ED5A 2KICA 1B0XA 5AKJA 5HMWA 2HF3A 3GDXA 1D09B 1X4AA 5J0XA 3MAAA 4M42A 2E2OA 2HGLA 1HQEA 4MF2A 3H40A 9ICIA 1NNLA 1IKYB 4NLTA 3N9UC 4BR0A 5KG0A 4YP3A 1G4CA 1M5HA 1OMSA 2GV1A 2ZBCA 2CNOB 3Q86A 2KHVA 1R8CA 2BCUA 4OFZA 5AK5A 3OS2A 1ZQXA 3CCSS 2GTDA 3CEDA 3U1NA 1RT1A 4ENOA 4EX6A 3JTOA 2QLWA 1DK2A 2DXEA 2VQEJ 5U47A 2J9CA 2KIWA 2EAMA 4IG3A 1MWZA 3P39A 1IKXB 5J2NB 3T9NA 3BF1A 2L9NA 3O5TB 3H8YA 6AT1B 4A48A 3W62A 5F8IA 1Z4OA 3TA1A 5AQUA 9ICJA 2VIHA 5ALSA 3MBYA 1IXKA 4UOHA 4X62J 1U2VB 2YNGB 2RD5C 2HBQB 3TR5A 2F8HA 2ZE2B 2ZUDA 3RSEB 4CK2A 3IBWA 4YXJA 4AHRA 2EK6A 3SUQA 2P6RA 3IS9A 4RQNA 3CCUN 1RDWX 2KJ5A 3KLHB 3C0BA 4CESA 4IG0A 4OJ6A 1JJ4A 3KJNB 4Z6CA 1NJWA 2QI2A 3GP9A 4RJVA 3HSTB 4RL1A 4FJXA 3J80U 2OPQA 1FKPB 4CJUA 2P9KB 2OI2A 3VA0A 1KRPA 1IXRA 2GIRA 2IRXA 3WU2U 2P9SA 4KLGA 4FZVA 3B0YA 1X6JA 2WCXA 3RB0A 2QM1A 4C8OA 1G1XA 4FF3A 5GAGI 1WBDA 4CGGA 1N5XA 3QMLA 3RW6A 1W0HA 1U49A 3DRRB 8ICTA 2WFBA 3MR6A 2J0XA 5ALGA 5KFHA 1TV9A 2GAGC 1WI8A 2MMYA 3H3NO 2I6WA 5ALPA 4JV5J 5C24B 3Q2TC 1XR6A 2YCHA 4ZLLA 1QAYA 5DM6L 1WF2A 3JPTA 1A0PA 3V9WA 4HAIA 4IR9A 3CJ8A 3GIKA 3GSDA 2RQMA 3WKEA 4RCHA 2HWHA 4MF8A 1U09A 1Q82O 1KW4A 4CLUA 4DOBA 2G8KA 2YMQA 2O8FA 4FE3A 4OX8A 2W03A 5K14B 4O3NA 1SB3C 3Q7CA 2D4WA 2AXTU 3TARA 1IG6A 3P5TL 2VWKA 5IIIA 4JKHA 3CUNA 4RG8A 4OPAA 3P6YC 5D0GA 3TSUA 1BMQB 1U0HA 3IRXA 4Y34A 2QK9A 4F3OA 5DDRC 1VQOS 3H42A 4CGJA 3I55S 5GMDA 2CJAA 2O8CA 4O4RA 3E01A 2NREA 4ES2A 3C6UA 1NNDA 4MO5A 2GGPA 2I9GA 2L08A 2LYAA 3GDQA 4U8VA 4BQZA 3CCVS 4CVNE 5BXIA 2ZUBA 5GAGP 2R8JA 2WTFA 4A59A 2VC1A 2DGZA 2B7CB 2UUWA 3FUYA 3V9UA 3D7EO 2CWXA 2YB1A 3QPIA 4G3IA 1YJVA 1YTYA 2C2KB 2DY9A 3IWNC 3JQKA 5F8NA 3GILA 4I2IA 2MDAA 4BRHA 4KB7A 4KHMA 2MXYA 4F4ZA 4AHVA 2BR0A 3K1ZA 4JI2F 8ICUA 4FLXA 4JI7F 3VV2B 1URNA 3ULEB 3G10A 2W7OA 2DKZA 1PZNA 3Q83A 3SFUA 2Q36A 5KFVA 1VRQC 4Y3CA 3JS6A 5IT9Y 5HAOA 1MWMA 1OH6A 4XUSA 4B1UB 3V9SA 2CADA 4YOTA 3K5MA 4DOZA 3RRHA 2JFKA 3CCES 5F3ZA 2NO4A 2OEHA 3F2BA 2I5JA 1RBLA 3SSRA 4URGA 2BKPA 4IJNA 3PSPA 3P4UB 2ZWPA 1TU0B 4CHNA 1LKYB 4S0MA 3TWHA 5A6PA 1ZA1B 1HA1A 2Z2LA 4OQJA 4F3TA 3NAEA 4DJBA 2PMZD 1VYAA 5AXKA 2HK3A 4YDDB 2IMWP 2ZTEA 2P6UA 4RW4B 3OFEA 2VCPA 5JLFA 3SEIA 4J7CA 4DBQA 1R31A 4GV6A 2CQPA 2LXFA 1S57A 2HFNA 2QSFA 2HMIA 3VAHA 4O3MA 5GIOA 2AH5A 2Z2MA 2B4JA 4OJ3A 1D9DA 4B9VA 1SH3A 1ZQHA 3BKFA 1Z2LA 1CG2A 3GYNA 2WOMB 2COLA 5AI0A 4DR1J 3T7ZA 4BACA 4IJAA 5KT6A 4X4VA 3PLAA 1RKJA 3UIQA 4FZLA 5CCLA 1JLBA 4A8WA 1RTIA 2E5LF 4OX9F 3L3UA 3AJ2A 3BEXA 4CIOA 4WIQA 2QB0B 3PIPQ 2UU9K 3DGPA 4IO1A 3MXIA 7ICEA 3CCUS 1V3RA 2IVPA 3BREA 4C9DA 4BJQA 1TL1A 1CLQA 2D0BA 1GEHA 1XJWB 4NZ0A 2FJAB 2HOEA 2DO4A 3M1YA 1Q8BA 2VWBA 4ISFA 2DHAA 2CJBA 2C2MB 2M5YA 3O0FA 1VQ5S 1YJNS 5D15A 3U3YA 4KHRA 5HRPA 3JXOA 4M5DB 1GQEA 2VG7B 2ZH7A 1VQ8N 3RH4A 2FVRA 2J0QD 5HNKA 3JPPA 4KO0A 4RW7A 4HHJA 3C6HA 2APOA 1S12A 4RUAA 1J2MA 4E7LA 2FHJD 1KTVA 1YJUA 4DXLA 1N32F 4O5BA 4A57A 2XHWA 1V85A 1S6PB 4JRPA 1ZQUA 3KK1A 1K9MO 4WE1B 3W8PA 3DNCA 5AZIA 5AXLA 4OPJA 2Q79A 4C23A 4KH6A 5AQKA 4QZFA 3BKTA 2EAPA 1BLUA 2B6GA 1WSIA 2OTJS 2FTRA 5E33A 2AJ0A 1DY3A 2UUAK 1HQUB 8ICBA 1BIUA 1D8YA 4FJ5A 2VBYA 2CXYA 4DUZJ 2ASDA 3GL1A 5HANA 2FJXA 4UASA 2YI1A 4ZITA 3SEOA 4MFAA 5M1PA 1XI1A 2ISPA 3HDSA 2ZITA 2HWTA 3UXNA 1DARA 3CM5A 3HLUA 1S0MA 2ASYA 4PKHA 3HX0A 5AZIB 4FZXC 4QYRA 3U7JA 3RJHA 2A1RA 2NUUG 1YJRA 1S5LU 3A5NC 4KV8B 2CG4A 2HRUA 5G0RA 1KWMA 2MRLA 3DGVA 4EIAA 2LSNA 3DCAA 3HOSA 4OPHA 5D4BA 1B92A 5KFZA 3PKYA 1N32K 3BDPA 1L3VA 3O1BA 5GTHU 2DNQA 3JPNA 4W4MA 2A40A 2GZOA 3K9JA 2JNJA 3M3ZA 2HBYB 3DXKA 3V7LA 1SXEA 3QATA 2UU9F 4G1QB 2HFZA 2AQ0A 3KK1B 1U0SA 1S7IA 3CP8A 2FQQB 4I2QB 2FVSA 4NYZA 2CVEA 4BGBA 4CJ5A 2JEIA 1N0UA 3DU5A 2YHYA 4K43A 3QFHA 1TL1B 5ETOA 4I2PB 3VAFA 1R6YA 4BROA 2HBZB 3CJ3A 1N6QB 4OZ0A 3OV7A 3DOMA 4PR6A 3FEXB 3B6OA 1ICEB 3MXJA 3D1QA 3C94A 8ICHA 4OVLA 4JB8B 2W2PP 3TTFA 4IEIA 4NE9C 1IQZA 2WF5A 4PWWA 5LJVA 1Q95G 3I8DA 1MMDA 4DR2F 1TV6A 1KNZA 2F9JA 1H38A 8ICYA 1NI3A 3M6GA 2G8FA 3TJ8A 4UARA 4MH8A 3V5RA 4WQ5C 4CHQA 4KHPK 1H3DA 4QWCA 1FD8A 2EFQA 1CPZA 3CC2N 3VQQA 2FHMA 2RKIB 5KAFU 1HFEL 3KWIA 4GC6A 1DQAA 4DU1A 4HDHA 3ZTSA 2HFOA 5HP4A 4UUWA 2W4CA 3RW7A 1RAAB 2KN4A 4G9ZA 5GADI 5D0HA 2J7WA 2FJBB 3C95A 4FOEA 4CZGA 3NNAA 1WNEA 1B99A 1GLFO 1FXDA 2BANB 3M1FA 2OPSB 4ELTA 3UR3C 2CGJA 3PTWA 3NGYA 2KG1A 2ZM6J 4N76A 1FFUA 5H9FK 3CETA 5A8KB 3H4BA 3WIUA 3O6QA 3R7SB 4P10A 5GIPA 3QICA 5EGYA 4I1TA 3Q8LA 2EAOA 3MUVP 4ZOHC 1JUDA 2V34A 1YVFA 4OI3A 3D45A 3MM8A 4DN0A 1F0MA 3F5AA 3BQ7A 2BPCA 4IQTA 5A8RA 3ISZA 4LFBJ 4AM7A 2Y9HA 3W9JA 5LJWA 3TFRA 3HFVA 3MCMA 3KLIB 4CHPA 2E8MA 2G1HA 4WP9A 1SL2A 3T1HK 2WZ1A 2BMBA 5LSOA 2V2KA 4IQVA 4BR5A 1RBSA 2YNIA 2GS8A 5DJBA 1MG7A 3CF5Q 3ZDAA 3JQJA 4B3TK 3O9QA 2VA8A 4TQSA 3OTCA 3KD5E 3MEGB 4NXMJ 4M3ZA 1KQSM 3VPZA 2HSZA 3OYKA 2BKEA 4J9MA 2NPFA 1EB0A 1Q9XA 1HI0P 3W64A 2LEBA 4LF4K 5DBBA 3U9ZA 1VQYA 1R0AB 5LJ5Y 2Y0SF 4RW6A 3D2EB 2BPGA 2HZVA 2VPYB 2ALZA 4PAAA 3QWPA 1NKBA 1HUZA 3KJVA 1X4EA 3PIPL 2VJVA 1WEXA 1U6ZA 4A8FA 1D5AA 5ALIA 2ZH6A 2AQ4A 2FC8A 1FRLA 4OKEA 2P35A 1Q86O 3HT3A 5CXTA 3WC2A 4MTPA 2HNZB 2ATLA 4JI0K 4OHVA 2YXLA 3U3GA 3AT1B 3DDNA 4J2AA 1SZ2A 2R9LA 5L1IA 3FZBA 4WU3A 4JKEA 1RBOB 1SJRA 4YN4A 4CT8A 5DDMA 4DR4F 3ONQA 1OH8A 1IV8A 5CHIA 5ETRA 2F8MA 2KRRA 2N4DA 4UY8O 3T1HF 3TUZC 1VC6A 3OFGA 4M04A 1IKVB 2KP7A 3GPAA 2XI3A 4IS7A 1BPBA 2FLPA 2AYBA 4OL8A 3O4WA 1OYDA 3VEOA 3CM6A 1H0HB 4DCCA 1SJQA 4DTXA 4IOCL 3UD5A 3TQ1A 5AQOA 4JV5K 4OYIA 3TO8A 4CLSA 2ZNZA 1NGGA 2D0OA 2QYGA 1U45A 2DH8A 3CC7S 1A5VA 4DTMA 5FPEA 5J0RA 2RDJA 2LU2A 2KRBA 2SXLA 3OUYB 2IOHA 3D67A 4I2QA 2RQ5A 3O4NA 4UZCA 2ZZMA 3D2WA 3CJ7A 5AQRA 2J7UA 5DLGA 2KKZA 5E3CA 5GAHP 3MM7A 3T5KA 1U02A 1X3NA 2O4GA 1U2VA 3DXMA 2UXCK 1JLAB 3PACA 3M8PB 5DMRA 5AJ3J 1UT5A 3UB5A 1B9DA 4LF5F 3R97A 2KE7A 4DU3A 2P6TA 2P9SB 2DGQA 3THWB 1WKJA 3POTA 3PRBA 2R18A 1K73T 5HMMA 1UP1A 5KFOA 5D6GA 1TK8A 1B9FA 3D6JA 1EP4B 5ETSA 2GMJA 2E8AA 4LC9B 4QZ9A 2RF2A 4DL7A 1TVAA 4PGXA 1PVQA 1Q5YA 3G71S 2F4FA 3CJ1A 4EHTA 5KFFA 2EFOA 1K47A 1ZAXA 1UAWA 3ADAC 4FJLA 2GELA 1ZQFA 2DRBA 2XI2A 5J29A 3BS9A 3BZKA 3QYPA 2MJNA 1ITGA 3BGFA 2FBTA 1MMNA 3A8JA 2UXDF 3C16A 4X4QA 4DV4K 3QNNA 2J7KA 1NPPA 4A8SA 3HJVA 1OY8A 2P9NA 4EO8A 2QL7B 4DUTA 3T6JA 2LM4A 1NZBA 4KLHA 3RJGA 2OANA 5GAGU 5CEHA 2P9IB 3GB0A 2ASMA 1AROP 3HL8A 2GHVC 2XSJA 2JJ4D 4NLRA 4CF4A 1HQ2A 3CTRA 3UI3A 1IV0A 4DX5A 1HNIB 4DSJA 3H08A 4XO0A 2K4PA 1RT7B 5J0YA 2W9AA 1WUUA 5JTIA 4AL7A 3ZFVA 4U67L 4OX9J 2KTQA 1LW2A 1JN3A 3MCSA 3AVFA 3MEEA 2RMLA 1TMMA 2B9XA 2HHTA 2B9YA 4FXWA 4JI4K 4TY9A 1S1WB 5LMNF 3BM7A 2RB7A 1P8GA 4R65A 5BPCA 5EHHA 1XR5A 4QOZB 1XTZA 4PG6A 1VHIA 4QWAA 2HVHA 4WQ4A 4HH1A 4CZCA 4AXJA 1KEJA 5J2KA 2DNNA 4J2DA 3QZ8A 5AR0A 3BB5A 5EE9A 1YWXA 3VEYA 4KGMA 3VQ7A 1ZQDA 4ALZA 4B9MA