4DSLA

Crystal structure of fragment dna polymerase i from bacillus stearothermophilus with duplex dna and calcium
Total Genus 191
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
191
sequence length
579
structure length
579
Chain Sequence
b'KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase
publication title Biochemical and structural insights into the fidelity of bacillus stearothermophilus DNA polymerase
rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 191
structure length 579
sequence length 579
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4dslA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4dslA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dslA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4dslA01
4E7LA 3UPQA 4LSNA 3QZ8A 4I2JA 3H8JA 3TAQA 3L3UA 4DQIA 3HL8A 3U3GA 2J6UA 3ALYA 4O5EA 2QKKA 3V1RA 3PUFA 4CJPA 3C5GA 4AHTA 3H4BA 3MXMA 5KTQA 2JEGA 1VSJA 2ZUDA 2IHNA 4IG3A 4TSXA 4L8RB 3VA3A 4RNNA 1LWFA 4CGJA 4BXOB 4RPZA 1ZBIA 5CZ1A 1C1CA 3ZT3A 1RT3A 2ZQBA 3TFRA 4I2BA 3HPOA 1A5XA 3SUPA 4ED3A 5KFZA 4TURA 1RBRA 2HHWA 2C2RA 2FBXA 4RT2A 2P51A 1QSSA 3BQ0A 5IINA 5KFEA 3SNNA 2G8KA 2PYJA 3RMDA 4ELUA 4CIFA 4PGXA 4B08A 4HHTA 5KG7A 2I9GA 3NF7A 4KO0A 3SV3A 3L2WA 5DQHA 4CHPA 2BANA 2OA8A 2HHXA 3QE9Y 4HTUA 4M04A 3RH5A 2HHQA 3E2EA 3KLIA 1WSHA 4CJUA 3PX0A 1HYVA 3EY1A 2AGOA 3DLBA 7ICJA 1HRHA 4FJLA 5KFAA 4J9LA 4YMNA 4J9SA 4QWAA 1I39A 4RW7A 1JXLA 3DOKA 4J2DA 1RDBA 2NUBA 3U3YA 4NM1A 2AQ4A 3DM2A 2H5XA 4HCBA 1JLQA 4DQSA 4QZAA 3M8SA 1JXBA 4MF8A 4KTWA 4I2CA 3BQ1A 3GIMA 3MABA 3C5FA 4CJVA 1HYSA 3ISNC 1ZQFA 2FMQA 1BPYA 5HLFA 2HHSA 2ISPA 3RJHA 1QLNA 2W9BA 4LH4A 3S3MA 3ZSOA 3IAYA 3TQ1A 4YCXA 8ICUA 3AA5X 3LAKA 3VQEA 1SZPA 2X6NA 4EP4A 4DFJA 1FKOA 2BPCA 4M3WA 4YVZA 2BHNA 3NGZA 1RBUA 3QO9A 4P4OA 4CJ4A 2I1QA 4CJRA 5J0PA 4O3PA 7ICGA 2Z1HA 2JEJA 1SV5A 3H08A 2RPIA 4R5PA 5CYMA 5KFKA 3DRSA 2ITGA 3RB0A 4CJEA 4LZDA 1U4BA 2WOMA 1ZQPA 5TZVA 5KFXA 3E01A 4B9UA 5CA7A 4AHSA 3AVGA 2UVUA 4BDZA 3K4GA 1G15A 1KCFA 1KDHA 3KLGA 1S1XA 3LAMA 4DL5A 3H8WA 2E6MA 4CJFA 4FJ8A 4QWDA 1TL1A 3T5JA 2Z1GA 1ZQMA 4E1NA 4DFKA 3SUQA 4DL2A 2JZBA 3ZD8A 4RQ5A 3OHBA 2GV9A 3EPGA 3LALA 3OS0A 4FJ7A 3HK2A 5J2MA 2KW4A 4IFVA 4I2EA 1T05A 4RPXA 2XCPA 8ICXA 4C8LA 1RDCA 5J29A 3TABA 4BE1A 3IG1A 5D49A 2ETJA 3DLKA 4B8AB 1RTJA 4RQ1A 3O3HA 2D0CA 5D4BA 4FM0A 1RT4A 1ZYQA 3C2KA 5J2IA 1LV5A 4ED6A 3K5NA 4Z4CA 1GOCA 4CEFA 3JPRA 2YKMA 3OYJA 3PMNA 3C2LA 1S6QA 4CJQA 3PW7A 5DDYA 5CZ2A 2R8HA 1K1SA 2PZSA 4FZXC 1KVCA 4CJ5A 3KD5E 4CERA 3DOLA 1L3UA 1RCHA 4J9RA 4Q43A 4MFBA 3PMLA 3QESA 3NGIA 1AROP 1S0OA 4O3OA 2D5RA 2KZ3A 5JS1A 1ZQGA 4CEOA 4MEYA 3CM5A 2V4QA 4O5CA 3A2FA 4EBCA 3VQ5A 4DQPA 4UB1A 5KGXA 3OYHA 2W9CA 5KT7A 4QW8A 5CWRA 3JPPA 4JK1A 2XY6A 1ZQZA 2EX3A 1ZQDA 3AV9A 1W9HA 4CGFA 3P83D 2OPQA 4ECZA 4RG8A 1KVBA 4ID1A 3V1QA 1RBVA 2G8HA 4ID5A 4H4MA 2QXFA 3OHAA 3LWLA 2WONA 4GC7A 4C8NA 4TUSA 4FXDA 4F5PA 1REVA 1ZQQA 7ICIA 2VG5A 1A5VA 1RZTA 1BPEA 2FPLA 4DF4A 3H8SA 5J2KA 5EOZA 5F9LA 3HYFA 4PH5A 2MUTA 4DWIA 4ELVA 4O0IA 4FJ5A 3GV8B 1S97A 1QS4A 3AO5A 3V9XA 2FBYA 1TKDA 1HYZA 4W5RA 4M45A 1VRUA 4DTOA 4OKKA 4YMOA 4RQ7A 4E19A 8ICLA 4KB1A 1MQ2A 3RMAA 3MGIA 1ZQJA 4NLZA 2DFFA 5KGWA 4DU3A 3LP1A 1SUQA 3K5LA 5EU7A 5IIMA 1YTAA 4GLXA 3ASMA 1JKHA 4DL3A 4PY5A 3B0YA 5KFQA 3RAXA 2FPKA 4JRQA 5KFLA 1S77D 1TK0A 4IRCA 4DL6A 5CY4A 2OYQA 3MEDA 4K8XA 4FJ9A 4XRHA 2BQRA 2DPIA 5DLGA 5KFGA 4J9NA 3Q8SB 4B9MA 4Q45A 3NHGA 4O3NA 3RB6A 2KZZA 1CXUA 4J9PA 1TV9A 2A1JA 2F1HA 4QZCA 1BIUA 4QW9A 3QIOA 4P2HA 3G6YA 3HM9A 1SKRA 1TGOA 4KHSA 3RB4A 1RT7A 3MR6A 1TAQA 4CF1A 1A77A 3VQPA 4CF8A 3VA0A 3MBYA 2W9BB 4M3RA 4QCLA 4CFCA 1J53A 7ICPA 4F50A 4NCBA 1VSHA 4QWEA 1B9DA 5J0XA 1Y97A 5HP1A 1LWEA 3K57A 8ICRA 3GIKA 1ZQKA 3ZSQA 5J2QA 1RXVA 5EWEA 1B9FA 5DLFA 3C1ZA 3H40A 3BJYA 1GOBA 3NH0A 4M9LA 3GIIA 1HNVA 2M9NA 4EYHB 9ICKA 4O44A 2E4LA 9ICRA 5C24A 4Y1CA 4I2PA 3AO2A 4AILC 4O9MA 1YVUA 4F4KA 3NDKA 4DQRA 5KFUA 1WSFA 4GC6A 1JLFA 5J2AA 4UAYA 1J9AA 3VQ8A 4O3RA 5EWFA 1X1PA 1SL1A 4RQ3A 4FK0A 1BI4A 3MR2A 4E7IA 4E7JA 2P1JA 1KFSA 3AVFA 3SQ0A 4OGEA 4AHRA 2JZBB 3AA3A 3SCXA 4ED2A 3ZDCA 4FLTA 3QEXA 3Q8QB 9ICTA 8ICZA 5KFIA 1WSIA 3OJSA 8ICBA 1HNIA 4I9QA 1ZQTA 4F91B 4M3UA 1KFDA 2IGIA 3HPHA 7ICKA 4RQ4A 3RRHA 4F5OA 4UAZA 5CR0A 2PXIA 2HVIA 4MFCA 4J9MA 5CHGA 2BR0A 5I3UA 5J2GA 2HHTA 4Z4FA 4ZTFA 4KHQA 2FMPA 4NLNA 3MEGA 1ZBFA 4NY8A 4CFBA 1D9FA 3TI0A 1X9SA 1WAJA 3AVHA 3IHQB 3TWHA 4YXJA 1VSMA 1ZQAA 5DMRA 2Q3SA 9ICFA 2OPSA 1L5UA 1D8LA 9ICWA 1RT1A 4FJHA 3AA2A 4I2AA 3GQCA 1I3AA 1C7YA 4UQGA 4FJJA 4FZZA 1ASUA 1VSLA 4QZBA 4PGQA 4BWMA 4DOCA 4LSLA 2BKEA 4CJ3A 3V72A 2KFZA 1CEZA 2OZSA 2W9CB 1BQMA 3K75D 3ZSVA 1NK6A 1S0VA 4ECUA 3UXOA 1VSKA 1TL3A 4Z4EA 2VWJA 4J9OA 1BPZA 4IG0A 3QEBZ 4I2GA 4R66A 3N4MB 1C1BA 4O4GA 2BDPA 4CEAA 3MDCA 1NK5A 1JX4A 4RW8A 4FJGA 4CIEA 1FK9A 4IBNA 1BGXT 5E41A 1K6YA 4QZ9A 1J5OA 4IQTA 3S3NA 2HB5A 2W9AA 4LVSA 5KFSA 5J0UA 4PQUA 2RKIA 1BL3A 3DLHA 2MUTB 5DG7A 3NF9A 4N76A 3RWUA 4PHDA 1U49A 1ZBLA 4M9NA 4OKJA 4UBBA 3PW0A 2F1JA 4KMUA 4E1MA 3TR8A 3OYAA 3NTUA 2OWOA 3PO4A 3PW4A 4HUEA 3Q8PB 3GDXA 4M6WA 3T5KA 3KIOA 4JS4A 3TAMA 1TK5A 4XA5A 4FS2A 4IR1A 1C6VA 5J2DA 4M3TA 1SKSA 4NM2A 1DOQA 3PR4A 4F5QA 7ICTA 4NCAA 3WNEA 2C2DA 4KLFA 5L1IA 3LDSA 4EYIB 4KI6A 3ZDAA 2IC3A 5DDMA 3QINA 5FRMA 4KTZA 1ZQEA 1XU4A 3PW2A 7ICQA 3MR3A 2A1JB 4DS4A 3MDAA 1EETA 1ZJMA 3RBEA 3JPOA 2P66A 4HUGA 4DSJA 5DQGA 3ZCMA 1XO1A 3O4NA 4DU1A 9ICNA 2Y1JA 1XSLA 1ZQCA 1BCMA 5KG4A 1ZQSA 4YNQA 4P4PA 4E0DA 4Z6DA 3KKRA 3RJKA 3EWAA 3MFHA 1RBTA 3KHLA 3VQ4A 1N56A 5JS2A 1ZQIA 1JMSA 9ICOA 3QEAZ 1KSPA 1MQ3A 4R8UA 3OYBA 3RJIA 3D45A 1BPDA 2IDOA 4Z4HA 3NFAA 4IQUA 1U48A 5IIOA 1KRPA 1LW2A 3NE6A 4Z4IA 2BCVA 1TFRA 4CHNA 3LANA 2J6SA 4PGYA 3AVCA 7ICRA 4HUFA 4OKEA 3L8BA 4FM2A 3Q8RB 3TAEA 3VQAA 4K4GA 3MXJA 3ZSRA 1LAVA 4BDYA 5HMLA 1UOCA 4ZH4A 1RDAA 4HYKA 4F4XA 3N97B 4O3QA 3G6VA 1CXQA 2Y1IA 2A1SA 4N5SA 4J2BA 5HRPA 3LK9A 1S1TA 4YXMA 2ZUBA 1BI4B 5K14A 2IBKA 4FK4A 2UVWA 5KFPA 2Z1JA 4F3TA 4QZFA 3NAEA 4J2EA 3WNGA 3H4DA 4B9NA 1JLEA 4CJLA 2ZD1A 5HHIA 4B8CA 4DG1A 3SZ2A 1RXWA 3DLGA 3M9MB 5DKWA 4W5QA 2JEIA 1HQEA 1ZQOA 2B21A 4M47A 3HX0A 1TAUA 1ASVA 2VWKA 4FLZA 3RJFA 3JYTA 4JUZA 1HQUA 3KD1E 3GV5B 3AVKA 5HRSA 5KG5A 2PFPA 4FW1A 1S9EA 1Z25A 4RU9A 2YNIA 4DF8A 5KT2A 2IS3A 4Z6FA 2EHGA 3GFKB 1Y88A 2X74A 1HJPA 3MXIA 2GBZA 1BIZA 3NGDA 3CQ8A 4ZHRA 5DB6A 1S10A 4ECXA 1ZQRA 5J2CA 1NKBA 4UBCA 4ECVA 1RT5A 4GXKA 4I2DA 4RW9A 4YR0A 7ICNA 2OZMA 1IH7A 4YD1A 3HVRA 3LPUA 4F5NA 3RBDA 3ISCA 5KFNA 3M8PA 5KFWA 3VN5A 8ICQA 1X9MA 3P1GA 2WTFA 4IRDA 4KN7A 4ECWA 3V7LA 1ZQHA 3LWMA 3VQCA 4GXIA 4PA1A 4CGDA 2VG6A 8ICEA 4CIGA 1ZQXA 5L9XA 2R8GA 4KN4A 1IKWA 1NK9A 3I0SA 4QOZB 2C2EA 1MSWD 1ZBUA 1LW0A 5IILA 2I5JA 1EXQA 4AHVA 4J9KA 4F4WA 3AVJA 1C0UA 4OLAA 4CF0A 2HHUA 4EBDA 4AHCA 4F2SA 2F8TA 3AU6A 3ZSXA 4DSFA 3VQBA 1U9LA 1KFTA 1KEJA 1VSIA 2V9WA 1UT5A 4CJTA 2BGGA 3V9UA 4E7HA 4I9LA 9ICEA 4RNMA 2IMWP 5J1EA 2F8SA 4E3SA 3T5LA 2JEFA 1S9GA 3PX6A 5C25A 4N56A 2PI4A 4TQSA 1KLMA 4M6WB 5KG2A 1GOAA 2IOCA 3Q8MA 2XRIA 3QLHA 2ISOA 3HSTB 5KT5A 1N5YA 4R63A 3V9WA 1TVAA 3ZSZA 1WN7A 1IKYA 4TUPA 4FW2A 3AO1A 4OPKA 3LP3A 5KRSA 2ATLA 4FJMA 2P6RA 5JUMA 3AU2A 2YNHA 2ZTEA 1MU2A 5IIIA 3QZ7A 9ICPA 3OJUA 4KB0A 9ICLA 3OYEA 2YV0X 3OYIA 1K1QA 3V6DA 4KI4A 3FYHA 5KFJA 1T4GA 2NRWA 4TQRA 4YP3A 3OGUA 3DYAA 3NH1A 2XGQA 1BVSA 1DTQA 5J2PA 4RQ0A 1Q9XA 4N41A 4ED1A 4DOAA 3LPTA 1EP4A 3KTQA 3EPIA 4UB2A 2FLLA 1BISA 5D3GA 3UQ0A 5HP4A 4DTXA 3UXNA 4CK2A 2RDIA 4DS5A 3KLHA 1KLNA 3OSPA 4R8UB 3NBPA 4JRPA 4IQVA 2LSNA 4CJWA 5KFRA 2R8IA 1C1AA 1ZQVA 9ICGA 2HVHA 3AO3A 4PPXA 9ICBA 8ICKA 5KFHA 3HW8A 1XWLA 3ULDA 5HBMA 2G8IA 4KLHA 1ZQUA 4CEZA 2VA2A 1S9FA 4YFUA 3OY9A 3B0XA 3SV4A 5DB7A 8ICCA 2LYHA 3H7IA 4QZDA 1NKEA 4H8KA 9ICCA 1A76A 5BOMA 3SQ1A 3THVA 4B9VA 2FC0A 3C23A 3RR7A 2DPJA 4DTMA 4IRKA 4ECYA 5J0WA 2PI5A 2X78A 4CEEA 4FBTA 1X2IA 1NOZA 3O4QA 3PVXA 1S0NA 3CG7A 3NCIA 4M3YA 3C94A 2KFNA 3FDSA 4XUSA 3K2PA 1RYSA 4KTQA 4QZGA 1UWBA 1PZNA 5KFYA 4G3IA 2P5OA 3AUOA 3QEIA 1RT6A 5KG3A 3S3OA 5DG8A 3BQTA 4XQ8A 4QAGA 2RDJA 4IKFA 4CEDA 1UT8A 3K5MA 2HW3A 2VA8A 4Z6CA 1IXRA 1QTMA 3ZSYA 3I8DA 3KK3A 3S9HA 2GUIA 1NOYA 3PX4A 1TV6A 4KFBA 5KFTA 4UB3A 4R64A 4FJNA 8ICGA 3HXMA 5DBAA 4KPYA 3JPQA 4ZTJA 3VQDA 4FLYA 1BHLA 1NJZA 4CFAA 8ICWA 9ICJA 3L2VA 4PWDA 4FLUA 4AHUA 4KLMA 4W5TA 1J54A 4LH5A 2FMSA 4I2QA 3BGRA 2A1RA 1RPLA 2BE2A 4M42A 3JPNA 3P5JA 2ZUCA 1S76D 3RJGA 1COOA 1Q8IA 4CESA 1JN3A 4PHEA 2BPFA 1JL1A 1YTUA 3CFOA 2YHBA 2G8VA 5DBCA 3AVIA 5EWGA 1BPBA 3KHRA 4F93B 1DGSA 4F92B 4IR9A 2UVRA 4IQWA 3KLFA 2D0AA 4JWNA 4PHPA 1S1WA 5KFDA 3PNCA 4Q5VA 5J0RA 3SPYA 4OVLA 1UA1A 3GILA 4M41A 4FLWA 3ZDBA 4KLTA 3NF6A 2BCSA 3KK2A 1TKTA 1U47A 1JXEA 3ORYA 4I2IA 2FBTA 4CE9A 1WSEA 4M3ZA 1XI1A 4LY7A 4DO9A 2R8KA 3PW5A 2F96A 4BDPA 4CGIA 1QQCA 3RH4A 3V9SA 3LP2A 5J2EA 1HPZA 1Z00A 3NGYA 5C42A 4O3SA 3C21A 4YQWA 3HP6A 4F4YA 2KN7A 1RYRA 9ICXA 4GMJB 3MAQA 4DTSA 3C6TA 4I7FA 2DFEA 2B5JA 3QEWA 1V9PA 3DLRA 4QZHA 3O3FA 2UVVA 3L2QA 5DB9A 3EW9A 2BQUA 9ICQA 5HMMA 4DTNA 3GV7B 4I27A 5SWMA 3NF8A 5CB1A 4I2FA 5KFBA 4QZ8A 4CHOA 3C95A 2HNZA 1XSNA 4MEXA 1IM4A 2AGPA 7ICLA 4KHNA 4RQ6A 3BDPA 1ITGA 4FJXA 4DLEA 4IDKA 3SI8A 3PO5A 4CEBA 5KG6A 3OS1A 4H4OA 4FCYA 4CK1A 7ICFA 8ICHA 1DTTA 1TKXA 1VK0A 3OYFA 7ICSA 4Z6EA 2W8LA 4GXJA 2E6LA 1QSLA 3EZ5A 4HCCA 1NJYA 4Q44A 4Z4GA 4HVJA 1JLGA 4CK3A 3L3VA 4KLIA 4EEYA 3QERA 2KTQA 1L3VA 2ZJ8A 3T3FA 1A5WA 4EZ9A 3HT3A 1QSYA 1SL0A 3PV8A 3QIPA 4JLHA 4ECSA 2FLPA 9ICIA 3OYLA 5DK5A 4KLGA 2B6AA 4YR2A 1LWCA 4FZYA 4CJKA 4YFKA 3AVMA 2NRZA 1ZQYA 2W8KA 4IFYA 5FDLA 5KI6A 2VA3A 1WAFA 2ATQA 8ICIA 4BACA 4E7KA 1HMVA 4RUCA 2W42A 1RBSA 4ECTA 3V6KA 4DFPA 1FXXA 1T3NA 3FFIA 5HRRA 1BCOA 3TANA 2YKNA 4O0JA 4CHQA 3MFIA 3HJFA 2R7YA 1U45A 3JPTA 4KHWA 4FK2A 3HWTA 4QWCA 5KT3A 1XS9D 8ICPA 1WLJA 4BGDA 4F4ZA 5KT6A 1VSFA 3WNHA 4FYDA 3KHHA 2YHAA 3ZT2A 5KFVA 1RTHA 1WSGA 3CYMA 2OPPA 3OYGA 4FJKA 3L2RA 5HHHA 4NXZA 3K5OA 3RAQA 4OPJA 3AVBA 5HROA 2MAXA 2PY5A 1CUKA 3WNFA 3ISDA 4M3XA 1ZBHA 3RMBA 4MFAA 3LDAA 3DRPA 4F3OA 1KTQA 3EYZA 5HNKA 2XGPA 1RNHA 4ECQA 4ED7A 4RZRA 9ICSA 3LZJA 4NLGA 4M0AA 5KRTA 2BCUA 3AO4A 3ZDEA 2PFNA 4UB4A 1ASWA 5KFOA 5J0TA 2ZTCA 4YN4A 1VRTA 4CEQA 5DB8A 4DU4A 2BPGA 1XHZA 2W9MA 3ZT1A 1LAWA 4NCGA 2JGUA 2FLNA 2ZJ5A 4K8ZA 4RUAA 3MR5A 3Q8LA 4G1QA 1CZBA 2DFLA 2XY7A 3B6OA 2V4RA 3F73A 4W5NA 4CECA 4ED8A 5J2HA 3VQ6A 2DY4A 4B9LA 3MECA 2YNGA 2IA6A 4LZGA 5F9NA 4GW6A 1SL2A 3U6FA 2BCQA 1RT2A 5I42A 3KKSA 5DGAA 3LP0A 5J0OA 2JLEA 4I28A 2BQ3A 3ISBA 3TAFA 4Q0BA 4ECRA 4MQ3A 1VSDA 7ICHA 3OYDA 5D46A 4PUOA 2ZJAA 2BGWA 1D5AA 1BQNA 4WE1A 5J2NA 5BOLA 4DL4A 3BQ2A 4Q8EA 1HUOA 3T19A 4MF2A 4M9JA 4O5BA 4KLUA 3RTVA 4F5RA 1TKZA 2B4JA 2D0BA 1IKVA 1Z00B 3KLEA 3HVTA 4KRFA 5KG0A 3ITHA 1RDDA 2XY8A 8ICMA 4XIUA 1Z26A 4JV1A 5FRNA 1LB2B 3V6JA 3T1AA 4OJRA 3M8QA 2FBVA 2IHMA 3ZDDA 4DEZA 2HHVA 4OLBA 3V7KA 1NJWA 4O5KA 3CFPA 5J0SA 3T5HA 4KLDA 4FLXA 1JLBA 1T8EA 1IG9A 2RN2A 1IKXA 3ZT4A 1UA0A 2HNYA 5T7BA 9ICMA 2KZMA 1EKEA 2O4GA 4O55A 3QNNA 2G8FA 4M2YA 7ICVA 5FROA 2F1IA 8ICJA 4I29A 1NK4A 4QZIA 7ICMA 1RTIA 2RF2A 3OYNA 2ASDA 1KVAA 4M9HA 1HUZA 3PR5B 1RTDA 4YR3A 4DFMA 1EX4A 4RW4A 2AJQA 1NKCA 9ICHA 1D8YA 3DLEA 3OYKA 4DSIA 1UAXA 5J2FA 4C8KA 4UB5A 2KQ2A 3SJJA 5J2JA 1D9DA 4UAWA 2FPMA 1ZQNA 3SQ4A 1VSEA 3ETLA 1TK8A 4GVMA 4KAZA 3B6PA 2P5GA 2XO7A 1NJXA 8ICNA 3AVLA 2ALZA 1B92A 2PYLA 4R65A 5DBBA 4Q8FA 1EXNA 1T7PA 2NRVA 4K4IA 3AVNA 2ASJA 4RW6A 1L3SA 1BPXA 1C0MA 4JV0A 1T03A 5IIJA 4FM1A 3F9KA 2NRTA 4EP5A 4KLLA 4DTPA 3QETA 1X9WA 4JV2A 2Q0ZX 2R8JA 4QWBA 3MGHA 4CGGA 1DLOA 1MC8A 4B9SA 1ZQBA 3RRGA 3LZIA 2PFQA 4BXOA 3V4IA 1CLQA 2NRXA 4KLEA 3QNOA 4DSLA 3HP9A 2AGQA 2VG7A 3QEPA 3K58A 5KG1A 1NK7A 1O1WA 2J6TA 3VQQA 4FBUA 4KLOA 5CYQA 1Z3EB 3O3GA 3PY8A 5CP2A 3VQ9A 2AU0A 4RQ2A 5L1JA 4W5OA 8ICFA 2OPRA 3IM1A 3OVNA 4QZEA 1B22A 3ZSWA 3UQ2A 9ICAA 5J0QA 3IS9A 4KITB 2C22A 4AH9A 4JS5A 4MFFA 3M9NB 2XCAA 4RQ8A 3DRRA 1YT3A 3TAPA 3SYZA 9ICVA 2HNDA 2PFOA 1Q9YA 8ICVA 1S6PA 3M9OB 4F2RA 4KHUA 1H38A 2IAJA 1W0HA 1N48A 1IO2A 1QE1A 2X6SA 3OYMA 2YNFA 4YMMA 4LD0A 2AQ0A 3G0ZA 3SPZA 3AVAA 2ASLA 1NK8A 3MEEA 4YD2A 5HRNA 3QEVA 8ICOA 4DL7A 1QHTA 5C5JA 3CFRA 4CCHA 3G6XA 3KK1A 4DTUA 1TVRA 4KLSA 1C0TA 4FO6A 1S1VA 4F8RA 4PHAA 3Q8KA 3SQ2A 4DTJA 1JL2A 4FJIA 4B9TA 1CZ9A 3ZT0A 4C8MA 3RB3A 5KFCA 7ICUA 4OGCA 4NYFA 4ED0A 1F21A 4CGHA 1WNSA 5KFMA 4ICLA 3VQ7A 3V81A 4KREA 9ICUA 2C28A 1U04A 5KFFA 2QKBA 4KHYA 4KV8A 3NH2A 2XC9A 4BE0A 3UXPA 4DOBA 4KKOA 5DQIA 3V6HA 2VANA 3C1YA 4RPYA 4FLVA 1L3TA 1SKWA 5L1KA 3CM6A 1JLCA 3C6UA 4YG2A 3AA4A 4DQQA 4Y1DA 3V1OA 3SUNA 3SUOA 2GWSA 4FS1A 3TARA 4EZ6A 3OYCA 3DI6A 3OSNA 1B43A 1JLAA 3HO1A 5CJ7A 5SZTA 2BCRA 3JSMA 4CF9A 4KLQA 4Z0UA 3SI6A 4KLJA 1S5JA 1HJRA 5DG9A 4C8OA 1NOMA 4EBEA 4DTRA 2HMIA 3UIQA 2O4IA 1ZQLA 4CHYA 3K59A 3L2UA 4J2AA 2XHBA 3DMJA 4I2HA 4TUQA 4P4MA 3C2MA 1N6QA 1ZETA 7ICEA 7ICOA 4E89A 8ICYA 4RT3A 1RILA 5IIKA 3TAGA 3V7JA 2G8UA 2XY5A 3KHGA 5J0YA 4CF2A 3G10A 4NLKA 4DSKA 4DSEA 3RH6A 4DMNA 2ZTDA 4FVMA 4JWMA 2P6UA 8ICAA 5DGBA 3RJEA 3M8RA 8ICSA 4NYNA 1FKPA 3HPGA 1XSPA 2DFHA 2QK9A 4M9GA 3TFSA 3IRXA 1R0AA 5BPCA 3ZD9A 3GIJA 3D0PA 1XC9A 1XHXA 3I0RA 4CJSA 2G8WA 1S0MA 4J9QA 4CHZA 4K4HA 1ZQWA 1ZJNA 4DLGA 5J2BA 8ICTA 2ZE2A 1WSJA 1NK0A 3RMCA 1S1UA 5L1LA 3RJJA 1JIHA 4BWJA 4N47A 1WCLA 3JPSA 3KJVA 4BE2A 4CFDA 3V9ZA 1WCNA 3RR8A 4ELTA 4B3OA 2DTUA 2Z1IA 4RNOA 4X5VA 3OS2A 5KT4A
chains in the Genus database with same CATH superfamily
3UPQA 4LSNA 3UMBA 4I2JA 3L3UA 2NSCA 4DQIA 2RQ5A 2KHQA 5ALDA 3A3PB 3ALYA 3D0IE 2GIRA 2BXJA 3PHEA 3MXMA 1F60B 4LFCK 3UO0A 1RWMB 1NMEB 4CWBA 4TSXA 4L8RB 5JMVA 3VA3A 2V4JA 5ALRA 3G86A 1FWLA 2PFFB 1JRPA 4RPZA 1ZBIA 4PPDA 1C1CA 5E3RA 3ZT3A 2CAJA 2ZQBA 4I2BA 1QZ5A 3HPOA 3FNNA 5CYQB 2CQDA 4FF1A 4X64K 2YKAA 1TUVA 1BHNA 1QAYA 2AX1A 4TURA 4DR3K 3BS5B 1YI2S 1YWXA 3I82A 3ED5A 1ZOLA 2RIJA 3UN5A 3WXJA 1GLBG 1QSSA 2G8KA 2PYJA 4YOXA 1NEEA 5JVHQ 4BC4A 4ELUA 4CIFA 4PGXA 3M2RA 1HNWK 2JRSA 4DU7A 2MQ8A 1HWUA 1S6PB 1CULB 2IAJB 2QIFA 1LNQA 3SV3A 4DR4F 5TKYA 4CHPA 2AYEA 2YNFB 3HHLA 1SC6A 2VPZB 3QE9Y 4ISGA 4M04A 3E2EA 1ZA1B 1EB0A 2W11A 4GNIA 3EY1A 1VBYA 2GJ2A 2D41A 5M2RA 1PGZA 5LXRA 4J9LA 4YMNA 4J9SA 2KT2A 3R6GB 1S1VB 1JXLA 1CC8A 4J2DA 2NUBA 1XMQJ 1N4LA 5HAOA 3IR7B 4Y0FA 2V94A 1GH8A 1NNDA 4HHJA 4DQSA 4DMZA 2DY9A 4KTWA 3LF0A 5D0EA 1E3MA 2VL1A 3GIMA 3C5FA 4DBQA 2IPOB 2JH7A 5F8IA 1ZQFA 4K0KJ 4W98A 4AYBD 5AXMA 1HA1A 3D67A 4XPEA 3BO3A 2XMTA 2ISPA 3V81B 2AJ1A 3RJHA 1FJGF 1PK1A 2V2ZA 4LH4A 4YB7A 5FPNA 4YCXA 5IQQA 3AA5X 3VQEA 3CI5A 1YIJN 4CZFA 3UW1A 2X6NA 3KZIU 4KKOB 5HJYA 1P27B 5HR6A 2Y8WA 3QO9A 5GAHP 5E26A 4P0QB 3TZWA 4P4OA 3KHYA 2I1QA 7ICGA 2AIRB 3UKRB 3H08A 1U1RA 5ITHA 1H74A 5DO2A 1JLAB 1KKHA 3RB0A 4CJEA 4X4NA 2FSNA 2WOMA 5KFXA 4B9UA 5CA7A 2QN6B 1GTEA 3KLGA 3MN5A 1SJ3P 3BO2A 3FZMA 2EEYA 2MYFA 2V69A 3H8WA 2E6MA 1GEHA 3DMJB 2KJ8A 2EXUA 4A8MP 1TL1A 2RJZA 3MCPA 3U1MA 3WQTA 5FD1A 2FD2A 1KWMA 2X1FA 3GU3A 2Q6CA 3SUQA 4DV7K 2HQDA 3OS0A 4FJ7A 3S41A 5J2MA 4RQNA 4JI7J 5AQYA 4A48A 3CCVN 1B70B 4RPXA 2E44A 3IBWA 1IJJA 2L08A 2BZ2A 4FWNA 2CPYA 4NJ8A 3TACB 4RQ1A 3SXLA 3ULEA 4I6MB 3IRXB 3F5AA 3CIMA 2V8DA 4LVOP 4DX6A 5HVHA 4PL7A 3R6LB 2W2QP 5DM6L 1S6QA 1BE4A 2A2CA 1RHMB 3CCRS 1TL3B 4KH5A 3IMQJ 2PZSA 4FZXC 4GKJK 1KVCA 1C4CA 4LF4K 5CABA 1RCHA 1RAOA 2Z57B 3E0FA 3RBXA 3JQKA 1S0OA 2KZ3A 5C2DA 2XIDA 2WFAA 3FZHA 4MEYA 4O5CA 2C2NA 2J0QD 3VQ5A 4DV0K 2R7OA 4DQPA 4UB1A 2RNEA 4QW8A 4FXWA 2YWEA 2LQBA 3DXMB 2O8EB 5BPLA 4I0WA 1W9HA 5LMNK 3CJ5A 3P83D 4RBUA 2F2AB 4RG8A 1O8BA 1RBVA 3FBFA 1LWFB 2KHDA 3AJ2A 2G0JA 1FERA 2V2KA 1DY3A 1XERA 2DGZA 4F5PA 3RSEA 1M5PC 4LRDA 3A0IX 4DV3F 5ALWA 3DFEA 7ICIA 3HFZB 2VG5A 1A5VA 2DBYA 4DF4A 3N6NA 2RRNA 1H2VZ 4I69A 4DWIA 2GX8A 4O0IA 3V9XA 2OSRA 4KH4A 2W7AA 2FBYA 2K8GA 4W5RA 2DGQA 2DXEA 2GHPA 4LBHA 3R5CA 2V8HA 3HBTA 4YMOA 3HX9A 3G8TA 4E19A 1X6JA 2UUAJ 8ICLA 5AQZA 4KB1A 1VIXA 1G6BA 1VOMA 2GJIA 5KAKA 2IMOA 1RWPB 2V0NA 1ZQJA 4NLZA 2DH7A 2DFFA 5KGWA 3FMBA 5IIMA 4USHA 4OD0A 3ASMA 2O8CA 4PY5A 4IOCQ 3B0YA 2OMLA 4JI6F 1NZAA 2RUGA 3L4PA 4JKGA 1DHMA 5ALZA 2R2SA 3MAAB 4P2SA 2FF6A 4RW7B 4LF5K 1EWQA 1TELA 3V2UC 4GMKA 2FVQA 1TE2A 4J9NA 3FSIA 2HGLA 3Q8SB 2CDRB 1U1QA 1OY6A 4BRCA 4ZPCA 3DM2B 4OJGA 2BRLA 4O3NA 5ALIA 1CXUA 3IBFB 4J9PA 2YWFA 1TV9A 2A1JA 3W9HA 4QW9A 1HYSB 5GVQA 3QIOA 5K8PA 4OYXA 4QQBA 5KL8B 2QEXS 2WHEA 2GELA 1TGOA 3CJ0A 3RB4A 1RT7A 4LMZA 4OZ1A 1TAQA 1RE1B 4CF1A 2H48B 2W9BB 3C6AA 1J53A 3OTQA 7ICPA 2AYBA 1PVRA 1N5QA 1IBKK 2KKHA 1VSHA 3C7NB 4O8KA 1ZBTA 3GFHA 2C3PA 1UL3A 1FKOB 3K57A 3N0VA 5J2QA 3AJDA 3ZTPA 1B9FA 3SDEB 2YQ1A 3CJ8A 4J9UE 3R9LA 3H40A 3NS6A 1HW9A 3NH0A 4M9LA 1HNVA 3P5BP 9ICRA 3KG4A 1ZM3A 5IT9Y 4M5KA 5GIOA 1U02A 4F4KA 5GADP 2H3ZA 4OJOA 5J2AA 1S1XB 2GO9A 4HLBA 4LF1A 5GAGI 1KDNA 3CDBA 4HHUA 4IEIA 4CNYA 5DRKA 3ISND 5E84A 3D2FB 4C48A 1XC3A 2DKOB 1DGJA 2P1JA 3SQ0A 2MKKA 4OGEA 2ROPA 5B0DA 2JZBB 1GXTA 4J90A 2G07A 2ZVIA 3MF5A 4KGVB 2K89A 4DV6K 4WCEQ 3EZOA 5EE1A 2V51B 4I9QA 3DDNA 2HFNA 1KFDA 2ODGA 1YITS 3VF0B 1RTJB 2IGIA 3HPHA 4F5OA 1RT4B 3FC9A 4MFCA 2CPXA 4R0JA 1BNPA 4YN3B 5HQ8A 5K8OA 2Y0SF 4Z4FA 1MW7A 4DV1J 4WK1A 2BKPA 4KHQA 3B54A 3MDFA 1GLJO 2H3EB 2RT3A 2UXDJ 2WVFA 2FMPA 4NLNA 1K8AT 4NLCA 4NY8A 1ZBFA 1SIWB 1ZOTA 1X9SA 4OZ3A 1WAJA 4XH1A 3TWHA 4YXJA 1GX6A 1RACB 2FVSA 1NGJA 2OPSA 4G9ZA 5I3PA 5ALJA 4FN5A 5M1KA 4I2AA 1NUEA 2KG5A 3QXGA 1W7WA 1C7YA 4OLOA 5SUHA 5F3ZA 1QAJA 1N62A 4FZZA 1VSLA 1CQMA 4NO7A 4DOCA 3EXYA 2YX7A 4PKDB 1BQMA 4ZPBA 3F2KA 3T6BA 1S0VA 4ECUA 3CCES 2OPQB 3WK5A 3QEBZ 1NPKA 3K1ZA 1GX5A 3N4MB 2P2CB 3MURP 3CQXA 4CEAA 4CF5A 2XEXA 1DEJA 5LSOA 1CVJA 3FZBA 4ZOSA 1YBUA 4CIEA 4CIOA 5CA5A 3CHWA 2KHOA 4IBNA 1BGXT 5E41A 2JGAA 3MPYA 3F2CA 1HL6A 4Y28C 1N5WA 4LVSA 1F0XA 4PQUA 2KM8B 3DLHA 4FWPA 3IBCB 1RWUA 4EMDA 4TLRA 2RHQB 2OIHA 3NVYA 2YB1A 1DRZA 1N32K 3VCBA 1JROA 3CF5Q 2B0GA 2Y9TA 3J8AA 3OYAA 1FESA 1H0HB 4EENA 3H45C 3M32B 3JAMU 5B5EU 2QFJA 4OV6A 4URQU 3R7SB 4GFJA 3T5KA 4Q7AA 2HLTA 3KIOA 1GXLA 4JS4A 1SUQB 3TAMA 3LGMA 4OI4A 6FD1A 2DHAA 4OZ2A 1JKHB 2AXTU 3AARA 4RPFA 3E66A 2CDQA 3PKYA 5IM0A 1ZTTA 1DOQA 3W8GA 1XNRF 2C2DA 3K1RB 1ZS6A 4KLFA 5L1IA 3GJSB 2YHXA 1RLDA 3ZDAA 3SFUA 3AH6A 4PL2A 5EHHA 3THYA 4KTZA 2KVSA 1U09A 1U0HA 3MR3A 2DGWA 3MDAA 1EETA 1VLYA 4ZP6A 5AE2A 3JPOA 3O6QA 4ZK7M 2GUPA 1ZQ1C 2DHSA 5DQGA 3ZCMA 1XO1A 1PVQA 4DU1A 9ICNA 2BJ8A 1N33K 4UAUA 5K9FA 3VAMA 3NXZA 3P39A 2CZVC 5A8KB 3K0SA 2F77X 2BW2A 2LCWA 4LF9F 2VKQA 1N56A 3Q2TC 2YWWA 3EDQB 1G3OA 3H8MA 1O08A 2WSFC 3TUPA 1RBAA 4KPCA 4I56A 5HP1B 5HR7A 3FKBA 1KSPA 4ES3A 1F5AA 3RF9A 4R8UA 2YWKA 4QNLA 3D45A 4Z4HA 1U8SA 2R7SA 1U48A 3B4MA 4PYAA 3NE6A 2O8BA 5KPZA 4DR5F 2MZRA 4Z4IA 3CCTA 1YG0A 1RUSA 1IBMK 4WF9Q 4FF4A 1PO6A 1XUPO 4O44B 1AYEA 3DDIA 2J6SA 1R3NA 3NNAA 1FT8A 4I2PB 4LSZB 2VOPA 4FM2A 4UW9A 2F4VJ 1FDBA 1XJWB 2YTUA 1SJ1A 5AZJB 4BDYA 3O08A 1JLFB 4ZH4A 2EAOA 1RDAA 3A5MC 4HYKA 4F4XA 3N97B 1Q5VA 4O3QA 2ZUAA 2ILYA 3W2VB 3BSNA 3GZFA 4J2BA 5HRPA 3R7BB 3PDNA 2YX4A 2EFVA 3JXOA 3M4XA 2YMMA 1BI4B 1X3NA 2E88A 1KW4A 5KFPA 1Y4ZB 2E20A 1KQGB 2Z1JA 3EZWA 3OPKA 4C3KA 1K0VA 1RAFB 5F8HA 1N8RT 3BEXA 4B8CA 4DG1A 3SZ2A 5AQIA 3KD3A 5DKWA 2G09A 1HNIB 1VQMS 1ZQOA 2YQ3A 3OTEA 4BR0A 4FLZA 4CBWA 4JUZA 1HQUA 1FFVA 3SBGA 2VONA 4TY8B 3AVKA 1WC1A 5KG5A 5BJRA 2FJWA 3VCDA 3D4JA 2IJFA 4ILMA 1S9EA 1X6IA 3MEGB 1Z25A 4RU9A 3QUBA 3M2UA 5KT2A 2IS3A 4PG6A 3KLFB 1Y88A 3MXIA 2GBZA 3CQ8A 4M5JA 4ECXA 1KD1O 1VK3A 3H6EA 4ECVA 1RT5A 3J7YU 4GXKA 5DDOC 4I2DA 5AIBA 3GCXP 3O9RA 3N4QA 1KQFB 3I55N 2OZMA 3SCKE 1MA9B 3PACA 3A0HU 4LF8F 3U02A 5BREA 5KFNA 5KFWA 1CJVB 1UW4A 2RHKA 2KG1A 2WTFA 1PK3A 4HR2A 4KN7A 3QT7A 4IG0B 8ICEA 4CLPA 4NZ6A 4WFBL 2UU9K 1ZQXA 4HVZA 1AB8A 3NVVA 2LQJA 2VASA 4RW8B 3I0SA 1FK9B 1ZBUA 1J5OB 1TMMA 4TY9A 1EXQA 2DH8A 2ZJQL 2BJ7A 4ZN3A 4KHPJ 4AHCA 4F0KA 2VPWB 3PSIA 3H0MB 1HKCA 4F2SA 2I6WA 2KXNB 3NOGA 1F3VA 1KFTA 1P9QC 2VBZA 4CJTA 3V9UA 4I9LA 2IMWP 5J1EA 2ACYA 4BY9C 2F8SA 3T5LA 2JEFA 3VGSA 3SJHA 3O9UA 3PX6A 1VQLS 4WYWA 4N56A 3QU4A 2PI4A 3QFUA 5KG2A 2ZZMA 3QLHA 3Q8MA 1NWKA 3GFZA 5IWAF 1XQIA 3VEXA 3HSTB 1NU4A 1N5YA 4R63A 2MKSA 3V9WA 3I5CA 3M8WA 4FW2A 3AO1A 3TSUA 2EFOA 2LBOA 5KRSA 1EQMA 3CIPA 4FJMA 2P6RA 3AU2A 2IC3B 2I2YA 4F67A 1J27A 4OJPA 3GR0A 3MTJA 1YTYA 2CWKA 3MMAA 4C4WA 1NGDA 5DDPC 2WW4A 4KB0A 3SQOP 1K1QA 3IBPA 3A4TA 4TVAB 2HBJA 1Q86T 3V6DA 2C1EB 4FVUA 4NLOA 3BKFA 4UZCA 2P9IA 1T4GA 3OGUA 3DYAA 1Y5LB 2XGQA 3NH1A 4RQ0A 2ZIXB 4BQZA 1HD1A 3QFHA 1BUXA 1VS3A 1EP4A 5LMUK 1KTVA 3MPUB 2LEBA 3EPIA 3N28A 2FLLA 1BISA 1WTBA 3QWPA 3KLVA 3UQ0A 3I56S 1N34J 5HP4A 4HACA 3IDHA 4DTXA 2CG4A 4UARA 3VAKA 4JK9A 3OSPA 4USVA 4H4KC 3LDLA 4X4SA 1U2VA 1HPMA 5CRXA 3LOUA 1LW2B 5ALPA 2VJ5A 3O1LA 1N63A 1ZQVA 3M6VA 3AO3A 3AD9C 9ICBA 1CRXA 4YDXA 8ICKA 4EX6A 3PIOQ 3SAGA 3FE1A 2G8IA 4GVEA 5A2QY 5IOLA 2VA2A 3B0XA 3SV4A 5DB7A 3O4WA 2DR9A 1VQ5N 2GFFA 2G2ZA 5BOMA 5D4LA 3THVA 5ALUA 4LFCJ 1C0GA 1FEHA 5F8GA 4Y2AA 5EX0A 3MC1A 3U27A 3G8QA 4G1IA 2X78A 5F8MA 4FBTA 3EEQA 3O4QA 2FC9A 3D5MA 3C3LA 2P6SA 3JAMO 3JQJA 2CA9A 2GGPB 2IM0A 4X64J 3IRWP 3CG7A 3DLGB 2KFNA 4WFXA 3TVZA 4KTQA 4QZGA 4DR3J 1TZ0A 3C65A 1ZM2A 3BPDA 3WU2U 2P5OA 3AUOA 2E5HA 3QEIA 3I76A 2FJEB 3DJCA 5BR8F 3C2PA 4IKFA 5GTIU 1UT8A 1TQLA 4ZCMA 1HNWJ 2RVJA 2MLZA 1IXRA 4ZLLA 1NG9A 3ZSYA 3I8DA 2YNIB 4ZVHA 3VVTA 2E5SA 3KK3A 1T9YA 3EE3A 3S9HA 2GUIA 3PX4A 3B4DA 3KJQB 1TV6A 4KFBA 2DL0A 5KFTA 1HR0K 4F04B 8ICGA 3HXMA 1ESVA 4ZHRB 2GTDA 4DUZF 4K4VA 3H90A 2GJFA 3VQDA 4F3QA 4CFAA 3RVCA 1XMBA 9ICJA 2LU2A 3IWXA 4TNOA 5HMYA 3OTOF 3H98A 4LH5A 2F3NA 2G5IB 4M42A 1LCUA 1S76D 1MMDA 4YORA 3RJGA 3VF4A 4CESA 5HL7L 3MM7B 2XHCA 2BPFA 3G71S 2UP1A 1JL1A 3IWLA 1IKVB 5FPMA 3AVIA 5L9NA 1BPBA 3KHRA 1DGSA 4F92B 3U26A 4IR9A 2HKEA 3GONA 4M95A 1S79A 5KFDA 5CD4H 5J1NA 4JV5K 5HVGA 4B3SF 2MB0B 2MTLA 5J0RA 1VQ9S 1IKWB 3CETA 1Z1BA 4XPCA 4OVLA 1I94K 1T9TA 2CN1A 4FVCA 5AI9A 4K0KF 3P6YC 1JXEA 3C6HA 3FC4A 1LXJA 1H1VA 3PW5A 2KSOB 4CGIA 4FL9A 3GOIA 3V9SA 1G7CB 4ICAA 5J2EA 1Y0HA 4BGBA 1VHXA 1KNZA 3HP6A 3CWJA 2KN7A 1RYRA 1SKUB 4GMJB 3AB2B 2G9OA 3MAQA 4O23A 4DTSA 1B0XA 4E1JA 2B5JA 1V9PA 2MXYA 4JI0K 1I1GA 4KY3A 4QZHA 2ZC4A 4DN9A 4TYAA 3L2QA 3LO3A 3TEHB 2BQUA 2DR6A 2RE1A 4DTNA 3J7AN 4ZPWR 2VBWA 1CLFA 3PJ9A 1XSNA 4JYAK 2LMIA 2AGPA 3SSSA 2YNHB 1MU2B 5I3QA 1IV8A 4FJXA 4DV7J 3SI8A 3PO5A 4FE3A 1U1LA 4H4OA 2Z30B 3L3CA 4FCYA 2JOQA 7ICFA 4LFAK 1DTTA 3OYFA 1Z6RA 7ICSA 3RU0A 4ID8A 1QSLA 1NJYA 2KO1A 3ZTSA 4CK3A 3L3VA 4KLIA 1DTQB 1QVFR 3ZXWA 4BRAA 5E3PA 1YZ7A 5AQQA 2ZJ8A 5AM5A 3T3FA 1TL7A 3NY0A 5B0EA 1QSYA 2LDYA 5D3GB 3QIPA 2FVPA 1N5SA 1VQ7N 1Q0NA 5IT9U 1IBLK 1W2IA 3KLHB 2ASOA 2KE7A 2JC0A 1Z2LA 2QWNA 5LL6Z 3ZZTA 2EFNA 4LF4J 2DUYA 1LWCA 1CSJA 2ACMA 3BBFA 1WUAA 4IFYA 2W8KA 3SMPA 4FF2A 4NXMK 4BG9A 7FD1A 1ZPVA 2Z2MA 2VA3A 3NGRA 2CIMA 5HBMB 3VGTA 5ETVA 2LKZA 4DV0J 3KZXA 2W42A 3TSQA 2GWJA 1ITPA 4ZP7A 4DFPA 2NO5A 3FRZA 1VQYA 1T3NA 5LMNJ 2ADCA 3PYFA 4O0JA 4CHQA 4KHWA 3AGRA 4FK2A 4UAVA 2L3MA 1Q82O 4IO9L 3FRYA 3VAGA 4YDUC 3GP9A 2WAQD 3TRGA 5JU5A 3VGMA 5F8JA 4RU2A 1BG3A 2A3ZA 1UKUA 4JKAA 1DQ8A 3QU2A 4OHWA 4MHVA 4FYDA 1L6NA 4Y65A 2WZ1A 3OYGA 2D69A 4ZJOA 1Q4RA 4RNHA 1CQNA 4CNQA 2PY5A 3TWZA 3E8OA 2DKZA 2P9SA 1ZD4A 2E5JA 5KOXA 3J80U 2BJ9A 1OPZA 1UPHA 7AT1B 5HNKA 2XGPA 4ECQA 2ASPA 3HTVA 1RWKB 2P6TA 2DGXA 5KRTA 4TN2A 1C4AA 4UB4A 5HOOA 1ASWA 5KFOA 1QQMA 4YN4A 4DU4A 3DGPA 2BPGA 1VISA 4PKGA 1XHZA 2HFZA 2HPUA 3Q86A 2XYPB 4DOZA 2A19A 3H5YA 1E6VA 1RADB 4G1QA 2PIIA 1JUDA 4CO3A 4PWDB 3B6OA 2V4RA 1FHTA 2MZJA 4LF5J 4W5NA 4CECA 2VQFK 4I2QB 2VJ4A 2MZSA 3ILLA 2DY4A 1JNZB 2YNGA 2FHJD 4ZVPB 3N01A 5F9NA 4BC5A 4OZ5A 1P8GA 2BCQA 2AT1B 5I42A 4MT1A 1K5OA 2JLEA 4M5DB 4FWMA 1KBUA 3ISBA 3TAFA 1S1WB 2VD3A 1CG2A 5HANA 1HLUA 3GU0A 1FTRA 2DGTA 4ALZA 4RX6A 5JXSA 5B7WA 1TFWA 1YJ9N 1IBKJ 4M63C 4IC9A 4Q8EA 3D6JA 3T19A 3HMJG 3MM5A 1VQ8S 3CC4N 1NNEA 1ED1A 2KEYA 1K9MO 1QHAA 4F5RA 2WF8A 3HILA 4KYZA 4ZVGA 2D0BA 3CJKA 1Z00B 5C42B 3ZTOA 4LBPA 1LB2B 4IOAL 3V6JA 4KIAA 4OJRA 3M8QA 4NLXA 3L7OA 2IHMA 3ZDDA 2KYXA 4RLEA 3R8YA 3HSCA 2PEHA 2WW8A 2HHVA 5KAFU 2GAGC 3KKAA 1S99A 4J8FA 3WQPA 4URGA 5GAHU 4OYMA 4HDHA 3T5HA 2J7UA 4NRTA 4KLDA 2D0OA 4FLXA 1T8EA 1IG9A 2PFUA 2YH0A 2AX0A 4B6JA 2RN2A 1EO1A 4USWA 1YJVA 4UY8O 1FNXH 4AQYF 3GIRA 4JBCA 4UUXA 5B0AA 2HNYA 9ICMA 5GMEA 2E8PA 2QL7B 3NAIA 2O4GA 3EWGA 4O55A 1RAEB 2GO8A 3QBXA 1NGBA 4JB8B 2MKHA 2IFXA 1MWZA 3QT6A 1KAXA 4L6V3 2FI1A 2RS8A 8ICJA 1DK3A 1TKXB 4DV6J 1NK4A 4QZIA 2E1ZA 1RTIA 2RF2A 3OV7A 4AM6A 1VK8A 3CC2S 1HUZA 4Y0WA 2D3OR 3THTA 1NKCA 4CZHA 3OYKA 1UAXA 3BH6B 4UB5A 2KQ2A 4UQTA 3SJJA 5J2JA 7FDRA 1D9DA 4UAWA 1VSEA 5HO4A 3QIDA 2KG0A 3D7EO 5LL6d 3PFOA 1FA0A 1C1CB 8ICNA 5AK4A 2ALZA 2K4EA 4UB8U 4MO4A 4BR4A 3M2VB 2QRRA 2B6AB 2Z58B 5AQSA 2IVYA 2G06A 4C7QA 1C0MA 1YF5L 5IIJA 1OIAA 2IVMA 1VR6A 4X4VA 4QU6A 3EUNA 3TUJC 3CC7S 1N5TA 4CO1A 2KFYA 3CJCA 2Q0ZX 2HI0A 2UUCK 2HQGA 4ZA1A 2ZJRL 1IV0A 3MGHA 1VQ4N 3TADC 1NJIO 2CPEA 1J97A 1HMVB 4OPHA 1ZQBA 3RRGA 2PFQA 1ZZNA 3QNOA 2MMYA 3FFIB 3HP9A 2HS4A 2YKNB 2QG9B 5KG1A 3DU6A 3H2VE 1WWHA 4FBUA 5CYQA 2QWRA 3PY8A 1TR0A 5CP2A 3VQ9A 2AU0A 1R31A 3A8IA 8ICFA 5AE3A 3IM1A 1VQSA 3HSGA 6AT1B 1B22A 2QWQA 4BUGA 9ICAA 3BS5A 5J0QA 2K2PA 2MJNA 1RTHB 1H6KX 2F8HA 4MFFA 3AA8A 3K8WA 4AH9A 2E9TA 4RQ8A 1NGCA 3DHXA 3SYZA 3SEOA 2CWXA 5HROB 1S6PA 1CULA 1T6CA 4WTYA 4CDGA 2IAJA 2CGKA 2Q0RA 2CNNB 1N48A 2YNFA 1Q18A 4LD0A 1VQ6N 1N32J 1AT1B 2LFVA 1ILYA 4YD2A 4WFZA 2ZZNA 5E2QA 5C5JA 4WFAL 2Z2LA 2AF6A 3KKFA 1R8BA 1FRMA 2N3LA 1S1VA 4PHAA 2DNYA 3KG0A 4OV1A 3Q8KA 4OJ1A 2ZH4A 2MJUA 2MKCA 1KXPA 2CRLA 4X65K 4PXCA 1T9XA 4M7YA 4M5NA 2LXFA 5JVHL 3O44A 4C8MA 3LYSA 2FY8A 4MKBA 4CLFA 2I7NA 3VTIA 5BXIA 3MECB 2VYPA 2Q1NA 2ZM6F 4OGCA 4ED0A 4B3RJ 2OP5A 5IT9O 2H5IB 3V81A 1O5JA 4KREA 1LKYB 5EXWA 1JJ4A 3GB0A 5DM6Q 5KFFA 1N33J 2QYGA 2I1RA 4Q0BB 5ALXA 2HMPA 3OUYA 4PUOB 3TZYA 1UEKA 3UXPA 4KKOA 5DQIA 2OO4A 3FJ2A 3C1YA 3T9ZA 4RPYA 4FLVA 4ZN1A 5J2NB 4P0QA 5L1KA 3CM6A 3WK6A 3NCQA 4YOWA 2GWSA 2VH7A 3UKRA 2N4CA 4FS1A 4BR2A 3TARA 3MMJA 4OQJA 1JLAA 2QO3A 3R27A 2PMHA 3C46A 4Z0UA 4KX3A 2KVQE 1OVYA 4DTRA 3WT0A 2VFUA 2H3GX 3DMJA 4TUQA 1PBAA 1G4CA 5EE3A 2HVZA 4CM2A 4U7UK 4U7UD 3AHPA 1SH0A 5AE1A 5IIKA 4DPTA 3TAGA 4CE6A 1RKJA 3J80O 2DIVA 2PKEA 2ZTDA 5H9EK 3MM8B 2KYZA 1N52B 3TJAA 4Z2XA 4NYNA 2L9DA 1RFQA 3M1FA 4ZVQB 5GADU 2OLWA 4C1NI 3BN7A 4I6MA 4MIAA 3IRXA 3D0PA 4FOEA 4DKWA 3RUBL 3W7BA 1RTDB 4RW4B 1WYGA 4DLGA 4CZKA 2F7TA 4W90B 1FJEB 3L5KA 1NK0A 1SQKA 4X2BA 5L1LA 1JIHA 2EH9A 2YPZA 4BE2A 1GLEG 4CFDA 2J0WA 1WCNA 2W3SA 3RR8A 4AE5A 4L72B 3O8MA 2M2BA 4LF7K 4RW6B 4FPBA 1QVGR 3QZ8A 2B43A 2F65A 3HL8A 4ZVOB 3V5RA 1XBWA 2DNMA 3DXMA 2O8EA 3OA9A 1AFIA 1B0TA 4OI2A 3C5GA 4AHTA 5KTQA 2IOFK 2W01A 2R7TA 2K4HA 3A3NB 1VSJA 2ZUDA 1DLOB 4DB3A 1OH6A 1NPRA 2VBXA 4YY3K 4FWLA 4RNNA 2CPFA 2OFGX 1LWFA 1JJ2M 4BXOB 2WB1D 4J91A 1GLCG 1NMDA 1DXSA 2VG7B 3LL3A 2CQ1A 3TFRA 1T11A 1PCAA 1A5XA 3NRBA 2K7JA 3W3SA 2UU9J 2OPRB 3CGIA 2FBXA 3W3DA 2JFDA 3BQ0A 4ZVUB 1M1GA 2GOLA 3PJXA 1X0FA 1WC6A 2OTJS 8RUCA 4WBFA 3L2WA 1FX4A 2OMOA 1YJUA 1IWGA 1FNOA 4HTUA 3UDEA 5M2UA 3BF3A 2QV6A 2C2MB 4M5IA 4ZCIA 3AT1B 2LQ8A 3R5GA 4LF6F 4CJUA 2VFRA 3W5YA 4IH7A 4DZ6A 3QQCD 3VZIA 4KHPF 2AGOA 4IO1A 7ICJA 2UUBK 2BBEA 2QX0A 3MM9B 2NXEA 3MAAA 3PYDA 4FP9A 4QWAA 4RW7A 1I39A 3MK6A 1FVQA 4J03A 5D4NA 1GLFO 2LI6A 1GMUA 1RDBA 3CJ4A 2X1AA 2NZTA 3DM2A 3NKYA 2H5XA 5K4LA 1WOQA 2NRHA 4A57A 3MEKA 4QZAA 3M8SA 5AR0A 4LIWA 4MF8A 4I2CA 2WSCC 4O0NA 3D54A 1FFUA 2M3DA 1HYSA 4WQ5A 3MAHA 4HH1A 5DS7A 4R0EA 1QQOA 4ICLB 1QM9A 1NBWA 1R8CA 4HHHA 2W9BA 3M6XA 3THPA 1U6FA 1EZZB 3JB9k 3ZSOA 3IAYA 3TQ1A 3K89A 4KV8B 3C7NA 4IOCL 1NHKL 3SBMA 4IOXA 1ECWA 1FKOA 5G0RB 2BPCA 4C4RA 5LMUJ 2HK3A 3SMVA 4WXOA 3BSCA 4ZPTR 4A8XA 4B17A 1JLCB 3BR9A 1NB7A 1UZDA 3CO0P 3DI6B 4CLTA 4F3MA 2ITGA 4YB6A 2ZHAA 3CDEA 1NI3A 4NPOA 2XSJB 5TZVA 1WI8A 1YJNN 3K4GA 1G15A 4R25A 1KCFA 1A6SA 1S1XA 4V1Ak 3C15B 3I96A 3P38A 2CPIA 2M9KA 1XR7A 2C3MA 4DU8A 3HKZF 3PLAA 1NBEB 2P9NB 2Z1GA 3D2FA 1N6QB 1Y7PA 4E1NA 2E1AA 3CE8A 2JZBA 3ZD8A 2HLUA 4P71A 2B9XA 3HK2A 5I4MA 2Y0BB 3DRYA 2HBLA 3C19A 2ZH5A 2YMPA 1B64A 8ICXA 4C8LA 3TABA 2Q36A 5E3QA 4Y3CA 1PYSB 2ETJA 1RTJA 2FDRA 3BEGB 2XQCA 3O3HA 1RT4A 4ED6A 1N2XA 2GVZB 3JPRA 2M0GB 3OYJA 4ZIVA 3C2LA 1QVFM 1URRA 3UR0A 3KKAC 5TISU 4CJQA 4M5LA 3PW7A 2AD9A 1K1SA 1R27B 2ZE2B 5FLXU 2P9LB 2Q2RA 3TX8A 3KD5E 1CS4B 1TP7A 2CVEA 1RAAB 4KJIA 3KJVB 2E3TA 4J9RA 1UTAA 3VOVA 1WG4A 1FIQA 4B3OB 3PMLA 1ZM4A 3QESA 3NGIA 1AROP 2H65B 2XMKA 1S3XA 1HR0J 2AH5A 4ZJQA 3UD4P 1ZQGA 1X7VA 1HNWF 2J9CA 2ZHOA 3CM5A 1ZTWA 4EBCA 3A2FA 1D3WA 2MY8A 4Y2KA 3OYHA 1PC4A 2QL9B 5CWRA 3G8SA 3JPPA 2XY6A 2YX6A 4QJVA 1C0FA 4EGLA 2OCEA 4MN4C 4CGFA 4M8LA 2OPQA 5C7PA 1KVBA 4J37A 4ED5A 3ATUA 3WBZA 3VERA 3RW6A 3EDRB 1ZC6A 4GC7A 4C6AA 2KKZA 4NWIA 1XMOK 3AM9A 3WKDA 5AQUA 5ETQA 5AZIB 3J7Z5 4KBIA 1RT3B 3R9KA 3ETOA 3N5BA 5IT0A 1ZQQA 2ZG6A 1FRLA 2R2UA 1RZTA 2FPLA 1F5CA 4Y2XA 1VLOA 2NNWA 1V3RA 1SVDA 4L74A 5J2KA 4TXSA 3ZZ0A 1T94A 4A8YA 3AO5A 2A1BA 4BC7A 3CO9A 3VGKA 4YHHF 4OKKA 2WVEA 4BRNA 2FSJA 4KO0B 4WP9A 3A5LC 4CD1A 5HQLA 2QLBB 1K8AO 3M32A 2E9RX 2BANB 4PRFA 2N7YA 1SUQA 4P7VA 4MLHA 2KV2A 4F7VA 2MY7A 5ALYA 3KLIB 1JKHA 3WXMB 2YY3A 2N1RA 2FPKA 4JI0J 4ILRA 1S77D 4AYBC 1X4HA 3N7SC 4DL6A 4K8XA 1HHSA 2HAFA 1MWQA 2DPIA 4Z7YA 3DDHA 5AKYA 3DOKB 4NMLA 2CQ4A 3BBBA 4L73A 5AI0A 2KZZA 5H1SQ 2F1HA 2LU1A 4NLTA 3SCLE 1KD1T 4JYAJ 4NYOA 2KD1A 4P2HA 3KJNB 2H9ZA 2XICA 3CF5L 3BZCA 2P9EA 3HM9A 1SKRA 5A8KA 4KHSA 2ZXIA 3MR6A 4LFAJ 1A77A 3VQPA 2KXFA 3G87A 1EWRA 2EVZA 3BF4A 1S7HA 2IDLA 4ZPDA 3T7ZA 1O0PA 3ZEUB 4QCLA 4CFCA 3WKCA 4KHMA 4DV7F 3CCUN 5GIPA 3F5EA 4MDBA 1Y97A 5AK3A 4XTTA 5HP1A 1Q79A 4RBTA 2DNNA 1RJJA 3GIKA 1RXVA 5HJXA 1ZA2B 1F1BB 1HHTP 4QR0A 5DLFA 3ET6B 3DC2A 4ZMMA 1GOBA 2UUWA 1IBLJ 4DR1F 4C0ZA 5I9EB 4Y2JA 2M9NA 1CI4A 3RFAA 4O44A 2GCFA 3VEVA 2V8PA 3F5TA 4I2PA 4DX5A 3LTOA 4AILC 2WC9A 1YVUA 3MMBB 2CJQA 2XTJP 5JLHA 5KFUA 1WSFA 4ZCLA 4GKJF 4NXMJ 5AZJA 1JLFA 1TAMA 2R2RA 2G2YA 5DJBA 4UAYA 2HOIA 4O3RA 3W2VA 5EWFA 1X1PA 2OYYA 1FRXA 2AHOB 4Y2PA 1SB3C 2CUYA 4FK0A 3IMXA 1BI4A 4E7IA 3BDEA 1KFSA 3AVFA 2DRDA 4CW7B 4IFVB 4DV0F 1L7OA 8ICZA 1F5SA 4K50A 1X60A 2IM3A 4X66F 2DT9A 4J9VA 8ICBA 1HNIA 2FY1A 1ZQTA 4A2AA 3R2CJ 4F91B 1PAEX 4C80A 2ZGZA 3HOTA 4WF9L 3QX7A 4M3UA 5LMNF 3DLKB 3NMRA 4RQ4A 4UAZA 3LA0A 4GVBB 2PXIA 2HVIA 4BQLA 4TY8A 3HOSA 1YDLA 5AKLA 3AAQA 2HHTA 2D1CA 1BWFO 2WMMA 3MEGA 4PKHA 3TNVA 1RSCA 2LXIA 4CFBA 2JC1A 3MMCB 3AVHA 3IHQB 3OFFA 5DMRA 2NPFA 4YEAA 1VBKA 2ZIVB 9ICWA 2RQCA 5IQ6A 3GQCA 1I3AA 2E8OA 1S72N 1WC0A 1LXNA 3UE5A 4FJJA 1OUQA 2GZOA 1NGHA 4A8EA 2XS2A 3FAHA 4JD2B 2BKEA 1RAIB 4CJ3A 2KFZA 1CJVA 3LUYA 4A8FA 3O8WA 4GY2B 2OZSA 2J8AA 4UOFA 9ATCB 2YKQA 2W9CB 4PAAA 2QA2A 3K75D 3LVVA 2G0AA 1NK6A 4LVNP 2Y1RI 3NEKA 3PTWA 5L8RC 2YMQA 2VQFJ 1VSKA 4IG0A 4F25A 2JMGA 4G65A 3HT0A 5J1EB 2HEKA 1M5OC 2QA4N 4F71A 4R66A 1IJEB 4ZS6A 2WONB 2DHXA 1FO4A 1GXUA 3QU9A 2MA1A 4RW8A 4FJGA 2EZZA 4LF5F 1WACA 1WC3A 4CI6A 1FK9A 1N8RO 1REVB 1K6YA 4QZ9A 1J5OA 2R3VA 2HWTA 4OIXA 4ZVFA 2AW0A 2HB5A 4DV5J 5HI7A 5J0UA 2MUTB 5DG7A 4KC5A 3TJ9A 2X1GA 5F1XA 2O8FB 1U49A 4QIWD 2O67A 4E98A 3MN7A 3PW0A 1T0TV 2HQIA 4KMUA 4E1MA 3NTUA 2OWOA 2FUG9 4YMEA 1GLAG 3PW4A 2ROGA 3P49B 3Q8PB 2Q79A 2XZTB 3GDXA 4M5GA 2V67A 4JI8F 3LP1B 1KQQA 4E8UA 5F3XB 1UP1A 3J81U 2VC0A 4XA5A 2YJFA 1EAYC 3NGSA 4IR1A 3L9ZA 4P52A 5J2DA 4M3TA 4NM2A 3WC2A 4W92B 3PR4A 4F5QA 2E8AA 7ICTA 2HMXA 3KJFB 4PR6A 3MEDB 2BH1A 3T1HK 1I5OB 4DV4J 4C0OC 1VLBA 2IC3A 5DDMA 4JI2F 3FSYA 2WTUA 1JALA 3DNCA 3PW2A 1U1KA 4ZDNA 1U8WA 4N8OA 5IC6B 4DS4A 1A9NB 1ZJMA 5FLXO 4HUGA 5JICA 1LFPA 3IR5B 4CH0S 4B1UB 5THWA 3Q23A 1UVKA 4E0DA 1GT8A 3CP8A 3KKRA 2ZIXA 1OY8A 3AD8C 4K4WA 4PWUA 2D1KA 1J2VA 3KHLA 5G4DA 2MSSA 1OQ6A 2FJDB 5JS2A 4U67Q 1DQ9A 2GLEA 1T3VA 1RHUB 2G2OA 2Q1LA 1VQKS 2DNPA 3L4QA 1MQ3A 4OYAA 4YOUA 3OYBA 3W61A 2B6GA 1G99A 1LW2A 3MPDA 4I6WA 2E1RA 1TFRA 1SXDA 3U1LA 1NSPA 3LANA 3AODA 5ADZA 4OKEA 1T95A 2NXCA 3L8BA 3VQAA 5AM0A 4K4GA 5HL7Q 4OFZA 2N7CA 3K8VA 3ZSRA 5AJ3F 1UOCA 2UUCJ 3B8AX 2A1SA 1KC8T 5B0FA 1WOSA 3TTCA 1UEUA 2IBKA 4FK4A 3ENOA 3HFKA 4IJAA 1VHFA 4F3TA 1B0PA 3NAEA 1WC4A 3WNGA 5CQGA 4ILHA 5ALLA 1XEZA 5HHIA 1BY9A 3OVBA 2GGPA 3B8HA 3DLGA 4W5QA 1Q86O 1Y3KA 3CCLS 3WUHA 4M47A 4NRUA 2IRXA 3PIOL 5J8YC 1FTCA 1ACMB 3IGNA 4IQXA 1M90T 4QS7A 4EHTA 2DB1A 3BGLA 4WPAA 1NLVA 1HKAA 2YNIA 4JK8A 2NPIA 4DF8A 2LEPA 2XM3A 4WU3A 2ZNZA 4JI5F 2DISA 1HJPA 2YQ0A 1BIZA 2Z4PA 4ZHRA 3ELHA 3LPYA 3E51A 3AY0A 1NKBA 4UBCA 1RT1B 3VETA 1QVGM 4FWOA 2EK6A 2O01C 4DHVA 4YD1A 5AM1A 4MIWA 4YB5A 3ISCA 4USUA 1IN0A 3UQSA 3VN5A 2Q3PA 2OH2A 3R5AA 3P1GA 2A3JA 2GQCA 2HGNA 2HZAA 3K17A 4C11B 1X4BA 4K41A 4IRDA 3MM7A 1VJWA 2RHSB 4ECWA 4LIRA 4B3MF 4GXIA 3VQCA 1UVJA 3U8XA 5FIIA 1NRKA 4EI2A 1H73A 1Q3UA 2ZZTA 4B3TF 4O4GB 5G5GA 2B56A 3SMZA 4KN4A 1IKWA 3FZKA 2MQQA 1NK9A 2CVIA 3TZZA 2LYBA 5IILA 3HHKA 4A59A 3DAWA 1U1OA 3HZ6A 1X4AA 2M8DB 1X66A 2XSFA 1C0UA 1X5OA 1AUDA 1VQPS 4I1TA 3QJJA 2KSOA 3CCSS 2RKIB 4DCHA 3H0RB 1N33F 2F8TA 3AU6A 3ZSXA 1U9LA 1KEJA 1VSIA 1UT5A 2OGUA 2GX9A 5ALHA 2VZ9A 1UCNA 4RNMA 2GMHA 2GV1A 2Y0SD 3PEJA 2A6OA 2IOCA 1RWNB 4ED4A 4CO5A 3F2DA 1ZRMA 4I68A 1WN7A 2WRMA 4TUPA 2XYGB 4WFNQ 3WK8A 2I0XA 3CCMS 1VBXA 4KGZB 4PJ0U 4C9DA 4OPKA 1A0OB 2BJ3A 1IVZA 4MH8A 1IBMF 5JUMA 2YNHA 1MU2A 5IIIA 3OJUA 2AJ0A 1WJ9A 9ICLA 1BD6A 2YV0X 3OYEA 1O03A 4S0MA 1BOTO 3G6ES 3BSOA 3I5BA 5H9EJ 3KUEA 4KI4A 2CJ9A 2P9PB 3FYHA 5KFJA 2G13A 2NRWA 4FZMA 4YP3A 4Z7CA 3EE9A 1D09B 5AKKA 1DTQA 1BVSA 4KX5A 1U6BA 2PA8D 2F76X 1QAIA 1MDUB 2SXLA 3KTQA 2RRAA 1XK8A 3ZZYA 5D3GA 3ONNA 1ZBSA 5AKJA 2K60A 3MCOA 1HFEL 3R1HA 4CK2A 2UXBF 3KLHA 1ROFA 4Q2MA 2LSNA 4JKCA 4CJWA 1IG8A 8AT1B 5BRDA 9ICGA 4OI1A 4PPXA 3ENBA 2Z8QA 4GRSA 2K7KA 5KFHA 3ULDA 3KOOA 5HBMA 3NVZA 3LQVA 3VPZA 1ZQUA 1OSCA 5AQLA 4YFUA 3OY9A 4FZLA 1WWUA 2KHVA 2DO4A 2DQNB 3HJEA 4H8KA 1A76A 5GAEI 5AFUA 3OL9A 3HVWA 4ATNA 4A47A 5GAGP 1VQNN 2QT7A 3QMQA 1RG6A 2MQLA 1JQGA 1RHKB 1SWVA 3G4SN 3NRWA 1S1TB 3HHLD 4YY3J 2FHKA 4DTMA 1UAWA 4ECYA 4K4XA 4F4AA 1XNRK 4DR2F 1NOZA 2P9KB 1GFWB 4CLUA 4QJFB 1S0NA 3JAMY 2QE5A 3NCIA 3C94A 3CDUA 4H5TA 2QLFB 2KIVA 3J81O 4C97A 1HQEB 2KNJA 3SR6A 1PZNA 5KFYA 2GIFA 2B8QA 3S3OA 3BQTA 2ZVSA 2H5EA 4QAGA 1UEVA 2RDJA 2EKNA 2NUUG 1G1XA 3JS6A 2UU9F 2HF3A 3K5MA 3CD5A 2V7ZA 4IOAQ 2HW3A 4Z6CA 2EC2A 4DR6F 3IP4B 1B3TA 3MI7X 3FVYA 4ZPAA 2C2KB 3HM8A 4LF9K 3MMVA 2YY6A 3ZFVA 4KRWA 3ZZPA 2O5DA 1O51A 4R64A 3CJ3A 2G08A 5DBAA 1X5SA 3FFKB 1NXIA 3JPQA 4QU7A 4ZTJA 1JK9B 1D4XA 4Y2QA 1NJZA 4FLYA 4PWDA 2UUBJ 4KBOA 4RW9B 1KAZA 3BYRA 1M1HA 4DR5K 5M1OA 4KLMA 2E2OA 1KOHA 2RHFA 4USIA 2FMSA 3M8PB 4I2QA 5IV3A 2A1RA 4RWXA 4FPRA 1SBRA 4PZVA 3CFOA 2FB0A 4DX8H 4F93B 2YHWA 3H1VX 5BPMA 4M5DA 4IQWA 2OHFA 1KN5A 1HLWA 4PHPA 2GIQA 1S1WA 3PNCA 3G9CA 1BC6A 4Q5VA 2UZAA 3MR7A 1B7YB 3SPYA 4PL1A 4FYWB 3GILA 3FQKA 4M41A 3N7PD 2CGJA 2XZDB 3NF6A 1F44A 4I2IA 4CE9A 2A1AA 5AM3A 3HVAA 2E8NA 1XI1A 4OJHA 4BDPA 1QQCA 3CD6N 3R5DA 2QTWA 1UVLA 2M8HA 2HBYB 3RH4A 2BJ1A 1Z00A 4J5OA 5C42A 2EC0A 5A8RB 2E5LF 2DRAA 2ZJRQ 5LMUF 4TLQA 4OHVA 2QW9A 3DLRA 2BRKA 2C3UA 3ENVA 2HFVA 4O8UA 3O3FA 2JDJA 3VQTA 3VEOA 3GV7B 4I27A 1IKYB 2KVIA 3AN1A 4I2FA 5AQTA 4QZ8A 3HZEA 4CHOA 1T02A 3C95A 4MEXA 3M7VA 1IM4A 4OYIA 1NLKL 4CBXA 4KHNA 3BDPA 4A61A 2E9ZA 2QARB 2DWQA 4CEBA 4WU2A 4LF8K 4CK1A 1JB0C 1TKXA 1SB6A 4Z6EA 2IRUA 2XI2A 1YI2N 3ILJA 4DUTA 3HSDA 2FJBB 1LK7A 2MZ1A 2R7VA 5LT5A 2HCFA 1U2CA 4JP8A 4MJKA 3MUTP 1ZZFA 2HQCA 3HT3A 1XNSA 4JLHA 5ALSA 4WFAQ 1T44A 2HS0A 3OYLA 3NBPB 3N6MA 3AQFA 4W4MA 5DK5A 3JTPA 3M2VA 3J81j 2B6AA 4CJKA 3AVMA 2CJAA 4USJC 2NRZA 1ZQYA 2RP5A 3NCPA 2C3YA 3D6TB 1SPBP 1Z2ZA 5KI6A 3H2LA 2KL8A 2D3ZA 4LQ9A 4HAIA 1HI8A 4BACA 4E7KA 1X9XA 3I6PA 3MHYA 4MK8A 1HMVA 1X5PA 3MN6A 4K2XA 1B99A 3THXB 1RBSA 1F2GA 1FXXA 3FFIA 2VPXB 1HR0F 3TANA 2YKNA 2B7BB 1RU1A 2C42A 4CP5A 5IWAK 3MFIA 3HJFA 2R7YA 4Y34A 1IBCB 4K4YA 4KGKA 4F72A 3VAFA 2KJ9A 2HRYA 3ZETB 1N36F 1XMOJ 2JXJA 1Q5YA 5KT6A 1Q95G 3WNHA 4C0HA 2HZVA 4KMOB 4KE5A 1KVIA 3ZT2A 1RTHA 1WSGA 3WXIA 3BGOP 4KB7A 4OPJA 3E9OA 4LJMA 3FGUA 5HROA 1RWOB 2MAXA 2PC6A 1UWBB 1NGEA 3WNFA 1SI9A 2MKIA 3NGKA 4LR9A 1ZBHA 2HS3A 2P5VA 3IGVA 2MHEA 3A8KA 4MFAA 3LDAA 4F3OA 1XTZA 2XMWA 1KTQA 4H5NA 5ALGA 2YJEA 1R8PA 1L3KA 1FRIA 1RNHA 4ED7A 4JV5F 4Y2MA 3NCRA 3IWNC 4M0AA 3H2UB 1I94F 1SCJB 4NL9C 3QGIA 1TFYA 4UT4A 3OUYB 2FLNA 2ZJ5A 3J7AP 2CJKA 2LKYA 3M3ZA 3MR5A 3UDCA 4OO1J 2DFLA 5A0YB 2BOAA 4IWVA 3TR5A 2ALYB 2EK1A 3JXUA 4ED8A 1ZD3A 4UTGA 2NXNA 3BGRB 3VQ6A 1KL9A 5F0XA 2BE2B 4B9LA 3CSKA 3MECA 3RW7A 1NHVA 4B9QA 5CH7B 1UJ6A 2D3DA 2IA6A 4LZGA 4H5WA 2Z2ZA 1LKYA 1IQZA 3WKEA 1A0PA 4I28A 3P31A 2KMDA 4Q0BA 1IQTA 1VSDA 1QQ7A 7ICHA 2MQMA 3GTYX 4NMXA 4U9RA 4PUOA 4DCJB 3EVWA 1DKGD 2I6XA 3H59A 3ZO7A 5JMNA 1HQ2A 4M1KA 1SJRA 3GG4A 5J2NA 3CCRN 1I6JA 2HOFA 4DL4A 1TKTB 5A0LA 2DPNA 5KQDA 4LFAF 4M9JA 3J7ZT 1TTHB 3VGUA 4KLUA 3RTVA 4BCAA 4X62F 3LP2B 3FBCA 1SV0C 5KG0A 4P2MA 4XIUA 2ZC3A 4ZOHC 5BR8K 3BB5A 4DXLA 3ENHA 2XWXA 4I7FB 3JSBA 4IH5A 4DEZA 4OX8A 1V85A 1IBLF 2DGOA 2W25A 3UPFA 2Q97A 4WP3A 4JI4F 4OZ0A 3BV8A 5CXTA 1FRKA 5AKZA 3UR3C 3ZT4A 4DUZK 4JHDB 2IVPA 3CQYA 1UA0A 2IOFA 4CM0A 2PO4A 3MM8A 3F44A 2EG2A 4IDKB 3QNNA 3OTOK 3AEVA 4K43A 3ILIA 1Y5IB 4NX9A 4I29A 1Y10A 1RDUA 3OYNA 1FJCA 3U1NA 3VC8A 3C14B 4M9HA 2IIRA 1RTDA 1EX4A 4RW4A 4NYZA 1UCVA 1HNXF 2FPMA 1ZQNA 4B3SK 1TK8A 4TKTA 5A8WB 1CZAN 1FJGJ 3SLCA 2P5GA 4PXBA 4UASA 1VC5A 2GC8A 4Q8FA 1EXNA 1T7PA 2NRVA 3NP5A 4MAKA 4RW6A 1L3SA 2AEFA 4U6PA 4BJQA 3QAUA 2NZCA 5DM7L 2NRTA 1HWKA 1MLAA 4FO0A 2I5HA 4CT8A 2WAQC 2OI2A 2V2QA 4MDAA 4CGGA 2FE9A 3CMES 1Q8LA 1DLOA 2HBRB 3ENAA 4OYWA 2PMZD 1UJ4A 5FP0A 4BXOA 4ISFA 1CLQA 2PE8A 4DSLA 2VG7A 3QEPA 4OI0A 1FD2A 3U7JA 5GINA 5CD4A 3VQQA 2QEXN 2E7VA 1Z3EB 4FFDA 4US9A 4RQ2A 4P0PA 5B8HA 1VCTA 4IJNA 1PAUB 2OPRA 3OVNA 5DZ7A 3P4UB 1U6ZA 3BN4A 2C22A 2OPPB 1TU0B 4BVOA 4P10A 2F8LA 1BO5O 4H4KA 3HF5A 3WK4A 3TU5A 8ICVA 2ZKTA 4DCCA 4IEEA 3HHEA 3DRPB 4NLQA 2E7XA 1YUWA 2OTLS 2HK2A 3FK4A 3SPZA 4IOBA 1HX1A 3L6QA 3QEVA 4D3GA 3Q83A 3O80A 1I3OB 1GO3F 1OO0B 5GMDA 3G6XA 4CO0A 2WF9A 3MM9A 4KLSA 2A41A 5LJWA 4NCGB 2H3IA 6FDRA 4DR7F 2R7QA 3SQ2A 2DGVA 4YOTA 3ICXA 4NE9C 4BRDA 4FJIA 4CGZA 2WFBA 3T1HJ 3T1YK 5B0GA 1CZ9A 3CPWM 3EM1A 7ICUA 4YOYA 4B1ZA 3TVKA 1F21A 4AT1B 3O9QA 4ICLA 4LR7A 5LJ5Y 1RT2B 2BDUA 5KPRA 2C28A 1NGFA 3LP0B 1S49A 4Y00A 1NDCA 1YITN 1OKJA 4KV8A 2XC9A 4RNFA 3KWGA 3HSJA 1MMLA 2IJNA 2L9NA 3NGTA 5G0RA 1M5VC 1BQNB 1L3TA 4WE1B 3T69A 1HBUB 4LRCA 1JLCA 2LDIA 4YG2A 4P6QA 4HKQA 1Z4OA 3SUNA 3V1OA 3SUOA 2W04A 4G1PA 3OYCA 4DV3J 4BRFA 3DI6A 5D77A 5SZTA 5EVZA 4WTOB 2K1RB 1RTZA 3S7RA 4KLJA 2XSJA 1HJRA 3R2DJ 1YJWS 1SGGA 3HVTB 4FKYA 2FVCA 1NOMA 1D0EA 1HIWA 3MUMP 3C15A 2EQYA 5HK4A 4RQMA 3LDPA 4M5MA 4I2HA 2NYIA 2E5GA 3WX8A 2NXJA 2ASYA 2P9NA 5ALFA 2BZFA 2BMBA 1N6QA 3A5NC 7ICEA 1L8OA 4DPXA 7ICOA 3CCEN 3V7JA 4BC9A 2G8UA 1Q16B 5J0YA 4CF2A 1BXNA 1MN7A 2NSBA 4NLKA 4DSKA 1IKXB 3J80Y 4DMNA 4LREA 4FVMA 4CVNE 3FEXB 2ZIWB 4PKIA 2QB0B 5LSLA 5KQ8A 8ICSA 2UUCF 2HQ3A 3HPGA 2WF5A 2QK9A 4EAHD 3M6KA 4MTPA 2GVZA 3SQIA 4OYBA 2G8WA 3CJSA 4XH5A 5ALMA 2JNJA 3QRQA 1FDAA 4CLWA 3DLEB 5MLCV 5J2BA 2CPZA 4RO0A 2B7CB 1UVMA 2ZE2A 5AFUH 4K42A 3RMCA 2P9LA 3KBBA 1CS4A 3RJJA 1IR2A 3JPSA 3KJVA 1FCAA 2HYIB 1L7MA 3JSRA 3AOAA 4KQZA 4ELTA 4B3OA 4IS7A 1UVIA 2XMVA 2C2ZB 3IM8A 4OJLA 2EBEA 1EQ0A 1FJ7A 3U3GA 1F9EB 3IAS9 5LOQA 4O5EA 3M6WA 3HLUA 3V1RA 2QKKA 4CJPA 4A8KA 1F2HA 1DFDA 2JEGA 2DITA 3SQGB 2IHNA 3POTB 3UCZP 4CGJA 2A18A 2DY1A 2DVIA 2A6MA 4CH1A 2M4MA 4X4PA 5AZIA 4P74A 2PEBA 1RT3A 1RAJA 3SUPA 2DXFA 4OX9F 4ED3A 4X65F 2XMUA 4NLUA 3TP2A 4ZP9A 1RBRA 2FDNA 4AQYK 3O5BA 1PC5A 4RT2A 2P51A 4K2JA 5KFEA 3DRRB 3S1TA 2VQEF 3RMDA 5D15A 3QUTA 3W0LA 2IVNA 4CZJA 2M88A 1NMNA 5CHIA 4DCOB 4B08A 4B3RK 4HHTA 2I9GA 4KO0A 5DQHA 1DT9A 1AQ6A 2BANA 2OA8A 3CJTA 1YHQS 5BPNA 3RH5A 1TL5A 1BUPA 2W55A 3KLIA 3ETRA 3MEEB 3QRPA 3PX0A 1UQVA 3DLBA 4MKYA 2MLYA 3D1OA 4FJLA 1TVRB 5KFAA 2Q43A 3O9SA 4UW2A 2MEWA 3DOKA 3TJ8A 4ISEA 1VIOA 5IS2A 2HG4A 3D68A 2HWIA 3UNYA 4NM1A 3TOQA 3D2SA 2VKRA 4A5BA 2PT0A 4FNHA 1FI4A 4YDUA 3H46O 4CYUB 4RWTA 2IM2A 1SJFA 1L7NA 3BSAA 3BQ1A 2IBOA 1JCEA 1VI7A 3MABA 2Q66A 2XZWA 4CJVA 1RQLA 3H0PA 3TYTA 3QBCA 3AD7C 1BPYA 3H5SA 3QYPA 1WHXA 4F0MA 5ELZA 1QLNA 1ZH5A 1VQMN 3WZ0A 3ZEUA 2XBPA 4AF1A 1X42A 2B4UA 3S3MA 3D0HE 2JH1A 3VQSA 5G5HA 4KSEB 8ICUA 2ZBIA 1HKBA 4N77A 4LFBF 4EP4A 5ETLA 4OHXA 2P9UB 4M3WA 2W2OP 1RBUA 1W25A 1FWKA 2CADA 3C6UB 3ET6A 3CJ2A 4CJRA 2Z1HA 4Y2VA 2JEJA 2B9WA 4R5PA 3O1BA 3UDLA 3CCQS 5EOYA 5KFKA 3SBTA 3D6HB 3EKSA 3JSMB 3PSFA 3QJPA 4LZDA 1U4BA 3SSRA 1ZQPA 3MMBA 2COLA 2J9DE 1VQOS 1X9JA 4BG8A 4AHSA 4H54A 1VJ5A 2HURA 2UVUA 4BDZA 3NWGA 2GAHC 1MWKA 2HHHK 4LBIA 1RZMA 1U24A 3LAMA 4DL5A 4CJFA 1R6VA 2QA1A 4QWDA 3W5ZA 2XMMA 4XAKA 2QSWA 1RGIA 2JSXA 1ZQMA 4OI6A 1QQ6A 1PVPA 3DV9A 4LF7F 4DL2A 3LALA 3EPGA 3VZHA 4BR5A 4IFVA 1NM1A 5ALNA 4BROA 1SQEA 1XNRJ 4BE1A 1WEZA 1OS5A 3IKMA 3F53A 3QDKA 3DLKA 4M63A 3LPEA 3AQPA 4GVBA 5D4BA 5J2IA 1R0AB 3K5NA 2ZM6K 1NSQA 5CAAA 3PMNA 4V19X 3D6MB 3GR1A 5KPTA 3ULHA 1M5SA 3D2EB 3THWB 3CULA 5DDYA 1WD6A 1VJQA 2R8HA 3OBWA 4LRAA 1CJKB 3MMCA 3R8EA 1PKUA 2ATCB 2H4YB 1GMWA 1S1UB 4CERA 4ILLA 2EANA 1L3UA 2ZIVA 4Q43A 3M6UA 1VQLN 3FSXA 2K3KA 4ZIWA 4LF9J 3G25A 2N4DA 4FYYB 4H0XB 4FKXA 2WB1C 4A5AA 5JS1A 3CCJS 4CEOA 5MLCQ 4JD2A