4DTAA

Crystal structure of f95m aminoglycoside-2''-phosphotransferase type iva in complex with adenosine
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
298
structure length
298
Chain Sequence
MRTYTFDQVEKAIEQLYPDFTINTIEISGEGNDCIAYEINRDFIFKFPKHSRGSTNLFNEVNILKRIHNKLPLPIPEVVFTGMPSETYQMSFAGMTKIKGVPLTPLLLNNLPKQSQNQAAKDLARFLSELHSINISGFKSNLVLDFREKINEDNKKIKKLLSRELKGPQMKKVDDFYRDILENEIYFKYYPCLIHNDFSSDHILFDTEKNTICGIIDFGDAAISDPDNDFISLMEDDEEYGMEFVSKILNHYKHKDIPTVLEKYRMKEKYWSFEKIIYGKEYGYMDWYEEGLNEIRSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APH(2'')-Id
publication title Structural Basis for Dual Nucleotide Selectivity of Aminoglycoside 2''-Phosphotransferase IVa Provides Insight on Determinants of Nucleotide Specificity of Aminoglycoside Kinases.
pubmed doi rcsb
source organism Enterococcus casseliflavus
molecule tags Transferase
total genus 103
structure length 298
sequence length 298
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01636 APH Phosphotransferase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4dtaA01
3.90.1200.10 Alpha Beta Alpha-Beta Complex Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 4dtaA02
5ITAA 3OY3A 3FLZA 3F7WA 5HVJA 3JVRA 3QWJA 3NUNA 2YACA 3HEGA 4YTCA 3KB7A 4ZZNA 4RZWA 3DLZA 3P86A 1DI8A 1PF8A 1FGIA 3FHRA 4IWOA 4YPDA 4R6VA 4TWOA 4GK2A 2X6EA 5LVLA 3AT4A 5L2IA 2VWVA 4TWPA 3LM0A 1S9JA 4II5A 1XH6A 3A7JA 4UB7A 4JRNA 2YIXA 4MXAA 4EORA 1OIYA 2CDZA 2F2CB 3AMYA 4IM2A 5EI2A 4XOZA 4AS0A 2WMSA 4D4VA 2YM5A 3QGYA 2B9JA 5TT7A 3HDNA 2YERA 4ASDA 2LGCA 3TUBA 2UZUE 3DDQA 3POOA 4DCEA 2C5VA 3VRZA 3LMGA 5BVKA 3KXMA 4OTIA 2IJMA 3FMKA 4WKQA 2PVHA 3Q4CA 2GS6A 1PMEA 4FIFA 4RX7A 2W4JA 2OJJA 5FBNC 2PUPA 4AGUA 1NVRA 3TT0A 3SV0A 3NUAA 4WG3A 4Q5EA 4ITHA 3SRVA 4BGHA 2C69A 2H6DA 4MBJA 3V8WA 3VQHA 4TYIA 4CVAA 3OS3A 4NCTA 3Q04A 4RLKA 3ODZX 4YZBA 5L2TA 1GZOA 1FPUA 4FSZA 5EFQA 3QRUA 4YBJA 3TTIA 3NUYA 1OB3A 2AUHA 4JX3A 2ITTA 3TUCA 4L44A 4FKVA 4KBAA 4NJDA 4HVHA 4BYJA 1QCFA 2ZV7A 4I0RA 1WBNA 2C1BA 2IN6A 1ZXEA 4IHPA 4GVJA 1SM2A 3DTWA 3SXRA 3FXZA 4MKCA 4YJQA 3VBTA 4G3EA 4IVCA 4KB8A 3UPZA 3Q9XA 3RJCA 4BZOA 2PZRA 4NTSA 4D0XA 4FA2A 4TNBA 4WNMA 3FL4A 3WZDA 2C6DA 2HZIA 3QTRA 4CFUA 3UMWA 5M44A 3PA3A 4KABA 2A0CX 4FKOA 2WTWA 2WEVA 4MYGA 4RLLA 4ZJVA 3Q52A 4DH5A 5FRIA 2BDJA 5AM7A 2OH0E 2CSNA 3OVVA 5AA8A 4R7BA 3MIAA 5CAPA 4ZTRA 3SDJA 3O17A 4EOKA 2BHHA 3D2KA 1UU7A 4FEXA 2QR8A 4FG8A 5CY3A 4JVGA 4L52A 4RC2A 3T3VA 2XRWA 3O23A 5ACKA 2WIHA 1IA9A 2QHMA 3W8QA 3EQRA 4NFMA 2CCHA 4B9DA 1U4DA 4F09A 2JBPA 2W9ZB 3ZCLA 3REPA 3EWHA 1Y8YA 3PJ3A 3QUDA 2UW0A 1ZOHA 3PY1A 4CV8A 4OTGA 3JXWA 4PP9A 5FUTA 4FG9A 1XJDA 2WMVA 4TYJA 4BKJA 3QBNA 2CN5A 4C36A 4PDYA 3FZSA 4MNFA 3HV3A 1UU3A 3P1AA 4FSRA 3OG7A 2ERZE 2HAKA 2JIVA 3AC2A 3EFKA 4O2PA 1RQQA 1ZAOA 4GUBA 3PXFA 2J0LA 4NT4A 4PTEA 1NY3A 3TZ9A 4PQNA 1FINA 4FEUA 4FSTA 4I0SA 2VX0A 3FMDA 3G9LX 2VWBA 4YLJA 3R7UA 4AWIA 4BDDA 4F70A 5A4CA 3CGFA 4LOQA 2UZWE 4G9RA 4BCFA 4O82A 3IOKA 1Y57A 5LQFA 3V5TA 2X8DA 4AN2A 2YHVA 4H3QA 5J1VA 3O2MA 3ZSGA 2R3RA 3KULB 1KE9A 2R3HA 4V01A 4X7QA 4EC8A 2C4GA 3FQSA 5CU2A 2V62A 2EB3A 3I1AA 5L2WA 5GIOE 3Q4UA 1A9UA 3N4VA 4NTTA 1QL6A 4BGQA 2XK3A 5IDPA 2BKZA 3NAYA 2DS1A 2V55A 2VZ6A 2VWWA 4I5HA 1B6CB 1YW2A 2YISA 3FZOA 3VULA 5K9IA 4I6FA 4J99A 3UO6A 5M57A 2VGPA 2WOTA 2PVLA 3ANQA 2XIKA 2XMYA 3GT8A 3K3IA 2FVDA 2OKRA 3FUPA 1JKKA 3EQCA 3KGAA 2VD5A 4A9TA 3GCPA 1JLUE 5HO7A 2PE1A 1UWJA 4RVLA 3ZYAA 3RINA 5CXHA 3OD6X 4FUYA 4LRJA 3UOJA 5CQUA 1IG1A 4Q5HA 3PSCA 4DE4A 4I6BA 5FTQA 3GB2A 4FIJA 1IR3A 5H8GA 4BR3A 4ZLZA 4DGLC 5HE1A 3F7ZA 4DGNA 3AT2A 2YA9A 1GAGA 2QOBA 2RL5A 2C5YA 3H10A 4QNYA 4ZTQA 5AAFA 4FTNA 3R7OA 2YN8A 4FODA 3AC8A 3EKKA 3R22A 4TN6A 1L3RE 2R3MA 4DTBA 4ANQA 4L6QA 3E62A 5DN3A 4ZSGA 2C5NA 4IDTA 5AP7A 1F3MC 2C6IA 2G15A 3HLLA 3V3VA 4IM0A 3QYWA 4M13A 4RIXA 4E4MA 4CKJA 5LWNA 1OL7A 4ANSA 4EOMA 5CEKA 4TYHB 2RIOA 1KE6A 4FNXA 4APCA 4JBPA 3LCOA 4B7TA 4CRSA 4O7WA 4AE6A 2YM3A 4R7HA 1OI9A 4B8MA 3Q6WA 3QXPA 4I22A 2PMNX 2FGIA 4PUZA 1V0OA 1FMKA 2YIRA 3R7IA 4F1OA 4F7NA 4HW7A 1E9HA 5DT4A 5HLWA 3ATTA 3QTUA 5DHJA 3U9CA 5JKGA 4I3ZA 3MVLA 3GGFA 4FIIA 4ACCA 5B2KA 4YJRA 5JFXA 5GJFA 2OU7A 5AIRA 2GDOA 1M17A 3MFTA 3AC1A 2R3GA 5I5ZA 4CFWA 4RX8A 4OBQA 1PXOA 2HWOA 5BVOA 3TN8A 4W4VA 3QWKA 3C4WA 5ANIA 4AACA 3IW6A 3MDYA 4D5HA 5TOZA 4X6QC 4BTMA 3F2NA 3H4JA 3ZC5A 5K4JA 3SW7A 3C1XA 2WTCA 2H8HA 5HICA 3L9LA 2BUJA 1KE5A 4Y73A 4PTGA 3A62A 4M67A 2UW5A 5CU4A 3LFNA 2BCJA 3NUSA 3C5UA 4W8DA 3TEIA 5BX0A 2YEXA 3VO3A 3K54A 5HG7A 2YITA 3R9DA 3NW6A 3ORLA 3CQUA 2FUMA 4YJNA 3HAMA 2EWAA 1AGWA 3FZTA 4QTEA 4G6NA 2GFSA 4GJ2A 3QD0A 1OBDA 4MHAA 2BROA 4UZDA 1U54B 3VHKA 4C2WA 4BDFA 2BRNA 1BKXA 3L8SA 4RX9A 3ZUUA 4TRLA 3ZZWA 5LWMA 2I40A 4EQCA 1HCKA 1KOAA 2PUIA 3OXTA 1PMUA 2R7BA 5D7VA 5M4UA 2FSOX 1X8BA 1H0VA 1Q99A 3RKBA 2XYNA 5L6WL 2LAVA 2OFVA 3ZEPA 1PXMA 2W5AA 4G1WA 4G3GA 4MNEB 4QQJA 3F6XA 3ZEWA 3WF7A 3RM7A 3HRFA 2VTPA 2E9OA 3VUMA 2JDSA 2UW7A 3N9XA 3ORXA 4WIHA 4EK4A 2ITWA 5IA4A 4IX6A 3E93A 4BCQA 3VRYA 3AG9A 4YPSA 5A46A 2JDOA 3S00A 3QUPA 4D2RA 4YSMA 1ZOEA 2OICA 3HP5A 3TKUA 3FEGA 4PL4A 2WTKC 4GRBA 2Y7JA 5HX8A 5J9LA 3EQDA 3HMNA 3KMWA 3BLRA 3TUDA 4TWNA 1OL1A 3UYTA 3OOMA 4YJUA 2QU5A 1AQ1A 5DYJA 2WXVA 1HOWA 2NRUA 4KRCA 2QO9A 3UP7A 3MJ2A 3S4QA 3DOGA 4G5PA 4FYOA 4OT6A 3U55A 4BYIA 3N4TA 2I6LA 1ZLTA 4QNAA 4QYHA 4IVDA 4EOLA 5IISA 2W1ZA 3HMOA 1Q4LA 2KTYA 2XZSA 1PKDA 4I93A 4DBXA 2CHLA 4JG6A 3RHKA 4IADA 4IX5A 4AZTA 3BYOA 3W0RA 3P0MA 3QUEA 2VTSA 4FIHA 5CSHA 4IE9A 3QKLA 1WBTA 3EIDA 4FKSA 2GTNA 4K11A 3O0GA 4ENYA 5JH6A 2QVSE 5GHVA 4ZZOA 3PLAE 5DE2A 2UW6A 3F5PA 3HVCA 5AUYA 4WA9A 1XH7A 3KK9A 4Y5HA 2FSMX 4GU9A 3NIEA 1CTPE 4HYHA 1H4LA 3F5UA 2ITVA 3UJGA 1ZY4A 4I1ZA 2YWPA 4YZ9A 5EDQA 1KSWA 4DFBA 2A1AB 5HLPA 5JZNA 4NW6A 4DT9A 3PRFA 1YWVA 3SX9A 5HBEA 4QMLA 3I79A 4LV8A 2P3GX 2WELA 4RX5A 4QOXA 4I41A 2FYSA 4E26A 2O64A 3OROA 4KIOA 4W4XA 3D94A 5DFPA 3THBA 4BB4A 4DGOA 3MWUA 4K18A 4JS8A 2H34A 4U8ZA 4PTCA 5AAEA 2HWPA 3NVMB 4JLCA 1Q62A 4O84A 3ETAA 2ESMA 2XKEA 1YDTE 4DAWA 5CYIA 2A27A 4QQTA 4D2SA 4WT6A 5FTGA 3LQ8A 3BKBA 3A99A 4KINA 4NH1A 3H9RA 5K5XA 1XKKA 2ETMA 2R3PA 4N4SA 3RK5A 2R5TA 2VRXA 4AW5A 3HV7A 3VF9A 5AP4A 2CPKE 1KWPA 3R2YA 4G9CA 3IPHA 4NKSA 1J7LA 2QR7A 3OEZA 3BBTB 2NPQA 3E87A 4HGSA 2HW7A 4DH1A 3GOPA 2P2IA 4LGGA 3BLQA 3FLYA 1P4OA 5L8KA 4D9UA 5A14A 4FV8A 3ZSHA 3UE4A 4OTDA 4BCJA 4BIDA 2HY81 3SQQA 4PP7A 1UKIA 2O5KA 3PWYA 3UOKA 4E7WA 5M08A 5FEEA 4U7ZA 4FZ7A 4KD1A 4L45A 1WBOA 3IW4A 2O63A 2QLUA 3BIZA 4B8LA 4CFVA 5C8MA 4DFZE 1BYGA 3K5UA 4ZLOA 5D10A 3PJCA 2OJFE 4LRKA 3NYOA 4E93A 5M51A 1STCE 2Z7RA 3AGMA 2X7OA 3EQPA 4JL9A 5CSWA 2IW8A 4A9YA 1PRYA 4YZCA 1KE8A 2CKPA 4B99A 4F99A 4UN0C 3UZTA 5F20A 3VC4A 4OUCA 5C4LA 2WMBA 4L00A 5KBRA 4ITJA 3D4QA 3RI1A 2ETKA 2BAQA 2CLQA 4W4WA 2BAJA 3NIZA 3HYHA 3D5WA 5HESA 2OG8A 3LCDA 2X9FA 3MY5A 4F0GA 3CPCA 3C5IA 3LM5A 3UVPA 5IUHA 1U46A 3QQUA 4FTLA 3AMAA 4J8MA 5ANOA 5AUWA 5C9CA 3GCSA 3UO4A 3QFVA 1H1QA 3OW3A 4XYFA 4D4RA 4PY1A 3NRMA 4WBOA 4HPUE 1XHAA 2C3LA 4KSQA 3VS3A 1LPUA 5I9YA 2IWIA 2X2LA 3IKAA 2CMWA 2C6LA 3QQKA 2GFCA 5EW8A 3R1QA 3R1NA 4BDEA 4FGRA 2GCDA 2WMXA 2WGJA 2FH9A 3ZRLA 4XJ0A 1ZWSA 1U5RA 2WMWA 5B0XA 3OTUA 2CNVA 4S30A 4RC4A 3QXOA 3BE9A 4FV0A 1JPAA 3E63A 4TXCA 3CCNA 3K3JA 2E9VA 1J1BA 4G3FA 1CM8A 3W2CA 4F6UA 1PW2A 3PA4A 5BVNA 4X3FB 5H9BA 3TM0A 4YUQA 5E8TA 4I0TA 2XB7A 3LJ2A 1OL6A 2PMIA 4XCUA 2YJRA 3DKGA 1YXVA 2ZM4A 5M4CA 3F61A 4GSBA 1REJA 4KUJA 4BDJA 3LJ1A 3FKNA 5EW9A 4DITA 2RFSA 5J7HA 2P2HA 4KSPA 2J4ZA 3LFFA 4U44A 5H3QA 2IW9A 3EN5A 1OM1A 2XK4A 4FTRA 3KULA 2C6EA 3GVUA 5JK3A 2OSCA 4OTRA 4TT7A 5EQPA 2G2HA 3U6JA 1A48A 3DDPA 4WNPA 1RE8A 3TKHA 2E9PA 1QPEA 2FB8A 5ETCA 3MVHA 2R3OA 1FVVA 4AGCA 4QQ5A 3O51A 3ACKA 3QD4A 1APME 1OUKA 3WF8A 4QTDA 2UVZA 3ACJA 3CS9A 3ORNA 3WZKA 2IVUA 3R1YA 2QKWB 4I4FA 4RJ4A 2VTHA 4H1JA 2R4BA 3FZ1A 3MIYA 4NM7A 4BBEA 2GU8A 5LMBA 3ET7A 4MEDA 3QAME 1CKIA 3QZGA 2JKQA 5LCJA 4O81A 3R6XA 3TJDA 2QOKA 4MQ2A 3C0GA 3DY7A 4RGJA 4IC7A 4ANBA 2WPAA 4O6LA 4AP7A 4BI0A 3TV4A 4EJ7A 1Y8GA 5AP6A 2F57A 2O2UA 1R3CA 2XNEA 5TKDA 4OGRA 4O27B 3W2QA 2HXLA 2XNNA 3R01A 2A19B 2W7XA 1LR4A 3OWJA 2GHLA 4LRMA 2PTKA 3VNTA 5AM6A 3BE2A 2R3IA 3DNEA 3TYKA 2PHKA 1JKTA 4FT5A 3HV4A 5LOHA 3VUGA 5JFVA 2ZMCA 4FIEA 3LMHA 3GFWA 4TNDA 2R3KA 4RVKA 2E9NA 3DK7A 5ACBC 4C3PA 4QT1A 4G6LA 4EOOA 3GP0A 2OIQA 2G2IA 4FK6A 3HRBA 4U94A 4O7TA 4XLIA 5HBHA 4TYHA 3NW7A 4JJRA 3BHUA 4PDPA 3MPAA 5L8JA 3D9VA 3EHAA 4F6WA 5HQ0A 4FEVA 4IFCA 2RGPA 4PDOA 2XNPA 5TO8A 4BCNA 3DBQA 4AQCA 2XK6A 1YOLA 1JVPP 1OVEA 2BILB 3G0FA 4FTTA 4EC9A 4L43A 3CD3A 3QTWA 3ZBFA 3GCQA 4TWCA 4MCVA 4E5BA 1XO2B 5BUJA 3CLYA 4NYEA 1YXUA 3OTVA 4EI4A 5H8BA 3HA6A 5H2UA 3OP5A 1H1RA 3ORZA 4GW8A 4FL1A 4AU8A 5J9ZA 5LARA 1GOLA 3A7IA 4YP8A 5CU3A 3BYSA 4TY1A 4DG2E 3JR1A 3MV5A 2CGUA 3C4FA 3BI6A 4J97A 3BQCA 5IA3A 2J9MA 1ND4A 2B0QA 3NCZA 4CV9A 3K2LA 3U6HA 3TL8A 2VX1A 5DG5A 3W2SA 3DXNA 4UZHA 4GFOA 5G6VA 4AZWA 3BQRA 3LFCA 2PVMA 4CLIA 4CFXA 1ZZ2A 2Y4IB 3EJ1A 1UV5A 4O7RA 4O21A 2VO0A 3UC4A 3D5XA 3R21A 1ZY5A 3M11A 3LQ3A 3RPSA 3ZFMA 5IH4A 5L6OA 4A07A 4NCTC 4XNEA 4JIKA 3VW6A 4YSJA 3MA6A 3GBZA 5CNOA 4WD5A 5HBJA 3G5DA 4QRCA 4FV4A 3FI4A 5CVHA 1U54A 5HG8A 2GNGA 4AA5A 3FLSA 5JMSA 4QMQA 2R3FA 4DF3A 3FMMA 2OIDA 3O7LB 3POZA 2ZYBA 2I0YA 4DINA 2YAKA 3VJNA 3GU5A 4C58A 3RK7A 5HVKA 2X4FA 3EZVA 3L8VA 3PIZA 5HO8A 2XKDA 4FSQA 3TACA 5JQ5A 4EUUA 5HCXA 1JSVA 4E6CA 4XV9A 4L46A 5KE0A 4BCMA 2F49A 3UQFA 4XP3A 4MNEA 1Q97A 5DR2A 2Z7LA 3R8MA 1H07A 2J5FA 3TWJA 5JN2A 4MBLA 2C0TA 4RMZA 3CR0A 4A9UA 2WQBA 3TI1A 1UU9A 5ANDA 4MQ1A 4XG2A 3FV8A 4ASZA 4PMTA 4MAOA 4DEHA 2ZM1A 5JFSA 2ZVAA 1K2PA 2Q0NA 1V0PA 2OXYA 3TNWA 4Q9SA 4QPSA 3BU6A 4AOJA 5GJDA 4DH3A 2W99B 3R8UA 1XH5A 3LJ0A 5L6PA 2VU3A 2CGXA 3TXOA 1YXXA 5FXQA 1P2AA 5EW3A 2BIYA 4AXAA 2VTQA 3ZLXA 2PMOX 4X6RA 3FLQA 3NNVA 1YI3A 4CT2A 3U4WA 2OH4A 3AGLA 3G15A 3MH1A 2BTRA 4RIWB 3T9IA 4IIRA 3W2PA 4CZTA 3GI3A 2ACXA 3C7QA 3RAKA 3D7TB 5LVOA 2VWZA 3EQFA 1WBPA 3KF4A 2UZBA 3MYGA 1OGUA 3DAKA 4N57A 2I1MA 3PXRA 3V51A 4IAFA 2BRGA 2BZKB 4B4LA 4Z7GA 2GQSA 3AXWA 4DH8A 4BI2A 3KRJA 5IUGA 5TF9A 2WZJA 4MF1A 4L3JA 3P78A 3BHVA 3H3CA 1ZYCA 2PZIA 3HMPA 2UW9A 4M12A 1YXTA 1V1KA 4C34A 5IMXA 3K5VA 3HMIA 4FTJA 5GJGA 4BY9E 3R9HA 3F66A 2Z2WA 4BDGA 3EN6A 5JGDA 4FTMA 1U5QA 2PULA 4CCUA 4OTHA 3NUPA 5KMOA 3QQHA 1JSTA 4AG8A 4KNBA 2C0IA 4ZMEA 1M2PA 3LKMA 2QG7A 3SA0A 1H0WA 4NIFB 5IEVA 2BDWA 1ZYSA 3IS5A 2Z02A 3PUPA 3Q2JA 4CTBA 3ERKA 2WTDA 4FT9A 3UYSA 2XA4A 5AEPA 4CZUA 4ZY4A 3PJ1A 3UVRA 2VWYA 4QMTA 5E91A 4ARKA 4FV2A 4CTCA 2VTOA 3GU6A 4JBOA 3MH2A 4RA5A 3TJCA 4IZ7A 3GCUA 5KMNA 3QTSA 3FZRA 3DBEA 5E8SA 4GKIA 4F9AA 2GTMA 2OXDA 3WF6A 2XRUA 3ZO4A 1OUYA 4NU1A 5AIKA 5IA1A 3CTQA 3RAWA 4O38A 4OBOA 3SVVA 1U59A 2QONA 4YJOA 3NUXA 3EN7A 5CF4A 4X3FC 3KY2A 5HNGA 3R8LA 3FI3A 2OO8X 3P5KA 4N0SA 4RQKA 4IVAA 4IEBA 3F3VA 2QCSA 3OC1A 1MRVA 3KKVA 4AAAA 3M2WA 2PVRA 4KKHA 4AGWA 3OF0A 2C6OA 3UOHA 5DH3A 2XBJA 3BYUA 5A9UA 4JR3A 4LMUA 3DKFA 1Z5MA 1TVOA 4E1ZA 4J8NA 3ZHPC 4EBVA 4FNYA 2FO0A 4FICA 1UA2A 3BBWA 3EQBA 1OMWA 3TCPA 4GG7A 1YVJA 2HCKA 3BPRA 1WVYA 5C8KA 2BTSA 2QC6A 3OUKA 2IO6A 2NP8A 4CSVA 2XH5A 3IO7A 3EFLA 4EHZA 3A8WA 3HUCA 1RW8A 2W1EA 2CKEA 5AV3A 4CXAA 3MB6A 4BC6A 3P9JA 1YHVA 4F64A 5LVMA 3R9NA 3UVQA 4DFXE 1YWRA 2EVAA 2IG7A 5K5NA 4MD8E 5ETIA 2JD5A 4NFNA 4RFYA 3GCVA 3MVMA 2CLXA 4GCJA 4BIEA 4L8MA 4MXCA 4O0VA 5H8EA 5AUVA 5JGAA 2X8EA 3LFDA 5ETAA 5E4HA 4O7SA 2P4IA 4EQMA 4E73A 2OZAB 3EH9A 3LXLA 4IAYA 2BALA 3R63A 1JBPE 3U8WA 4DCAA 1YKRA 5F95A 4RWJA 5FQDC 3RCJA 4ZMFA 3NSZA 2UW3A 4MTAA 5L8LA 4QMMA 2HOGA 3U6IA 4J96A 4XX9A 3S3IA 3EN9A 3Q96A 4X2FA 2BKKA 1WZYA 2XCKA 5DR6A 4HGTA 4D1ZA 2WMAA 4TTHB 4JAIA 2W0JA 1W0XC 4ZLYA 4JDHA 1NA7A 4O22A 1XH9A 4C4FA 3UZPA 2IPXA 3CIKA 4BTJA 2OIBA 3NR9A 4EOIA 1NW1A 5EM6A 4BDKA 4H39A 4ZEGA 3EOCA 2B9FA 2QD9A 1T45A 3BGPA 4I6HA 4M8TA 5E8XA 3SD0A 3LOKA 4FKTA 3VS4A 4O86A 4D1SA 4X21A 2ITXA 2PZ5A 3EYGA 4R7IA 3DA6A 3SKCA 2WMUA 3LFAA 4FV6A 3R7VA 4X3FA 4BN1A 4LOPA 2YCSA 3O8TA 2VTAA 4KAOA 2VWXA 4XMOA 5A3XA 1VYWA 1GZNA 3KXXA 4X2JA 4DT8A 3Q6UA 2O0UA 4GYIA 5FM2A 4RFMA 3MGYA 4YTFA 3PJ8A 2WAJA 3OT8A 1MQ4A 5AWMA 4CG8A 2QOIA 4ALUA 3PVUA 5BQ0A 2ITUA 4XS2A 2Y4IC 5BVDA 2C6MA 1JSUA 3BELA 4HCTA 5CU6A 4FL2A 5IDNA 4IB3A 3HKOA 1OECA 4PRJA 4RG0A 3GUBA 3W16A 1QMZA 3R28A 3FBVA 3UQCA 4I94A 4I21A 4OLIA 3VWAA 4QYFA 3PIXA 4XH6A 3CQWA 3NPCA 2R0IA 1KV1A 4FC0A 1JAMA 3CXWA 4IC8A 2GNIA 5EDPA 1OPKA 5FBOA 2Z60A 3QL8A 3V5JA 1O6LA 3VHEA 3BGQA 1SZMA 3ORKA 2YM7A 4U5JA 4UXLA 5CS6A 3NGAA 3W32A 3P7BA 5DVRA 4AF3A 1E1VA 4EK6A 3BGZA 2C30A 3ZXTA 1P14A 4GUEA 2ZJWA 4FKUA 2GNHA 5CLPA 4AZEA 2JDTA 3I6UA 2I0HA 2PVNA 2XIZA 3UBDA 3JVSA 2WQOA 2A2AA 3RGFA 1XH8A 4X0MA 5ANJA 3QQLA 2XUUA 1UKHA 3BHHA 5DA3A 4BDCA 4UWYA 2RKUA 5GINE 1L8TA 4A9SA 3QC4A 4NK9A 3DV3A 4XV2A 3IK3A 4KS7A 2IZSA 3CTJA 4L3LA 4RJ5A 5CX9A 3UZRA 3L1SA 3ZUVA 4EOSA 5C01A 4FTOA 4ZTMA 3NW5A 3E64A 5CSXA 4APPA 2XCHA 3OUNB 5DI1A 5KZ0A 4JX7A 1YOJA 4KBKA 3ULZA 3ORPA 3WZJA 3L8XA 3MA3A 3VVHA 1OIUA 5G1XA 4J53A 3R9OA 1Q8WA 5EHOA 5M55A 4CD0A 1FOTA 5EI6A 2JC6A 3ULIA 2JITA 2E2BA 2G01A 5FG8A 3CEKA 4QPAA 5CI6A 5BVWA 3C0IA 4C4GA 4F08A 2GNFA 4G34A 1W8CA 1PY5A 3KQ7A 4R5SA 3ZBXA 2WMRA 1URCA 3IECA 5JGBA 3HUBA 4CFNA 4DC2A 3IDCA 3CE3A 3PXQA 4AOIA 3G33A 3KXHA 4L3PA 4DG0E 5CSPA 3QRJA 4IWPA 4R1YA 2W9FB 2JKMA 2VTMA 5E7RA 3AD4A 3F3WA 2C3JA 4JDIA 3SOCA 1BI8A 3QHWA 4H36A 3VQUA 3ATSA 3HV6A 4L7SA 2BFYA 4QMUA 2WQEA 4FZ6A 5CXZA 2UVXA 2FSTX 2W4KA 4ZK5A 5BUIA 2WU7A 5LVNA 3QC9A 4A4OA 2AYPA 5CF5A 3G0EA 4BIBA 3DFCB 3OBGA 4NUSA 4Y83A 2CNUA 5E8VA 5EHYA 5CEPA 3LFBA 1WVXA 4HNFA 5C03A 3UIMA 4LI5A 1J3HA 4JG7A 4F63A 4K33A 1DI9A 3FQEA 3QTXA 3DJ6A 1ZYDA 2J0JA 2X8IA 2ZOQA 1FBNA 4JIAA 4B6LA 2CNQA 2XM8A 1IAHA 2XKCA 1Q24A 2ZDTA 3AC5A 3SW4A 4J52A 4DFYA 4WRGA 5D9HA 3TIZA 5HCZA 2G9XA 1Q3DA 4YO4A 1GIIA 4O7ZA 1OZ1A 4HVDA 1JQHA 5CVGA 3II5A 4USDA 4EH6A 4K77A 4PWNA 3MPTA 3ZZEA 2NO3A 4G3DA 4YHJA 3IOPA 5D7AA 3L9MA 3TG1A 5KNJA 5A54A 5AMNA 4CGAA 1SVEA 5F1ZA 3B2TA 3H30A 3RALA 2O3PA 5J8IA 1W83A 5EG3A 4X2NA 3OXZA 2PZPA 5E8YA 3OZ6A 5GNKA 2XJ0A 3DB8A 3Q4TA 4IVBA 1Q8YA 2WQMA 2V7OA 4OT5A 4S2ZA 4TYEA 1Z57A 4YJSA 5M4FA 5CF6A 4ACGA 2OF4A 1YRPA 4HVIA 2IZRA 4E8AA 2ZB1A 4WRSA 3A7GA 3VW8A 3G6GA 4LG4A 2PVFA 3ID6C 4JQ7A 3UO5A 4ITIA 3ZLWA 3FE3A 4I5PA 3AOXA 3FSFA 4XG7A 5KUPA 2OI4X 3V04A 4FZFB 2B4SB 3QZFA 1DM2A 2Y0AA 3E8CA 1SYKA 4ZTHA 3RWQA 4RIWA 4IACA 3AC3A 5HTBA 3I60A 3GC8A 3D7TA 5IA5A 5ETFA 2VO3A 5E1SA 3ZRMA 3R71A 4IBMA 3SG8A 3QKKA 5AUZA 5T6KA 1MRUA 3QTIA 4YR8A 1BMKA 3LVPA 3CSVA 2QQ7A 4BDHA 5DRBA 5ANKA 4QO9A 4XV3A 2XNBA 5DT3A 1JWHA 3EL7A 3R30A 1ZOGA 2R3NA 3OMVA 3LCSA 1R78A 3SXSA 5LMAA 4EH5A 4FEQA 4F9WA 4XP2A 3ZDIA 1I44A 4QTBA 5IA0A 1W82A 5KKRB 3EL8A 4R77A 4AT5A 3WF5A 1PMVA 1GY3A 4HGLA 5BMSA 4USEA 4FMQA 3U4UA 3FC2A 5D1JA 5EHLA 5EM7A 4RJ8A 3R2BA 4KKGA 3EB0A 4O0SA 4MD7E 1GZ8A 4ZSJA 4GG5A 2V5QA 3DLSA 1UNHA 2VTIA 3F82A 2RG6A 5FDXA 3R83A 4YU2A 3NYXA 3R8VA 3C4CA 4HZSA 4ZOGA 3VS2A 3RCDA 4DFUA 3NNXA 4ZAUA 4HYUA 3LMIA 4LYNA 5AP5A 3QYZA 4O7NA 3FY2A 3QHRA 3DXPA 2BRBA 1S9IA 2R3QA 3JUHA 3PDTA 4FKJA 4ZSAA 3GNIB 4R3PA 4EEVA 3KA0A 4M69B 3VBQA 4AE9A 3UNJA 3QU0A 4J71A 5JFWA 4KKEA 2BVAA 3ZRKA 5HKMA 3A60A 5C26A 4F6SA 5FGKA 4C2VA 3B2WA 4FV3A 2W1HA 4GT4A 4D5KA 4ZY6A 3ZDUA 4BBMA 2PWLA 4QP8A 2YIQA 2XEYA 3PG3A 3V5WA 3EN4A 1FQ1B 3LQ5A 4ACMA 4ONAA 4Y85A 3FHIA 3ZS5A 2G2FA 5IEYA 2XNMA 3CKWA 4O0TA 5HE2A 4WNOA 5FEQA 3AMBA 3LXPA 2W1DA 4AFJA 3PE2A 4JAJA 3W18A 1DAWA 1ERKA 5B2LA 3ELJA 1JOWB 3PXYA 4MX9A 4IH8A 2UZDA 4QMYA 2QURA 2X6DA 2PMLX 3ZTXA 5IH6A 4DYMA 2JIUA 4XG6A 2XNGA 3E88A 3FC1X 4IQ6A 3PA5A 4WSYA 4FT3A 4GMYA 3QX4A 1OIQA 2QNJA 3G6HA 1YXSA 4BICA 2VNYA 4GJ3A 1CKPA 1GNGA 2WKMA 1H00A 3WZUA 3I81A 5AA9A 3OCGA 1MP8A 5HI2A 2JDVA 4DA5A 3FYJX 1M7NA 2BIKB 2WB8A 2F7XE 2XYUA 4L53A 3V5QA 3AD5A 3ENHA 3KC3A 3QCQA 4M97A 3U9NA 4C59A 3DQWA 2RFNA 2GNJA 2Z7QA 2W1CA 5FP5A 4A4XA 5HU3A 3VUKA 1SVGA 3AQVA 3LXKA 2H96A 4YZDA 2OZAA 5E8ZA 4ZJIA 2RG5A 4UWCA 3MTFA 3R9RA 3VJOA 3RHXA 5AJQA 4E6DA 5KMMA 2AC3A 3DCVA 3DT1A 2XBAA 3Q9ZA 2X9EA 3V5PA 4CFMA 3V01A 1UU8A 4HVGA 1RDQE 3C4EA 3CKXA 5C1QB 1WCCA 5CT7A 2WEIA 1AD5A 4Y95A 1M2RA 3DK3A 3JS2A 4ENXA 5J95A 2WIPA 4XHKB 2REIA 2HW6A 5CEOA 3BYVA 4YC6A 2PK9A 4NM5A 2W17A 5HG9A 3TV7A 4UX9A 2X2MA 3OEFX 4AX8A 1YI4A 2X7FA 3OW4A 1OKVA 3LFQA 3QKMA 4LGHA 3ORMA 3ZXZA 3D7ZA 3NWWA 4JOAA 3MH3A 4FBXA 4OR5A 3GFEA 3CQEA 3BYMA 3L9NA 4DTKA 1O6YA 4R3CA 2F7ZE 2YCRA 1MRYA 2RF9A 2YM8A 2DWBA 1UVRA 4QMOA 3U87A 4GS6A 2GQRA 2R9SA 4O0XA 2UW4A 3DKOA 4PV0A 3WBLA 4DLJA 3Q9YA 2OJIA 3F9NA 3SAYA 4HGEA 4QP9A 5HIDA 5C4KA 4PNKA 2JAMA 2AC5A 5IQCA 3E3BX 3IGGA 2YDKA 5ANGA 2HXQA 2HZ4A 4EHVA 3CJFA 4G16A 4FE2A 2C5OA 4H1MA 5CQWA 2F9GA 4LL5A 4FI1A 2QHNA 4H3PA 5EQYA 3CY2A 2PVKA 3LIJA 4NKAA 2XF0A 3ODYX 5HE3A 3SLSA 1CSNA 2VO6A 4OTQA 3TNHA 4CRLA 3NDMA 3A4OX 4AZFA 4USFA 2JDRA 2VAGA 2GPHA 4WG5A 3ALOA 3LZBA 3WYYA 2UZNA 3KMUA 4EH7A 4RSSA 1NXKA 3EFJA 4HOKA 3A4PA 5A4EA 4JXFA 2KULA 2UW8A 3BEAA 4C37A 3PXZA 2ITZA 4RIYB 2YM6A 4K2RA 1F0QA 5IQHA 1ZMVA 3LFSA 4TW9A 4YBKA 3Q3BA 3KXGA 1OKWA 3BEGA 4BTKA 2WHBA 2UUEA 4U6RA 5K3YA 4XG3A 1UWHA 4IZYA 3TV6A 4EOJA 4I92A 2QOOA 2OJGA 2XEZA 3IQ7A 3H9OA 3MH0A 3ZUTA 3PIYA 2W05A 3MSSA 2GS7A 2XJ2A 1OL5A 4JQEA 4EYMA 4BDBA 5JEBA 2HENA 3BHTA 2VTLA 3G51A 3PSBA 1OKZA 2BZIB 4AFEA 2J0MB 2QLQA 4OTWA 4DEEA 1F5QA 3AC4A 3IG7A 3DJ7A 1H01A 4AT3A 1URWA 1G8AA 4KIPA 1H27A 3D5VA 3BWJA 3PPKA 4O0RA 4ZS0A 2XIXA 3M42A 2ZMDA 4EONA 4R5YA 5KHWA 5C27A 3UODA 2BAKA 4YNOA 5IQFA 4CT1A 4K6ZA 4QP2A 5IQGA 2XP2A 4IZAA 3KFAA 3V6RA 3R00A 5IZFA 4IAZA 4FV7A 3Q60A 4YLKA 4FGBA 3PXKA 3IW8A 3ZLSA 4QP1A 3MY1A 5E90A 5FM3A 4ALVA 2P55A 2UZEA 2VNWA 4EOPA 4MXXA 4XV1A 2ZV8A 2WTIA 3PE1A 4W8EA 2QKRA 4EH4A 1H1PA 3GC7A 3BCEA 3WARA 3G90X 2PE0A 4I23A 3ORIA 4L9IA 4EBWA 1XH4A 3WE4A 1NT2A 1O6KA 4RZVA 3RP9A 5ICPA 2B9IA 4DHFA 4EK3A 4IM3A 1J91A 3A7HA 4BZDA 3GU7A 2W5HA 5KMLA 2P0CA 2R3JA 4BVUA 1V0BA 5DNRA 2B1PA 2C6TA 4M15A 3OFMA 4GT5A 3WE8A 5KKRC 4A4LA 2GHGA 2DUVA 3F5GA 4C7TA 5BPYA 3QA8A 4YMJA 5IA2A 2EXCX 4YZMA 4WHZA 5I9UA 4C3RA 4U81A 4FTQA 4DTAA 1XBBA 4J98A 2YZLA 4TYGA 2XS0A 3QZHA 3DBCA 2B54A 4IWQA 2NNWB 5M53A 1GZKA 4LL0A 2R0UA 2YWVA 4XUFA 4EKKA 5DT0A 4EQUA 2WU6A 5LJJA 3S1HA 3ZFYA 2YCQA 4GEOA 3ZFXA 2Y9QA 4OTFA 3FDNA 1T46A 3I7CA 2HZ0A 3JY0A 3NZ0A 3QF9A 3C4XA 4EWQA 3GC9A 4FV5A 1Q61A 1W84A 4FKLA 4F7SA 3I5ZA 4AGDA 4V04A 3E3PA 3FMLA 3ROCA 3GENA 3KCFA 4CMUA 4KRDA 3CD8A 4O0UA 4GFGA 4DFNA 2V0DA 2ITQA 4OW8A 1K9AA 1XBCA 3E7OA 4RFZA 4C4IA 2JLDA 3FL5A 4I24A 5CAOA 2W4OA 3PY3A 4F1TA 1OPLA 5LCKA 4UYAA 4EZ5A 4M3QA 2O65A 3FI2A 4FTUA 4X3JA 1M52A 1YDRE 4AW0A 1JKSA 4P5ZA 1B38A 3C0HA 4RJ3A 5DWRA 4K9YA 2GSFA 5CEQA 3V5LA 3WI6A 4EZ3A 5JZJA 1ZARA 5CANA 3OBJA 5CT0A 1ATPE 5AX9A 3QQGA 4JBVA 4QTAA 4AZSA 1PXPA 4UALA 3BV3A 3DBFA 3FI8A 1BUHA 3VS0A 5FDPA 3W0NA 3FYKX 5CVFA 5CI7A 2I7QA 3KREA 2Q0BA 3ZU7A 5J5SA 2QODA 3COKA 4RC3A 3FLWA 3IGOA 4MWIA 4NSTA 4KIQA 1H1SA 3T9TA 3TKIA 3ROYA 4E5AX 4O7OA 3ORTA 5KBQA 1OBGA 3FY0A 2YM4A 4PL5A 4U42A 3VS5A 4FVRA 4YC3A 3MN3A 3ZO2A 3LE6A 3TNIA 4D0WA 3EYHA 1OL2A 4RWIA 5JRQA 3W0OA 2OGVA 1R39A 2J0KA 3DPKA 4O7YA 3FMJA 4JBQA 2X2KA 4HCVA 1YHWA 4LUEA 3R8ZA 3UTOA 4DEDA 3HNGA 3R02A 2C68A 2XK8A 3KVWA 3LW0A 3V8SA 2C3KA 4O7VA 2IVSA 2WTKB 1QPCA 2VTTA 2YAAA 4U79A 3PZHA 4JR7A 2B7AA 3PY0A 5EYMA 5T3QA 4ZJJA 3OOGA 4E4XA 1IA8A 1M2QA 2R64A 3GOKA 3Q4ZA 2X4ZA 3QZIA 4ORKA 4U80A 4HNIA 1PYEA 3TZMA 4JT3A 4PX6A 3KRLA 4DGGA 2YIWA 2Z8CA 1GIJA 1A06A 4W4YA 1R0PA 2B53A 5KMJA 3DAJA 3FPMA 3P23A 4ERWA 2OZOA 3JYAA 3RNIA 3PRIA 3W2RA 3RPVA 2SRCA 4E6QA 1VEBA 2GQGA 3H0ZA 5AP3A 3D0EA 4IAIA 4FK3A 3MJ1A 5IQAA 1ZRZA 2H9VA 1J7UA 3GU4A 4QMXA 1PKGA 2BZHB 4DBNA 2XM9A 2Q83A 4FKWA 3RK9A 2FA2A 3PZEA 3HAVA 4GT3A 5BYYA 3TDWA 4KA3A 2QG5A 3E8EA 4FZAB 5HEZA 4EJNA 5KHXA 4GIHA 4C4EA 4QP3A 3F5XA 3MFRA 3OCSA 3VS1A 3P79A 4U9AA 5IMEA 3CPBA 5L2SA 4L68A 1G5SA 2JKKA 5FXSA 4BDAA 4KBCA 4EWHA 3FMNA 1PJKA 2VO7A 2R7IA 3FJQE 5EI8A 4GYGA 4DEGA 1YDSE 2VWUA 3DZQA 4HZRA 3IDPA 1WMKA 3DU8A 4EK8A 4FT0A 5HVYA 3S0OA 4FKRA 3QQFA 3G9NA 4Z9LA 3UGCA 1GJOA 2JFLA 3GXLA 4LV5A 4BGGA 4NL0A 3OCTA 5HD7A 3IW5A 5CSVA 4MK0A 2PL0A 1CDKA 4MXOA 5D12A 4FVPA 4E6AA 5CF8A 4FT7A 3O96A 4XG4A 2HIWA 2OWBA 4EYJA 4Y72A 3I0QA 2QOLA 3Q9WA 4AOTA 3OY1A 2W06A 3UIXA 4IMYA 4P4CA 3MFUA 3W55A 4C38A 3KN6A 2X0GA 3ZOSA 4U98A 2YZAA 2E9UA 3A2CA 3W0SA 5AFVA 5EM8A 2ZDUA 5CAUA 3TIYA 3NYNA 5IPJA 4D9TA 3NX8A 3NMUF 4ZS4A 2ITYA 3R0TA 4RRVA 3UG2A 1YHSA 2CGWA 4D4SA 4NJ3A 3JPVA 4Y5QA 2ZM3A 4E4LA 1Q41A 5E1EA 3H9FA 2BRHA 4QMVA 2W1GA 4U45A 3W0PA 5I0BA 5HNBA 2F7EE 4I5MA 3P7AA 4D55A 4O7PA 3NUUA 3LLTA 2YABA 4U3ZA 2XK7A 3R04A 3DQXA 2B52A 3A7FA 4XRJA 4ZY5A 1JKLA 2CKQA 1REKA 4X2KA 3W2OA 2DQ7X 2QOHA 3DAEA 1WBWA 4QMPA 2ZV9A 3EQGA 3FQHA 4MH7A 4AN9A 4U43A 2YCFA 4NM3A 4DG3E 4IB5A 3SOAA 4I4EA 4U41A 3GC0A 4BCIA 2QO7A 3OWKA 5HD4A 4JI9A 4S32A 4RQVA 3NAXA 3SG9A 4KS8A 4E20A 1M14A 4R78A 2QU6A 5HHWA 3SC1A 4BCKA 1O9UA 4C3FA 4LQMA 2QI8A 2UZOA 1OIRA 3Q5ZA 4K0YA 3QCXA 4ZXTA 5BUEA 2ZAZA 3HMMA 3ANRA 4CNHA 3U51A 4F9YA 3NVKI 2X81A 4LMNA 2HZNA 4M0ZA 4CMTA 4JQ8A 4PL3A 1FVTA 4CKRA 2BPMA 2WQNA 3LCKA 4RJ7A 3TZ7A 4DEIA 4YGAA 1H8FA 1I09A 4LUDA 5IUIA 2J2IB 1Y6BA 4S31A 4N6ZA 3WF9A 5I9ZA 4DH7A 3E7VA 4L42A 3D2IA 3PFQA 1H24A 3OT3A 2W1IA 4GH2A 4X2GA 4C4HA 4IX3A 3W33A 4HYIA 5B7VA 4UWBA 5EH0A 3OXIA 4FTCA 3DZOA 4QMWA 2J50A 5A4LA 2ZB0A 2BFXA 4P2KA 3D83A 4Z16A 2PPQA 3MESA 3LFEA 4FSUA 1NVQA 4U40A 3R1SA 2JIIA 5A6OA 3FPQA 4ZZMA 4IDVA 2ITPA 2OFUA 3DS6A 3PP0A 5DR9A 3OHTA 4WBBB 2XKFA 2C1AA 3PG1A 2YJSA 3ZO3A 5CWZA 3LLAA 3LXNA 4RIYA 1J1CA 4YJPA 4AA0A 4D58A 4V05A 3VS6A 3A61A 5AADA 5E9EA 3B8RA 5DEWA 3S2PA 4TZRA 5FTOA 4K8AA 4O91A 3QLGA 3QRTA 3QCYA 5CU0A 5AUUA 4PMSA 4WZYA 4JDKA 4MVFA 3ZMMA 3GQIA 3F3TA 3R73A 5DLSA 4F1MA 4FKIA 2CJMA 5KO1A 3MBLA 3VS7A 5F94A 1BI7A 1IRKA 5HIBA 3Q32A 5M06A 3BV2A 2X1NA 1Q8TA 3D5UA 1ZYJA 1BLXA 2PVYA 3DKCA 3MY0A 5KX8A 2J6MA 2PYWA 3C50A 3FKLA 1PXKA 4I20A 2HK5A 2P33A 3M1SA 3ZSIA 3C9WA 3RZBA 4FNWA 2DYLA 5HIEA 1TQIA 2R2PA 3NNWA 1PXIA 5KZIA 4F9CA 2Y4PA 4R3RA 4EZ7A 4G17A 2GMXA 4HYSA 3NYVA 4IX4A 5I9XA 2ERKA 2VTNA 2UV2A 2Z7SA 5I4NA 4FIGA 4ANLA 3VF8A 3E8DA 4BHZA 2WMQA 4AZVA 3EKNA 4BCPA 1PHKA 3ZC6A 2RFEA 1E1XA 5EYKA 1PMNA 3F2RA 3NLBA 5AP2A 4E4NA 4M0YA 2G1TA 3Q2MA 4BTFA 1Y91A 3IW7A 5D11A 2EXMA 4DN5A 3RM6A 2PUNA 4V0GB 4YC8A 2UZLA 4TPTA 3BU5A 4QYYA 5EK7A 4PMPA 4JG8A 2R3LA 4WUNA 4BDIA 1VYZA 4XP0A 5A4QA 4J95A 3VN9A 2X39A 1TQMA 4O83A 3TTJA 3CGOA 3NCGA 3PJ2A 4NZWB 4Y46A 4QTCA 2ITOA 4UEUA 5BMMA 4EL9A 4F7JA 3KK8A 1XWSA 3WIGA 1YI6A 4FYNA 2QOCA 4Y8DA 2XK9A 3KCKA 3RPYA 5HGIA 3BX5A 2OXXA 3UIBA 4ZSEA 2B55A 3EQHA 3NS9A 4G5JA 3DXQA 3F69A 3KMMA 3QCSA 3PYYA 2C3IB 2ONLC 4DGMA 4O2ZA 3HZTA 5CASA 3LAUA 3QGWA 3ZM9A 3W0MA 2X7GA 3TZ8A 2IVTA 3ZM4A 2QOQA 5JSMA 2CKOA 4QYEA 1B39A 3Q53A 2YIYA 4B0GA 2XVDA 5EOBA 1G3NA 4L7FA 2PUUA 1WBVA 3CJGA 4DEBA 2XNOA 4H3BA 4K1BA 4AT4A 4LM5A 3O50A 3QRIA 1YQJA 3EFWA 3F3ZA 4BBFA 3AD6A 2C47A 2PE2A 4QMZA 5IG1A 5EKNA 4OBPA 3L9PA 4XRLA 4F0IA 4Z7HA 4XG8A 1H26A 2ZV2A 2GHMA 2BHEA 3Q5IA 4F65A 5GIPE 1KOBA 4QP7A 3PP1A 4NW5A 4F7LA 5HLNA 4P90A 4YZNA 1OKYA 5KCVA 4G31A 3DB6A 3V8TA 3MS9A 4G6OA 4CQEA 3OWPA 3WILA 4FKGA 3F88A 3I0OA 3GU8A 4BCOA 4XLVA 1G8SA 4M14A 5CZIA 3BHYA 4XBUA 5EKOA 3U54A 3WZEA 3AT3A 3PVGA 4H58A 1Q3WA 3P4KA 2J5EA 4KWPA 1P4FA 2W1FA 2YFXA 2HYYA 4WNKA 3UNZA 5EM5A 3VUIA 4BCHA 2W96B 5J9YA 5FXRA 4WO5A 5M56A 5CAQA 4RBLA 3TNQB 5F9EA 3SRVB 4CLJA 5BVFA 1ZZLA 5LMKC 4GVAA 4NM0A 2JGZA 5B2MA 4J7BA 2IVVA 3HX4A 2F2UA 3SHEA 3PPZA 4MXYA 4PMMA 1WAKA 3E8NA 3RPRA 5IU2A 3L8PA 5K4IA 1IAJA 4GV1A 5A4TA 3F3UA 1H1WA 4BI1A 1VZOA 3DGKA 1RJBA 2EB2A 3N51A 5HU9A 1H08A 4U97A 4YTHA 4ASXA 5HTCA 4UXQA 4Q2AA 2Y6OA 3VAPA 5CZHA 2WTVA 2XJ1A 3A8XA 4Q9ZA 1SNUA 4ERKA 1FMOE 4QMNA 3ZLYA 4S34A 5IF1A 2C6KA 2UZVA 5KMKA 4YTIA 3O8UA 1CKJA 2ETRA 2OBJA 1WVWA 5DGZA 5LXMA 5EQEA 4IB0A 1MUOA 2WD1A 4FOCA 4F0FA 5BNJA 3KF7A 4IAAA 3FXWA 3KEXA 2WO6A 5E92A 4QQCA 3ZH8A 2UVYA 3BZ3A 4IAKA 4IZ5A 4M7IA 4UYNA 4YJVA 4IJ9A 2PU8A 5BYLA 2ONLA 3UQGA 4QP4A 4GFMA 4YURA 4FSNA 4CEGA 3MTLA 1H25A 4ASEA 4FTKA 2JEDA 5I9VA 1Y6AA 4U0IA 4YJTA 5EYDA 4BF2A 3G2FA 4IWDA 3TDVA 4CCBA 5IQBA 4EHGA 4BRXA 5CEIA 4O0WA 3QD3A 4CG9A 3ALNA 5T68A 1FGKA 2F4JA 2VWIA 4FOBA 2JKOA 5HCYA 2HELA 3LHJA 4FNZA 3W1FA 4HVSA 3FMHA 5E8UA 1IASA 4TKSA 4BHNA 4GK4A 2XIYA 2VUWA 1Q8UA 1WFCA 3FAAA 4FKPA 3KVXA 4FTAA 3E92A 4IANA 1LEZA 4FL3A 4P7EA 4ACDA 3RPOA 1ZMUA 3HECA 4GKHA 4P5QA 3GEQA 5DPVA 4ID7A 5EYCA 2OK1A 4A06A 4ZSLA 4AN3A 4DEAA 4RWKA 2UZTA 1DAYA 3KRXA 4M84A 5DBXA 4ACHA 3UG1A 3CTHA 3BU3A 4M68A 4GL9A 5IQEA 4BCGA 5DRDA 3C13A 4FZDB 3HL7A 4YLLA 3UIUA 2OLCA 5DIAA 3HV5A 4ZTSA 4QP6A 3COHA 2YDIA 4H05A 5ANEA 5FEDA 4I5CA 3T3UA 1XR1A 4DLIA 3BWFA 4C35A 2WOUA 2BDFA 2XIRA 4XEYA 1QPDA 4IJPA 3C4ZA 1JNKA 4EH3A 1M7QA 5LMKA 3H0YA 2VGOA 4FX3A 5DEYA 4C02A 3DK6A 4LOOA 4HCUA 3GQLA 2EUFB 3HP2A 3LCTA 1CMKE 1Z9XA 3CY3A 5AV1A 5BYZA 3I5NA 3KU2A 5D41A 4EOQA 3UNKA 2VN9A 1UNGA 3OWLA 3UMXA 5JT2A 3PLSA 3FXXA 3MFSA 3PTGA 2EU9A 4FSWA 4RT7A 4D4YA 3EQIA 2PY3A 4GU6A 1PXJA 4BZNA 1H28A 3V6SA 3JY9A 5AP1A 4C4JA 2I0EA 4IB1A 1BL7A 3O8PA 4U3YA 2BR1A 4YHTA 3RAIA 4FR4A 4FV9A 3SGCA 2YDJA 4XBRA 2Y8OA 5AP0A 3RMFA 1LP4A 2JFMA 3RVGA 3RWPA 3BLHA 3MPMA 2IZTA 4RA4A 1W7HA 5L3AA 3PSDA 2HY0A 2VTRA 4QMSA 2J7TA 1PXNA 2JBOA 3DBDA 5A6NA 5M07A 3R7EA 3I4BA 1XQZA 4ZTLA 3D15A 3QQJA 4QYGA 4XG9A 5AV4A 1SMHA 5HNIX 3HA8A 1P5EA 4Z55A 5CALA 3F2AA 4L01A 5C8NA 1K3AA 1LUFA 1YWNA 4EK5A 4FVQA 3PWDA 4S33A 4RPVA 3VBWA 2A4LA 3TNPC 1MQBA 1ZMWA 2C5XA 5AUXA 3KXNA 3UPXA 4D28A 5AAGA 3QALE 4G2FA 2PVJA 4A7CA 4EH9A 1SNXA 5BVEA 1W98A 2IW6A 4IW0A 4JDJA 5CNNA 4PDSA 3UC3A 3VBVA 2BZJA 1KV2A 2J0IA 2WFYA 3CP9A 4HJOA 1NVSA 4JRVA 3KL8A 5AX3A 2WTJA 3C51A 3DFAA 4IFGA 4O0YA 3I6WA 3KXZA 4RIXB 2J51A 4RVTA 4RWLA 3UDBA 1BL6A 4F4PA 5DOSA 3VBYA 4E5WA 3ITZA 4N6YA 2GS2A 3OCBA 3RTPA 3MW1A 1VR2A 3DTCA 4YHFA 1UNLA 2QOFA 3DJ5A 5JQ8A 2ITNA 4RJ6A 3P7CA 1TQPA 3BRBA 3N4UA 4JNWA 5FP6A 3VUDA 2OF2A 3ENMA 5CEMA 2BRMA 2GNLA 5HE0A 3IONA 4EUTA 4WG4A 1Q8ZA 4O6EA 4WOVA 3W8LA 3EMGA 3ZO1A 3NNUA 3IDBA 3QTQA 3HGKA 5JRSA 2VX3A 4AA4A 4F9BA 3VUHA 4EKLA 5F4NA 2CN8A 3RAHA 3R7YA 5IH5A 3FLNC 2V22A 4RIOA 4UBAA 4CKIA 3O7LD 2J90A 3WYXA 2WNTA 2VTJA 3QLFA 3QRKA 2OJ9A 4RVMA 3W10A 4I6QA 3CC6A 4C61A 5AV0A 3T8OA 4CMOA 3SXFA 4AW1A 2RFDA 4FKQA 2C0OA 1R0EA 3COIA 3UP2A 3MB7A 2QO2A 5FLFA 5M4IA 4EH8A 3FWQA 5EDRA 4C62A 3FKOA 5KMIA 5CENA 1EH4A 3DNDA 5IQIA 1XBAA 1HCLA 4YO6A 3D14A 3FSKA 4CFFA 4FSMA 3QD2B 4Z3VA 2JAVA 5IQDA 2Y6MA 3LPBA 1PYXA 1BX6A 4YNEA 1Q5KA 4FSYA 4TL0A 4FTIA 4EHEA 1PXLA 1YOMA 5J87A 4FEWA 3KN5A 3VIDA 4J1RA 2V7AA 5CTPA 4FUXA 5AUTA 2IZUA 4GK3A 5FD2A 1DS5A 4MD9E 3COMA 1FVRA 1LEWA 2PZYA 3KRWA 1KE7A 4GIIA 4FV1A 3UOLA 4AW2A 4UY9A 1GIHA 5HG5A 4DFLA 4L67A 4MBIA 4EH2A 3HRCA 2PSQA 3QA0A 3B8QA 4LFIA 4FG7A 4ALWA 3CBLA 3WIKA 2CCIA 3PVWA 2B9HA 5J1WA 1KUTA 5AV2A 3EZRA 5E8WA 4R1VA 3WOWA 4O96A 4N70A 3NEWA 5LVPA 4MXZA 3MI9A 4UV0A 2W5BA 1SVHA 2O8YA 3FMEA 4A9RA 3I7BA 3MVJA 4XOYA 5I9WA 5M09A 1WBSA 4G3CA 4C0TA 4PNIA 1TKIA 5CAVA 3W0QA 3E5AA 3HDMA 4V0GA 4WUAA 4HPTE 3P08A 2OW3A 3QX2A 1OITA 3PVBA 3KRRA 4ZIMA 5HORA 5EOLA 4C33A 1OPJA 4ZTNA 5HZNA 3FZPA 4O7LA 1IEPA 4D1XA 4NWMA 2VV9A 3S95A 3ZONA 4MWHA 3QTZA 5HX6A 3R8PA 2I0VA 4AUAA 1QPJA 1J7IA 2CGVA 3VBXA 5IEXA 1R1WA 1VJYA 2NRYA 3PPJA 4ANMA 5TR6A 3O71A 2BMCA 4PF4A 4ZP5A 2FSLX 2WMTA
chains in the Genus database with same CATH superfamily
5ITAA 3OY3A 3FLZA 3F7WA 5HVJA 3JVRA 3QWJA 3NUNA 2YACA 3HEGA 4YTCA 3KB7A 4ZZNA 4RZWA 3DLZA 3P86A 1DI8A 1PF8A 1FGIA 3FHRA 4IWOA 4YPDA 2XANA 4R6VA 4TWOA 4GK2A 2X6EA 5LVLA 3AT4A 5L2IA 2VWVA 4TWPA 3LM0A 1S9JA 4II5A 1XH6A 3A7JA 4UB7A 4JRNA 2YIXA 4MXAA 4EORA 1OIYA 2CDZA 2F2CB 3AMYA 4IM2A 5EI2A 4XOZA 4AS0A 2WMSA 4D4VA 2YM5A 3QGYA 2B9JA 5TT7A 3HDNA 2YERA 4ASDA 2LGCA 3TUBA 2UZUE 3DDQA 3POOA 4DCEA 2C5VA 3VRZA 3LMGA 5BVKA 3KXMA 4OTIA 2IJMA 3FMKA 4WKQA 2PVHA 3Q4CA 2GS6A 1PMEA 4FIFA 3BL9A 4RX7A 2W4JA 2OJJA 5FBNC 2PUPA 4AGUA 1NVRA 3TT0A 3SV0A 3NUAA 4WG3A 4Q5EA 4ITHA 3SRVA 4BGHA 2C69A 2H6DA 4MBJA 3V8WA 3VQHA 4TYIA 4CVAA 3OS3A 4NCTA 3Q04A 4RLKA 3ODZX 4YZBA 5L2TA 1GZOA 1FPUA 4FSZA 5EFQA 3QRUA 4YBJA 3TTIA 3NUYA 1OB3A 2AUHA 4JX3A 2ITTA 3TUCA 4L44A 4FKVA 4KBAA 4NJDA 4HVHA 4BYJA 1QCFA 2ZV7A 4I0RA 1WBNA 2C1BA 2IN6A 1ZXEA 4IHPA 4GVJA 1SM2A 3DTWA 3SXRA 3FXZA 4MKCA 4YJQA 3VBTA 4G3EA 4IVCA 4KB8A 3UPZA 3Q9XA 3RJCA 4BZOA 2PZRA 4NTSA 4D0XA 4FA2A 4TNBA 4WNMA 3FL4A 3WZDA 2C6DA 2HZIA 3QTRA 4CFUA 3UMWA 5M44A 3PA3A 4KABA 2A0CX 4FKOA 2WTWA 2WEVA 4MYGA 4RLLA 4ZJVA 3Q52A 4DH5A 5FRIA 2BDJA 5AM7A 2OH0E 2CSNA 3OVVA 5AA8A 4R7BA 3MIAA 5CAPA 4ZTRA 3SDJA 3O17A 4EOKA 2BHHA 3D2KA 1UU7A 4FEXA 2QR8A 4FG8A 5CY3A 4JVGA 4L52A 4RC2A 3T3VA 2XRWA 3O23A 5ACKA 2WIHA 1IA9A 2QHMA 3W8QA 3EQRA 4NFMA 2CCHA 4B9DA 1U4DA 4F09A 2JBPA 2W9ZB 3ZCLA 3REPA 3EWHA 1Y8YA 3PJ3A 3QUDA 2UW0A 1ZOHA 3PY1A 4CV8A 4OTGA 3JXWA 4PP9A 5FUTA 4FG9A 1XJDA 2WMVA 4TYJA 4BKJA 3QBNA 2CN5A 4C36A 4PDYA 3FZSA 4MNFA 3HV3A 1UU3A 3P1AA 4FSRA 3OG7A 2ERZE 2HAKA 2JIVA 3AC2A 3EFKA 4O2PA 1RQQA 1ZAOA 4GUBA 3PXFA 2J0LA 4NT4A 4PTEA 1NY3A 3TZ9A 4PQNA 1FINA 4FEUA 4FSTA 4I0SA 2VX0A 3FMDA 3G9LX 2VWBA 4YLJA 3R7UA 4AWIA 4BDDA 4F70A 5A4CA 3CGFA 4LOQA 2UZWE 4G9RA 4BCFA 4O82A 3BL7A 3IOKA 1Y57A 5LQFA 3V5TA 2X8DA 4AN2A 2YHVA 4H3QA 5J1VA 3O2MA 3ZSGA 2R3RA 3KULB 1KE9A 2R3HA 4V01A 4X7QA 4EC8A 2C4GA 3FQSA 5CU2A 2V62A 2EB3A 3I1AA 5L2WA 5GIOE 3Q4UA 1A9UA 3N4VA 4NTTA 1QL6A 4BGQA 2XK3A 5IDPA 2BKZA 3NAYA 2DS1A 2V55A 2VZ6A 2VWWA 4I5HA 1B6CB 1YW2A 2YISA 3FZOA 3VULA 5K9IA 4I6FA 4J99A 3UO6A 5M57A 2VGPA 2WOTA 2PVLA 3ANQA 2XIKA 2XMYA 3GT8A 3K3IA 2FVDA 2OKRA 3FUPA 1JKKA 3EQCA 3KGAA 2VD5A 4A9TA 3GCPA 1JLUE 5HO7A 2PE1A 1UWJA 4RVLA 3ZYAA 3RINA 5CXHA 3OD6X 4FUYA 4LRJA 3UOJA 5CQUA 1IG1A 4Q5HA 3PSCA 4DE4A 4I6BA 5FTQA 3GB2A 4FIJA 1IR3A 5H8GA 4BR3A 4ZLZA 4DGLC 5HE1A 3F7ZA 4DGNA 3AT2A 2YA9A 1GAGA 2QOBA 2RL5A 2C5YA 3H10A 4QNYA 4ZTQA 5AAFA 4FTNA 3R7OA 2YN8A 4FODA 3AC8A 3EKKA 3R22A 4TN6A 1L3RE 2R3MA 4DTBA 4ANQA 4L6QA 3E62A 5DN3A 4ZSGA 2C5NA 4IDTA 5AP7A 1F3MC 2C6IA 2G15A 3HLLA 3V3VA 4IM0A 3QYWA 4M13A 4RIXA 4E4MA 4CKJA 5LWNA 1OL7A 4ANSA 4EOMA 5CEKA 4TYHB 2RIOA 1KE6A 4FNXA 4APCA 4JBPA 3LCOA 4B7TA 4CRSA 4O7WA 4AE6A 2YM3A 4R7HA 1OI9A 4B8MA 3Q6WA 3QXPA 4I22A 2PMNX 2FGIA 4PUZA 1V0OA 1FMKA 2YIRA 3R7IA 4F1OA 4F7NA 4HW7A 1E9HA 5DT4A 5HLWA 3ATTA 3QTUA 5DHJA 3U9CA 5JKGA 4I3ZA 3MVLA 3GGFA 4FIIA 4ACCA 5B2KA 4YJRA 5JFXA 5GJFA 2OU7A 5AIRA 2GDOA 1M17A 3MFTA 3AC1A 2R3GA 5I5ZA 4CFWA 4RX8A 4OBQA 1PXOA 2HWOA 5BVOA 3TN8A 4W4VA 3QWKA 3C4WA 5ANIA 4AACA 3IW6A 3MDYA 4D5HA 5TOZA 4X6QC 4BTMA 3F2NA 3H4JA 3ZC5A 5K4JA 3SW7A 3C1XA 2WTCA 2H8HA 5HICA 3L9LA 2BUJA 1KE5A 4Y73A 4PTGA 3A62A 4M67A 2UW5A 5CU4A 3LFNA 2BCJA 3NUSA 3C5UA 4W8DA 3TEIA 5BX0A 2YEXA 3VO3A 3K54A 5HG7A 2YITA 3R9DA 3NW6A 3ORLA 3CQUA 2FUMA 4YJNA 3HAMA 2EWAA 1AGWA 3FZTA 4QTEA 4G6NA 2GFSA 4GJ2A 3QD0A 1OBDA 4MHAA 2BROA 4UZDA 1U54B 3VHKA 4C2WA 4BDFA 2BRNA 1BKXA 3L8SA 4RX9A 3ZUUA 4TRLA 3ZZWA 5LWMA 2I40A 4EQCA 1HCKA 1KOAA 2PUIA 3OXTA 1PMUA 2R7BA 5D7VA 5M4UA 2FSOX 1X8BA 1H0VA 1Q99A 1VLRA 2XYNA 3RKBA 5L6WL 2LAVA 2OFVA 3ZEPA 1PXMA 2W5AA 4G1WA 4LV7A 4G3GA 4MNEB 4QQJA 3F6XA 3ZEWA 3WF7A 3RM7A 3HRFA 2VTPA 2E9OA 3VUMA 2JDSA 2UW7A 3N9XA 3ORXA 4WIHA 4EK4A 2ITWA 5IA4A 4IX6A 3E93A 4BCQA 3VRYA 3AG9A 4YPSA 5A46A 2JDOA 3S00A 3QUPA 4D2RA 4YSMA 1ZOEA 2OICA 3HP5A 3TKUA 3FEGA 4PL4A 2WTKC 4GRBA 2Y7JA 5HX8A 5J9LA 3EQDA 3HMNA 3KMWA 3BLRA 3TUDA 4TWNA 1OL1A 3UYTA 3OOMA 4YJUA 2QU5A 1AQ1A 5DYJA 2WXVA 1HOWA 2NRUA 4KRCA 2QO9A 3UP7A 3MJ2A 3S4QA 3DOGA 4G5PA 4FYOA 4OT6A 3U55A 4BYIA 3N4TA 2I6LA 1ZLTA 4QNAA 4QYHA 4IVDA 4EOLA 5IISA 2W1ZA 3HMOA 1Q4LA 2KTYA 2XZSA 1PKDA 4I93A 4DBXA 2CHLA 4JG6A 3RHKA 4IADA 4IX5A 4AZTA 3BYOA 3W0RA 3P0MA 3QUEA 2VTSA 4FIHA 5CSHA 4IE9A 3QKLA 1WBTA 3EIDA 4FKSA 2GTNA 4K11A 3O0GA 4ENYA 5JH6A 2QVSE 5GHVA 4ZZOA 3PLAE 5DE2A 2UW6A 3F5PA 3HVCA 5AUYA 4WA9A 1XH7A 3KK9A 4Y5HA 2FSMX 4GU9A 2AEGA 3NIEA 1CTPE 4HYHA 1H4LA 3F5UA 2ITVA 3UJGA 1ZY4A 4I1ZA 2YWPA 4JMQA 4YZ9A 5EDQA 1KSWA 4DFBA 2A1AB 5HLPA 5JZNA 4NW6A 4DT9A 3PRFA 1YWVA 3SX9A 5HBEA 4QMLA 3I79A 4LV8A 2P3GX 2WELA 4RX5A 4QOXA 4I41A 2FYSA 4E26A 2O64A 3OROA 4KIOA 4AQKA 4W4XA 3D94A 5DFPA 3THBA 4BB4A 4DGOA 3MWUA 4K18A 4JS8A 2H34A 4U8ZA 4PTCA 5AAEA 2HWPA 3NVMB 4JLCA 1Q62A 4O84A 3ETAA 2ESMA 2XKEA 1YDTE 4DAWA 5CYIA 2A27A 4QQTA 4D2SA 4WT6A 5FTGA 3LQ8A 3BKBA 3A99A 4KINA 4NH1A 3H9RA 5K5XA 1XKKA 2ETMA 2R3PA 4N4SA 3RK5A 2R5TA 2VRXA 4AW5A 4BJJB 3HV7A 3VF9A 5AP4A 2CPKE 1KWPA 3R2YA 4G9CA 3IPHA 4NKSA 1J7LA 2QR7A 3OEZA 3BBTB 2NPQA 3E87A 4HGSA 2HW7A 4DH1A 3GOPA 2P2IA 4LGGA 3BLQA 3FLYA 1P4OA 5L8KA 4D9UA 5A14A 4DDGA 4FV8A 3ZSHA 3UE4A 4OTDA 4BCJA 4BIDA 2HY81 3SQQA 4PP7A 1UKIA 2O5KA 3PWYA 3UOKA 4E7WA 5M08A 5FEEA 4U7ZA 4FZ7A 4KD1A 4L45A 2XAMA 1WBOA 3IW4A 2O63A 2QLUA 3BIZA 4B8LA 4CFVA 5C8MA 4DFZE 1BYGA 3K5UA 4ZLOA 5D10A 3PJCA 2OJFE 4LRKA 3NYOA 4E93A 5M51A 1STCE 2Z7RA 3AGMA 2X7OA 3EQPA 4JL9A 5CSWA 2IW8A 4A9YA 1PRYA 4YZCA 1KE8A 2CKPA 4B99A 4F99A 4UN0C 3UZTA 5F20A 3VC4A 4OUCA 5C4LA 2WMBA 4L00A 5KBRA 4ITJA 3D4QA 3RI1A 2ETKA 2BAQA 2CLQA 4W4WA 2BAJA 3NIZA 3HYHA 3D5WA 5HESA 2OG8A 3LCDA 2X9FA 3MY5A 4F0GA 3CPCA 3C5IA 3LM5A 3UVPA 5IUHA 1U46A 3QQUA 4FTLA 3AMAA 4J8MA 5ANOA 5AUWA 5C9CA 3GCSA 3UO4A 3QFVA 1H1QA 3OW3A 4XYFA 4D4RA 4PY1A 3NRMA 4WBOA 4HPUE 1XHAA 2C3LA 4KSQA 3VS3A 1LPUA 5I9YA 2IWIA 2X2LA 3IKAA 2CMWA 2C6LA 3QQKA 2GFCA 5EW8A 3R1QA 3R1NA 4BDEA 4FGRA 2GCDA 2WMXA 2WGJA 2FH9A 3ZRLA 4XJ0A 1ZWSA 1U5RA 2WMWA 5B0XA 3OTUA 2CNVA 4S30A 4RC4A 3QXOA 3BE9A 4FV0A 1JPAA 3E63A 4TXCA 1TFFA 3CCNA 3K3JA 2E9VA 1J1BA 4G3FA 1CM8A 3W2CA 4F6UA 1PW2A 3PA4A 5BVNA 4X3FB 5H9BA 3TM0A 4YUQA 5E8TA 4I0TA 2XB7A 3LJ2A 1OL6A 2PMIA 4XCUA 2YJRA 3DKGA 1YXVA 2ZM4A 5M4CA 3F61A 4GSBA 1REJA 4KUJA 4BDJA 3LJ1A 3FKNA 5EW9A 4DITA 2RFSA 5J7HA 2P2HA 4KSPA 2J4ZA 3LFFA 4U44A 5H3QA 2IW9A 3EN5A 1OM1A 2XK4A 4FTRA 3KULA 2C6EA 3GVUA 5JK3A 2OSCA 4OTRA 4TT7A 5EQPA 2G2HA 2XARA 1A48A 3DDPA 3U6JA 4WNPA 1RE8A 3TKHA 2E9PA 1QPEA 2FB8A 5ETCA 3MVHA 2R3OA 1FVVA 4AGCA 4QQ5A 3O51A 3ACKA 3QD4A 1APME 1OUKA 3WF8A 4QTDA 2UVZA 3ACJA 3CS9A 3ORNA 3WZKA 2IVUA 3R1YA 2QKWB 4I4FA 4RJ4A 2VTHA 4H1JA 2R4BA 3FZ1A 3MIYA 4NM7A 4BBEA 2GU8A 5LMBA 3ET7A 4MEDA 3QAME 1CKIA 3QZGA 2JKQA 5LCJA 4O81A 3R6XA 3TJDA 2QOKA 4MQ2A 3C0GA 3DY7A 4RGJA 4IC7A 4ANBA 2WPAA 4O6LA 4AP7A 4BI0A 3TV4A 4EJ7A 1Y8GA 5AP6A 2F57A 2O2UA 1R3CA 2XNEA 5TKDA 4OGRA 4O27B 3W2QA 2HXLA 2XNNA 3R01A 2A19B 2W7XA 1LR4A 3OWJA 2GHLA 4LRMA 2PTKA 3VNTA 5AM6A 3BE2A 2R3IA 3DNEA 3TYKA 2PHKA 1JKTA 4FT5A 3HV4A 5LOHA 3VUGA 5JFVA 2ZMCA 4FIEA 3LMHA 3GFWA 4TNDA 2R3KA 4RVKA 2E9NA 3DK7A 5ACBC 4C3PA 4QT1A 4G6LA 4EOOA 3GP0A 2OIQA 2G2IA 4FK6A 3HRBA 4U94A 4O7TA 4XLIA 5HBHA 4TYHA 3NW7A 4JJRA 2ZFYA 3BHUA 4PDPA 3MPAA 5L8JA 3D9VA 3EHAA 4F6WA 5HQ0A 4FEVA 4IFCA 2RGPA 4PDOA 2XNPA 5TO8A 4BCNA 3DBQA 4AQCA 2XK6A 1YOLA 1JVPP 1OVEA 2BILB 3G0FA 4FTTA 4EC9A 4L43A 3CD3A 3QTWA 3ZBFA 3GCQA 4TWCA 4MCVA 4E5BA 1XO2B 5BUJA 3CLYA 4NYEA 1YXUA 3OTVA 4EI4A 5H8BA 3HA6A 5H2UA 3OP5A 1H1RA 3ORZA 4GW8A 4FL1A 4AU8A 5J9ZA 5LARA 1GOLA 3A7IA 4YP8A 5CU3A 3BYSA 4TY1A 4DG2E 3JR1A 3MV5A 2CGUA 3C4FA 3BI6A 4J97A 3BQCA 5IA3A 2J9MA 1ND4A 2B0QA 3NCZA 4CV9A 3K2LA 3U6HA 3TL8A 2VX1A 5DG5A 3W2SA 3DXNA 4UZHA 4GFOA 5G6VA 4AZWA 3BQRA 3LFCA 2PVMA 4CLIA 4CFXA 1ZZ2A 2Y4IB 3EJ1A 1UV5A 4O7RA 4O21A 2VO0A 4FJVA 3UC4A 3D5XA 3R21A 1ZY5A 3M11A 3LQ3A 3RPSA 3ZFMA 5IH4A 5L6OA 4A07A 4NCTC 4XNEA 4JIKA 3VW6A 4YSJA 3MA6A 3GBZA 5CNOA 4WD5A 5HBJA 1ZYLA 3G5DA 4QRCA 4FV4A 3FI4A 5CVHA 1U54A 5HG8A 2GNGA 4AA5A 3FLSA 5JMSA 4QMQA 2R3FA 4DF3A 3FMMA 2OIDA 3O7LB 3POZA 2ZYBA 2I0YA 4DINA 2YAKA 3VJNA 3GU5A 4C58A 3RK7A 5HVKA 4MUQA 2X4FA 3EZVA 3L8VA 3PIZA 5HO8A 2XKDA 4FSQA 3TACA 5JQ5A 4EUUA 5HCXA 1JSVA 4E6CA 4XV9A 4L46A 5KE0A 4BCMA 2F49A 3UQFA 4XP3A 4MNEA 1Q97A 5DR2A 2Z7LA 3R8MA 1H07A 2J5FA 3TWJA 5JN2A 4MBLA 2C0TA 4RMZA 3CR0A 4A9UA 2WQBA 3TI1A 1UU9A 5ANDA 4MQ1A 4XG2A 3FV8A 4ASZA 4PMTA 4MAOA 4DEHA 2ZM1A 5JFSA 2ZVAA 1K2PA 2Q0NA 1V0PA 2OXYA 3TNWA 4Q9SA 4QPSA 3BU6A 4AOJA 5GJDA 4DH3A 2W99B 3R8UA 1XH5A 3LJ0A 5L6PA 2VU3A 2CGXA 3TXOA 1YXXA 5FXQA 1P2AA 5EW3A 2BIYA 4AXAA 2VTQA 3ZLXA 2PMOX 4X6RA 3FLQA 3NFFB 3NNVA 1YI3A 4CT2A 3U4WA 2OH4A 3AGLA 3G15A 3MH1A 2BTRA 4RIWB 3T9IA 4IIRA 3W2PA 4CZTA 3GI3A 2ACXA 3C7QA 3RAKA 3D7TB 5LVOA 2VWZA 3EQFA 1WBPA 3KF4A 2UZBA 3MYGA 1OGUA 3DAKA 4N57A 2I1MA 3PXRA 3V51A 4IAFA 2BRGA 2BZKB 4B4LA 4Z7GA 2GQSA 3AXWA 3AKJA 4BI2A 3KRJA 4DH8A 5IUGA 5TF9A 2WZJA 4MF1A 4L3JA 3P78A 3BHVA 3H3CA 1ZYCA 2PZIA 3HMPA 2UW9A 4M12A 1YXTA 1V1KA 4C34A 5IMXA 3K5VA 3HMIA 4FTJA 5GJGA 4BY9E 3KIOC 3R9HA 3F66A 2Z2WA 4BDGA 3EN6A 5JGDA 4FTMA 4AXDA 1U5QA 2PULA 4CCUA 4OTHA 3NUPA 5KMOA 3QQHA 1JSTA 4AG8A 4KNBA 2C0IA 4ZMEA 1M2PA 3LKMA 2QG7A 3SA0A 1H0WA 4NIFB 5IEVA 2BDWA 1ZYSA 3IS5A 2Z02A 3PUPA 3Q2JA 4CTBA 3ERKA 2WTDA 4FT9A 3UYSA 2XA4A 5AEPA 4CZUA 4ZY4A 3PJ1A 3UVRA 2VWYA 4QMTA 5E91A 4ARKA 4FV2A 4CTCA 2VTOA 3GU6A 4JBOA 3MH2A 4RA5A 3TJCA 4IZ7A 3GCUA 5KMNA 3QTSA 3FZRA 3DBEA 5E8SA 4GKIA 4F9AA 2GTMA 2OXDA 3WF6A 2XRUA 3ZO4A 1OUYA 4NU1A 5AIKA 5IA1A 3CTQA 3RAWA 4O38A 4OBOA 3SVVA 1U59A 2QONA 4YJOA 3NUXA 3EN7A 5CF4A 4X3FC 3KY2A 5HNGA 3R8LA 3FI3A 2OO8X 3P5KA 4N0SA 4RQKA 4IVAA 4IEBA 3F3VA 2QCSA 3OC1A 1MRVA 3KKVA 4AAAA 3M2WA 2PVRA 2NYAA 4KKHA 4AGWA 3OF0A 4BJJA 2C6OA 3UOHA 5DH3A 2XBJA 3BYUA 5A9UA 4JR3A 4LMUA 3DKFA 1Z5MA 1TVOA 4E1ZA 4J8NA 3ZHPC 4EBVA 4FNYA 2FO0A 4FICA 1UA2A 3BBWA 3EQBA 1OMWA 3TCPA 4GG7A 1YVJA 2HCKA 3BPRA 1WVYA 5C8KA 2BTSA 2QC6A 3OUKA 2IO6A 2NP8A 4CSVA 2XH5A 3IO7A 3EFLA 4USFA 4EHZA 3A8WA 3HUCA 1RW8A 2W1EA 2CKEA 5AV3A 4CXAA 3MB6A 4BC6A 3P9JA 1YHVA 4F64A 5LVMA 3R9NA 3UVQA 4DFXE 1YWRA 2EVAA 2IG7A 5K5NA 4MD8E 5ETIA 2JD5A 4NFNA 4RFYA 3GCVA 3MVMA 2CLXA 4GCJA 4BIEA 4L8MA 4MXCA 4O0VA 5H8EA 1G8JA 5AUVA 5JGAA 2X8EA 3LFDA 5ETAA 5E4HA 4O7SA 2P4IA 4EQMA 4E73A 2OZAB 3EH9A 3LXLA 4IAYA 2BALA 3R63A 1JBPE 3U8WA 4DCAA 1YKRA 5F95A 4RWJA 5FQDC 3RCJA 4ZMFA 3PUFC 3NSZA 2UW3A 4MTAA 5L8LA 4QMMA 2HOGA 3U6IA 4J96A 4XX9A 3S3IA 3EN9A 3Q96A 4X2FA 2BKKA 1WZYA 2XCKA 5DR6A 4HGTA 4D1ZA 2WMAA 4TTHB 4JAIA 2W0JA 1W0XC 4ZLYA 4JDHA 1NA7A 4O22A 1XH9A 4C4FA 3UZPA 2IPXA 3CIKA 4BTJA 2OIBA 3NR9A 4EOIA 1NW1A 5EM6A 4BDKA 4H39A 3NFGB 4ZEGA 3EOCA 2B9FA 2QD9A 1T45A 3BGPA 4I6HA 4M8TA 5E8XA 3SD0A 3LOKA 4FKTA 3VS4A 4O86A 4D1SA 4X21A 2ITXA 2PZ5A 3EYGA 4R7IA 3DA6A 3SKCA 2WMUA 3LFAA 4FV6A 3R7VA 4X3FA 4BN1A 4LOPA 2YCSA 3O8TA 2VTAA 4KAOA 2VWXA 4XMOA 5A3XA 1VYWA 1GZNA 3KXXA 4X2JA 4DT8A 3Q6UA 2O0UA 4GYIA 5FM2A 4RFMA 3MGYA 4YTFA 3PJ8A 2WAJA 3OT8A 1MQ4A 5AWMA 4DHIB 4CG8A 2QOIA 4ALUA 3PVUA 5BQ0A 2ITUA 4XS2A 2Y4IC 5BVDA 2C6MA 1JSUA 3BELA 4HCTA 5CU6A 4FL2A 5IDNA 4IB3A 3HKOA 1OECA 4PRJA 4RG0A 3GUBA 3W16A 1QMZA 3R28A 3FBVA 3UQCA 4I94A 4I21A 4OLIA 3VWAA 4QYFA 3PIXA 4XH6A 3CQWA 3NPCA 2R0IA 1KV1A 4FC0A 4QEBA 1JAMA 3CXWA 4IC8A 2GNIA 5EDPA 1OPKA 5FBOA 2Z60A 3QL8A 3V5JA 1O6LA 3VHEA 3BGQA 1SZMA 3ORKA 2YM7A 4U5JA 4UXLA 5CS6A 3NGAA 3W32A 3P7BA 5DVRA 4AF3A 1E1VA 4EK6A 3BGZA 2C30A 3ZXTA 1P14A 4GUEA 2ZJWA 4FKUA 2GNHA 5CLPA 4AZEA 2JDTA 3I6UA 2I0HA 2PVNA 2XIZA 3UBDA 3JVSA 2WQOA 2A2AA 3RGFA 1XH8A 4X0MA 5ANJA 3QQLA 2XUUA 3UDTA 1UKHA 3BHHA 5DA3A 4BDCA 4UWYA 2RKUA 5GINE 1L8TA 4A9SA 3QC4A 4NK9A 3DV3A 4XV2A 3IK3A 4KS7A 2IZSA 3CTJA 4L3LA 4RJ5A 5CX9A 3UZRA 3L1SA 3ZUVA 4EOSA 5C01A 4FTOA 4ZTMA 3NW5A 3E64A 5CSXA 4APPA 2XCHA 3OUNB 5DI1A 5KZ0A 4JX7A 1YOJA 4KBKA 3ULZA 3ORPA 3WZJA 3L8XA 3MA3A 3VVHA 1OIUA 5G1XA 4J53A 3R9OA 1Q8WA 5EHOA 5M55A 4CD0A 1FOTA 5EI6A 2JC6A 3ULIA 2JITA 2E2BA 2G01A 5FG8A 3CEKA 4QPAA 5CI6A 5BVWA 3C0IA 4C4GA 3AKLA 2GNFA 4G34A 4F08A 1W8CA 1PY5A 3KQ7A 4R5SA 3ZBXA 2WMRA 1URCA 3IECA 5JGBA 3HUBA 4CFNA 4DC2A 3IDCA 3CE3A 3PXQA 4AOIA 3G33A 3KXHA 4L3PA 4DG0E 5CSPA 3QRJA 4IWPA 4R1YA 2W9FB 2JKMA 2VTMA 5E7RA 3AD4A 3F3WA 2C3JA 4JDIA 3SOCA 1BI8A 3QHWA 4H36A 3VQUA 3ATSA 3HV6A 4L7SA 2BFYA 4QMUA 2WQEA 4FZ6A 3VONA 5CXZA 2UVXA 2FSTX 2W4KA 4ZK5A 5BUIA 2WU7A 5LVNA 3QC9A 4A4OA 2AYPA 5CF5A 3G0EA 4BIBA 3DFCB 3OBGA 4NUSA 4Y83A 2CNUA 5E8VA 5EHYA 5CEPA 3LFBA 1WVXA 4HNFA 5C03A 3ML1A 3UIMA 4LI5A 1J3HA 4JG7A 4F63A 4K33A 1DI9A 3FQEA 3QTXA 3DJ6A 1ZYDA 2J0JA 2X8IA 2ZOQA 1FBNA 4JIAA 4B6LA 2CNQA 2XM8A 1IAHA 2XKCA 1Q24A 2ZDTA 3AC5A 3SW4A 4J52A 4DFYA 4WRGA 5D9HA 3TIZA 5HCZA 2G9XA 1Q3DA 4YO4A 1GIIA 4O7ZA 1OZ1A 4HVDA 1JQHA 5CVGA 3II5A 4USDA 4EH6A 4K77A 4PWNA 3MPTA 3ZZEA 2NO3A 4G3DA 4YHJA 3IOPA 5D7AA 3L9MA 3TG1A 5KNJA 5A54A 5AMNA 4CGAA 1SVEA 5F1ZA 3B2TA 3H30A 3RALA 2O3PA 5J8IA 1G8KA 1W83A 5EG3A 4X2NA 3OXZA 2PZPA 5E8YA 3OZ6A 5GNKA 2XJ0A 3DB8A 3Q4TA 4IVBA 1Q8YA 2WQMA 2V7OA 4OT5A 4S2ZA 4TYEA 1Z57A 4YJSA 5M4FA 5CF6A 4ACGA 2OF4A 1YRPA 4HVIA 2IZRA 4E8AA 2ZB1A 4WRSA 3A7GA 3VW8A 3G6GA 4LG4A 2PVFA 3ID6C 4JQ7A 3UO5A 4ITIA 3ZLWA 3FE3A 4I5PA 3AOXA 3FSFA 4XG7A 5KUPA 2OI4X 3V04A 4F78A 4FZFB 2B4SB 3QZFA 1DM2A 2Y0AA 3E8CA 1SYKA 4ZTHA 3RWQA 4RIWA 4IACA 3AC3A 5HTBA 3I60A 3GC8A 3D7TA 5IA5A 5ETFA 2VO3A 5E1SA 3ZRMA 3R71A 4IBMA 3SG8A 3QKKA 5AUZA 5T6KA 1MRUA 3QTIA 4YR8A 1BMKA 3LVPA 3CSVA 2QQ7A 4BDHA 5DRBA 5ANKA 4QO9A 4XV3A 2XNBA 5DT3A 1JWHA 3EL7A 3R30A 1ZOGA 2R3NA 3OMVA 3LCSA 1R78A 3SXSA 5LMAA 4EH5A 4FEQA 4F9WA 4XP2A 3ZDIA 1I44A 4QTBA 5IA0A 1W82A 5KKRB 3EL8A 4R77A 4AT5A 3WF5A 1PMVA 1GY3A 4HGLA 5BMSA 4USEA 4FMQA 3U4UA 3FC2A 5D1JA 5EHLA 5EM7A 4RJ8A 3R2BA 4KKGA 3EB0A 4O0SA 4MD7E 1GZ8A 4ZSJA 4GG5A 2V5QA 3DLSA 1UNHA 2VTIA 3F82A 2RG6A 4QDVA 5FDXA 3R83A 4YU2A 3P5JC 3NYXA 3R8VA 3C4CA 4HZSA 4ZOGA 3VS2A 3RCDA 4DFUA 3NNXA 4ZAUA 4HYUA 3LMIA 4LYNA 5AP5A 3QYZA 4O7NA 3FY2A 3QHRA 3DXPA 2BRBA 1S9IA 2R3QA 3JUHA 3PDTA 4FKJA 4ZSAA 3GNIB 4R3PA 4EEVA 3KA0A 4M69B 3VBQA 4AE9A 3UNJA 3QU0A 4J71A 5JFWA 4KKEA 2BVAA 3ZRKA 5HKMA 3A60A 5C26A 4F6SA