4DT5A

Crystal structure of rhagium inquisitor antifreeze protein
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
143
structure length
143
Chain Sequence
GYSCRAVGVDGRAVTDIQGTCHAKATGAGAMASGTSEPGSTSTATATGRGATARSTSTGRGTATTTATGTASATSNAIGQGTATTTATGSAGGRATGSATTSSSASQPTQTQTITGPGFQTAKSFARNTATTTVTASHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antifreeze protein
publication title Crystal structure of an insect antifreeze protein and its implications for ice binding.
pubmed doi rcsb
source organism Rhagium inquisitor
molecule tags Antifreeze protein
total genus 58
structure length 143
sequence length 143
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.150.10.20 Mainly Beta 2 Solenoid Alkaline Protease, subunit P, domain 1 Alkaline Protease, subunit P, domain 1 4dt5A00
4DT5A
chains in the Genus database with same CATH superfamily
2XQHA 1SMPA 2ZVDA 3HDAP 5CXLA 3HBUP 3VI1A 1P9HA 1AF0A 1H71P 2ZJ7A 2YO0A 3HB2P 5CVWA 5D7WA 3A70A 1OMJA 1SATA 1OM7A 1JIWP 2ML2A 3LAAA 2QUBA 3ULTA 1GO8P 1O0QA 2YO1A 1K7GA 2QUAA 3NTNA 1K7IA 1KAPP 1GO7P 1O0TA 2ZJ6A 1OM6A 3S6LA 3LA9A 1K7QA 2AGMA 1G9KA 4I35A 1SRPA 3A6ZA 1OM8A 3U1RA 3WP8A 3HBVP 2Z8XA 1AKLA 2Z8ZA 4DT5A
chains in the Genus database with same CATH topology
4DT5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DT5 A; 
#chains in the Genus database with same CATH topology
 2XQH A;  1SMP A;  2ZVD A;  3HDA P;  5CXL A;  3HBU P;  3VI1 A;  1P9H A;  1AF0 A;  1H71 P;  2ZJ7 A;  2YO0 A;  3HB2 P;  5CVW A;  5D7W A;  3A70 A;  1OMJ A;  1SAT A;  1OM7 A;  1JIW P;  2ML2 A;  3LAA A;  2QUB A;  3ULT A;  1GO8 P;  1O0Q A;  2YO1 A;  1K7G A;  2QUA A;  3NTN A;  1K7I A;  1KAP P;  1GO7 P;  1O0T A;  2ZJ6 A;  1OM6 A;  3S6L A;  3LA9 A;  1K7Q A;  2AGM A;  1G9K A;  4I35 A;  1SRP A;  3A6Z A;  1OM8 A;  3U1R A;  3WP8 A;  3HBV P;  2Z8X A;  1AKL A;  2Z8Z A;  4DT5 A; 
#chains in the Genus database with same CATH homology
 4DT5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...