4DSLA

Crystal structure of fragment dna polymerase i from bacillus stearothermophilus with duplex dna and calcium
Total Genus 191
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
191
sequence length
579
structure length
579
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical and structural insights into the fidelity of bacillus stearothermophilus DNA polymerase
rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA polymerase
total genus 191
structure length 579
sequence length 579
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4dslA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4dslA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dslA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4dslA01
1HQEA 2HVHA 5KG7A 4Z4HA 2XCPA 3PX0A 2P1JA 3U3YA 4DLGA 1Q8IA 4XQ8A 4PPXA 2WONA 4M04A 4FYDA 3AU2A 4CIEA 3IS9A 3MABA 4F5PA 1JLCA 4K4HA 2ATLA 2X74A 1D9DA 1S1WA 2HMIA 3BQ2A 4BE0A 5HHHA 4W5TA 3AO1A 1L3VA 3SPZA 5IINA 3RAXA 3VQ5A 1RT5A 3O3FA 4ECYA 1TKZA 7ICJA 5HMMA 7ICEA 1ZBFA 3PV8A 3JPNA 2BANA 3NF7A 3JPSA 4OKKA 4RW6A 5JS2A 3PW5A 4O0JA 5J2PA 5J0WA 4DQPA 1TAUA 2BCUA 5IIMA 3O4NA 3ZSOA 3RJHA 3V9XA 4KKOA 8ICRA 3QEXA 5KFPA 1JL2A 2UVUA 4DTPA 3ZT3A 2R8GA 5J2NA 5KFVA 1ZQRA 4EZ6A 4FW1A 4W5OA 4QAGA 3SUNA 2BQ3A 2P5OA 5CHGA 3AVGA 4W5NA 3HPOA 3Q8RB 2QK9A 1L3UA 5FDLA 4K4IA 3C2KA 3SCXA 1ZETA 1LV5A 4ECVA 4J2EA 1WAFA 3MR5A 3C23A 4MQ3A 5J0QA 3QO9A 3MEDA 4DTUA 5CJ7A 1RCHA 3M9MB 3MDCA 1ZQFA 1PZNA 4FJ7A 1XI1A 4NM2A 4RQ4A 5J0OA 5J2MA 3K5MA 2NRXA 2P51A 2IBKA 4YVZA 1EX4A 4ID5A 3T5JA 4N76A 4PH5A 5J2IA 4O5CA 1LWFA 2ZE2A 1SL0A 5DGAA 1N5YA 1L3TA 4NM1A 3OS0A 5EU7A 1NKCA 1TKDA 3RJKA 3K5OA 4PHAA 4FK2A 2YNFA 4H4MA 2YV0X 3RRGA 5HBMA 3SZ2A 1NK9A 1Q9YA 1D9FA 4KPYA 5T7BA 4M3ZA 3QZ8A 1RNHA 4DG1A 1BCMA 9ICTA 1S6QA 2J6UA 4FCYA 2IMWP 3P5JA 2FBVA 8ICFA 3OYEA 2BQRA 4IBNA 4R8UB 1B43A 2KQ2A 4CF9A 9ICFA 1ZQLA 7ICFA 1I39A 1S1VA 1FK9A 1Y97A 2VG6A 3LP3A 2BCSA 1BPBA 3HVRA 3AVAA 1RT4A 4I2IA 1L5UA 3G6YA 4CGIA 1WCLA 1N6QA 1HPZA 2FPLA 3NGDA 3QEAZ 1SKWA 1RDCA 4J2AA 2ZUDA 5IIJA 5KG5A 4KHUA 2PI5A 3ZDCA 2V9WA 3ZD8A 4HUGA 4GXJA 3RH5A 1QHTA 1RDBA 3TAEA 4KLEA 3KHRA 3QIPA 5KFZA 4KB1A 4E7JA 3NBPA 3M9NB 3ZT2A 2D0CA 4PGQA 2W9BA 5DB8A 3LP1A 4E7LA 5KG3A 3OY9A 4JUZA 2XY7A 4OGEA 4YQWA 2Y1IA 2V4RA 4RQ8A 1TV9A 4ELVA 2F1JA 3LK9A 1KTQA 3HXMA 4Q8FA 4YN4A 5CZ2A 3UXOA 2JEIA 4ECQA 2B4JA 2C2DA 4DO9A 1A5VA 2NRVA 2PFQA 3TR8A 1WAJA 3DRSA 3MEGA 3UIQA 4OKJA 5KT7A 1S5JA 1X9WA 5D49A 5J2DA 4O55A 5KG6A 4C8KA 1ZQEA 3MBYA 2DFFA 4BDZA 3HWTA 4F5QA 3QNOA 2ZTDA 3C1YA 8ICQA 4DTRA 3DLEA 3NCIA 3RAQA 2DPJA 3E2EA 1RBRA 2B21A 3FFIA 2Q3SA 4F4XA 3WNEA 1U04A 4YD2A 4R66A 4FLXA 1JLFA 4DFMA 4DTJA 2ASJA 1WSHA 2DFLA 2FMSA 4F2RA 8ICXA 2JEFA 2P5GA 7ICSA 5TZVA 3ZSXA 4C8NA 4NXZA 1NK8A 3LWMA 2HW3A 1JXLA 4FBTA 3GILA 1T3NA 4KLIA 5HP1A 4Q45A 2XGPA 4BE1A 5BOLA 1JIHA 3KTQA 4EP4A 1FXXA 4IR1A 4UB4A 3PX4A 4IQUA 1XS9D 2XGQA 3B0YA 4J9LA 3D45A 3QLHA 4F3TA 3UPQA 3PW2A 4KLLA 3T1AA 4O3NA 3QESA 1ZQYA 3MGIA 5J0RA 3VQDA 3C95A 4ELUA 4O3RA 1S0NA 3RB6A 1COOA 3H7IA 2BQUA 3KD5E 2Y1JA 5KT6A 1QE1A 4I2HA 2OZMA 1S6PA 2ZUBA 4QW8A 1LW0A 4Q0BA 4DQIA 1RYRA 4FZZA 3RR7A 1KLMA 3Q8KA 4NY8A 3VQCA 1TL3A 3V6HA 3KK2A 3RJIA 2M9NA 2DPIA 3S3MA 8ICJA 4FS1A 5J2EA 3UXNA 4M9LA 5D46A 4PGYA 4PHPA 1Z26A 1ZBIA 1NJWA 4M9JA 3V4IA 4G1QA 4QZ8A 3KHGA 4N5SA 4PHEA 4R64A 3K5NA 3ZCMA 1JL1A 2E6LA 2R8KA 2R8IA 2VA3A 4AHRA 2BHNA 1LAVA 4QCLA 5CP2A 2IDOA 4IRCA 1ZQAA 1BIUA 4RT3A 4O3PA 4O3SA 3KD1E 2E4LA 4JK1A 4YXMA 4KTQA 3NF6A 3A2FA 4C8MA 1HJRA 4KLTA 4HUEA 3AU6A 2AGPA 4N41A 3DI6A 2KW4A 7ICIA 4CEBA 3H8JA 1K6YA 4CEQA 1ZJNA 4UB1A 3ZD9A 3OGUA 2BE2A 1RT2A 3PMLA 9ICAA 3PW0A 3KLGA 4QZEA 1ZQNA 3JYTA 1J54A 3O4QA 2VWKA 5JUMA 2A1JB 4KLGA 2QKKA 4PQUA 2F1HA 4DL3A 3QERA 3AVHA 5CYMA 5DB7A 4RT2A 7ICOA 3HVTA 3SYZA 1BI4B 2E6MA 1W9HA 3LDSA 8ICPA 1RT7A 2HHUA 1UWBA 3NGYA 3AO2A 5KG1A 1WLJA 5KRSA 4QWAA 3OYHA 8ICIA 2GBZA 4LD0A 1HUZA 4QWCA 3PR4A 2PYJA 3DLKA 3Q8PB 4AHVA 4RUAA 4F4KA 3H08A 5FROA 4ICLA 3Q8QB 3SNNA 4RNMA 4F4YA 3FDSA 4J9SA 1XU4A 5J0PA 1ZQZA 4ECTA 1O1WA 3NH2A 3OSNA 4DSIA 3RR8A 4J9PA 5KG2A 4ED7A 4GC6A 3NH0A 4I2DA 5KG4A 4OPKA 5EOZA 2A1JA 3EPGA 2X78A 3SI6A 2I9GA 2LSNA 3BQ1A 1S10A 4DL4A 1WSGA 2XY6A 1YT3A 3I0SA 3RBDA 3CYMA 5I42A 4Z4GA 4CEEA 5J2BA 3TFSA 1HNIA 3LWLA 3HSTB 3SUOA 3AO4A 4DOBA 2HNYA 4AHSA 2ITGA 2ZD1A 3ZDBA 4DQQA 3HP6A 4CFDA 5KFAA 1NOYA 4E0DA 3K2PA 1ASVA 2W9CB 4LSLA 3LPTA 3C94A 4J9QA 3DMJA 1Z00B 2BPFA 1B9DA 3MR6A 5J1EA 4DQSA 4J9RA 4I9QA 3JPQA 1BIZA 5KT2A 4OVLA 5DQIA 5KFJA 2RDIA 3SQ2A 4MFBA 4RZRA 1S76D 5J2QA 3UXPA 1NK0A 4MFCA 4KMUA 2WTFA 3KKSA 4WE1A 4CEDA 2C22A 1SV5A 3DOLA 1JXBA 3OYDA 2HHVA 2R8HA 1VSHA 4CGFA 4UB3A 1UA0A 1R0AA 5JS1A 3L2QA 2XY8A 1JN3A 1JMSA 3OYNA 3OYIA 4QWBA 1KFTA 4F5OA 5L1LA 3TAQA 3ZDAA 2G8VA 3KIOA 4Z4IA 4F4WA 1RZTA 4DU3A 3PVXA 3ITHA 2RPIA 3F73A 2BCRA 3V6KA 2Q0ZX 4P4MA 3ZSVA 4DS4A 4EYHB 3V1OA 5BOMA 4F8RA 3NTUA 2V4QA 4FZYA 4PGXA 4CHQA 3AUOA 4M3XA 5CWRA 2MAXA 3ZT0A 5C25A 4BXOA 5CZ1A 4F50A 4QZ9A 1C0MA 1VSFA 2FMPA 3B6OA 3QEBZ 5KT4A 3NH1A 3MGHA 4DSJA 1HQUA 3TANA 8ICGA 4KLHA 5J2FA 4FJNA 3MEEA 5DMRA 3HL8A 5KFKA 3AVBA 1NJYA 3GIMA 4M9GA 1KVAA 3MR2A 1RBVA 9ICVA 5L1KA 8ICYA 3KLHA 5SZTA 4ED6A 3OSPA 4J2BA 1EXQA 3QINA 3GV5B 2YKNA 5HRRA 3BDPA 4CJUA 2A1RA 4FLWA 9ICGA 1U4BA 4KO0A 2OZSA 4F5RA 3GV7B 2HHQA 1B92A 4B9SA 2ZUCA 4BDPA 4OLAA 2VA2A 3KK3A 5C24A 2BPGA 1BVSA 2ZTCA 3OYKA 1LWCA 1HUOA 1RYSA 2OA8A 4CJRA 4FM0A 1J53A 4CK3A 5KT5A 4KV8A 3QETA 2IC3A 2FLPA 3ISDA 2JEGA 4EEYA 4Y1DA 5EWEA 4CE9A 3H40A 1BQMA 4X5VA 2XCAA 1CLQA 4QZHA 3KLIA 4KHYA 4F93B 4XRHA 1X1PA 3JPOA 1G15A 2A1SA 3T5LA 3V81A 2W8KA 4DOCA 4GW6A 4I2QA 4CIFA 8ICHA 4M47A 3DRPA 4HCBA 3KHLA 3C1ZA 5L1IA 3RJGA 4GVMA 3JSMA 4UAWA 9ICPA 4UAYA 9ICJA 1YTUA 2Z1HA 1S0MA 9ICMA 4CJ3A 4IRKA 1VRUA 4RNNA 4AILC 4IQVA 1VSDA 4FW2A 2FBYA 3L3VA 4FJXA 3AVLA 2DTUA 4FJLA 4CEAA 3RWUA 1ZQDA 2JGUA 4JRPA 1T7PA 3KJVA 1IG9A 2MUTB 3H4DA 3TAGA 1QQCA 4RQ7A 3HJFA 3T19A 4FBUA 1NJXA 3IAYA 4ZH4A 4JV0A 1JLGA 1J5OA 1GOCA 2BDPA 3L2UA 2FLLA 1MU2A 4ECSA 4AHCA 4M2YA 4NCAA 5CR0A 1HYSA 4KHNA 3VQ9A 1ZQUA 4G3IA 3NHGA 1ZQJA 3OYLA 5KFEA 4CJEA 4CFBA 3T3FA 5HP4A 1BCOA 3RMBA 1HJPA 3P83D 4NYFA 3OHBA 3I8DA 1BPEA 1CEZA 4O3OA 2D0BA 2ASDA 2PFOA 1X2IA 4QZBA 3PY8A 1C0TA 1UOCA 4JV2A 5KGXA 4HUFA 3RJEA 3L2RA 3PMNA 5HNKA 1BPDA 5L9XA 4RW9A 1ZBLA 2IAJA 2KFZA 4B9UA 9ICOA 1ZQWA 4I27A 7ICMA 4I2FA 1Q9XA 2OPPA 1C1BA 3LAKA 4I9LA 2P66A 1BQNA 4M9HA 3TAMA 1KEJA 3HO1A 2Z1IA 5J0SA 2W9CA 4OGCA 2FBXA 3KLFA 1Z25A 1U48A 3QEPA 2FPKA 2DY4A 3MDAA 4OPJA 4Q5VA 3KKRA 2KTQA 2HB5A 4DTXA 5FRNA 3MECA 4YFKA 4KTWA 1C6VA 3HM9A 2KZZA 4O0IA 4O5EA 4KLJA 4B3OA 3ISNC 4CF2A 3IRXA 1S1XA 1KVCA 4Z6DA 5EWFA 4Q43A 3OHAA 2UVVA 3ALYA 3WNHA 1ZQGA 3AA3A 1BI4A 5HHIA 3ZSZA 4RG8A 1B9FA 2AGOA 3SV4A 2KZMA 3NF8A 4HVJA 4DF4A 4JS5A 1U9LA 4RQ2A 3GIJA 4FK4A 5DG8A 4NLGA 5L1JA 5HRSA 4ECXA 3TWHA 1ZQQA 2B5JA 2IOCA 4J2DA 9ICNA 3BGRA 3L2WA 1V9PA 3ZSRA 3RMCA 3C6TA 4YNQA 3H8WA 3OYMA 4LH5A 5DBBA 1S97A 4KREA 4CEFA 1A76A 4QZDA 4CERA 4FLTA 1SZPA 4CHNA 2HHWA 4AH9A 3PO4A 4KITB 3HPHA 1CUKA 8ICLA 1NOZA 3V9WA 3TFRA 2AJQA 1TGOA 1RT3A 1ZBUA 8ICOA 1IM4A 2HHSA 4EYIB 4N47A 1QS4A 4XIUA 1NK6A 5KTQA 4YCXA 4RUCA 5HROA 3V9ZA 1A5XA 4NYNA 4Z6EA 5KFQA 4RQ1A 2IHMA 2X6SA 4E19A 4JS4A 1TAQA 1WCNA 3Q8MA 1ZYQA 4M45A 2JZBB 4BXOB 4KFBA 4I28A 1N48A 3K4GA 1DOQA 2BCVA 4ECZA 4GXKA 3RMDA 4CCHA 3PUFA 3GDXA 3AVJA 5DBAA 4CJTA 3HPGA 3ZSQA 4DL6A 3KLEA 3OYAA 1JLBA 3S9HA 3C6UA 3C2LA 1IH7A 4LSNA 1NK7A 4J9NA 5DG9A 3NF9A 4ED2A 1XHZA 4TQRA 2J6TA 1QSYA 4IRDA 5C5JA 3CM6A 2MUTA 1BISA 4L8RB 2PY5A 2YHBA 5KFTA 2F96A 4JLHA 3DM2A 1XC9A 4KAZA 8ICWA 5IILA 4CECA 3S3NA 1EETA 1KRPA 4QWEA 1KDHA 5IIIA 4K4GA 1YVUA 5KFGA 3RB4A 4NLZA 5HLFA 4KHQA 3VQ8A 3LZJA 4FJKA 3E01A 4FLYA 1IKWA 1F21A 4Z6FA 3WNFA 4GLXA 2BPCA 1XSLA 1H38A 4DF8A 5KFOA 5KFHA 1RTHA 3RRHA 3RB0A 3M8RA 1KLNA 1FKPA 1W0HA 3VQ4A 1IXRA 2HHTA 3T5HA 1RT6A 4M0AA 3EZ5A 4B08A 1T03A 4CJ5A 4KI6A 4FJMA 3TAPA 5BPCA 3EYZA 4I2PA 5FRMA 3IM1A 4OJRA 7ICHA 3TAFA 1HNVA 3CQ8A 1XSNA 4FJHA 4QZIA 4E7KA 9ICWA 3GFKB 4DFKA 1DGSA 2HNZA 1KCFA 3C5GA 2EHGA 4M6WB 1SUQA 3T5KA 4RQ3A 5K14A 5J2GA 4P4PA 5J29A 1T05A 3ASMA 4UAZA 4QZCA 1A5WA 3OYJA 3I0RA 4DQRA 2XRIA 2H5XA 4IFYA 1LAWA 1WSFA 1QSSA 9ICEA 1ZQTA 1N56A 3RBEA 5DDYA 1C7YA 5KFFA 4F3OA 4YMNA 5DK5A 2AQ0A 4FJ9A 5KG0A 3M8SA 3O3HA 3JPPA 4ID1A 2KZ3A 4KLQA 1UAXA 3L8BA 4AHUA 9ICSA 3HW8A 3L2VA 1U45A 4KTZA 4EBDA 1T8EA 4JWNA 3MXIA 4BACA 5J2KA 2LYHA 1JXEA 1CZBA 2FC0A 4CF8A 4YR0A 4IDKA 3AVIA 1ZQIA 3K57A 4AHTA 2VWJA 4MEXA 3FYHA 1EP4A 3QNNA 2G8UA 2ATQA 3ETLA 2W9BB 3VQ6A 1NOMA 2RDJA 4MF8A 4K8XA 2BCQA 1VSKA 1RXVA 3Q8SB 1CZ9A 4N56A 1X9MA 3SJJA 1WSIA 4KB0A 3QEWA 2HNDA 1S77D 4CJFA 1SKRA 5KFUA 2P6UA 2O4GA 3VQPA 3HYFA 2KN7A 1ASUA 3GQCA 3LAMA 3VA0A 1RXWA 2G8HA 4HCCA 1TK0A 2YKMA 3NE6A 4M3WA 4OLBA 4YR3A 1JLAA 3VQEA 3OYCA 5HRPA 1RDAA 4CHZA 3B0XA 1SKSA 9ICIA 4KI4A 4IR9A 4C8OA 4NLKA 1LWEA 3AVKA 3QEVA 1J9AA 2IS3A 3GV8B 3RJJA 7ICUA 3K58A 4DTNA 5J2JA 1VK0A 2AQ4A 1Z00A 4UQGA 2C2RA 2ETJA 1IKVA 1REVA 4CJ4A 1JX4A 4M3UA 3EW9A 1ZQCA 2JLEA 3BQ0A 1S1UA 4W5QA 1DTTA 5DQHA 4M42A 1TVAA 4CESA 4CHOA 4FLVA 4QOZB 5KRTA 4E1MA 1ASWA 3N4MB 4JWMA 4YMOA 5DLFA 3MR3A 1ZQOA 2VANA 4B9NA 8ICAA 4YD1A 2GV9A 3ZDDA 1RTJA 4FK0A 2YNHA 7ICTA 4ZTFA 3Q8LA 4QWDA 4O9MA 4FLUA 3LALA 4CIGA 1GOAA 2PZSA 3THVA 1KVBA 1QTMA 2D0AA 2F1IA 3PR5B 3HX0A 4RQ0A 7ICLA 3V6DA 4R65A 4ECUA 1VSEA 3OS2A 3OYGA 4M41A 4CGDA 4PWDA 1QLNA 5DB6A 3P1GA 2PYLA 3M9OB 3AVCA 3C21A 1CXUA 9ICKA 2IGIA 1K1QA 1Y88A 3AVNA 3MAQA 4ED0A 4O44A 2XC9A 4GXIA 2EX3A 3DLGA 4CJPA 4YFUA 2YNIA 3K5LA 4E89A 1Z3EB 4PHDA 5KFCA 1BHLA 2ZJ5A 1XO1A 1ZQVA 3NGIA 1VSJA 4FO6A 1ZJMA 4GC7A 1ZQXA 4H8KA 7ICQA 3M8PA 3K75D 1VSIA 4MEYA 2PFNA 3V9UA 5D4BA 3LP2A 2FMQA 3CG7A 1UT5A 5KFNA 2ISPA 3PW7A 3DLHA 4KLDA 2GWSA 3JPTA 3NGZA 3AO5A 4YP3A 4DS5A 5KI6A 1ZQSA 3DLBA 1MSWD 4Q8EA 2B6AA 2P6RA 8ICNA 3TABA 4FM2A 4F91B 1JLEA 4PA1A 4QZFA 3VQAA 4UB5A 1C1AA 3DOKA 4F4ZA 3RH6A 2HHXA 4EP5A 2NRTA 4FJJA 4DFPA 3G0ZA 3MFHA 4JRQA 4I2BA 1ZQMA 1GOBA 3DLRA 3ORYA 5J2CA 4B8AB 4RW8A 2FPMA 3WNGA 4E3SA 3ISBA 5DG7A 1D8YA 4B8CA 3LANA 3N97B 2PFPA 2W9AA 1UA1A 2G8FA 2UVWA 2O4IA 1S9GA 2C28A 5CA7A 1MQ2A 1BPZA 1AROP 5E41A 4QZGA 3LPUA 4R63A 4DSEA 1JLQA 4ZTJA 4QZAA 4DSFA 4NCBA 4FJ8A 3H4BA 5F9NA 3DYAA 3DRRA 2VG7A 5DBCA 4B9TA 4O5KA 4R8UA 3OYBA 1KFDA 1ITGA 2IHNA 5J2AA 1TK8A 4XA5A 1BL3A 2G8KA 3HK2A 2R7YA 1JKHA 3PW4A 5CYQA 4J9MA 1RTIA 1U47A 2VG5A 4P2HA 5F9LA 4Z4EA 4HYKA 4CJVA 4CK1A 4IQTA 1ZBHA 2G8WA 3SV3A 3LZIA 5KFLA 2QXFA 4CHPA 4DL5A 5DB9A 4KLUA 3G10A 4IKFA 3V72A 1MC8A 2DFHA 2R8JA 4ED8A 2J6SA 3S3OA 3AVMA 4TUPA 3IG1A 1U49A 4KN7A 3L3UA 2WOMA 5IIKA 4ED3A 3MXJA 3RMAA 4RPXA 4MF2A 1RTDA 1NJZA 4DOAA 4CGGA 3TI0A 1HYVA 3MXMA 4CEOA 1RBTA 3UQ0A 1RBUA 4YMMA 9ICLA 3B6PA 3RJFA 3CM5A 1DLOA 1D8LA 4FJIA 1HRHA 4DU4A 4B9MA 2PI4A 4FXDA 1A77A 3NDKA 2ZQBA 2NUBA 4Z4CA 2G8IA 1ZQHA 4Q44A 5KFIA 4I7FA 2NRWA 2W8LA 4RNOA 9ICQA 4DLEA 1NKBA 5KFRA 1KFSA 4E7HA 4KRFA 1RBSA 4RPYA 4KN4A 1IKXA 3NAEA 4BE2A 4CFCA 8ICVA 4DFJA 1QSLA 4IG0A 1LW2A 4I2GA 3CFRA 5HRNA 4KLMA 4O3QA 4Y1CA 3QIOA 1HMVA 5KFXA 5DKWA 3VN5A 4JV1A 7ICRA 4CEZA 2X6NA 4M3TA 3SQ4A 1S9FA 2OYQA 5SWMA 2OWOA 2BGWA 1VRTA 3V7LA 9ICBA 3QEIA 3AA5X 1B22A 1WSJA 4RW4A 1TFRA 3OYFA 3AA4A 5C42A 3V7JA 1XSPA 5DGBA 2OPSA 4DTMA 8ICEA 5KFYA 4H4OA 3OS1A 3RB3A 4KLOA 4EBCA 1XWLA 4DTOA 4LY7A 7ICNA 3SPYA 4I2CA 3TARA 4DL7A 1NK4A 5CY4A 4CF0A 4FZXC 4IFVA 2XY5A 2PXIA 1TK5A 2RF2A 4NLNA 3KK1A 2OPQA 1D5AA 4CJQA 4W5RA 3U6FA 2ZTEA 2RN2A 4BWMA 4CJKA 2I5JA 2IA6A 4FJ5A 3KHHA 4UBBA 5D3GA 4E7IA 4FM1A 5KFSA 2VA8A 1BPXA 1RPLA 3C5FA 2ISOA 4DSKA 5KFBA 4CJWA 1RT1A 2YNGA 5DLGA 2F8TA 4B9VA 4CGHA 4FJGA 2DFEA 4EBEA 7ICVA 4ECRA 4HTUA 1FKOA 3QZ7A 2YHAA 2Z1JA 3NFAA 1EXNA 4LVSA 2OPRA 9ICUA 4B9LA 2GUIA 2Z1GA 5KT3A 2W9MA 3K59A 9ICHA 2ZJ8A 4CGJA 5DDMA 4DWIA 2F8SA 3AVFA 4O4GA 4M3RA 8ICKA 3CFOA 3F9KA 4CHYA 4GMJB 2JZBA 1UT8A 4ECWA 4I29A 4KLFA 4RU9A 4CJSA 1XHXA 1EKEA 4RQ6A 1S0OA 4TSXA 2I1QA 1LB2B 4LH4A 2BR0A 4BDYA 8ICCA 3OVNA 3ISCA 4ZHRA 1TKXA 1IKYA 3HP9A 3V7KA 2RKIA 4RW7A 4QW9A 4J9KA 4IQWA 4DU1A 3PX6A 4F92B 4DTSA 3LDAA 5KFWA 3V9SA 4F5NA 2C2EA 3M8QA 2KFNA 1DTQA 3LP0A 3SQ1A 4CJLA 4R5PA 3BQTA 4I2AA 4M6WA 4TQSA 1HYZA 4FVMA 1SL1A 5I3UA 4TUQA 4FS2A 1C1CA 3EWAA 2QKBA 1S9EA 4DEZA 1CXQA 3JPRA 1MQ3A 2W42A 5J0TA 4CF1A 3V1RA 5J2HA 4OKEA 3EPIA 3SQ0A 3GIKA 3ULDA 8ICTA 4I2EA 5KGWA 4M9NA 2BGGA 4CFAA 2HVIA 5KFDA 4DSLA 3MFIA 3AO3A 2FLNA 1WNSA 1TV6A 5EWGA 3G6XA 4CK2A 4MFFA 4C8LA 3D0PA 3CFPA 3GIIA 1WSEA 3SI8A 1X9SA 3ZDEA 3OJUA 3TQ1A 3ZSYA 1ZQKA 4LZGA 1T4GA 1RILA 4BGDA 4LZDA 1C0UA 5KFMA 4M3YA 2JEJA 8ICUA 3PNCA 8ICMA 3RH4A 3UQ2A 1KSPA 1L3SA 3VA3A 4Z4FA 3HT3A 4P4OA 3QE9Y 3PO5A 1WN7A 1NK5A 4EZ9A 4RQ5A 2XO7A 3V1QA 7ICPA 1BGXT 3ZT4A 1I3AA 4I2JA 3C2MA 2FBTA 3EY1A 1TVRA 3RTVA 1NKEA 4DL2A 1IO2A 4YXJA 4K8ZA 4UBCA 2D5RA 3ZSWA 4FLZA 7ICGA 2AU0A 1YTAA 4YR2A 4TURA 1VSLA 9ICRA 2NRZA 4ED1A 5J0UA 4O5BA 4TUSA 4PUOA 3AA2A 5CB1A 1TL1A 1K1SA 4UB2A 1SL2A 1BPYA 4RPZA 3G6VA 4F2SA 3U3GA 3VQ7A 4DMNA 9ICCA 4HHTA 2ASLA 2UVRA 3SUQA 1S0VA 7ICKA 4KHWA 4BWJA 5DQGA 1VSMA 3IHQB 8ICZA 3SUPA 1S1TA 1RDDA 4NCGA 8ICBA 5J0YA 4ELTA 5J0XA 4Z6CA 4J9OA 3BJYA 4XUSA 5IIOA 3AV9A 2AGQA 2BKEA 4YG2A 3ZT1A 1TKTA 5HMLA 3H8SA 4KLSA 1ZQBA 1ZQPA 8ICSA 4IG3A 4KHSA 3VQBA 3V6JA 2ALZA 4E1NA 3OJSA 3VQQA 4Z0UA 4PY5A 4MFAA 9ICXA 2ZJAA 2XHBA 3O3GA
chains in the Genus database with same CATH superfamily
3EEQA 2KD1A 1M5HA 1VQ8N 4Z4HA 3PX0A 2CGJA 1GO3F 1FEZA 2H3GX 1IKYB 1SCJB 4DLGA 4E1JA 4XQ8A 2WONA 1SXLA 3U9ZA 3VAKA 2FZKB 2Y8WA 3IS9A 3R27A 4YN3B 3M1VB 4CT8A 3E51A 5HHHA 5JLFA 1L3VA 2YX1A 5IINA 3RAXA 4FPBA 1WTFA 1OKJA 5G5HA 2ZJPL 1TKZA 2EI5A 2WSCC 2ZC4A 5D4NA 3J80Y 3HHLC 2F8HA 3JPNA 4RWWA 4FP9A 4OKKA 4O0JA 5J0WA 4DQPA 3E66A 2BCUA 5IIMA 4JB3A 3WK8A 4KKOA 4EUVA 1AFIA 3C0BA 2UVUA 5H9EK 3QRRA 4WQ5C 1KOOA 2W01A 5KFVA 2EZXA 3BS5B 3ZX3A 2N4DA 4EZ6A 1CC8A 4IO9L 1VIXA 2JC1A 3WX4A 5CHGA 4W5NA 4FYYB 1VC5A 3LTOA 1FRLA 4LBHA 4RLEA 5F41A 1LOUA 1T3OA 1F9HA 3CO9A 4JV5F 3MCAB 2ZHAA 4P74A 1NM2A 3QWUA 3FR0A 2H5IB 4J2EA 4PWWA 5HATA 3QO9A 3TKAA 4OX8A 5CJ7A 4E98A 2IHR1 4DR7K 2MMYA 2MY7A 2GO8A 2G13A 1Y9OA 2IBKA 4YVZA 2QKQA 1O08A 4PH5A 4UQTA 4O5CA 4XH5A 2RU3A 1OQ3A 1N5YA 1X4EA 2LP4A 4NM1A 5EU7A 1AA1B 4B1XB 2MJNA 2XB2D 4H4MA 1ZD5A 4I67A 1NK9A 4OL8A 1WC3A 1D9FA 4KPYA 5T7BA 3CCRS 2HVZA 3QZ8A 4WFAQ 3L9ZA 2BYCA 1WB9A 5HVFA 4MAKA 5A8RB 1FRMA 2J6UA 5ETQA 4PZOA 3IBWA 2IMWP 4DV7J 2EWHA 3F53A 2KB2A 3QMQA 3EICA 1MN7A 2KQ2A 5ALUA 1FK9A 1MW7A 2RMLA 3UO0A 2VG6A 2BCSA 4DR4F 4OX7A 3AVAA 2CXYA 2NPFA 2Y9HA 3SCKE 2YWWA 1L5UA 3G6YA 1N6QA 1DJ0A 3D2WA 4ED5A 4FZMA 5GAHP 1RDCA 4I6WA 2RE1A 3CJCA 4ZLNA 4KHUA 1N36J 5F8IA 2RKIB 1ZPWX 2PDAA 4RW7B 3LA0A 4HUGA 3ZD8A 2FB0A 3RH5A 1QHTA 1UVKA 1XEZA 4BX9C 2AEFA 2V8VA 2AH5A 4Q2LA 3QIPA 5KFZA 4E7JA 5FPEA 2D0CA 4PGQA 4G9ZA 1R0AB 4EX6A 1QM9A 3CSKA 2W9BA 3LP1A 4YHHF 4NEZA 3MUMP 4ZP9A 2F77X 4YQWA 4WPAA 5HR7A 3AXMA 4UY8O 2QIFA 3VAMA 2D6FC 4OI2A 2G08A 2QX0A 3B4DA 3LDPA 4IFYB 2EG1A 1HHTP 2DO4A 4KH6A 1UVJA 4JI2F 2ZGYA 2WB1F 1P8ZA 4Y2CA 1HKBA 1NZPA 2W4CA 3TR8A 1WBBA 3CC4S 2WAQC 3UIQA 2K3KA 3I32A 1FHTA 2IA0A 2JVOA 2YKAA 3DC2A 2KJ9A 3GU3A 4C4WA 4CO0A 3LOUA 1CLFA 5JTIA 2GMHA 3D7SB 3W61A 5ALQA 3VF6A 1SXDA 1KN5A 5HO4A 5AZIB 5JMVA 4I2PB 3A0IX 3CCLS 2OH2A 4ZK7M 3QNOA 8ICQA 1FK9B 3TQEA 3OFFA 3H1QA 1X9JA 3D6TB 4CZKA 3TA1A 3R3LA 4UY8T 3H59A 1S7HA 1ZM2A 1SGGA 1PJ6A 3TJAA 4RPFA 1U04A 4YD2A 2D3ZA 4DUZJ 4FWLA 4DFMA 2KRRA 3GFYA 4F4AA 2IJFA 2ASJA 4DV5K 1W7WA 3CF5L 3M2RA 2FMSA 2VICA 2MZRA 2BJDA 2JR5A 7ICSA 4B3SJ 1RWXB 3KKAC 3ZSXA 4NXZA 4OI6A 1JXLA 4FBTA 1T3NA 2FE9A 5HMZA 1FRJA 2HNYB 1S5ZA 3IWXA 5J8YC 2E5GA 5IT9O 4CZIA 3CCSN 2C2OB 3KTQA 2YTCA 2J7WA 3A8IA 1RTIB 3QIDA 4IR1A 3IWNC 2FJAB 3PX4A 1K0VA 1T9XA 2WW4A 4F3TA 3UPQA 3UCGA 2VUGA 3T1AA 3D9BA 1UCNA 1X31C 1ZQYA 2K4PA 2DTJA 3GTYX 4O3RA 1COOA 2ZBPA 3H7IA 2OELA 4PL2A 3QX7A 4JI5F 2YQ3A 1CVJA 2FZCB 1S6PA 4MH8A 4ZPTR 4JI0J 1LW0A 2R7OA 3CCZA 1GLFO 3THWA 2Q43A 1TL7B 3Q8KA 4Y65A 4UOFA 1TL3A 1WKLA 2M9NA 3S3MA 5JVHL 2XNRA 1BNOA 2AX1A 1OW5A 1HNWK 4RW6B 4UOCA 3V4IA 1IBCB 3CMEN 1T9TA 1JL1A 1TKZB 2R8KA 3MDFA 2IVNA 3MMCA 5CP2A 3KLGB 4IRCA 1F9EB 1KP6A 2LECA 4KH0B 5LM7E 4O3SA 3FGVA 3KD1E 4WJ3B 4B9QA 5HL7Q 2C2MB 5AQNA 1XMQF 5I3UB 4KTQA 1PC5A 4XDDA 3M7DA 1DBDA 2VL1A 3DI6A 4J5OA 7ICIA 1K6YA 4UB1A 2YKOA 1RT2A 4HKQA 3W63A 3PMLA 9ICAA 3PW0A 5LXRA 1VISA 3JB9k 5ADXH 3O4QA 1QDUB 2WAQF 2ZF5O 4PQUA 4ID8A 1WI6A 3AY9A 1G7CB 7ICOA 2YBVA 2ZBCA 3SYZA 1WF0A 4JI0K 4M5DA 2E6MA 2FHMA 2HDOA 1Z4NA 3FCWA 1TL1B 4F04B 3I56N 3HSGA 5CCMA 1UWBA 3UN3A 5D0RA 3W5XA 4QWAA 2HURA 4LD0A 1H1VA 4QWCA 1ZH5A 1S5LU 2IVYA 2VDHA 5LMUK 1RAJA 4MKBA 1WHVA 3SNNA 1DRGA 3C3LA 3MMBA 2Z8QA 4IKAA 1I6JA 4OYMA 5SUHA 4J9SA 4WF9L 1ZQZA 1O1WA 4DSIA 3RR8A 2VQEJ 2DY9A 5AQMA 4ANDA 4J9PA 2OFHX 4PHTX 3NVMA 2C3MA 2Z56B 2MKJA 3R8EA 2YNHB 1O03A 4WFNQ 5EOZA 5AI4A 2OTJN 4WKRA 3AQOA 3TA0A 1WSGA 5I42A 3CYMA 3RBDA 4KGVB 4ZOHC 1RT6B 1U1OA 4AHSA 1XMOK 3UDLA 4BROA 4CFDA 3PEJA 1NOYA 1X9XA 2MGZA 3K2PA 5EOYA 1WG8A 2IM3A 1TQLA 1Q46A 3C94A 3DU6A 3CXCR 2DNGA 1IKVB 2BPFA 5J1EA 1B9DA 3VF0B 1EWQA 1JJHA 2GEMA 3D4JA 3OFGA 5AHXA 4MFCA 3KKSA 4WE1A 1ZM9A 2VYPA 1JXBA 1S3XA 3VPZA 1VSHA 2GFFA 1NPRA 4ICAA 2OM6A 1LXNA 4G1IA 3V4IB 1JMSA 2F65A 2QWNA 3GSIA 3OUYA 1FTRA 4EI2A 1J97A 4K2XA 4JKHA 2BW2A 4DV6K 3UVJA 3DKDA 1EJ7L 4F4WA 1RZTA 4NLPA 1T0TV 2W11A 1HLUA 1IJFB 3PRVA 4LJXA 1LWXA 3VHQA 2RPIA 3F73A 3E9PA 1KQSM 2BCRA 3V6KA 3ZSVA 4DX5A 5BRFA 1ELOA 1E4FT 4F8RA 1N36K 3QBCA 2OO4A 5KAFU 3EWGA 5J1PA 1ROFA 4B3TK 3TJ9A 5KT4A 1WG5A 3MGHA 2I5HA 8ICGA 5J2FA 4WK1A 4BG9A 2FYXA 3KG1A 5DMRA 4OPHA 5CZXA 1F3FA 2P8IA 2OEMA 4IOBA 4JYAF 3A8JA 5ALSA 3FRYA 4HACA 1HD0A 1EQ0A 3P39A 1X6JA 1Y7PA 1ZZFA 1EXQA 3PYEA 1CJTA 5TKWA 4ID5B 2FVQA 5AQGA 5KQ8A 1FX4A 4ISGA 2BM1A 4CJUA 3T1HF 3AEVA 2COLA 3OTOK 1F0XA 4F5RA 3KD3A 3T1YJ 3QFWA 2W7AA 1B92A 3OPKA 4CQ1A 2HGNA 1HW9A 2ZKTA 2EAMA 3GCXP 3BZCA 1TE2A 2ZTCA 1LWCA 1DGKN 2AYGA 4DV6J 1JROA 2ZBRA 2W54A 5DZ7A 4KV8A 2F8MA 3R5CA 2OIHA 5J8YA 2PA3A 2AWZA 2FLPA 3ISDA 1YZ6A 4EEYA 2JRSA 3I5AA 2E8AA 3SAFA 3CCVN 3H40A 5EE1A 5AQWA 4C48A 3HFZB 1CLQA 2HRYA 3VGMA 4NI2B 3A13A 4IFVB 3UDEA 4ZVUB 1G15A 2QWPA 2A1SA 3T5LA 3V81A 2A40A 4DOCA 4AL7A 3L4PA 4CO3A 8ICHA 2G2OA 3LL3A 3U1LA 2IDLA 5L1IA 1QH9A 2ATCB 3CNQP 1RHKB 2XYGB 2V8DA 9ICMA 2LYBA 4AILC 3J7Z5 2R9LA 4FW2A 2J9DE 2FBYA 2GELA 3AVLA 3L3VA 2DTUA 4FJLA 4CEAA 1H2VZ 3T6JA 3NWRA 1YBAA 2KO1A 1FNOA 3PYGA 1YBUA 4ZJLA 3TAGA 2CUYA 1QQCA 3PIPQ 1CJUA 5BR8F 4ZVFA 1WG1A 4LREA 2GS8A 3T19A 4BR7A 4ZLJA 4JKAA 2EFPA 2BDPA 2NUUG 3L2UA 2FLLA 3DI6B 4NO7A 1MU2A 1FO1A 4ALZA 2A10A 1CQNA 5CR0A 2R3VA 4MYUA 4F3MA 4ILHA 1IKXB 4P9SA 3VQ9A 3HKZF 1NO8A 4G3IA 1ZQJA 3OYLA 1A0PA 5E0OA 4NLQA 4CJEA 3NG8A 2VIXA 4CFBA 5DM6Q 4YORA 3N4QA 1U1NA 3CC4N 1HJPA 2XS7A 3MN5A 2DNPA 4L74A 4K4SA 3RSEA 2E5IA 3ATVA 1MWMA 2PFOA 1N8RT 1C0TA 2FC9A 3RJEA 3L2RA 4EO6A 2KEYA 5HNKA 2C2NA 5L9XA 1N32J 2DUYA 4RW9A 3OLBA 1NSAA 1XIQA 2B43A 4C1NI 9ICOA 4NB4A 4C6AA 1JLGB 3H7HB 1JCEA 4I27A 4PEOA 4I2FA 2CRLA 5E79U 1C1BA 2OPPA 3LAKA 2D1CA 2P66A 1BQNA 2HYIB 4BY9C 1KEJA 3TZXA 2Z1IA 2WHEA 3Q7BA 1HBMB 1U48A 3AY0A 4NLVA 3QEPA 4AYBD 2ABYA 2ZOMA 3VWSA 4JI7F 3US5A 2DY4A 3CDEA 2QT7A 2JFKA 2RE2A 4P0QB 4AUKA 2KTQA 5T14A 5FRNA 1R27B 3MECA 4YFKA 3QBWA 2W2MP 4X64K 1E3MA 4KTWA 2FGCA 5B0EA 2FSNA 4O0IA 3KLFB 5DM7L 1SVDA 3CD7A 4CF2A 4CYUB 4Y2QA 3IRXA 1S72N 5EWFA 4PKGA 3TSUA 2XNQA 1J5EJ 3I55N 3DYAB 1KHVA 2EFGA 5HHIA 5AFUA 4HVJA 2P9SB 1F5CA 3BF3A 2KVSA 5T7LA 5A8WA 3JQMA 3QAEA 2NSCA 5L1JA 2NPIA 4ECXA 1YHQS 5HRSA 4DJBA 4CLLA 3BF1A 2IOCA 1UPHA 5ALXA 2DNOA 3BGRA 1V9PA 4YOVA 3RMCA 5F3XB 3RBXA 5AK6A 3VENA 3SAGA 2W7PA 3OYMA 4AD6A 4F0HA 3IC1A 1SKUB 4NRUA 4QZDA 4PQUB 2DNYA 2OHDA 2ZH7A 3NS7B 3BB5A 1VQLS 2DF4B 1G1XA 5LJWA 3W9JA 4WWSA 4OZ1A 3IRWP 2G07A 2ZIVA 5G4DA 2KXNB 2D3DA 2QZ8A 3CJRA 3QBXA 1FW6A 2R2UA 2AJQA 2XHWA 3HFKA 2I2YA 4NXMK 1VQ9N 4G65A 2RVJA 4CBUA 4UB8U 1QTNB 4OZ2A 1VYAA 3WBZA 4XIUA 4JK8A 5AXNA 1TV6B 2QV6A 1FJGF 4HTJA 4Y2UA 4Z6EA 2ZOFA 2IHMA 3DXKB 5I3PA 4V19J 1WCNA 4DPWA 3A0HU 1U0HA 2JZBB 4KFBA 2ZJRQ 2NV3A 2DRAA 2CPXA 2J0SD 1QD1A 3C16A 4ECZA 4GXKA 1CS4A 3C7NB 2HZCA 1S7IA 4Y2SA 3AVJA 1QQNA 2VQEK 3L95X 4CJTA 4O23A 3NP5A 2PEHA 2YB4A 4DL6A 2Y9UA 3BM7A 3C65A 2E20A 4BRNA 3B9JA 4DR5J 3CCRN 3S9HA 4U67Q 4LFCF 1IH7A 4DV0K 3J7AN 4PPZA 1NK7A 3Q23A 1XHZA 1QAIA 4TQRA 1KTVA 1QSYA 2BJ1A 2LA4A 2FLOA 2O8CA 3J7A1 2RRAA 2ZGZA 3HHKA 1Z19A 1A6SA 3SEOA 4JLHA 1L7MA 2Y0BB 5M1FA 8ICWA 4NLUA 5IILA 5LJVA 4CECA 1FFSB 4QWEA 1RAHB 4WTOB 5D4LA 1KL9A 3QXGA 3SMZA 4DUYJ 4IOXA 1VJQA 3KDNA 2RF2B 1PC4A 2BABA 3RB4A 4FF1A 4YDXA 1FVSA 5AQPA 4LF8J 4FJKA 3RZAA 2DEJA 1JCGA 4Z6FA 3HKWA 1OY6A 1NGCA 2BPCA 1U09A 4DF8A 2GVZB 1X4GA 5KFHA 5ETVA 4WJBA 5HP1B 3VQ4A 2M9KA 2RP5A 2QSWA 3F5EA 4JI4J 2ZUGA 2F63A 4H5WA 5K8MA 4CJ5A 3ILIA 2HGMA 1FRKA 2I38A 4US8A 4KI6A 1HQ2A 3TZZA 3BYRA 1VOMA 3IM1A 1KBUA 7ICHA 3TAFA 4O3MA 3MCPA 1N34J 1N32K 1XSNA 1FDBA 3TTCA 5KPZA 3TO8A 3GFKB 3C6UB 3KJQB 4FNIA 4DFKA 1YXQA 1DGSA 2HNZA 4OJHA 3VERA 4I56A 5C2CA 4QYZK 1T6DA 3T5KA 5K14A 4WCEQ 1A5WA 3LP0B 2XRIA 3CC2S 4IFYA 1LAWA 1UW9A 4IWVA 4K42A 4UW2A 2O6KA 4LFCK 4OYWA 2BX6A 5KG0A 5B7WA 1UAXA 3L2VA 3SQGB 3PFOA 1T8EA 3TA2A 4FO0A 1D9AA 1BDGA 2JGAA 1L3KA 2YWEA 4CF8A 4IDKA 3DOKB 4N7TA 1ZQIA 3SQOP 3AMZA 4KRWA 2VWJA 4MEXA 3FYHA 2K4IA 4C8ZA 1VSKA 3GCWP 5J1NA 3V2UC 3WKDA 4I68A 2I6XA 4DV3K 3QEWA 2H3IA 4CJFA 2P6UA 3VQPA 4NZ6A 3D2EB 3UVJB 1FO4A 5DDRC 5AQFA 3GQCA 4CLZA 2JC0A 4A8MP 2R7RA 2G8HA 1KW4A 4XPEA 2DQNB 2YKMA 1Q3VA 4UB6U 3HMJG 3OYCA 3CGIA 4GKJF 4LFBJ 3B0XA 3GONA 1UVMA 1MN9A 1HWKA 3A8EA 2ZJQL 3AVKA 4JD2A 2X1GA 3GE1A 1FD2A 3CMAN 3K58A 4BC2A 5J2JA 2C2RA 2HFZA 2IY5B 1ZQCA 3FBFA 4K0KF 3JTPA 5ETRA 2HHPA 3VGSA 3SDEA 4CESA 5KRTA 1LWFB 3CB4A 4RCHA 4E1MA 1ASWA 2BTFA 4F02A 3N4MB 2J9DA 1T9YA 3O8MA 2C3UA 1WUDA 3MD1A 1FDNA 2CWXA 4F26A 1OPIA 2IMOA 3RU0A 5CQGA 2GV9A 4XAKA 1EWRA 4FK0A 3ALRA 2YNHA 3TR5A 3TAMB 7ICTA 3E58A 4TKTA 4MLHA 2BM0A 4FLUA 5GAGP 2KFYA 4CIGA 3BZQA 2ASOA 3THVA 2D0AA 7ICLA 3H5YA 4CZMA 4LF7J 4MIBA 3O5TB 1F5SA 3DXBA 2QMXA 1N5QA 4PWDA 3O4WA 1QLNA 1FXDA 1D8ZA 3P1GA 1YJNS 3M9OB 3AVCA 3J7ZO 2Z2ZA 1Q81T 1CXUA 2IGIA 1K1QA 2O66A 2QLJB 4ANEA 4ED0A 5TKYA 4O44A 3R1HA 4OYBA 4BC7A 4GXIA 4I4BA 3AQFA 1HBNB 3N4PA 2Q6BA 3Q8YA 2V68A 4CE6A 2HZAA 3IA0A 1DQ9A 1JRPA 4FO6A 1MA7A 1ZBTA 4LF7F 1ZJMA 4GC7A 1ZQXA 1WNEA 1XTZA 3MWTA 1HHQA 4MEYA 2PFNA 4UT4A 1VQ5N 2XWXA 3LP2A 1X3NA 3CG7A 5KFNA 3IWLA 3PACA 3PW7A 4CF5A 3T1YF 1RHMB 1Q8BA 2FUG9 3O8WA 3NGZA 1HNWJ 4DS5A 4NPOA 2A1AA 2QC3A 3O9RA 4OX6A 4RNHA 4YOWA 3UE5A 2K60A 4X62K 3BR9A 3NVYA 1UPMB 4UB5A 1C1AA 4X62F 5HQ8A 3IKMA 4EP5A 2ZM6F 4DFPA 3W9HA 3WT0A 1HBNA 3AARA 4CLYA 3MN7A 5LOQA 2ZDOA 1SAZA 2LXFA 1ZQMA 4FYXB 1GOBA 4B8AB 3NS5A 4RW8A 4ZIVA 3DCAA 4CI6A 2FPMA 3NXZA 3ISBA 2KI2A 4Y2PA 3LANA 2P6TA 3M30B 3MMBB 4C0OC 3CT9A 1FTCA 1U2VB 2NO4A 1WI8A 5M1PA 2UZAA 2C28A 5CA7A 1DK3A 3F41A 4PYDA 4M1KA 1VQPS 1AROP 4QZGA 4PG6A 1HWLA 1NSQA 2H48B 3H4BA 1XMQK 4FOIA 4Y34A 5CHIA 2O3DA 1IG6A 4YDUA 1BQMB 1IBKJ 1VLYA 3GFHA 4L3QA 1TK8A 2VJVA 1BL3A 1YJ7A 2DBYA 1VMBA 5CYQA 3PXGa 1OXJA 4BRQA 2K06A 3UI3A 2AP6A 3JSYA 4J9MA 3MAHA 1OY9A 2VG5A 4MKVA 3OVBA 4C9DA 1LK5A 1PO6A 2RB7A 1CPZA 3CPWR 2XYPB 5A76A 1S1UB 4I6AA 3CJTA 4JKFA 3DLLL 4UARA 3ONQA 3TPQA 2CDRB 5KFLA 2QXFA 1NCLA 2P9IA 4DL5A 2DK2A 4X62J 2RS2A 2ODGA 1IVZA 2Y0SC 1Z4OA 2M2BA 5AI9A 4EHUA 1X8DA 3VCBA 5AKZA 3J7YI 4K0KJ 1L8OA 2LXUA 4MF2A 4DPUA 1NJZA 1XBWA 3TI0A 1XJWB 1HYVA 2L48A 4CEOA 2MKKA 4DN9A 5B0GA 3PKYA 2A6AA 3B6PA 3EX7B 3RJFA 1RKJA 3HKZC 2KKHA 3H46O 2XEXA 4FXDA 2BOPA 1Z1BA 2GHPA 2WF5A 2NUBA 2G8IA 4LQ9A 4X4QA 3QQCD 2ZUAA 1WF1A 2CQIA 3J8AA 3MF5A 1N36F 3MMVA 5AR0A 1C1CB 5HMXA 4ZHRB 1UW4A 1RBSA 1S6PB 1Q4RA 2C3PA 4KN4A 4ZJQA 4CFCA 3S1TA 8ICVA 4DFJA 3DNCA 1LW2A 3N79A 1EIYB 1VBKA 1I51B 5HRNA 4NJ8A 2M8HA 5F0UA 2G4BA 4Y1CA 3QIOA 3JSMB 2R7QA 3VN5A 3M3ZA 1VCTA 2CXEA 4ZCMA 1S22A 2X6NA 3CDBA 5BN8A 1M5KC 4I64A 4K50A 5SWMA 2VKRA 2KKVA 2KG5A 1VRTA 1ATSA 3V7LA 1FEHA 1WEYA 3AA5X 4PL7A 2ERRA 5AE3A 5H1SQ 1IQZA 8ICEA 3MM8B 1EAYC 4U7BA 2VU5A 1RAEB 3OVAA 4FXVA 7ICNA 4I2CA 3NCPA 4MLEA 4DL7A 2UU9J 1NK4A 1C0GA 5J2MB 4X4TA 2MKYA 3W1YC 1K5OA 1TK5A 4C8YA 2RF2A 3KK1A 3B8AX 3CJ1A 1SQKA 1TFYA 2VQFK 2HCFA 2RN2A 4CJKA 4LF4K 3WK9A 3DRRB 3HDSA 4FM1A 4HL9A 1HWUA 2ZKUA 2VA8A 1BPXA 2E1YA 4E2FB 2ISOA 5D8HB 5U47A 4DSKA 5KFBA 4CJWA 1YKWA 1YI2N 2F8TA 2V2KA 4B9VA 4CGHA 3U1MA 3E0FA 2QGFB 3TUJC 4OX9F 7ICVA 4HTUA 3QZ7A 2XI2A 3KK1B 2YHAA 3I28A 4A47A 2CNOB 2KT5A 2OPRA 4B9LA 5KT3A 3GZ7A 9ICHA 2W55A 1NB7A 3RGIA 3QRQA 1BOTO 4M3RA 2YTUA 3F9KA 3MDQA 1MMNA 5AIBA 2MHNA 2MQPA 4DV0J 2E88A 1TL5A 3OA9A 2W3RA 1XHXA 1OJ4A 2HHHJ 1AXQA 3OR1B 4UZBA 4TSXA 2WVDA 1IQTA 2KM8C 1W26A 2GA7A 2I9SA 2BMBA 1Z1VA 4QW9A 4J9KA 2C42A 4GIBA 2M8DB 4K5RA 3UDCA 4X4OA 3LDAA 4ER8A 2F4VK 3V9SA 1H3DA 1WOSA 1JK9B 3H8MA 2KFNA 4LRFA 1RU2A 4R5PA 3CMES 3BQTA 1F0MA 4X4VA 2LQ5A 4FVMA 1C1CA 1S9EA 1UMJA 3JPRA 1MQ3A 2LCWA 3P38A 4RUBA 4LF6J 3BN7A 4A8KA 1S6QB 1FJEB 3N4WA 5KOXA 8ICTA 4I2EA 2F7TA 3O9TA 2F4VJ 3FSXA 4LSLB 5ALNA 1TV6A 5GAHI 3G6XA 4WFXA 2PAVA 4ILMA 3GIIA 4YDUC 2IBOA 1X9SA 2E5HA 3ZDEA 1XNQF 1VLOA 3FZHA 1SC4B 4H4KC 1T4GA 2DHHA 3ZNJ1 1C4CA 4OJ6A 2WF7A 8ICUA 2XICA 1QUPA 3CCWA 1R8BA 3THWB 4Z4FA 2BJ9A 3J7YP 2KKPA 3QGHA 4NYOA 3H90A 3G8TA 3MM5A 2HBYB 2VZ9A 2VOOA 4EMDA 3MK6A 3T9NA 4RQ5A 3I31A 2HIYA 7ICPA 1BGXT 2NLXA 3ZT4A 2JZ5A 4BRFA 1I3AA 3OL6A 2FBTA 1TVRA 5CHCB 2X1FA 2A2CA 2OEJA 2P9NB 2UXDK 5A8KB 4QJFB 3QT7A 4ZVPB 1NGEA 5JMNA 2FXUA 4BRMA 4OO1J 5IC6B 9ICRA 3WK6A 3B8HA 5J0UA 4GV9A 2RDDA 4PUOA 4BLGA 4NI2A 2EH9A 3AA2A 4AYBC 2F5GA 1U1RA 1RQLA 1F2HA 5GIOA 3K17A 2X7IA 9ICCA 2AJ1A 2ZBIA 4H54A 3LGMA 5AK5A 3EO3A 1Y5IB 1KWMA 1QQMA 1S6OA 4BHQA 3RSEB 2ZIUA 4DV1K 8ICZA 3ZO7A 1RDDA 8ICBA 4RNFA 4ELTA 2ZH4A 1HR0J 1OY8A 2AGQA 2BKEA 3ZT1A 2B4PA 4QU6A 2VV5A 4DV6F 4KLSA 8ICSA 4FE3A 1C1BB 3OJSA 4J7CA 3VQQA 3GLJA 2Q0RA 1ITPA 5A0YA 2QWMA 2HVHA 1J2VA 1UPPA 3G25A 2F8KA 2XCPA 4TYBA 1NJIO 4CZJA 3F2KA 2O5DA 2B51A 1BU6O 3MABA 4G1QB 3TZYA 2YKPA 4YOEA 3K1ZA 3M2VA 4O8KA 3AOBA 1D9DA 3IG5A 1S1WA 4PRFA 2OTJS 4CW7B 1KN6A 2VGMA 3AAQA 3SPZA 2DT9A 4U7CA 3VQ5A 3H3NO 3O3FA 3FLCO 2B5JB 3WZ0A 3CJBA 4HHHA 2EFVA 4IOCQ 4ZLLA 1SC6A 3FZKA 1U6BA 1OMSA 5AIAA 1XNRK 4H0XB 4KAIA 1XMOF 5A2QO 1TAUA 2IVOA 1F2GA 3O4NA 2ILZA 3RJHA 1X40A 2ASPA 4ZCKA 3ZT3A 4WZMA 1VQPN 2R8GA 2LDIA 2VF3A 2MZSA 4KX3A 1YI2S 4W5OA 4QAGA 3CDUA 4DR2F 4K59A 3AVGA 5IFMA 4B1UB 3Q8RB 2IOFA 2K89A 3A3PB 4DR4K 1LXJA 1SUQB 4UOGA 1K8KB 1N54B 2EDUA 2PGCA 5ALTA 4MQ3A 5J0QA 2CG8A 3MEDA 4RTFD 4ATNA 3FEZA 5E3AA 3M9MB 1XR6A 4RQ4A 5J0OA 2PFUA 1TYQA 2OXOA 1FE4A 5ALFA 4KT0C 2NRXA 2P51A 4NXNJ 1GK8A 3T5JA 4KX5A 2K3IA 4YOYA 2D9OA 4QIWF 1IBMJ 4B3RJ 2ZE2A 3SSQA 1VBXA 3A5LC 1LEOA 1L3TA 2HBLA 2GJIA 1L7PA 3IBPA 3KYLA 2WK4A 4AQYJ 3RJKA 5L39A 5A2QU 4PG4A 4FK2A 2YNGB 1VQ5S 3SZ2A 2AMCB 2R7SA 1YRUA 2DGXA 4J37A 4KBIA 5KPRA 1W7AA 4A5BA 1S6QA 1N0VC 4FCYA 1LKYB 4CLTA 3TW0A 2FBVA 3ZZYA 3KG4A 1GNKA 4M5MA 2BQRA 3CJQA 1R8CA 1S1VA 3HCXA 1Y97A 3CCVS 3LP3A 1BPBA 1V85A 5K5MA 1CG2A 1Q95G 2BZFA 4C7YA 2GUPA 2VC0A 4PPDA 2FJVA 2P9KA 1WCLA 2WVBA 2BZ2A 1SKWA 3C19A 3MZIA 3X1LB 4I7FB 4UAUA 1U02A 4EX7A 5KG5A 3G9CA 2PI5A 3VAFA 2V9WA 3ZTPA 4GXJA 4KKOB 2UYTA 5AK4A 3IXQA 3NBPA 2D9PA 3IM9A 5DB8A 2IM1A 5KG3A 4JUZA 2XY7A 1SV5B 4LRDA 4OGEA 2Y1IA 4KFBB 1HMVB 5I9EB 4IDHA 2CFXA 4ELVA 2EXUA 3T41A 3CETA 1N6QB 3G71N 1KTQA 4YN4A 5CZ2A 3UXOA 2JEIA 5D0GA 2KE7A 4XPCA 2B4JA 5K14B 5DZ6A 4FNHA 1M5SA 3R7BB 1W25A 3N0VA 4DHVA 2VPXB 3WC2A 1KQSR 2P9GA 2LQBA 2CPIA 3FNNA 1X9WA 5D49A 5J2DA 4O55A 5KG6A 4C8KA 2WTUA 2BUPA 5ADZA 4JBCA 4CBXA 3MBYA 1KXPA 1FRIA 4BDZA 2ZEJA 2IVMA 3VAGA 1JI7A 2FDNA 3AJ1A 4F5QA 3WQPA 4CZGA 1WHYA 3F2DA 2E7XA 4HT5A 2DGOA 5AQLA 5ALMA 2WVFA 4LF2A 3MM6B 4BR9A 3BZKA 2HBZB 3E2EA 3M6XA 3MPVA 1K9MT 2B21A 3FFIA 1RJJA 4FPIA 4ISFA 3WNEA 4R66A 3LGNA 4FLXA 3TJ8A 3GR0A 2H51B 1WSHA 8ICXA 5T7LB 5A8WB 5TZVA 2I6WA 4C8NA 1NK8A 3FZFA 3LWMA 3CDWA 3FJ2A 4KLIA 5D4OA 4M63A 4YHHJ 4AXJA 1WWVA 4WYLA 1X5TA 4HWIA 4BQLA 4EP4A 1FXXA 2R2TA 2CPRA 1ZRNA 1KBRA 1NXIA 3QLHA 4KLLA 2RQCA 2EZYA 2V8PA 4O3NA 3QESA 1EKSA 5ALLA 4IO9Q 2KRBA 5C2FA 2MTLA 3N6LA 4OI0A 1FFVA 1S0NA 2P6SA 3NWGA 3PCOB 1VIOA 2Y1JA 5KT6A 3CCES 1URRA 1HLWA 2OZMA 2ZUBA 5LMNJ 1AUSL 5DS7A 1QQ6A 4FZZA 3RR7A 2WBNA 1NSPA 3VQCA 1P9YA 3FAHA 3K7RA 1FCAA 3IBCB 4LSNB 4WCEL 2ILYA 1KVJA 2PBDA 2MQLA 3QMLA 4M9LA 3NNAA 5D46A 2WZ1A 3FZBA 5J2PB 2PFFB 1NJWA 2RJZA 1Q5YA 1JJ2R 4MDAA 4QZ8A 2P9LB 3NASA 1AYEA 1RKIA 1Y0HA 2Q36A 1JWWA 4PHEA 5D0HA 1OH6A 1VBZA 2NUHA 2E5LK 2E6LA 2OI2A 4P75A 2BHNA 1AFJA 1LAVA 1RACB 1BWEA 2A3JA 2EKNA 3Q8VA 2R18A 4JI3J 1M6YA 3SQIA 3ET6A 3FFKB 1ZQAA 4USTA 4TY8B 2N7YA 3MCMA 2BACA 5F8LA 2DRBA 4GY2B 4OYPA 2LDYA 4JK1A 4YXMA 4BC4A 1RUSA 3D3BJ 1GTHA 3NF6A 3A2FA 4C8MA 2GHVC 4HUEA 5EGYA 2LM1A 1NGBA 4PG8A 4CEBA 1YRXA 3OGUA 1GLEG 3T7ZA 1ZQNA 1M1GA 3OBYA 2DNNA 2PMZF 4LIWA 3EN9A 4LVNP 5JUMA 4QNLA 2NSBA 4EGLA 3KJNB 3VZIA 4JEPA 2F1HA 4DL3A 3W7BA 3QERA 5CYMA 4C98A 5AJ3K 2UUCJ 2P9LA 4X4NA 5ALDA 4WYBA 3HT0A 4I1TA 2KSOA 1BI4B 2KIWA 3LDSA 8ICPA 2KG0A 2HHUA 3NGYA 2BRKA 1QVFM 3AO2A 1RWMB 1X5SA 5KRSA 1WC0A 2WUSA 2GBZA 5CXTA 1S1XB 1HUZA 1DTTB 2NZCA 2PYJA 3DLKA 3SAHA 5JU5A 4AHVA 4RUAA 3H08A 4KJIA 3VCDA 1X0FA 4PXBA 1K73O 3FDSA 2CQDA 4F72A 4B17A 4Y00A 4OJPA 5J0PA 2Z2YB 3BH6B 1UTAA 1SB6A 2AHOB 5HANA 2CJYB 5FLXY 2QG9B 3T1HJ 5KG4A 4PL8A 1TU0B 5B0DA 2DHSA 2A19A 3WUHA 2A1JA 3DDHA 3EPGA 2RHQB 4DCJB 2LSNA 1A7GE 3BQ1A 3I0SA 4Z4GA 1YZ7A 3NMRA 3NCRA 4CEEA 3LWLA 1DGJA 3HSTB 1NZAA 1P8GA 3NVZA 2HQCA 1TUYA 3BR8A 4DOBA 2HNYA 3CCMS 3BY5A 2ZD1A 4DQQA 3FEYB 3VGKA 4RW4B 3FMBA 1ASVA 2Y3YA 2W9CB 3LPTA 1DY3A 1YJUA 2YHYA 3MR6A 1FEEA 4J9RA 3EMTA 5DQIA 5KFJA 3FEXB 4MYTA 2CH6A 4LFAF 3SQ2A 4MFBA 2PO4A 5J2QA 1EP4B 2QEXS 1PYTA 3CJ9A 2K8GA 4KMUA 1Q7LB 2QL9B 2C22A 1SV5A 2V7ZA 3L5KA 2HHVA 3U02A 4UB3A 2VKZG 1M5VC 1R0AA 1Q7YT 3KWGA 1X4DA 2EC0A 5JS1A 3L2QA 1FNMA 2EW9A 2FF3B 3EE9A 1IV8A 3CCUS 1X4CA 2XLJA 4QWBA 1KFTA 5M1QA 4F5OA 5L1LA 2G2YA 1PAEX 1HD1A 3GDQA 5AKGA 2QLBB 2G8VA 4Y2XA 3KIOA 4CNYA 2QA2A 2WW8A 2WFAA 3ITHA 1C0FA 3I6PA 2Q0ZX 2P9PA 4EYHB 2A41A 1H2UX 2KV2A 3O5BA 4FZYA 2FHJD 5AM4A 2WCXA 4K4TA 4JMUA 2KVCA 1WF2A 2FJDB 1TKXB 1ZZNA 1BC6A 4QZ9A 2QL5B 4LF7K 3OTDA 2FMPA 3B6OA 3NH1A 1HQUA 1A0OB 4KLHA 2G09A 5EDWA 2UUTA 4WF9Q 1YJNN 3OBWA 5A2QY 1SV0C 1NJYA 2GGPA 4USWA 4M9GA 1KVAA 4DPXA 3D7EO 2WF8A 3MR2A 2VFSA 4OX9K 4DX7A 3KLHA 5SZTA 3ONNA 3POTB 4DR5K 4CRXA 2AZ3A 4K4VA 1RT4B 1CULA 2PD1A 3BDPA 2NRHA 3J80O 4FLWA 5C2DA 9ICGA 1HFEL 3GV7B 2JWKA 2HHQA 3HF5A 4B9SA 3P8BB 4H03B 2VA2A 2ASYA 4KO0B 5BPNA 4NLOA 5C24A 1BVSA 3OYKA 4DR1J 1HUOA 4ZVHA 4YB7A 4LMZA 3R6GB 4CK3A 2Z4PA 2CQHA 1NGAA 5AKKA 1LOTB 1K0TA 5AKYA 3WK4A 4RWTA 5LSLA 3C15A 2XS5A 1ULRA 1S9GB 3UNYA 4CE9A 2KU7A 4WP8A 2XCAA 1FJGK 4TXSA 1XN9A 2Z57B 3QFPA 2I8EA 2MKIA 3D6RA 4O4RA 2N4CA 2CQ3A 4JHDA 3HHNB 4RKUC 1R0BG 2CPHA 1X5PA 2K8CB 1PIEA 2ZC3A 2IRXA 3CXCM 4I2QA 4IUFA 4HCBA 3KHLA 3C1ZA 2EZZA 2DGQA 2GIFA 2DVIA 1IBLK 3EGZA 1J27A 3R6LB 4CJ3A 1VRUA 4RNNA 5HJYA 1VSDA 4GKJK 4OZNA 4FJXA 3QIPB 3MTKA 1SZ2A 2WBMA 2MUTB 2ZM6J 2W2NP 2E2NA 1IBKK 4DR7F 1B0TA 2H4WB 5AZJB 5KAKA 4CZHA 5LJ5Y 4ECSA 2DKZA 4M2YA 3BS7A 3OXGA 1DLOB 4KHNA 1J6ZA 4D3HA 2XBPA 1FFWB 3MM9A 4B1YB 2BANB 2H65B 3T3FA 5HP4A 1BCOA 4BC9A 3RMBA 2HHHK 3EZUA 4NYFA 2E1CA 4WXWA 1VQ4S 3LVWA 3CIZA 4Y2VA 4KPCA 4CZFA 1FWPA 4KC5A 1U2CA 2RH3A 2D0BA 5C0YA 2XSFA 4QZBA 4BRAA 3PY8A 5H2FU 1P27B 1UOCA 2YPZA 3R6MA 3AQPA 1BPDA 1KAXA 3WDOA 2XIDA 3PYDA 3V6DB 1ZBLA 2IAJA 3H0MB 4PG5A 4B9UA 2RUGA 4LRBA 7ICMA 1TR0A 1MWZA 5AI6A 4QZVB 1M0SA 4NE9C 1BA0A 5IM0B 3OTQA 5B5EU 4BRCA 2O8EB 4M9HA 2EWSA 3NCQA 1X4HA 2HBKA 3HO1A 3D6FB 2H1YA 5DDQC 1CSJA 2UUAK 4DR1F 4I0WA 4JKEA 2PMHA 2JH1A 1UWAA 3IM8A 3MDAA 3WXMB 1X4AA 4DZ6A 3KKRA 3DV9A 3ISZA 3UW1A 3HM9A 1C6VA 5D0EA 2YQEA 1HWIA 3H2LA 3PRBA 4KLJA 4DPOA 3VQSA 2R7TA 1FA0A 4LRCA 1S1XA 1IR0A 1KVCA 2GO7A 1TP7A 4Q43A 2VG7B 3OHAA 4KHPJ 2UVVA 3WNHA 1ZQGA 3JTNA 4P2SA 3GBTA 1LNQA 3ZSZA 4RG8A 2AGOA 4Z2XA 2PIIA 3A5MC 4NMLA 2LEPA 4LIRA 1EQYA 4FK4A 5DG8A 3X3UA 3W66A 2YB1A 3KMQA 2WVCA 5BR8K 1ZA1B 4Y2KA 3TWHA 3HHEA 2HZVA 3L2WA 3ZSRA 2EFNA 1U1PA 3MTJA 1VK8A 2DR9A 4CTAB 2FY1A 2QM1A 3QB0A 4L6V3 1SC1B 3CUNA 1BA1A 4RQNA 4CERA 2YJFA 2OAUA 4ILLA 2KIVA 3PSTA 2HFOA 2ZH5A 4AH9A 2P2CB 3HPHA 4QJVA 3O0FA 1KC8T 4ISEA 3V9WA 1RDUA 5KL1B 2MLYA 8ICOA 1IM4A 2HHSA 4ITSA 2QB0B 4N47A 1NU0A 2UUWA 2HLTA 3BUZB 4NXMJ 3UMBA 3RYLA 4WBFA 4RUCA 5HROA 2HAIA 3V9ZA 4FWMA 3PJXA 5KFQA 4H0VB 2V51B 1ZYQA 3UQSA 3GB0A 2QI2A 3MMCB 5AXLA 1XNSA 1YUWA 4C80A 1N48A 1AW0A 1DOQA 1RADB 4X65J 3IR6B 4Y3CA 4KB7A 2O1PA 4DPYA 5AI0A 2JRZA 5DBAA 3UR3C 3KLEA 2KG1A 4B6JA 2M0NA 3WQTA 1JLBA 4QPXA 3CCMN 3UMCA 3S8SA 1TMMA 3MMAA 3RFAA 1NNDA 2ALYB 4IRDA 4JB8B 3CM6A 1FFGB 2P9CA 3ID6A 4LF9F 2PY5A 1R8HA 2YHBA 4PR6A 3W9IA 5E3QA 2F96A 3OR1A 2G5IB 1XC9A 3C14A 4KAZA 4HVZA 1KRPA 2G5HB 4F7VA 2AJ2A 4K41A 2DY1A 5IC4B 1VHXA 4K4GA 4K2JA 2VODA 2NYIA 3L3FX 4NLZA 3DRPB 4DCHA 5HLFA 4QYRA 2OFGX 5F8GA 1U6FA 1K47A 3VQ8A 3W65A 2FC8A 3E01A 4LFBF 1N34F 4WQ5A 1IKWA 4X66K 2HVDA 3PSFA 4GLXA 2W4PA 3ICXA 8ATCB 3PM9A 2ZHBA 2MGZB 4ZITA 3I55S 1N5SA 4ZP7A 3U27A 5AM1A 1KLNA 1W0HA 3MI7X 3T5HA 4M0AA 3ZX0A 3NS1A 4WK3A 3DWLA 3NKYA 3V5RA 4EK2A 3MEEB 1S4EA 2CGLA 3VOVA 2GQQA 5FRMA 3ENQA 4ETZA 2NO5A 4U7UD 3JS9A 3GJTB 4OJRA 2I5JB 3DGPB 3L7OA 1HNVA 2HBMA 4ZVEA 2HI0A 1YRTA 5E33A 1U2RA 4LVOP 2JLFA 1GT8A 2X3DA 3SLCA 3LYSA 1FT8A 1UEUA 2ADCA 4CNZA 4QS7A 2J4RA 2HEKA 3CW2C 5AQZA 2ZDPA 5JRTA 2EHGA 4JI7K 4BUGA 1P9QC 2CQBA 4CRJA 5J2GA 5JVHQ 3D0GE 1N0UA 2O8CB 1WUUA 3JXOA 3TYTA 2JSXA 1WSFA 1QSSA 3RBEA 3LGHA 5KFFA 4YMNA 4XEIA 3HRDD 3RJMB 3N5BA 3JPPA 2KZ3A 5E2QA 1D4XA 4N77A 3HW8A 2W40A 1HKCA 4EAHD 2ZXIA 4AXIA 2Q2RA 3HVTB 5J2KA 1Q8LA 2LYHA 1HIYA 2WONB 1PILA 3F2BA 4YR0A 2GAHC 3IR5B 4ES2A 1U1QA 3K57A 3GJQB 5CYJA 1N33F 2JXJA 3ETLA 1S6UA 2AW0A 3VQ6A 3G96A 4IG0B 2VCPA 3Q8SB 1CZ9A 4N56A 3SJJA 4KB0A 3GR1A 2HK3A 1SKRA 5KFUA 5LMUJ 4AL5A 3HYFA 3IG8A 5AI8A 2ZH9A 2QWQA 2V6AA 1ASUA 2BV3A 1BQXA 4UF4A 1N4LA 4NLDA 1SJRA 2ZM6K 4ZLPA 2YI1A 3GPAA 1RXWA 3AODA 5LSRA 4M5JA 1HBOB 1QY7A 4OLBA 1NDCA 2DYAA 2POKA 3VQEA 4JI2J 1BD6A 5HRPA 4KGKA 3G82A 3H5XA 1C2PA 2ZH2A 2LQJA 4KI4A 4IR9A 1LKYA 2KXFA 2XULA 4IZ9A 5J2QB 4NLKA 1Z05A 4DG1B 2ESEA 1J9AA 1O51A 1DQ8A 1JLQB 4DTNA 1KAYA 1Z00A 3IRXB 1REVA 4M3UA 3EW9A 3E01B 1DFDA 3Q89A 2R7VA 4ZPAA 1REGX 1S1UA 2AJ0A 3ULHA 1DTTA 4JI4F 2JH3A 2LMIA 4DPTA 1UFWA 2RQ4A 4JI6K 4HI2A 2P35A 3AJDA 1IV0A 2ZZNA 3OBIA 4CHOA 4QOZB 1SJ3P 3F44A 2Y1LB 4JWMA 4YMOA 2CA9A 4M5DB 4AQYF 3MR3A 4GO7X 4B9NA 5FDLB 2N7CA 3TX0A 5CCLA 3VEYA 3ED5A 4JKGB 4FFDA 2F44A 5JJBA 1BG3A 2LA6A 3TSPA 3UKUA 5AE1A 3QATA 1WEXA 3D6JA 2PZSA 3RF9A 3PR5B 3HX0A 3UFCX 3LQVA 3A3NB 1QAYA 2E1PA 1KKHA 3OYGA 4OYOA 1VQSA 5BN9A 2AEMA 1OSCA 1V6HA 3CJKB 3ZTOA 5DB6A 3QYYA 2WVEA 4UUWA 4GVEA 3MAQA 3KG0A 5HMWA 5E3CA 3VC8A 3N9UC 2AP1A 4JI5K 2YMMA 3DXMB 2YNIA 3K5LA 2XO6A 2LHTA 2F9WA 2ZH8A 3KOAA 4KHPK 2YWGA 3BF4A 1C20A 2D0PA 1XO1A 3NGIA 2QN6B 1PK3A 2H5EA 3T79A 3IN5A 2CYYA 3UN2A 2E8OA 4YB1P 2OSQA 5D4BA 4TLQA 4EFHA 4U8VA 2XZTB 5CE3A 3DDIA 3M05A 3IBFB 4TNOA 4FYWB 1A9NB 2HFVA 3NGKA 1ZQSA 1U24A 1B64A 3CCTA 5M1KA 8ICNA 3TABA 3UD5A 3HHLA 4F91B 1JLEA 1HIWA 1R59O 3VQAA 3ZZ0A 3ELHA 2MXYA 2UU9K 4O4GB 2AT1B 3T69A 1KAZA 2HHXA 1E4GT 5GTHU 2NRTA 4FJJA 3W8GA 3QNMA 4J9VA 1Q18A 4RBTA 5AICA 4JRQA 4BRLA 2E2OA 4JN4A 3CCSS 2V34A 2E8PA 3WNGA 4E3SA 5M1OA 5DG7A 4B8CA 2ZH6A 5HN0A 2B8PA 3N97B 2PFPA 1UA1A 2G8FA 5HL7L 4O5FA 4DR2K 2LPEA 1BLUA 2MZQA 2FJXA 1BPZA 3DLKB 5E41A 2IC3B 3AQEA 1JLQA 3P6YC 1YJ9S 2PA8D 4DSFA 4TU9A 4CLFA 2OPRB 2ZIWA 1Q79A 4FJ8A 2QA4G 3DRRA 1HW8A 5A0LA 4IJAA 3UKUB 4B9TA 3IP4B 4O5KA 3OYBA 2BKOA 1KFDA 1ITGA 2IHNA 2DPNA 4U95A 3NMAA 1RT1B 2G8KA 2R7YA 1BO5O 3FUYA 4LT6A 3EM1A 4GV6A 1CJTB 1OVQA 2DNKA 4CDIA 3Q2TC 1I3OB 1IBMF 4B3RF 5ETLA 2Q6CA 2GGPB 2VB6A 2MSNA 3GL1A 1JJCB 3J7ZT 4HHUA 3LZIA 5LMNK 2NQPA 3N28A 2IVFB 2LM4A 4USJC 4EHTA 2FJEB 1HQUB 2R8JA 3Q86A 1OH8A 4NWIA 2M88A 5LJ3Y 4KN7A 4U6PA 5HLFB 4FPAA 2IAJB 4B3SF 1FI4A 2K2PA 3TX8A 5MLCV 4ED3A 1OPZA 3CCJS 4JK9A 4CD1A 4OJ5A 1PCAA 4DOAA 3H2VE 3MXMA 1ZXOA 1LW2B 3UQ0A 1HWJA 2Y8YA 3C14B 4A48A 4FJIA 4DU4A 1SPBP 4M8LA 3OHRA 1ZQHA 3VTHA 2YMPA 4Q44A 3CJKA 4X4PA 4I7FA 2E5LJ 4GVBB 4DLEA 1NKBA 1HPZB 3N7PD 2JFDA 1KFSA 4DI6A 4E7HA 4RPYA 1R31A 4GVLA 2CQ1A 1T94A 3VESA 3CFRA 1SXEA 1J5OB 5ADXA 5B0BA 5KFXA 4JV1A 7ICRA 1SH2A 1XQIA 2EG2A 1S9FA 1IXKA 3QU4A 4IXCA 1DZ5A 4CWBA 4DCOB 2BGWA 5I3QA 1RTDB 1DARA 3QEIA 1BWVA 2HLUA 4J9UE 1WSJA 5FLXU 2ZD1B 5K9FA 3O44A 1XSPA 1IJEB 2BDUA 3OS1A 3RB3A 3VAJA 4ACOA 2OCEA 1HL6A 3M7VA 1QAJA 5HVHA 5AKEA 2EAPA 4JI8J 1N62A 3SPYA 1YJWN 1TAMA 3W5YA 5BYSA 3I56S 3UE2A 4OD0A 5CY4A 4FZXC 4IFVA 4R25A 4CLPA 2PXIA 1ACMB 5L9NA 4O0NA 1FKOB 3JQJA 4CJQA 4W5RA 3U6FA 4BWMA 1M90O 4CJ7A 4KH5A 4FWKA 2N1RA 2DNMA 2GHWA 5EE9A 2MQ8A 2RAQA 4WQ4C 3O80A 1RT1A 4OFZA 3POTA 2YNGA 5DLGA 3I4HX 3PTWA 5ALJA 3H42A 4EBEA 1S49A 1VQ7S 4BGAA 2Z1JA 2OP5A 3D2EA 4JYAK 2M4MA 3E1YA 1EXNA 2NR0A 3U7JA 1GAOA 3KK7A 3NUQA 4UOHA 2B0CA 4LF1A 4CGJA 1IUJA 4N8NA 3G87A 4DWIA 2F8SA 4NLSA 2J0XA 1V5IB 3S6JA 4CHYA 3WXLA 5ALYA 4USIA 4I29A 3HX9A 1RA7A 3N7RC 4WFNL 4BG8A 1EKEA 2V67A 4FWSA 1LB2B 4LH4A 8ICCA 2E7VA 4L76A 3ISCA 3I33A 2XSJB 1JNZB 1VQ8S 1L8LA 1X66A 3SJHA 1YSJA 3BSOA 2FTRA 1FKAF 3CCQN 4AP9A 3PX6A 4DTSA 3CJSA 5KFWA 4WFBL 5E5NA 5KL8B 4NASA 4TY8A 4CVNE 3M4XA 4ZVQB 1RCXB 2J0WA 1HNXJ 2D3O1 4DUZK 2IRUA 1GLLO 4M6WA 1NLVA 4TQSA 4EIAA 5I3UA 4TUQA 4FS2A 3OXFA 2YH0A 4NLYA 4DEZA 2CZ4A 2B4OA 1F9FA 5ETSA 2NRRA 3ILJA 3SBGA 2W42A 2A6MA 3KXDA 3V1RA 4OKEA 4WP3A 1QZ6A 4M95A 3JS6A 3EPIA 4HT7A 3HSZA 1UHUA 2QARB 3GIKA 5ETKA 4A8QA 1PVRA 2O8BA 2BGGA 2LU2A 4LBPA 5KFDA 4DSLA 2QLFB 3ZTQA 1UFLA 2HF4A 3QSYB 1PVQA 1ECWA 4CK2A 2CN1A 3CFPA 4NA2A 3SI8A 3EDQB 2YQ1A 3CCQS 3TQ1A 3ZSYA 1ZQKA 2DEIA 4LZGA 1U8WA 1RM6C 1HNIB 2GIQA 1C0UA 4BR4A 1K9MO 5J1EB 8ICMA 3P31A 3WKAA 2APOA 2ZJPQ 5AQQA 3UN5A 2OMOA 2HSZA 2IYGA 3QGPA 1VR6A 4A46A 2R2RA 3QE9Y 1WN7A 1RA6A 1NK5A 2DKXA 3DU5A 2N3LA 4ZKAA 5EX3A 1MWKA 3U9DA 3DDNA 5CYQB 2CPFA 1XNQJ 4CH0S 2W4DA 1IO2A 5LMUF 4YXJA 4CO5A 3QU7A 1WWUA 3ZSWA 1KDNA 7ICGA 2WSFC 2QW9A 4ED1A 4W92B 2A18A 4LJMA 4U67L 1TL1A 4WFYA 1Y3KA 4LF6F 3GMGA 1RWPB 4RPZA 2E1FA 4F2SA 5LSOA 1HKAA 3U3GA 3VQ7A 4DMNA 3NRWA 2V2ZA 2ASLA 2UVRA 3VEVA 3MM7A 1GFWB 1E6YA 5HMYA 1S0VA 3L3CA 3R9KA 5DQGA 4LFCJ 2GAGC 1B4FA 5D3GB 3GWCA 3CO0P 3SUPA 1F5BA 4H0OA 1LQ9A 4NCGA 3CEDA 3CJ3A 4Z6CA 2AZ1A 6AT1B 2B3TB 5ALEA 1Z1ZA 2LI6A 2DO0A 2F9JA 3BJYA 3O08A 4XUSA 2D7SA 4PJ0U 1NEEA 2JMGA 1TKTA 1BY9A 5HMLA 3HI0A 4E1NA 1RHRB 1SBRA 2Z2LA 4HLBA 3GE9A 9ICXA 3VF4A 2XG8A 5AQKA 1HQEA 5DDOC 4B3TJ 1NH7A 1SH3A 5EHHA 2RUSA 5KG7A 3CF5Q 2AYMA 2P1JA 3U3YA 1Q8IA 1URJA 5L46A 1HNXF 4PPXA 4M04A 4FYDA 3AU2A 4MKAA 5JICA 4UATA 1Y11A 4K4HA 2ATLA 2X74A 2ZJRL 3QFUA 1VHIA 3FZ2A 4DX8H 3BQ2A 3G71S 3H3OB 4BE0A 1ZAVA 4O44B 3AO1A 4W5TA 1DK2A 2HQDA 2NZ4A 3OTOF 1RT5A 3OR2A 4JI5J 2IDEA 1YJVA 3QUTA 3IP0A 2E5SA 4ECYA 7ICJA 4KR0B 5HMMA 3R1XA 3AAPA 7ICEA 1ZBFA 3NAIA 4UY85 2BANA 1H73A 1HNZJ 3NF7A 2VC1A 3FZMA 4IYQA 4HI1A 5AXMA 3ZSOA 3HKZD 4NL9A 3V9XA 1H0HB 1XR5A 4YDDB 3T9ZA 2GCFA 3QEXA 4DTPA 1N33K 1Y00A 4JI6F 5J2NA 1ZQRA 3UR0A 5AM5A 2J76E 5CABA 3A8KA 7AT1B 1V97A 1TMJA 3SUNA 2P5OA 3PHTA 3EJMA 2QK9A 1TUGB 1L3UA 4Q7AA 5EVZA 3M1FA 3SCXA 2CJXB 3EXCX 3VGUA 3PIOL 1ZETA 1Q81O 4ECVA 1L7NA 1WAFA 2L9NA 3MR5A 3K0JA 3D67A 3R5JB 3C23A 1WORA 3CD0A 3NEKA 4DTUA 2QWRA 2B9XA 1RCHA 1HI1A 2GQ2A 1ZQFA 4CZCA 3KDOA 4FJ7A 4TY9A 1DKGD 2F8LA 1HUXA 5J2MA 3RW7A 4DDFA 4Z7YA 5K8NA 4ID5A 1EX4A 1VQKN 4N76A 3EXYA 1Y10A 4WXOA 4XK8C 3FSIA 5DGAA 2NS1B 4XH1A 3OS0A 1NKCA 2CVEA 4M7XA 1TKDA 5G0RA 2VFUA 3K5OA 3BV8A 4PHAA 2D8CA 3J81Y 3OPXA 3VVUA 2YV0X 3RRGA 5HBMA 3TZWA 2D4WA 1YDLA 5I42B 4USHA 3HZEA 2MZJA 1MLAA 4M7YA 1RG6A 2W04A 1RNHA 2XI3A 4QU7A 2V4JA 1NZ8A 2IJRA 1NSKL 3OXLA 4IBNA 4YUDA 1R6VA 1Y3JA 2HPUA 5E3PA 1B43A 1I39A 3DLEB 2W2PP 2BKPA 4G9BA 3DRSB 3S7RA 1OO0B 1RT4A 1R89A 1Z4UA 2XMKA 2YKNB 3H6EA 3Q0AA 2IRYA 2KM8B 2LYAA 6FDRA 3QEAZ 2RHSB 3NVVA 2ZUDA 5IIJA 3DHWC 2E1EA 4FKXA 5C42B 3GZFA 1RDBA 3IFEA 4KLEA 2QB1A 2DGWA 3KHRA 1SH0A 3ZT2A 3MC1A 1N60A 5ETNA 1QVGM 2KT3A 4E7LA 4IEIA 3DJCA 3CMQA 1FJCA 2V4RA 3HILA 4DFDA 1ZS6A 3JSRA 3CQYA 2WOMB 2MJUA 1TV9A 5IXUA 4I2QB 1EQMA 3LK9A 3L7PA 2ZXHA 3HXMA 2C2DA 1WEZA 5H9FK 2NRVA 1QQ7A 1NU4A 2VFVA 3IAM9 3DRSA 1RAIB 5IWAK 2HNZB 1JXVA 2ACYA 1S8OA 1MROA 2F2AB 4OKJA 5KT7A 3DLLQ 2VDIA 2F3JA 1EB0A 1VQON 3V4MA 4P71A 2D74B 2ZIXB 3R3TA 3NS6A 3QWPA 3HWTA 4LFBK 4M63C 2ZTDA 4H4MB 4DTRA 3CIMA 3DLEA 2MYFA 3GFXA 2EPIA 5H9FJ 2G0AA 3RAQA 1SIZA 1YLXA 2Q3SA 2DNZA 3M6WA 3DGVA 3H8YA 5EXWA 2YH1A 4D3GA 3VMFB 2YWFA 3EUB2 1VHFA 1N52B 3WC0A 1RWVB 2P5GA 2C1EB 4ZVOB 2HW3A 4NXNK 5HP1A 4Q45A 3TWZA 1SJQA 1U26A 1JIHA 3D2NA 4QPTA 4K4WA 4MJKA 4UB4A 2UXDJ 1TUWA 1WKJA 2L41A 4KHRA 4A61A 5B0FA 4IQUA 2FJ6A 1XS9D 2GC8A 3D45A 1HNWF 1KR4A 4JI6J 1AB8A 2CPDA 2B9EA 1WHWA 4LR8A 3MGIA 5IV3A 5J0RA 3VQDA 3C95A 4FWQA 2J0QD 4ELUA 3RB6A 2K8BB 2HRUA 1I94K 3KD5E 1OIAA 5IT9Y 4AM6A 5IT9U 1QE1A 4I2HA 2MHEA 9ATCB 5BRDA 1YG0A 3EGVA 3THXA 4QW8A 4Q0BA 4DV2K 3R97A 4BJQA 1RYRA 1KLMA 1JCFA 2MU2A 4OV1A 3V6HA 5GADP