4DTBA

Crystal structure of f95y aminoglycoside-2''-phosphotransferase type iva in complex with guanosine
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
296
structure length
296
Chain Sequence
MRTYTFDQVEKAIEQLYPDFTINTIEISGEGNDCIAYEINRDFIFKFPKHSRGSTNLFNEVNILKRIHNKLPLPIPEVVFTGMPSETYQMSFAGYTKIKGVPLTPLLLNNLPKQSQNQAAKDLARFLSELHSINISGFKSNLVLDFREKINEDNKKIKKLLSRELKGPQMKKVDDFYRDILENEIYFKYYPCLIHNDFSSDHILFDTEKNTICGIIDFGDAAISDPDNDFISLMEDDEEYGMEFVSKILNHYKHKDIPTVLEKYRMKEKYWSFEKIIYGKEYGYMDWYEEGLNEIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APH(2'')-Id
publication title Structural Basis for Dual Nucleotide Selectivity of Aminoglycoside 2''-Phosphotransferase IVa Provides Insight on Determinants of Nucleotide Specificity of Aminoglycoside Kinases.
pubmed doi rcsb
source organism Enterococcus casseliflavus
molecule tags Transferase
total genus 100
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01636 APH Phosphotransferase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4dtbA01
3.90.1200.10 Alpha Beta Alpha-Beta Complex Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 4dtbA02
1OIQA 2J5FA 3RCDA 4AOIA 1PMUA 3DU8A 3VS1A 3VO3A 5HO8A 2WTWA 5KKRC 4I4FA 2PUNA 3GCSA 1CDKA 4F65A 2BDWA 2NO3A 4EEVA 4DINA 3ZC5A 2QI8A 5IQHA 5FUTA 3NUUA 4K8AA 2JITA 3PWYA 3H30A 3PA5A 4FEUA 4YC6A 3W0NA 1UVRA 4QQ5A 4CKRA 2H34A 3DJ5A 3FBVA 2OFVA 1NVSA 2ETMA 4R5YA 5IUHA 5L8KA 2VWWA 3A7FA 4JDKA 4DHFA 4QMNA 3KVWA 2WIPA 4RJ5A 4IAKA 5E8ZA 4GV1A 3KXNA 3WF6A 1XHAA 4UZHA 3LVPA 3FQEA 5DRDA 4B6LA 2OXYA 3THBA 1U54B 3EHAA 3I81A 5CF4A 2EVAA 4NFMA 4QMUA 2R3KA 2WTKB 4QPSA 3EQRA 2GMXA 5K3YA 2Y9QA 3ZFYA 3VQHA 3DPKA 3DBFA 3FMKA 1JOWB 3QRKA 2CMWA 4QNYA 3OWLA 4FV5A 3D15A 5LVLA 2VWXA 2I0VA 4AGWA 3MH0A 3VIDA 2UZUE 4J7BA 3Q9WA 5BUEA 3CKXA 3A7GA 3SHEA 2VWYA 3EN4A 4E93A 4JS8A 2FSMX 5CSHA 2C69A 3EQCA 5T3QA 3TZ7A 3ZSIA 4GIIA 3W8QA 4M69B 4FT9A 3SW7A 4MBLA 4XYFA 1YI6A 2GNGA 3CLYA 3DLZA 3H0ZA 3VBVA 1JBPE 3G0EA 4BCKA 4C2WA 5L2SA 2EUFB 5I9VA 2PZPA 2WMWA 4CRSA 4F0GA 4EOMA 1XH4A 2R3RA 3ZUVA 1PXKA 4C35A 2XIZA 3VHKA 4R7IA 3R9HA 3VQUA 3TTIA 4U0IA 3D5UA 2C6MA 3BHTA 3VUMA 3AT4A 4E1ZA 3IONA 3WZDA 4DG3E 3SV0A 5JQ5A 4F1MA 2XIKA 2C47A 3HV7A 4KIQA 3E64A 4TWCA 2ZB1A 4UY9A 1V0BA 3I0QA 2XNEA 1Q41A 4YBKA 4WSYA 2RFEA 1IAJA 2X6EA 2RKUA 4EH5A 4IX5A 3KCKA 4HCUA 1OL1A 3PRIA 4L9IA 3RAHA 4K0YA 2OXDA 4WG5A 4D5HA 5AV4A 3VW8A 2RL5A 5FD2A 4D4VA 2OFUA 4AFJA 4GK2A 2ZV8A 1IA9A 4UEUA 4FSZA 4L3LA 3HYHA 4D28A 4QTEA 3SW4A 4RVTA 2XUUA 4KA3A 3FSFA 3HA8A 5LQFA 3D0EA 5L8JA 2G2HA 2PHKA 2F9GA 2IZTA 4YNEA 5EDPA 4C4EA 1XWSA 3R1SA 4LI5A 4PTGA 4E26A 5JZNA 3AC3A 3HECA 2ZAZA 5LMAA 1ZOGA 5HX6A 2BZHB 1UNGA 4RA4A 5A14A 5EHYA 3OT3A 1M14A 4M8TA 5CI6A 3EQDA 4FL1A 4BI2A 3KQ7A 5HG9A 4FTKA 3BRBA 3BEAA 4FEVA 5CSVA 3UE4A 5JSMA 4ORKA 2CCHA 2YABA 5AJQA 2PE2A 3Q32A 5HE3A 5BYYA 4F6UA 2ZMCA 4KNBA 3ZBFA 5KHWA 3U6HA 4YLJA 5CU2A 5EG3A 2QLQA 5I4NA 2C6TA 4Y5QA 3OOGA 5FGKA 2GQSA 1JKTA 1PHKA 3TCPA 5IEXA 1GZOA 3DK6A 1XH6A 5G1XA 4DCEA 4ZZOA 1XH8A 3U4WA 4DTAA 3QKMA 4CMTA 4ZZMA 5FDPA 2OZAA 4ZTRA 5FP5A 4TYHA 3IKAA 2XA4A 2ERKA 2BVAA 3NNWA 3W2PA 4AOTA 1OB3A 1STCE 2W4JA 3OXTA 4IDVA 4DEIA 5KMJA 3DB8A 1SNUA 3D14A 2ITNA 3TNQB 3PJ1A 2FSLX 3QTQA 4AZTA 3QQJA 4AACA 5ETFA 3PTGA 4OTGA 4QP3A 1A06A 1FGIA 4XV2A 4C3PA 3W0RA 3KULB 3PY1A 4H36A 4RIXA 2C30A 5L6WL 3LM0A 3P4KA 3Q60A 3V8TA 4FK3A 2CSNA 4WD5A 2RFSA 4O86A 2OJIA 5AIRA 2W5HA 3ORPA 4KSQA 1HCKA 4U45A 4ACMA 2QLUA 3PXFA 4EOPA 4TZRA 5AAFA 4YR8A 2RF9A 4ITJA 4YJOA 3NZ0A 2PU8A 3B8QA 3PXRA 4FYOA 4PX6A 4GK3A 1TQMA 2YDIA 1R0PA 2BAJA 2VTQA 4FNXA 2B53A 2LGCA 4ZLYA 5CU0A 3C1XA 2BILB 2QOCA 3NUXA 1LP4A 2PVRA 4PWNA 5DHJA 2XNNA 5KZIA 4ACCA 1PXNA 1VJYA 3JPVA 5C4LA 2PMIA 1RE8A 2XK9A 3BKBA 4IVBA 2QR7A 3IW7A 4H05A 5J87A 4HVDA 1O6KA 3FDNA 3ZZEA 3CXWA 3DLSA 3FHIA 2ZV7A 3OEFX 2PVNA 3Q4CA 2I0YA 3DXQA 3OUKA 3R8ZA 4DGOA 5D7VA 4C3FA 4CLJA 3GQIA 2QKRA 1SVEA 4IFCA 2PMNX 4MXCA 3GP0A 2BCJA 3AC5A 4RA5A 4WUNA 4QOXA 4DGGA 3W16A 3VBWA 1ZXEA 2XKEA 4RIWA 3UIBA 3FZSA 3L1SA 2J4ZA 4H58A 5CWZA 5I9XA 2FVDA 5B7VA 4AP7A 4ANMA 4I6QA 4D4SA 5LMKC 1Q5KA 4AZWA 5FTOA 2XKDA 1ZZLA 2CKEA 3BX5A 1OBDA 3LCOA 1GIHA 5CEKA 2W5AA 3ITZA 5AUTA 2WFYA 2X8DA 2CGWA 3OFMA 1CKIA 3GFWA 3T9IA 1VR2A 2HZ4A 4A4LA 3ID6C 5DN3A 2JC6A 3IECA 3NPCA 2BR1A 4C4HA 2WQEA 3BBTB 3HA6A 4P5QA 5HBEA 3RPVA 4FV4A 5BVOA 1OIUA 3EKKA 2GU8A 5AP5A 5HLPA 3NVKI 5EOBA 1SYKA 3EH9A 3QQGA 4CFUA 2WB8A 3E93A 4HGEA 1K9AA 1XBCA 3ORLA 3FY0A 3SOCA 3UJGA 5IDPA 3SVVA 4FV3A 4FICA 3MDYA 4FR4A 3QRIA 2B54A 2QODA 1ZOHA 4GS6A 3IDPA 4E5AX 1YOLA 3DBDA 1WFCA 4X2FA 3D83A 3R9RA 3KFAA 1HCLA 2R5TA 3C4CA 3QU0A 4USDA 4FUYA 3IGGA 3FQHA 3BYUA 2XS0A 3QZGA 3OVVA 3UGCA 2DS1A 2W96B 4CFNA 3FL4A 2GFCA 4JX7A 4CKJA 1REJA 3AOXA 4ZJJA 1ATPE 4ZTSA 2EXMA 2OF4A 3OTUA 4K33A 3GQLA 4UWBA 5HHWA 3HMPA 1IA8A 2ZB0A 3N4VA 4E20A 2JD5A 3DY7A 4KKHA 2CCIA 3UVPA 5J1WA 3D7TB 2C5NA 4WG4A 1UA2A 3LPBA 2XEZA 5HCXA 5IUIA 3M42A 3LJ0A 4QP9A 3C9WA 4L6QA 3RK9A 3O17A 1YI4A 4IJPA 5HTCA 5AUWA 5LVOA 3VAPA 3KU2A 2C5OA 5BMSA 4I94A 1UWJA 2OU7A 3TT0A 3NAYA 4UZDA 4ZY5A 2PVJA 3NUYA 4FVPA 4ZMFA 4RIYA 4NKAA 4PDPA 2VO0A 3NNUA 3DXPA 3W18A 3UODA 1YXXA 3QLFA 4B7TA 4CSVA 2C1AA 2IVTA 3OXZA 5CU4A 3KRWA 4MXAA 2CLQA 4C61A 3LLTA 2YIYA 4ZP5A 5HZNA 4LOOA 1JKKA 4ANBA 3R8UA 4PDOA 2JDRA 1UU7A 3PJCA 3RPOA 2IVVA 3DFAA 3MVHA 1Q97A 5M55A 4C37A 1P4OA 4ERWA 2JDOA 1E9HA 4NTSA 3DT1A 3POOA 4FKRA 4LOQA 4YJRA 4A9UA 4EKLA 1KSWA 4NJDA 3S0OA 5DG5A 3ZZWA 2OZAB 1GNGA 4DC2A 3CQUA 3D2KA 4YLKA 3BV2A 4MD9E 4TYHB 3ROCA 2VU3A 3PXKA 4BTMA 3PVBA 4BZNA 4DH5A 1JSUA 1YWRA 4JG8A 3LCTA 2IVUA 3DAJA 4J99A 5KMNA 1PKGA 4NCTA 3ODYX 3LLAA 2W9FB 2WTKC 1BL7A 4XG6A 5AFVA 4BKJA 3SC1A 1SVGA 5FTGA 3CD3A 4CFFA 5L3AA 4Y8DA 5H8GA 2VO7A 3RTPA 4LRKA 3M11A 4Y83A 3BYVA 3V5TA 4AA4A 4RIXB 4ZLOA 1QMZA 2X8EA 3LFQA 3U4UA 3TDWA 1SM2A 1NW1A 3LM5A 4MAOA 3ZSHA 4UALA 5DR6A 4D58A 5AAGA 5IQDA 2QG7A 2XNMA 3A99A 2F57A 1Q8TA 3LXPA 4ENYA 1H26A 1MRVA 5JT2A 2GQGA 3PXYA 3OW3A 5GNKA 2Y4IB 2VWVA 2XIXA 2XJ2A 3PPJA 3VW6A 2CGVA 3FAAA 4HNFA 2JKOA 2Y8OA 3EJ1A 2Y6MA 3DTCA 4WNKA 4YURA 3PRFA 4D5KA 3FEGA 4PL4A 4DAWA 2VZ6A 3W55A 4X3FA 3R7VA 1URWA 5BUIA 4L53A 4H1JA 3UIMA 3K5VA 3SG9A 4DLJA 2OO8X 3SDJA 4Z55A 4EBWA 4O82A 3BIZA 3T9TA 4HPTE 1FOTA 3M2WA 3TXOA 3PPZA 4QP8A 4LUEA 5CU6A 3E88A 3RHXA 3C7QA 3L8PA 3C5UA 4IHPA 4I6HA 3H10A 3PE1A 3V3VA 3ULZA 3ORMA 1OKZA 3KREA 3NWWA 2VX1A 2A0CX 3KXGA 1NVQA 3BZ3A 3IOKA 3UP7A 4RIWB 5LWMA 5M57A 4RWKA 4TNDA 2XM8A 2UZWE 5L2TA 3Q4TA 3VJNA 5KMOA 5HU9A 2PMLX 3QC9A 3FUPA 1ZMVA 4FV0A 4NZWB 4AWIA 4I4EA 3G9NA 2QR8A 3PY0A 4I93A 4ALUA 1FPUA 3ODZX 3I7CA 2AUHA 1F3MC 2W1CA 4EOKA 3MPAA 3NNXA 3VRYA 1WBTA 4JDJA 3BBWA 1ZAOA 1LEWA 4MNEB 5AP2A 4TYEA 2C5VA 4XP2A 4FE2A 4MYGA 5DE2A 4EJ7A 3EQBA 2Z7RA 5AEPA 5C8KA 2H9VA 3VS5A 5E91A 4AW5A 5J95A 2YHVA 2X2KA 4G5JA 1R39A 5IA2A 5JK3A 4DBNA 2ERZE 4FZFB 3QZFA 1Q8UA 2X2LA 2QOFA 2W1GA 3CTQA 3GVUA 2HELA 4O6EA 4QPAA 3UZPA 5DI1A 3ZH8A 5AUXA 2C0TA 4DFYA 5HD4A 3TV6A 2UW5A 5GHVA 5FEDA 1XKKA 1ZARA 3LHJA 3OCTA 5B0XA 4AN9A 4HVSA 2QURA 2JDTA 2Q83A 4LOPA 3F5XA 4XG9A 2R7BA 3A60A 4RIOA 2GSFA 4PY1A 1OUYA 5CENA 2BUJA 3VHEA 3IW6A 3ZRMA 2RFDA 2OKRA 3R9NA 2HWOA 2YM3A 1FQ1B 3I6WA 4BICA 4C4GA 4W4YA 4MH7A 3VUDA 4F64A 2UW3A 2VTHA 5ANGA 5AP6A 2GQRA 3DFCB 4WO5A 4I20A 4XOYA 4I92A 4HZSA 4HCTA 5M06A 3TNHA 5BVEA 4TW9A 1V0PA 4IADA 2C0IA 4Q9ZA 4RZVA 4YTIA 4BDFA 5HLWA 3ZLSA 4E6CA 4H39A 3I5NA 2X81A 4FNWA 4MCVA 4XRLA 3GEQA 4RIYB 1FVVA 5CEQA 5ANIA 1H01A 2E9NA 5CQUA 3IG7A 4CFVA 3PXZA 3GU5A 4YP8A 4G5PA 4YLLA 2PVLA 2WMAA 4BTFA 3R02A 4YZNA 2DQ7X 3QTWA 3U6IA 1GAGA 4JRVA 3F3UA 4XV9A 4ALVA 3BELA 3A62A 4KRDA 5JFXA 5FM2A 1M7NA 4ASDA 1UU9A 4ANQA 4QTAA 2CHLA 4X2NA 3SGCA 3VBXA 4U7ZA 2AC5A 4DH8A 4XJ0A 3MTFA 3O8PA 3QGYA 4S31A 4ZMEA 3P7AA 5CI7A 3UTOA 2VNWA 3ORZA 5CZIA 1OBGA 4JLCA 2O5KA 4FV1A 3RM7A 3FLQA 3WBLA 2ONLC 4OTRA 3E8EA 4F9BA 4ZAUA 2PL0A 2UZOA 2ITPA 3ZBXA 1OKYA 5CVFA 2CDZA 3I5ZA 3SAYA 4AU8A 2C1BA 3COMA 1GOLA 3PFQA 4RJ4A 3ZO3A 4I5PA 2BRGA 3QA8A 3JVRA 2BFYA 3F3WA 5IUGA 5ETAA 3CJFA 4K11A 2O3PA 4AX8A 2OW3A 2QOBA 2XVDA 3PA3A 4YZMA 1Y6AA 3PIXA 2J5EA 5BUJA 2XKFA 4U79A 1M2RA 3DJ6A 4YO4A 4DT9A 3DQXA 2CNUA 3GU7A 1ZMUA 4O0RA 5KBQA 3IW4A 2XNPA 3VF9A 2W99B 4X3FB 2Q0NA 2WPAA 3D94A 3CKWA 3IPHA 3OC1A 3KVXA 4Y72A 4H3PA 5E7RA 5CZHA 3GB2A 4A9YA 4EH9A 4BHNA 2WMXA 4P4CA 3KXXA 3SX9A 5I5ZA 2VRXA 4FKUA 5DRBA 4TY1A 2SRCA 4MD8E 2EU9A 4FTTA 3RK5A 1ZZ2A 2OIBA 4MX9A 2FO0A 2WMTA 3G9LX 2OGVA 4KKGA 3TWJA 4ARKA 3QTZA 4GU9A 1PXIA 4LYNA 4BC6A 4GVJA 1PXMA 3R8MA 1CMKE 4IMYA 5BMMA 3DXNA 4N0SA 1W98A 4I5HA 5F9EA 4ZIMA 2QG5A 3CSVA 3LFEA 4GEOA 4PNKA 3CTHA 4ASXA 4FZAB 4HYSA 5CNOA 5CU3A 3WF7A 3Q9ZA 4FIEA 4FX3A 4V04A 5H9BA 3LFNA 3CTJA 4XH6A 3ZUTA 2FUMA 3R28A 3PLSA 4FOCA 1P4FA 4IB3A 1T45A 4YSMA 3RALA 1JKLA 3V5WA 3VC4A 1R1WA 1IEPA 2PE0A 4RWJA 2I0EA 2C4GA 2F7XE 3A2CA 3U87A 1KOBA 3EZVA 2W7XA 4XRJA 5CAQA 3ENHA 2RFNA 3Q6UA 5CX9A 3ZLWA 4WZYA 4PUZA 4E4MA 4KAOA 5AUZA 4H1MA 2BIKB 3NS9A 3WF5A 3PIYA 3NGAA 2R2PA 3BV3A 4O81A 3GI3A 4BCFA 4C7TA 3KK9A 4QP1A 1REKA 4D4RA 2OSCA 4DLIA 5I9YA 4R7BA 4O7VA 5EDRA 5LVPA 4JAJA 4AE9A 4L67A 3CIKA 4FTOA 2ZDTA 3ANQA 3QTXA 4FV9A 1H24A 4JOAA 4YC3A 2I0HA 3AGMA 2IWIA 2JDVA 5FDXA 3L8VA 5HCYA 4A4OA 5EQYA 3MB6A 5CF8A 3TUBA 5AP0A 1UNHA 4Y5HA 4AG8A 4HGLA 1UNLA 3VUGA 4F1OA 3FMNA 4XBRA 3MI9A 3CE3A 3WIKA 2HOGA 1QPDA 5DIAA 3HZTA 1OIYA 5ANOA 3QZIA 3IOPA 4FSUA 4C0TA 3G51A 2G1TA 4OT5A 3R0TA 3F5UA 4O84A 3WF8A 3PJ3A 1PYEA 3CD8A 4C3RA 3KEXA 2R4BA 5IQGA 1U46A 1OGUA 4OTDA 3GC8A 3V51A 3Q04A 3NUPA 4CLIA 3DA6A 4EK5A 5IQFA 4LV5A 1DI8A 4EYMA 4FIIA 4DF3A 4KS7A 2Y4IC 4S33A 5L8LA 4JQ7A 5JFWA 4FTRA 4DEBA 4WUAA 2Z7QA 3CQWA 5LJJA 1WZYA 5DR9A 3UOKA 4IWDA 4ZSGA 4WOVA 2Y0AA 2BFXA 4ZZNA 4O27B 3Q9YA 5HO7A 4L44A 3E5AA 4O7WA 3CEKA 4QMMA 4DCAA 3Q2JA 4L01A 3H9RA 4FKJA 1GZKA 3PPKA 3R01A 4P90A 2C3KA 2WQMA 2ZMDA 4ASEA 4C33A 3AD6A 4E4XA 2P4IA 1GZNA 1XBBA 4O0WA 4ZTQA 5A4LA 3RHKA 5AADA 3TKIA 3V6RA 4BYJA 2XCHA 5KX8A 3RKBA 3OBJA 2QOLA 1RJBA 4L46A 3ZCLA 3IDBA 1OZ1A 2BKZA 2PVYA 2QOIA 3PVGA 1QCFA 4BCOA 1I09A 5EYDA 5HVKA 4G1WA 4FC0A 4QO9A 3V5JA 1YW2A 3OY1A 3ORIA 2JFMA 2B7AA 4IIRA 5I9ZA 2ZM3A 3F3TA 2ZVAA 5J8IA 4QMQA 3TNIA 1ZY4A 2B1PA 3NUSA 1R78A 5DA3A 2UW7A 5LCKA 2C68A 2XF0A 4G6LA 5FEEA 5KHXA 4DGLC 4UX9A 4LQMA 2HY81 3CPBA 5DT0A 2R3LA 3IO7A 3LXKA 2GTNA 3ZRKA 4USFA 2WMSA 1U5QA 5E8TA 5GJGA 5TR6A 5BPYA 4NIFB 4F63A 4IDTA 3VBQA 2BPMA 4NSTA 4FTNA 3UQGA 4FI1A 4XHKB 1H08A 2XH5A 4M15A 3ZOSA 3UO5A 3C0HA 3POZA 1CKPA 1P14A 2YDKA 4W4WA 3G6GA 1U5RA 4DBXA 3AMBA 2G15A 3FI3A 4KABA 4UBAA 3DAKA 3R22A 5AP4A 2R3FA 3E63A 4M68A 2F2UA 2GNHA 3VUKA 4ALWA 3DB6A 4OTQA 2Y6OA 2YCSA 3F82A 5EH0A 3ZM9A 2OZOA 3U55A 3SRVA 5FXSA 3CY3A 4BTKA 3HMIA 1WBOA 3UPZA 2UZDA 4CVAA 5B2LA 2V0DA 3LZBA 4QYFA 4PTCA 5CSXA 4F70A 4YC8A 3F9NA 4USEA 3MBLA 3VS0A 2V55A 3NIZA 2VWIA 2CN8A 1U4DA 5CS6A 3LFFA 5C26A 2OH0E 1NY3A 3W0PA 1XBAA 4A7CA 4FNYA 2J0JA 4FKWA 3UVQA 4Q9SA 3JY0A 4YBJA 4OR5A 1YXTA 4L7SA 3UC3A 3W0MA 3MFUA 3HV3A 1L3RE 5A9UA 4GJ3A 3DS6A 4EZ5A 2RG6A 4X7QA 4G3EA 4WIHA 4J97A 4RJ3A 5AAEA 1DI9A 5CVHA 4G34A 3UOJA 4EYJA 3DZQA 2BZJA 4JBQA 4U40A 4UWYA 4FEWA 4IZYA 3PP0A 3QAME 2H8HA 4C4JA 1ZYJA 3WOWA 4CFXA 4PNIA 2WO6A 2QC6A 3IQ7A 3EQFA 3S4QA 3BE9A 1WMKA 2YAKA 5EDQA 4I5CA 3LKMA 3R7YA 3GU4A 2CGXA 3FMJA 4R7HA 2EXCX 3QXOA 3VUHA 5I0BA 4RQKA 2ITWA 3C4ZA 4MF1A 3G6HA 4JBPA 5D9HA 4FK6A 1FVTA 3I7BA 2O63A 2PY3A 4CNHA 2PUPA 2YCFA 2QU6A 4HGTA 2YITA 2VTJA 4ZLZA 5IMEA 5JEBA 1Q3DA 3UBDA 3K54A 3DQWA 3D7ZA 5I9WA 4AZEA 2ZDUA 1JAMA 3O71A 4FKQA 5M4IA 3FQSA 5HNGA 5EK7A 5C4KA 3KN6A 3QWKA 5DPVA 4MHAA 3R00A 3TZ9A 3H0YA 2CGUA 4IAZA 3LE6A 4KUJA 5HCZA 3QYWA 4FIFA 4BDJA 2FGIA 1WBNA 2DWBA 4FZ6A 4WRSA 4UN0C 5CAPA 4BDDA 5J5SA 3BEGA 1DAYA 4I23A 5TKDA 4BIEA 4DTKA 3OG7A 4QMVA 3NYNA 5JQ8A 3RWQA 5FLFA 5F20A 2OLCA 2WTDA 3MA3A 4O7NA 4L3PA 2UVXA 2UW0A 3HV6A 3VUIA 3Q4UA 3MJ2A 1U59A 4O0SA 4DFXE 4E8AA 2VTNA 4CGAA 1H28A 4II5A 1G3NA 4JRNA 4G9CA 4FZDB 1UKHA 4ZEGA 4KWPA 4PL5A 2BRBA 2NRYA 3NYVA 4X3FC 2IW8A 3L8XA 4EH8A 1QPCA 5K9IA 5IQEA 3LJ1A 2X9EA 4TTHB 5M4UA 2JIUA 2WMUA 3NW5A 3FXZA 3AGLA 3N9XA 4XUFA 3UMXA 2WMVA 3ZU7A 5EM5A 1PXOA 4X3JA 5JFSA 4EH4A 5KE0A 4BF2A 2IW6A 2WOUA 4QP7A 4WA9A 4CKIA 3H4JA 4GT5A 2VD5A 2YCRA 4C02A 3LJ2A 2YM7A 5ACBC 4D1ZA 1WVWA 3G90X 4FMQA 5D10A 2BAKA 3D2IA 2HXQA 2XK4A 4DEHA 2F7EE 2R3IA 4HZRA 3TV7A 3ERKA 1KV2A 3NCGA 4GT3A 2XNGA 4O7ZA 2WXVA 3WZKA 4F0IA 1SMHA 3MVMA 4BDAA 3R2BA 5IH5A 2JIIA 4FEQA 2X4ZA 4UV0A 5HE1A 3DCVA 4XNEA 2XMYA 3G5DA 3P7CA 4J8MA 2A2AA 3QHWA 5KMMA 1W7HA 3M1SA 2HENA 4PTEA 5EYMA 4O83A 1Q8WA 5M51A 2PYWA 5GIOE 4W4XA 2QQ7A 4KB8A 3ALNA 3EL7A 4K9YA 1ZWSA 2Y7JA 3MGYA 1A9UA 4YSJA 3FI4A 3ZC6A 4U8ZA 3II5A 4JDHA 4LRMA 4IE9A 3LCKA 2C6KA 3TYKA 3C0GA 3KK8A 3B8RA 3WZJA 4DH1A 2OH4A 4QMPA 3O7LD 4ZY6A 4I3ZA 2WEVA 3F5GA 5BVNA 3E3BX 2OWBA 3QF9A 5IH4A 4H3BA 3KCFA 1G5SA 3L8SA 1WBVA 4D4YA 3MWUA 3QLGA 3E8CA 2PPQA 2XZSA 2GNLA 3H3CA 1W0XC 4S32A 3DNEA 3ORTA 3W2SA 5HTBA 1E1VA 3RVGA 3QUEA 3O96A 3QUPA 4U9AA 2UZEA 2WZJA 3FKLA 3SRVB 3FC1X 1YQJA 5AUVA 4I0RA 3OT8A 3F2NA 4M0YA 1JLUE 4U42A 3BLHA 4RFZA 1ZMWA 4EK8A 2Z8CA 3IDCA 4FT5A 3F7WA 4MQ2A 4M0ZA 3C5IA 1VYWA 4TN6A 2Z7SA 2YA9A 3MV5A 4NU1A 5KNJA 4N57A 3W32A 4BR3A 5AA8A 3EFJA 4BZDA 4EH6A 3OCBA 3GC9A 2WEIA 3LCSA 4I21A 1DAWA 3COKA 5IQBA 2IN6A 5IEVA 2QHMA 5JKGA 5E9EA 1WAKA 3UP2A 3KRRA 3WILA 1BI7A 3AG9A 4WNMA 3FPMA 2BRMA 2H96A 3BLRA 2X8IA 2BRHA 4BCIA 3C4WA 5K5XA 2FH9A 4EUUA 4KIOA 2QO7A 5AM6A 3EB0A 2V7AA 3BGQA 3DV3A 2YN8A 3P7BA 3RZBA 5B2KA 2CKPA 3FJQE 4BHZA 4EOJA 3A8WA 1KWPA 3OS3A 4KBCA 4MTAA 4GH2A 1H1WA 3QD4A 4JXFA 1XO2B 2PVHA 3JR1A 4FTJA 3RJCA 4EOOA 4PQNA 2YM5A 4N6YA 1OL2A 5IA1A 4QP6A 3R7UA 3V01A 2CPKE 3A61A 4HJOA 1XJDA 3N4TA 4QQJA 3MH1A 1MUOA 4YJSA 3ETAA 3MB7A 5IPJA 3QD2B 1UU8A 1ZYSA 2WNTA 2XBJA 2YFXA 3HMNA 3RPRA 4DE4A 5T6KA 4A4XA 3EN5A 3MVLA 4FL3A 3PP1A 3C13A 3P9JA 1YXVA 3FY2A 3MH3A 1MRYA 3PXQA 1ZOEA 4FSYA 4KD1A 3UDBA 4C4FA 3LOKA 4G3CA 5IQAA 3VN9A 1NXKA 2YJRA 1H0VA 4O7TA 3PSDA 3DBEA 5FQDC 4FSRA 4Z9LA 3VS6A 3MTLA 1B6CB 2R3JA 2GS2A 3NEWA 4XS2A 3L9MA 5F94A 3WZEA 3P0MA 2RG5A 3R7EA 5HBJA 1VZOA 2J0MB 4J95A 3CY2A 3LAUA 1F0QA 2HZIA 2W1ZA 4IH8A 5EYCA 4ZTLA 3TIYA 4RC4A 3C0IA 3IW8A 2B9IA 4L43A 1KOAA 2WTIA 3PG3A 1GZ8A 3E87A 5EFQA 2YISA 1H1QA 4GJ2A 3TEIA 3TDVA 5A6OA 5C9CA 3F88A 3HAMA 3OUNB 3MW1A 4IX6A 4IVDA 4M12A 3A4PA 4E6AA 5LARA 4U94A 5K5NA 5IDNA 3SXRA 2WQOA 1J7UA 5JRQA 3EN9A 2WKMA 2UVYA 5AWMA 4XMOA 4DFZE 5HU3A 5ITAA 3NYOA 5AX3A 3TI1A 3ZLXA 4FKIA 3ZEPA 4L42A 1J3HA 4C36A 4DH3A 4XOZA 5BNJA 4AT3A 3MY1A 5DLSA 1O6LA 3P5KA 5DGZA 5IA4A 1V0OA 4FNZA 2JIVA 2OG8A 3C4FA 2GCDA 4K77A 3VS7A 4BCMA 5IA0A 3KMUA 4IB0A 2F7ZE 3O2MA 2JKKA 2VO6A 4ASZA 5BVFA 4NFNA 4ACGA 3JY9A 1ERKA 3QTIA 4JDIA 3KGAA 2BHEA 2IZUA 3ANRA 4TWOA 4Y73A 5CASA 4C58A 5J7HA 3GENA 2FSTX 3QBNA 1KE7A 5BX0A 2W5BA 2R3GA 3LFDA 2UZNA 5DT4A 1YDRE 3RI1A 4XG7A 4IM2A 5E8UA 1KE8A 3QQLA 5CQWA 1PKDA 3W0QA 2WMBA 3O8UA 2PVFA 4I24A 2JKMA 4UXQA 3MH2A 3R9DA 1GIJA 4F99A 4F7SA 3K3IA 2B9JA 3N51A 3OF0A 3AD5A 1CSNA 2XP2A 4TWNA 4U98A 4JIKA 3D9VA 3ET7A 3V5LA 5KMKA 1PYXA 5E92A 3QCSA 4CRLA 4EUTA 3CP9A 1S9IA 4I0TA 4EH2A 4J98A 2WOTA 5IF1A 5LVNA 2J0LA 2O0UA 3L9PA 5L2WA 2W05A 4ZTMA 3VJOA 4HYHA 4Y95A 3JYAA 3ACJA 4L68A 3O51A 3Q5IA 4O2ZA 2B55A 4RX9A 3LQ3A 2P55A 2W1IA 4D1XA 3NW7A 5DR2A 1H1SA 4ENXA 4PF4A 4IW0A 1KV1A 4N70A 2PTKA 4RFYA 1BKXA 3PE2A 4EHEA 5HNIX 4G16A 2ZM4A 5KCVA 2ITZA 3I0OA 4KIPA 5EHOA 3PJ2A 4AT4A 3REPA 3UG2A 2YCQA 3F61A 4AZVA 3GC7A 1OL6A 3D4QA 3S1HA 5CT7A 3OP5A 4FG7A 3QCYA 3E92A 3W1FA 3KXHA 4JG7A 3R2YA 5JH6A 4MBJA 3RNIA 5A6NA 5L6OA 4G6OA 4FYNA 5AP7A 3AC2A 2QHNA 3QQFA 1Q99A 2J6MA 3FE3A 5AP3A 3SXSA 3TJCA 4KKEA 4QQTA 2X9FA 5M4CA 2WAJA 1NVRA 4RWLA 1Z5MA 3FI8A 4NM0A 2R64A 2X0GA 4K2RA 3KRJA 4EWQA 2PVMA 3BYOA 5GINE 5LXMA 5L6PA 2PWLA 4IACA 1R3CA 2IW9A 3I79A 4U81A 1PY5A 3KRXA 3NYXA 2JGZA 5IU2A 2VUWA 2LAVA 4OTWA 1XR1A 3HP5A 4Q5EA 1FVRA 4EL9A 1Z9XA 2OBJA 2J0IA 3TUDA 4LL0A 4FIJA 4L00A 1WVYA 3BI6A 2EB2A 3P86A 2X7FA 4FKPA 4MWIA 5AUUA 4O6LA 2R9SA 4ITIA 4S30A 3MFSA 1Z57A 3MVJA 5FBOA 3RK7A 4F7JA 2Q0BA 1KE6A 3FMEA 3QUDA 2CKOA 4WG3A 3RCJA 4YJVA 3EYHA 3R8PA 4OUCA 4QMLA 3W2QA 1J7IA 3GOKA 3WE4A 2ITTA 3TNWA 4FG8A 2VWBA 3GUBA 4ZXTA 3F7ZA 3S2PA 4G3FA 3EFKA 4J53A 4AW0A 4BCPA 2BZIB 4IQ6A 4C62A 4EBVA 5HIBA 5M08A 5CNNA 1IAHA 2YERA 3EN6A 4HNIA 4M67A 1VEBA 4BN1A 3RAWA 3TZMA 5FBNC 1PMEA 4ZSLA 4M97A 3RP9A 3A7HA 4GW8A 5E8SA 1OITA 2P3GX 3TUCA 3FLYA 3VBTA 3EYGA 5AA9A 4ITHA 4XV3A 3FMHA 4V05A 4YTHA 4DITA 4DGNA 3SLSA 5CAOA 4FV7A 1M2QA 2JBPA 4FTUA 5CSWA 3FKOA 5A3XA 4FTCA 3LXLA 5IQCA 2GHMA 1K3AA 4M84A 4WBOA 3AC8A 2XIRA 4A9RA 2W1DA 4DYMA 3RWPA 5KBRA 4OLIA 3NVMB 5HI2A 4B9DA 4NL0A 1KE9A 1PMVA 1Q61A 4FV8A 5M4FA 3HKOA 5DH3A 3R73A 1Q4LA 5D7AA 1U54A 3CQEA 4AXAA 2X39A 5DOSA 3UQCA 4CV8A 3R6XA 4YTFA 3BHVA 4A07A 4CT2A 4O96A 4EJNA 4QMYA 5D1JA 4ZJIA 2A27A 2IO6A 4PDYA 2DYLA 5ANDA 3TM0A 3RPYA 4BIDA 4MNFA 5EOLA 4OT6A 1YHSA 4EKKA 3DKFA 4ZOGA 4E4LA 4I22A 4BCNA 3FMMA 4EORA 4FTLA 4ANSA 2QOQA 4RLLA 4F0FA 5JN2A 2YDJA 5CTPA 2HY0A 3UZTA 4IVCA 5EW3A 4AW2A 4EONA 4R78A 5FTQA 4AA5A 4RQVA 5E4HA 4JR3A 2R3OA 5ICPA 1Y8YA 5ANJA 3Q53A 3QTRA 4U80A 5EHLA 3G2FA 4FA2A 4GKIA 4AE6A 3UNKA 3V5PA 2DUVA 2C6IA 3KRLA 3KL8A 4YZDA 3R83A 3JUHA 3NIEA 2A1AB 4JI9A 4DG2E 3QRUA 2OJJA 3R21A 4D9UA 4K18A 2GS7A 4EH3A 4AAAA 2C6LA 4IAAA 4C34A 4K1BA 2A4LA 2WD1A 2H6DA 3PWDA 4RJ6A 5HE2A 3QWJA 4J8NA 2NNWB 3B2TA 2GNFA 4RG0A 3QRJA 3LFBA 4F9WA 4F08A 1OM1A 4XG8A 3QD3A 3BHHA 4RC3A 4G31A 5TOZA 4BDCA 2B52A 2W0JA 3TJDA 3DZOA 4L8MA 4IZ5A 2WMQA 3NCZA 3QX4A 4XBUA 3DKCA 2XJ1A 1OECA 2WTCA 5IZFA 3OY3A 3R1QA 5C8NA 2C6OA 1MQ4A 3DJ7A 2RGPA 3UOHA 5A4QA 2UVZA 1WCCA 4JAIA 2G01A 4BZOA 2OI4X 4JIAA 4NM3A 2BDFA 1CM8A 3FMLA 4E5WA 3VVHA 1Q8YA 3KB7A 4Y85A 4LMNA 3PVWA 3CGOA 2FSOX 5M44A 2HWPA 2XYUA 3FMDA 3FI2A 4RX5A 2BROA 4GIHA 1KE5A 3RPSA 1S9JA 2VX0A 5E8XA 4FSWA 3DAEA 3RINA 5EI8A 2HIWA 1BMKA 3BYMA 3CR0A 3O23A 2W1EA 3K2LA 5ACKA 2XJ0A 5BYZA 4YU2A 2GS6A 1BX6A 2PE1A 4GUEA 3WZUA 4UWCA 4YHTA 4WNOA 5EYKA 4P7EA 4I5MA 4XP0A 4V01A 4DH7A 2QD9A 5DEYA 1PJKA 4IX4A 1ZYCA 5EQEA 4APPA 1FGKA 2I7QA 3V04A 4EOSA 2J9MA 3NUNA 1J7LA 2XK7A 3HUCA 3NDMA 4FTQA 2YM8A 3WARA 4BDHA 5DNRA 4WT6A 2NPQA 2OJGA 2FA2A 3E3PA 3BE2A 4MQ1A 4RVMA 3F6XA 3PUPA 5HORA 3HLLA 2E2BA 2GHGA 4RSSA 3COIA 4BGHA 4TKSA 4DN5A 4KBKA 3PLAE 4IAYA 4GCJA 2YJSA 3R7OA 5CT0A 2E9OA 2WTVA 2IG7A 3N4UA 5E90A 4AS0A 3KY2A 4ZS0A 5C03A 4EK4A 5EKNA 3GCUA 4X6QC 4U3ZA 4X6RA 4BCJA 2I6LA 1HOWA 2PZRA 4Z7GA 4JX3A 1UV5A 4AGDA 1RW8A 3QQUA 4FSTA 4MBIA 2XK3A 5EW9A 3UMWA 4C38A 4CCBA 2BAQA 1H8FA 2E9VA 4XP3A 2IZRA 4R1YA 3EL8A 2C3LA 3MESA 3IS5A 4TYIA 5H8EA 4RMZA 2J50A 4I41A 3UZRA 5DEWA 2QOOA 3LFCA 4FT3A 4W8EA 4NM7A 4WKQA 4YHJA 5FP6A 3HEGA 4U3YA 2X6DA 3IK3A 5AV0A 4DFBA 2P2IA 4EOLA 5H3QA 3FZOA 1P2AA 2O8YA 5JGAA 4FTAA 4JT3A 4O0XA 4DEAA 4HVIA 3QCQA 3C51A 3LCDA 4EHZA 3NR9A 2C3JA 2ZJWA 4KINA 4R3CA 1EH4A 3F2RA 4G9RA 4GK4A 4WHZA 2VTIA 2VAGA 5FXQA 4NJ3A 5LMBA 1CKJA 3A7JA 4RWIA 5HNBA 1JVPP 4GMYA 4HYUA 4NW6A 4O21A 4X21A 5AIKA 4ZS4A 3ELJA 2ACXA 2UZTA 3EQGA 3FLSA 3S00A 3H9OA 2R3NA 4QMTA 5E1SA 1BUHA 4FV6A 4GFMA 4YZBA 4OTIA 4X0MA 1MRUA 2B0QA 3S3IA 2AYPA 4RC2A 1YHVA 4YZ9A 3LMGA 3OD6X 1PF8A 2XYNA 3FZ1A 1YXUA 4RZWA 4DTBA 2ONLA 3KA0A 4FGRA 2QNJA 3UC4A 4B99A 3OW4A 3FPQA 2QONA 3T3VA 1FMOE 4BI0A 3KXZA 2QCSA 4OW8A 3O0GA 3ZM4A 3QZHA 4BIBA 4QYEA 4V0GA 5H8BA 4AFEA 3Q52A 2I40A 1AQ1A 1SVHA 3ZLYA 4IC8A 4ZSJA 4BCGA 4DGMA 3ZYAA 3EFLA 2VO3A 4IX3A 3VRZA 4F7LA 5JMSA 4H3QA 4S2ZA 1OKWA 2BRNA 2O64A 4GSBA 3PIZA 4UB7A 3MIAA 1OKVA 3D5XA 4ZTNA 3MFRA 3C50A 3VULA 3W2RA 4GFOA 4BDEA 4M13A 2W9ZB 4X2KA 2ZOQA 2X1NA 2J7TA 1W84A 1YXSA 3GCQA 4U6RA 4HVHA 4QYYA 1YKRA 3MJ1A 3QKLA 4GRBA 3UYSA 2V5QA 2VTOA 2JLDA 3CCNA 3ZONA 3R1NA 1YOMA 2IJMA 4WRGA 5AV2A 1UKIA 3MS9A 2P2HA 2X7GA 4ZSEA 5FG8A 4IJ9A 1W8CA 3P78A 4FKOA 3TIZA 5CYIA 4GG5A 3GCVA 4ERKA 4HYIA 5HIDA 3TN8A 3V6SA 3QXPA 3K3JA 2PULA 2OXXA 3TL8A 1FINA 4R77A 3MSSA 4EC8A 3ULIA 3LFAA 4CEGA 2W4KA 1TVOA 1AD5A 3EZRA 1URCA 1Q24A 2J0KA 4IEBA 3Q9XA 4P2KA 2YWVA 3D7TA 3KF4A 2CJMA 2F4JA 2WQBA 2HK5A 2VTTA 2BZKB 4JVGA 1ZY5A 4QP4A 5CF6A 4BDIA 4APCA 4IZAA 3A8XA 4TRLA 5EI2A 2R0IA 3ROYA 1SNXA 3LMIA 4Q5HA 4D0XA 3COHA 3KKVA 4FKLA 1H1RA 4TNBA 2YZAA 2G2FA 3BQCA 5C1QB 3EQPA 2CKQA 4QMSA 1B38A 3HDMA 4JG6A 4NCTC 3V8SA 1LPUA 3BWJA 3DK7A 4LMUA 5C01A 5BQ0A 2UW6A 1YWVA 3SXFA 4QTCA 4AN2A 4BTJA 1OUKA 2W06A 5B2MA 3GNIB 3HGKA 2AC3A 3DTWA 4PMSA 4YJQA 1V1KA 2QO2A 3NUAA 4O91A 3RGFA 3WE8A 1OPLA 1MP8A 2YIWA 3PYYA 4RX8A 5K4JA 1YVJA 3OHTA 4QMWA 3TKHA 5AUYA 3HAVA 1JQHA 2UZLA 1OMWA 3MPTA 5AV1A 5A4EA 5GIPE 4BI1A 5ETIA 4YO6A 4LGGA 4O38A 1JPAA 1TQPA 1OL7A 2GNJA 4PDSA 4Q2AA 2ZYBA 3D5WA 3DKGA 2QU5A 2X7OA 4PL3A 5F4NA 4MK0A 2C6DA 2BMCA 2YWPA 3S95A 4IVAA 3BU3A 5GJDA 5EM6A 5BVKA 4F6WA 5CALA 3UYTA 1H0WA 3A4OX 3HNGA 1P5EA 2IVSA 3G15A 1G8AA 1OL5A 3UVRA 3U54A 4JR7A 3TKUA 2UW4A 4FT7A 3QRTA 4FODA 4DFLA 5HD7A 2VN9A 3ZO4A 3HDNA 2XNBA 3OXIA 3R9OA 4E6QA 2OJ9A 4OGRA 2CN5A 3AXWA 2WIHA 3QQKA 4FT0A 3SQQA 1QPJA 4AQCA 2YACA 3OOMA 3W10A 4EC9A 4FV2A 3MYGA 4WNPA 2UUEA 3UPXA 4QP2A 3K5UA 3FHRA 1A48A 1J1BA 3QGWA 4AW1A 1TKIA 5CAVA 4EQCA 5E8YA 4IM0A 3UO4A 2YAAA 1YI3A 3C4EA 4X2GA 5D41A 5TT7A 5FXRA 2W1HA 3PJ8A 3Q96A 4YHFA 1QL6A 4D2RA 4J71A 5CXZA 1H07A 3UQFA 3QD0A 5KMLA 3QKKA 3DOGA 3KXMA 5HGIA 2G9XA 3NLBA 3BLQA 2Z7LA 3QYZA 4U44A 2VGPA 4RVLA 4B8MA 4BVUA 4GT4A 3HMMA 3JS2A 3RAKA 4CQEA 3HMOA 2XK6A 2WGJA 2O2UA 1GY3A 1APME 1YDTE 2YM6A 3D5VA 1W83A 3ORXA 4G3DA 5CF5A 2ITVA 1JSVA 3PA4A 2PMOX 3GU8A 5CVGA 2OK1A 5HG5A 4FTIA 4XV1A 3LXNA 2IPXA 4JQ8A 4BY9E 5KO1A 1JNKA 4UYNA 2VTLA 1RQQA 3KMMA 3PVUA 4L3JA 2O65A 3BWFA 3LQ5A 5AX9A 3U51A 4C59A 4EWHA 1WBWA 4F9CA 3EQHA 4V0GB 2YIQA 4B0GA 3OTVA 1ZYDA 2IZSA 3HRCA 4QMOA 2ITQA 1IG1A 5DYJA 1WBSA 3HV5A 3BQRA 3R8LA 3VS3A 4BB4A 4HVGA 1H25A 4D1SA 2KULA 3CPCA 4IANA 4O7PA 3DBQA 1LUFA 4NT4A 1Y6BA 2CLXA 3ZFXA 1FMKA 5HESA 2VNYA 3UIXA 4Z7HA 1M52A 5IISA 4FG9A 2REIA 3FL5A 4MVFA 4FSNA 4O7LA 4D2SA 4NW5A 4KRCA 3R1YA 4G3GA 2ESMA 4IWPA 5CEOA 4N4SA 1IR3A 1Q8ZA 2JAMA 4HGSA 3EN7A 4AZSA 4MNEA 5JGDA 5HLNA 2YZLA 4O0TA 3R30A 4A9SA 3I6UA 3KN5A 3LIJA 3OBGA 1RDQE 5IQIA 4R1VA 3FWQA 4FSMA 3HVCA 3NSZA 4RVKA 3ZRLA 3P79A 2WQNA 4RRVA 4AGCA 4J96A 3I4BA 4EOIA 4RGJA 4MXXA 4RFMA 4CCUA 5DT3A 4E4NA 3AQVA 3JXWA 4YMJA 2ZV9A 3KC3A 4TXCA 4GU6A 3HL7A 2B4SB 3RM6A 4JQEA 3ZTXA 5D11A 1J1CA 3GT8A 4P5ZA 3U9NA 3E7OA 3VNTA 4MEDA 5IH6A 4O0YA 4MXZA 2HXLA 5CEPA 3ZDUA 5M09A 4EHVA 3FXWA 3HRBA 4BYIA 5IA3A 3BU5A 3LW0A 4FUXA 4MXOA 3ZO2A 5DWRA 3OCGA 2VGOA 3GBZA 4CXAA 3V8WA 5IEYA 4RX7A 2QVSE 2ITXA 3Q3BA 2W17A 2R3QA 4IAIA 4IBMA 4OTFA 1XH7A 5HE0A 4J52A 2B9HA 4I1ZA 3IGOA 2BTSA 4HCVA 3ZO1A 2W1FA 4ID7A 4MXYA 4FIGA 3G0FA 4LV8A 3Q2MA 3NW6A 4MKCA 4ZSAA 2R0UA 1JWHA 1R0EA 1YHWA 4TYJA 3BCEA 4QT1A 4QMXA 4R6VA 5C8MA 4EZ7A 1JKSA 1YWNA 3BGPA 3BYSA 4YPDA 1H4LA 2ITYA 4IAFA 4YNOA 4O0VA 4TT7A 4PV0A 2ITUA 1Q3WA 2ITOA 1BL6A 3AC1A 3NX8A 5HEZA 4TL0A 3F69A 4XG2A 4XLVA 4CMOA 3E7VA 4D55A 4Z3VA 5HQ0A 5J9YA 2GPHA 2GNIA 3H9FA 3UO6A 3WYYA 4W4VA 4DG0E 2QOKA 5ANKA 4YJNA 2ZV2A 4U41A 3FC2A 2J51A 1BLXA 1W82A 4NTTA 4TYGA 4JJRA 3VBYA 1TQIA 1H00A 3MN3A 3UIUA 3MA6A 2EWAA 4QRCA 2BTRA 4HOKA 2YIRA 3AT3A 4M14A 4A06A 2YIXA 4NK9A 4IZ7A 4FOBA 3U6JA 4PMTA 3OCSA 5I9UA 3MY0A 4OBQA 2F49A 3Q4ZA 5A46A 4YGAA 2XCKA 4TWPA 4AN3A 3PZEA 4EQUA 1GJOA 3ORKA 4F9AA 3AC4A 3QA0A 4JBVA 1YOJA 1K2PA 3F3ZA 3QHRA 2BDJA 3CBLA 4NH1A 3TV4A 4DFUA 2VWZA 1PMNA 3FSKA 5JZJA 4CG8A 2Y4PA 1T46A 4E6DA 4S34A 4FGBA 4JBOA 3FLWA 1PXJA 3P08A 4O0UA 1YDSE 4YJTA 3SA0A 4NKSA 4FKSA 2FB8A 2C6EA 3DKOA 3LFSA 4AT5A 4D9TA 3O7LB 4BRXA 2QKWB 5FEQA 5KKRB 4O22A 5AV3A 3CC6A 4RJ7A 5LVMA 2BHHA 4N6ZA 4FSQA 4RT7A 3PG1A 4ZK5A 5DFPA 3R71A 5E1EA 4YJUA 4BCQA 1GIIA 2HW7A 5EM7A 3WI6A 3TTJA 3ATSA 3O50A 3Q6WA 3R63A 4NWMA 5H2UA 4EOQA 3HV4A 2WU7A 5JGBA 4GVAA 4FTMA 5BVDA 3TG1A 4O7YA 4EH7A 3DK3A 2HW6A 4XG4A 2GDOA 3PSBA 2NRUA 1Y91A 3MIYA 4CT1A 4YUQA 5DVRA 4D0WA 2BIYA 2ETKA 1H1PA 1F5QA 3UOLA 5AP1A 2BALA 2VWUA 4LL5A 5IA5A 2UZVA 3F5PA 2UW8A 4IWOA 5F95A 4FZ7A 2HZNA 4CMUA 3SD0A 5M56A 3GU6A 4I6BA 5T68A 2GTMA 4BBFA 5TO8A 5EW8A 1X8BA 4XG3A 5CXHA 3E8DA 4GUBA 4QMZA 2Z2WA 5LMKA 3Q5ZA 3JVSA 5CEMA 1G8SA 4MWHA 5HKMA 4DFNA 3PSCA 1J91A 2X4FA 4QTDA 2XRUA 3BPRA 4QYHA 4E73A 5A54A 5J9ZA 2BKKA 3E62A 3HUBA 4OBOA 5BYLA 4EI4A 2R3MA 2XBAA 2VV9A 4PP9A 5CY3A 3R8VA 3EMGA 1Y8GA 5M07A 3KMWA 2WTJA 4RPVA 4L52A 4F6SA 3DDQA 3FYJX 3C4XA 2JBOA 4C4IA 5KUPA 4BCHA 2KTYA 3EOCA 4QNAA 4BGQA 2XNOA 5F1ZA 3W2CA 2Z60A 4OBPA 5EI6A 3BU6A 4OTHA 3ATTA 3AMYA 1L8TA 2VTRA 5ANEA 4E5BA 3F2AA 2OICA 4AUAA 4ACHA 2PUIA 4F1TA 3EQIA 4BDKA 4YJPA 4BDGA 1LEZA 4AF3A 1OI9A 4JNWA 4XX9A 3T8OA 1YRPA 3BHUA 3VS2A 1PXLA 5E8VA 4EK6A 5CANA 5K4IA 4B8LA 1CTPE 2HZ0A 3GCPA 4TPTA 4AOJA 4XCUA 2PZYA 4LGHA 4AGUA 3ZS5A 4IC7A 4IB5A 1DS5A 3QFVA 4DT8A 4CD0A 1I44A 1AGWA 3E8NA 3L9NA 4FKTA 4HPUE 4DEDA 3QALE 4PMMA 2P0CA 3QC4A 5HX8A 4NYEA 3R04A 4IB1A 4RJ8A 3NMUF 2VTAA 1ZRZA 5EKOA 4GFGA 4GL9A 3EKNA 4CG9A 2J90A 5G6VA 3NRMA 3DBCA 4QTBA 2XK8A 3QTUA 3QX2A 4QQCA 3MY5A 4NM5A 5FRIA 2R7IA 2QO9A 3HP2A 4AZFA 4FKVA 2HAKA 1Y57A 5TF9A 5E8WA 4NUSA 2HYYA 2ETRA 2JKQA 3GC0A 2YM4A 2YEXA 4R3RA 3RAIA 2HCKA 4BBEA 4M3QA 3RMFA 3F3VA 3F66A 1MQBA 4CFMA 2W4OA 4R3PA 1O6YA 5BVWA 4I6FA 3ZDIA 3WF9A 3OWKA 4A9TA 4EK3A 1XH5A 3MPMA 3NAXA 5AM7A 5FM3A 3G33A 1IASA 4I0SA 5JFVA 3L9LA 3UNJA 3PY3A 3PZHA 1O9UA 4DEEA 1IRKA 4BGGA 3B2WA 2GFSA 1XH9A 4ACDA 2ZM1A 4X2JA 2OJFE 5CLPA 5LWNA 4FVQA 1OVEA 2GHLA 3ZHPC 2C0OA 2XIYA 5J9LA 4O2PA 3IW5A 2R3PA 3GFEA 2UW9A 4AA0A 1NT2A 2X2MA 2WELA 2XRWA 3QQHA 5L2IA 3ZXZA 1SZMA 2WHBA 3W0SA 2QOHA 5IG1A 1M2PA 3W8LA 3FZPA 2WU6A 3OZ6A 5CSPA 3KF7A 4EQMA 3EWHA 5J1VA 3FYKX 4UYAA 1PXPA 2JDSA 3UNZA 3W0OA 3T3UA 4EHGA 1QPEA 4JL9A 2PUUA 4MD7E 3ZXTA 5HBHA 1WVXA 1BYGA 5HG8A 2VTMA 4Z16A 3DNDA 2XM9A 3DGKA 4CZUA 2JAVA 4DA5A 3DDPA 2CNQA 4EZ3A 3EIDA 1OPKA 5IMXA 4C2VA 3QCXA 1B39A 2EB3A 3ALOA 2OIQA 1PW2A 1BI8A 1M7QA 3FLZA 3I60A 2XB7A 3FLNC 4IM3A 4GKHA 5LOHA 4IWQA 5HIEA 4UXLA 3U9CA 2F2CB 2Z02A 4ZTHA 2VTSA 1ND4A 3ORNA 5JRSA 3TZ8A 1E1XA 3W33A 2UV2A 3QTSA 2VTPA 5A4CA 1H27A 1UU3A 2PK9A 5HG7A 4ZY4A 4LFIA 1ZLTA 3ACKA 4BBMA 2C5YA 4F9YA 2OF2A 3VF8A 4O7OA 4K6ZA 4PRJA 4FIHA 4ANLA 4FL2A 5GJFA 2V62A 2V22A 2I1MA 4KBAA 4GG7A 4KS8A 5AMNA 2WMRA 3WIGA 3ZMMA 3CJGA 2PZ5A 3LMHA 3OWJA 4RLKA 2NP8A 4L45A 3OMVA 4CTBA 2R3HA 4HW7A 3VS4A 2FYSA 3PDTA 3OWPA 4GYGA 1WBPA 2V7OA 4U43A 3A7IA 4U97A 3ZFMA 5DBXA 1UWHA 5EQPA 4G2FA 1NA7A 3GXLA 4IFGA 3R7IA 3SOAA 2B9FA 1OIRA 4XEYA 3CS9A 5HVJA 3P1AA 1XQZA 4CV9A 2JFLA 4ZJVA 5KZ0A 2P33A 1FBNA 4KSPA 4DEGA 3HRFA 4WBBB 4B4LA 5HICA 4LUDA 2OIDA 3O8TA 4YPSA 4FBXA 1DM2A 4CTCA 3LQ8A 3ZUUA 1JSTA 2C5XA 4LRJA 3U8WA 3WYXA 3I1AA 4GYIA 5LCJA 2PSQA 4G6NA 1LR4A 3GOPA 3P23A 3FZTA 4ONAA 3BGZA 4FVRA 1VYZA 4XLIA 5D12A 4FKGA 3NNVA 4RBLA 4W8DA 3QL8A 4F4PA 4R5SA 2VX3A 4PP7A 4CFWA 4YZCA 2XEYA 3FKNA 3EFWA 4E7WA 3SKCA 4LG4A 3MFTA 3GGFA 3OROA 3ZSGA 4Y46A 5EM8A 5M53A 2E9PA 4LM5A 2JEDA 5ETCA 5CAUA 3HX4A 1OPJA 3CGFA 3FV8A 2RIOA 3SG8A 3FXXA 1KUTA 4O7SA 4QYGA 2PVKA 2PZIA 3AD4A 5HVYA 3TACA 4F09A 4YTCA 4F7NA 2A19B 3OEZA 4J1RA 3AMAA 4M7IA 5CEIA 1PRYA 3AT2A 1M17A 3ENMA 4L7FA 3VWAA 4PMPA 1Q62A 3ZEWA 3FZRA 3UG1A 2XKCA 4CZTA 2E9UA 2CNVA 4BDBA 2J2IB 3W2OA 3TNPC 5A4TA 3KULA 4U5JA 4G17A 5C27A 3BHYA 2C3IB 2UZBA 4FEXA 5KMIA 2G2IA 3V5QA 4O7RA
chains in the Genus database with same CATH superfamily
1OIQA 2J5FA 3RCDA 4AOIA 1PMUA 3DU8A 3VS1A 3VO3A 5HO8A 2WTWA 5KKRC 4I4FA 2PUNA 3GCSA 1CDKA 4AXDA 4F65A 2BDWA 2NO3A 3AKKA 4DINA 4EEVA 3ZC5A 2QI8A 5IQHA 5FUTA 3NUUA 4K8AA 2JITA 3PWYA 3H30A 3PA5A 4FEUA 4YC6A 3W0NA 1UVRA 4QQ5A 4CKRA 2H34A 3DJ5A 3FBVA 2OFVA 1NVSA 2ETMA 4R5YA 5IUHA 5L8KA 2VWWA 3A7FA 4JDKA 4DHFA 4QMNA 3KVWA 2WIPA 4RJ5A 4IAKA 5E8ZA 4GV1A 3KXNA 3WF6A 1XHAA 4UZHA 3LVPA 3FQEA 5DRDA 4B6LA 2OXYA 3THBA 1U54B 3EHAA 3I81A 5CF4A 2EVAA 4NFMA 4QMUA 2R3KA 2WTKB 4QPSA 3EQRA 2GMXA 5K3YA 2Y9QA 3ZFYA 3VQHA 3DPKA 3DBFA 3FMKA 1JOWB 3QRKA 2CMWA 4QNYA 3OWLA 4FV5A 3D15A 5LVLA 2VWXA 2I0VA 4AGWA 3MH0A 3VIDA 2UZUE 4J7BA 3Q9WA 5BUEA 3CKXA 3A7GA 3SHEA 2VWYA 3EN4A 4E93A 4JS8A 2FSMX 5CSHA 2C69A 3EQCA 5T3QA 3TZ7A 3ZSIA 4GIIA 3W8QA 4M69B 4FT9A 3SW7A 4MBLA 4XYFA 1YI6A 2GNGA 3CLYA 3DLZA 3H0ZA 3VBVA 1JBPE 3G0EA 4BCKA 4C2WA 5L2SA 2EUFB 5I9VA 2PZPA 2WMWA 4CRSA 4F0GA 4EOMA 1XH4A 2R3RA 3ZUVA 1PXKA 4C35A 2XIZA 3VHKA 4R7IA 3R9HA 3VQUA 3TTIA 4U0IA 3D5UA 2C6MA 3BHTA 3VUMA 3AT4A 4E1ZA 3IONA 3WZDA 4DG3E 3SV0A 5JQ5A 1G8JA 4F1MA 2XIKA 2C47A 3HV7A 4KIQA 3E64A 4TWCA 2ZB1A 4UY9A 1V0BA 3I0QA 2XNEA 1Q41A 4YBKA 4WSYA 2RFEA 3NFFB 1IAJA 2X6EA 2RKUA 4EH5A 4IX5A 3KCKA 4HCUA 1OL1A 3PRIA 4L9IA 3RAHA 4K0YA 2OXDA 4WG5A 4D5HA 5AV4A 3VW8A 2RL5A 5FD2A 4D4VA 2OFUA 4AFJA 4GK2A 2ZV8A 1IA9A 4UEUA 4FSZA 4L3LA 3HYHA 4D28A 4QTEA 3SW4A 4RVTA 2XUUA 4KA3A 3FSFA 3HA8A 5LQFA 3D0EA 5L8JA 2G2HA 2PHKA 2F9GA 2IZTA 4YNEA 5EDPA 4C4EA 1XWSA 3R1SA 4LI5A 4PTGA 4E26A 5JZNA 3AC3A 3HECA 2ZAZA 5LMAA 1ZOGA 5HX6A 2BZHB 1UNGA 4RA4A 5A14A 5EHYA 3OT3A 1M14A 4M8TA 5CI6A 3EQDA 4FL1A 4BI2A 3KQ7A 5HG9A 4FTKA 3BRBA 3BEAA 4FEVA 5CSVA 3UE4A 5JSMA 4ORKA 2CCHA 2YABA 5AJQA 2PE2A 3Q32A 5HE3A 3VONA 5BYYA 4F6UA 2ZMCA 4KNBA 3ZBFA 4AXFA 5KHWA 4YLJA 3U6HA 5CU2A 5EG3A 2QLQA 5I4NA 2C6TA 4Y5QA 3OOGA 5FGKA 2GQSA 1JKTA 1PHKA 3TCPA 5IEXA 1GZOA 3DK6A 1XH6A 5G1XA 4DCEA 4ZZOA 1XH8A 3U4WA 4DTAA 3QKMA 4CMTA 4ZZMA 5FDPA 2OZAA 4ZTRA 5FP5A 4TYHA 3IKAA 2XA4A 2ERKA 2BVAA 3NNWA 3W2PA 4AOTA 1OB3A 1STCE 2W4JA 3OXTA 4IDVA 4DEIA 5KMJA 3DB8A 1SNUA 3D14A 2ITNA 3TNQB 3PJ1A 2FSLX 3QTQA 4AZTA 3QQJA 4AACA 5ETFA 3PTGA 4OTGA 4QP3A 1A06A 1FGIA 4XV2A 4C3PA 3W0RA 3KULB 3PY1A 4H36A 4RIXA 2C30A 5L6WL 3LM0A 3P4KA 3Q60A 3V8TA 4FK3A 2CSNA 4WD5A 2RFSA 4O86A 2OJIA 5AIRA 2W5HA 3ORPA 4KSQA 1HCKA 4U45A 4ACMA 2QLUA 3PXFA 4EOPA 4TZRA 5AAFA 4YR8A 2RF9A 4ITJA 4YJOA 3NZ0A 2PU8A 3B8QA 3PXRA 4FYOA 1TFFA 4PX6A 4GK3A 1TQMA 2YDIA 1R0PA 2BAJA 2VTQA 4FNXA 2B53A 2LGCA 4ZLYA 5CU0A 2BILB 2QOCA 3C1XA 3NUXA 1LP4A 2PVRA 4PWNA 5DHJA 2XNNA 5KZIA 4ACCA 1PXNA 1VJYA 3JPVA 5C4LA 2PMIA 1RE8A 2XK9A 3BKBA 4IVBA 2QR7A 3IW7A 4H05A 5J87A 4HVDA 1O6KA 3FDNA 3ZZEA 3CXWA 3DLSA 3FHIA 2ZV7A 3OEFX 2PVNA 3Q4CA 2I0YA 3DXQA 3OUKA 3R8ZA 4DGOA 5D7VA 4C3FA 4CLJA 3GQIA 2QKRA 1SVEA 4IFCA 2PMNX 4MXCA 3GP0A 2BCJA 3AC5A 4RA5A 4WUNA 4QOXA 4DGGA 3W16A 3VBWA 1ZXEA 2XKEA 4RIWA 3UIBA 3FZSA 3L1SA 2J4ZA 4H58A 5CWZA 5I9XA 2FVDA 5B7VA 4AP7A 4ANMA 4I6QA 4D4SA 5LMKC 1Q5KA 4AZWA 5FTOA 2XKDA 1ZZLA 2CKEA 3BX5A 1OBDA 3LCOA 4DDIA 1GIHA 5CEKA 2W5AA 3ITZA 5AUTA 2WFYA 2X8DA 2CGWA 3OFMA 1CKIA 3GFWA 3T9IA 1VR2A 2HZ4A 4A4LA 3ID6C 5DN3A 2JC6A 3IECA 3NPCA 2BR1A 4C4HA 2WQEA 3BBTB 3HA6A 4P5QA 5HBEA 3RPVA 4FV4A 5BVOA 1OIUA 3EKKA 2GU8A 5AP5A 5HLPA 3NVKI 5EOBA 1SYKA 3EH9A 3QQGA 4CFUA 2WB8A 3E93A 4HGEA 1K9AA 1XBCA 3ORLA 3FY0A 3SOCA 3UJGA 5IDPA 3SVVA 4FV3A 4FICA 3MDYA 4FR4A 3QRIA 2B54A 2QODA 1ZOHA 4GS6A 3IDPA 4E5AX 1YOLA 3DBDA 1WFCA 4X2FA 3D83A 3R9RA 3KFAA 1HCLA 2R5TA 3C4CA 3QU0A 4USDA 4FUYA 3IGGA 3FQHA 3BYUA 2XS0A 3QZGA 3OVVA 3UGCA 2DS1A 2W96B 4CFNA 2ZFYA 2GFCA 3FL4A 4JX7A 4CKJA 1REJA 3AOXA 4QDVA 4ZJJA 1ATPE 4ZTSA 2EXMA 2OF4A 3OTUA 4K33A 3GQLA 4UWBA 5HHWA 3HMPA 1IA8A 2ZB0A 3N4VA 4E20A 2JD5A 3DY7A 4KKHA 2CCIA 3UVPA 5J1WA 3D7TB 2C5NA 4WG4A 1UA2A 3LPBA 2XEZA 5HCXA 5IUIA 3M42A 3LJ0A 4QP9A 3C9WA 4L6QA 3RK9A 3O17A 1YI4A 4IJPA 5HTCA 5AUWA 5LVOA 3VAPA 3KU2A 2C5OA 5BMSA 4I94A 1UWJA 2OU7A 3TT0A 3NAYA 4UZDA 4ZY5A 3RNYA 2PVJA 3NUYA 4FVPA 4ZMFA 4RIYA 4NKAA 4PDPA 2VO0A 3NNUA 3DXPA 3W18A 3UODA 1YXXA 3QLFA 4B7TA 4CSVA 2C1AA 2IVTA 3OXZA 5CU4A 3KRWA 4MXAA 2CLQA 4C61A 3LLTA 2YIYA 2XARA 4ZP5A 5HZNA 4LOOA 1JKKA 4ANBA 3R8UA 4PDOA 2JDRA 1UU7A 3PJCA 3RPOA 2IVVA 3DFAA 3MVHA 1Q97A 5M55A 4C37A 1P4OA 4ERWA 2JDOA 1E9HA 4NTSA 3DT1A 3POOA 4FKRA 4LOQA 4YJRA 4A9UA 4EKLA 1KSWA 4NJDA 3S0OA 5DG5A 3ZZWA 2OZAB 1GNGA 4DC2A 3CQUA 3D2KA 4YLKA 3BV2A 4MD9E 4TYHB 3ROCA 2VU3A 3PXKA 4BTMA 3PVBA 4BZNA 4DH5A 1JSUA 1YWRA 4JG8A 3LCTA 2IVUA 3DAJA 4J99A 5KMNA 1PKGA 4NCTA 3ODYX 3LLAA 2W9FB 2WTKC 1BL7A 4XG6A 5AFVA 4BKJA 3SC1A 1SVGA 5FTGA 3CD3A 4CFFA 5L3AA 4Y8DA 5H8GA 2VO7A 3RTPA 4LRKA 3M11A 4Y83A 3BYVA 3V5TA 4AA4A 4RIXB 4ZLOA 1QMZA 2X8EA 3LFQA 3O5AA 3U4UA 3TDWA 1SM2A 1NW1A 3LM5A 4MAOA 3ZSHA 4UALA 5DR6A 4D58A 5AAGA 5IQDA 2QG7A 2XNMA 3A99A 2F57A 1Q8TA 3LXPA 4ENYA 1H26A 1MRVA 5JT2A 2GQGA 3PXYA 3OW3A 5GNKA 2Y4IB 2VWVA 2XIXA 2XJ2A 3PPJA 3VW6A 2CGVA 3FAAA 4HNFA 2JKOA 2Y8OA 3EJ1A 2Y6MA 3DTCA 4WNKA 4YURA 3PRFA 4D5KA 3FEGA 4PL4A 4DAWA 2VZ6A 3W55A 4X3FA 3R7VA 1URWA 5BUIA 4L53A 4H1JA 3UIMA 3K5VA 3SG9A 4DLJA 2OO8X 3SDJA 4Z55A 4EBWA 4O82A 3BIZA 3T9TA 4HPTE 1FOTA 3M2WA 3TXOA 3PPZA 4QP8A 4LUEA 5CU6A 3E88A 3RHXA 3C7QA 3L8PA 3C5UA 4IHPA 4I6HA 3H10A 3PE1A 3V3VA 3ULZA 3ORMA 1OKZA 3KREA 3NWWA 2VX1A 2A0CX 3KXGA 1NVQA 3BZ3A 3IOKA 3UP7A 4RIWB 5LWMA 5M57A 4RWKA 4TNDA 2XM8A 2UZWE 5L2TA 3Q4TA 3VJNA 5KMOA 5HU9A 2PMLX 3QC9A 3FUPA 1ZMVA 4FV0A 4NZWB 4AWIA 4I4EA 3G9NA 2QR8A 3PY0A 4I93A 4ALUA 1FPUA 3ODZX 3I7CA 2AUHA 1F3MC 2W1CA 4EOKA 3MPAA 3NNXA 3VRYA 1WBTA 4JDJA 3BBWA 1ZAOA 1LEWA 4MNEB 5AP2A 4TYEA 2C5VA 4XP2A 4FE2A 4MYGA 5DE2A 4EJ7A 3EQBA 2Z7RA 5AEPA 5C8KA 2H9VA 3VS5A 5E91A 4AW5A 5J95A 2YHVA 2X2KA 4G5JA 1R39A 1ST0A 5IA2A 5JK3A 4DBNA 2ERZE 4FZFB 3QZFA 1Q8UA 2X2LA 2QOFA 2W1GA 3CTQA 3GVUA 2HELA 4O6EA 4QPAA 3UZPA 5DI1A 3ZH8A 5AUXA 2C0TA 4DFYA 5HD4A 3TV6A 2UW5A 5GHVA 5FEDA 1XKKA 1ZARA 3LHJA 3OCTA 5B0XA 4AN9A 4HVSA 2QURA 2JDTA 2Q83A 4LOPA 3F5XA 4XG9A 2R7BA 3A60A 4RIOA 2GSFA 4PY1A 1OUYA 5CENA 2BUJA 3VHEA 3IW6A 3ZRMA 2RFDA 2OKRA 3R9NA 2HWOA 2YM3A 1FQ1B 3I6WA 4BICA 4C4GA 4W4YA 4MH7A 3VUDA 4F64A 2UW3A 2VTHA 5ANGA 5AP6A 2GQRA 3DFCB 4WO5A 4I20A 4XOYA 4I92A 4HZSA 4HCTA 5M06A 3TNHA 5BVEA 4TW9A 1V0PA 4IADA 2C0IA 4Q9ZA 4RZVA 4YTIA 4BDFA 5HLWA 3ZLSA 4E6CA 4H39A 3I5NA 2X81A 4FNWA 4MCVA 1OGYA 4XRLA 3GEQA 4RIYB 1FVVA 5CEQA 5ANIA 1H01A 2E9NA 5CQUA 3IG7A 4CFVA 3PXZA 3GU5A 4YP8A 4G5PA 4YLLA 2PVLA 2WMAA 4BTFA 3R02A 4YZNA 2DQ7X 3QTWA 3U6IA 4JMQA 1GAGA 4JRVA 3F3UA 4XV9A 4ALVA 3BELA 3A62A 4KRDA 5JFXA 5FM2A 1M7NA 4ASDA 1UU9A 4ANQA 4QTAA 2CHLA 4X2NA 3SGCA 3VBXA 4U7ZA 2AC5A 4DH8A 4XJ0A 3MTFA 3O8PA 3QGYA 4S31A 4ZMEA 3P7AA 5CI7A 3UTOA 2VNWA 3ORZA 5CZIA 1OBGA 4JLCA 2O5KA 4FV1A 3RM7A 3FLQA 3WBLA 2ONLC 4OTRA 3E8EA 4F9BA 4ZAUA 2PL0A 2UZOA 2ITPA 3ZBXA 1OKYA 5CVFA 2CDZA 3I5ZA 3SAYA 4AU8A 2C1BA 3COMA 1GOLA 3PFQA 4RJ4A 3ZO3A 4I5PA 2BRGA 3QA8A 3JVRA 2BFYA 3F3WA 5IUGA 5ETAA 3CJFA 4K11A 2O3PA 4AX8A 2OW3A 2QOBA 2XVDA 3PA3A 4YZMA 1Y6AA 3PIXA 2J5EA 5BUJA 2XKFA 4U79A 1M2RA 3DJ6A 4YO4A 4DT9A 3DQXA 2CNUA 3GU7A 1ZMUA 4O0RA 5KBQA 3IW4A 2XNPA 3VF9A 2W99B 4X3FB 2Q0NA 2WPAA 3D94A 3CKWA 3IPHA 3OC1A 3KVXA 4Y72A 4H3PA 5E7RA 5CZHA 3GB2A 4A9YA 4EH9A 4BHNA 2WMXA 4P4CA 3KXXA 3SX9A 5I5ZA 2VRXA 4FKUA 5DRBA 4TY1A 2SRCA 4MD8E 2EU9A 4FTTA 3RK5A 1ZZ2A 2OIBA 4MX9A 2FO0A 2WMTA 2NYAA 2OGVA 3G9LX 4KKGA 3TWJA 2XAMA 4ARKA 3QTZA 4GU9A 1PXIA 4LYNA 4BC6A 4GVJA 1PXMA 3R8MA 1CMKE 4IMYA 5BMMA 3DXNA 4N0SA 1W98A 4I5HA 5F9EA 4ZIMA 2QG5A 3CSVA 3LFEA 4GEOA 4PNKA 3CTHA 4ASXA 4FZAB 4HYSA 5CNOA 5CU3A 3WF7A 3Q9ZA 4FIEA 4FX3A 4V04A 5H9BA 3LFNA 3CTJA 4XH6A 3ZUTA 2FUMA 3R28A 3PLSA 4FOCA 1P4FA 4IB3A 1T45A 4YSMA 3RALA 1JKLA 3V5WA 3VC4A 1R1WA 1IEPA 2PE0A 4RWJA 2I0EA 2C4GA 2F7XE 3A2CA 3U87A 1KOBA 3EZVA 2W7XA 4XRJA 5CAQA 3ENHA 2RFNA 3Q6UA 5CX9A 3ZLWA 4WZYA 4PUZA 4AXCA 4E4MA 4KAOA 5AUZA 4H1MA 2BIKB 3NS9A 3WF5A 3PIYA 3NGAA 2R2PA 3BV3A 4O81A 3GI3A 4BCFA 4C7TA 3KK9A 4QP1A 1REKA 4D4RA 2OSCA 4DLIA 5I9YA 4R7BA 4O7VA 5EDRA 5LVPA 4JAJA 4AE9A 4L67A 3CIKA 4FTOA 2ZDTA 3ANQA 3QTXA 4FV9A 1H24A 4JOAA 4YC3A 2I0HA 3AGMA 2IWIA 2JDVA 3NFGB 5FDXA 3L8VA 5HCYA 4A4OA 5EQYA 3MB6A 5CF8A 3TUBA 5AP0A 1UNHA 4Y5HA 4AG8A 4HGLA 1UNLA 3VUGA 4F1OA 3FMNA 4XBRA 3MI9A 3CE3A 3WIKA 2HOGA 1QPDA 5DIAA 3HZTA 1OIYA 5ANOA 3QZIA 3IOPA 4FSUA 4C0TA 3G51A 2G1TA 4OT5A 3R0TA 3F5UA 4O84A 3WF8A 3PJ3A 1PYEA 3CD8A 4C3RA 3KEXA 2R4BA 5IQGA 1U46A 1OGUA 4OTDA 3GC8A 3V51A 3Q04A 3NUPA 4CLIA 3DA6A 4EK5A 5IQFA 4LV5A 1DI8A 4EYMA 4FIIA 4DF3A 4KS7A 2Y4IC 4S33A 5L8LA 4JQ7A 5JFWA 4FTRA 4DEBA 4WUAA 2Z7QA 3CQWA 5LJJA 1WZYA 5DR9A 3UOKA 4IWDA 4ZSGA 4WOVA 2Y0AA 2BFXA 4ZZNA 4O27B 3Q9YA 5HO7A 4L44A 3E5AA 4O7WA 3CEKA 4QMMA 4DCAA 3Q2JA 4L01A 3H9RA 4FKJA 1GZKA 3PPKA 3R01A 4P90A 2C3KA 2WQMA 2ZMDA 4ASEA 4C33A 3AD6A 4E4XA 2P4IA 1GZNA 1XBBA 4O0WA 4ZTQA 5A4LA 3RHKA 5AADA 3TKIA 3V6RA 4BYJA 2XCHA 5KX8A 3RKBA 3OBJA 2QOLA 1RJBA 4L46A 3ZCLA 3IDBA 1OZ1A 2BKZA 2PVYA 2QOIA 3PVGA 1QCFA 4BCOA 1I09A 5EYDA 5HVKA 4G1WA 4FC0A 4QO9A 3V5JA 1YW2A 3OY1A 3ORIA 2JFMA 2B7AA 4IIRA 5I9ZA 2ZM3A 3F3TA 2ZVAA 5J8IA 4QMQA 3TNIA 1ZY4A 2B1PA 3NUSA 1R78A 5DA3A 2UW7A 5LCKA 2C68A 2XF0A 4G6LA 5FEEA 5KHXA 4DGLC 4UX9A 4LQMA 2HY81 3CPBA 5DT0A 2R3LA 3IO7A 3LXKA 2GTNA 3ZRKA 4USFA 2WMSA 1U5QA 5E8TA 5GJGA 5TR6A 5BPYA 4NIFB 4F63A 4IDTA 3VBQA 2BPMA 4NSTA 4FTNA 3UQGA 4FI1A 4XHKB 1H08A 2XH5A 4M15A 3ZOSA 3UO5A 3C0HA 3POZA 1CKPA 1P14A 2YDKA 4W4WA 3G6GA 1U5RA 4DBXA 3AMBA 2G15A 3FI3A 4KABA 4UBAA 3DAKA 3R22A 5AP4A 2R3FA 3E63A 4M68A 2F2UA 2GNHA 3VUKA 2XAOA 3DB6A 4ALWA 4OTQA 2Y6OA 2YCSA 3F82A 5EH0A 3ZM9A 2OZOA 3U55A 3SRVA 5FXSA 3CY3A 4BTKA 3HMIA 1WBOA 3UPZA 2UZDA 4CVAA 5B2LA 2V0DA 3LZBA 4QYFA 4PTCA 5CSXA 4F70A 4YC8A 3F9NA 4USEA 3MBLA 3VS0A 2V55A 3NIZA 2VWIA 2CN8A 1U4DA 5CS6A 3LFFA 5C26A 2OH0E 1NY3A 3PUFC 3W0PA 1XBAA 4A7CA 4FNYA 2J0JA 4FKWA 3UVQA 4Q9SA 3JY0A 4YBJA 4OR5A 1YXTA 4L7SA 3UC3A 3W0MA 3MFUA 3HV3A 1L3RE 5A9UA 4GJ3A 3DS6A 4EZ5A 2RG6A 4X7QA 4G3EA 4WIHA 4J97A 4RJ3A 5AAEA 1DI9A 5CVHA 4G34A 3UOJA 4EYJA 3DZQA 2BZJA 3P5JC 4JBQA 4U40A 4UWYA 4FEWA 4IZYA 3PP0A 3QAME 2H8HA 4C4JA 1ZYJA 3WOWA 4CFXA 4PNIA 2WO6A 4DHJA 2QC6A 3IQ7A 3EQFA 3S4QA 3BE9A 1WMKA 2YAKA 5EDQA 4I5CA 3LKMA 3R7YA 3GU4A 2CGXA 3FMJA 4R7HA 2EXCX 3QXOA 3VUHA 5I0BA 4RQKA 2ITWA 3C4ZA 4MF1A 3G6HA 4JBPA 5D9HA 4FK6A 1FVTA 3I7BA 2O63A 2PY3A 4CNHA 2PUPA 2YCFA 2QU6A 4HGTA 2YITA 2VTJA 4ZLZA 5IMEA 5JEBA 1Q3DA 3UBDA 3K54A 3DQWA 3D7ZA 5I9WA 4AZEA 2ZDUA 1JAMA 3O71A 4FKQA 5M4IA 3FQSA 5HNGA 5EK7A 5C4KA 3KN6A 3QWKA 5DPVA 4MHAA 3R00A 3TZ9A 3H0YA 2CGUA 4IAZA 3LE6A 4KUJA 5HCZA 3QYWA 4FIFA 4BDJA 2FGIA 1WBNA 2DWBA 4FZ6A 4WRSA 4UN0C 4DHIB 4BDDA 5CAPA 5J5SA 3BEGA 1DAYA 4I23A 5TKDA 4BIEA 4DTKA 3OG7A 4QMVA 3NYNA 5JQ8A 3RWQA 5FLFA 5F20A 2OLCA 2WTDA 3MA3A 4O7NA 4L3PA 2UVXA 2UW0A 3HV6A 3VUIA 3Q4UA 3MJ2A 1U59A 4O0SA 4DFXE 4E8AA 2VTNA 4CGAA 1H28A 4II5A 1G3NA 4JRNA 4G9CA 4FZDB 1UKHA 4ZEGA 4KWPA 4PL5A 2BRBA 2NRYA 3NYVA 4X3FC 2IW8A 3L8XA 4EH8A 1QPCA 5K9IA 5IQEA 3LJ1A 2X9EA 4TTHB 5M4UA 2JIUA 2WMUA 3NW5A 3FXZA 3AGLA 3N9XA 4XUFA 3UMXA 2WMVA 3ZU7A 5EM5A 1PXOA 4X3JA 5JFSA 4EH4A 5KE0A 4BF2A 2IW6A 2WOUA 4QP7A 4WA9A 4CKIA 3H4JA 4GT5A 2VD5A 2YCRA 4C02A 3LJ2A 2YM7A 5ACBC 4D1ZA 1WVWA 3G90X 4FMQA 5D10A 2BAKA 3D2IA 2HXQA 2XK4A 4DEHA 2F7EE 2R3IA 4HZRA 3TV7A 3ERKA 1KV2A 3NCGA 4GT3A 2XNGA 4O7ZA 2WXVA 3WZKA 4F0IA 1SMHA 3MVMA 4BDAA 3R2BA 5IH5A 2JIIA 4FEQA 2X4ZA 4UV0A 5HE1A 3DCVA 4XNEA 2XMYA 3G5DA 3P7CA 4J8MA 2A2AA 3QHWA 5KMMA 1W7HA 3M1SA 2HENA 4PTEA 5EYMA 4O83A 1Q8WA 5M51A 2PYWA 5GIOE 4W4XA 2QQ7A 4KB8A 3ALNA 3EL7A 4K9YA 1ZWSA 2Y7JA 3MGYA 1A9UA 4YSJA 3FI4A 4AQKA 3ZC6A 4U8ZA 3II5A 4JDHA 4LRMA 4IE9A 3LCKA 2C6KA 3TYKA 3C0GA 3KK8A 3B8RA 3WZJA 4DH1A 2OH4A 4QMPA 3O7LD 4ZY6A 4I3ZA 2WEVA 3F5GA 5BVNA 3E3BX 2OWBA 3QF9A 5IH4A 4H3BA 3KCFA 1G5SA 3L8SA 1WBVA 4D4YA 3MWUA 3QLGA 3E8CA 2PPQA 2XZSA 2GNLA 3H3CA 1W0XC 4S32A 3DNEA 3ORTA 3W2SA 5HTBA 1E1VA 3RVGA 3QUEA 3O96A 3QUPA 4U9AA 2UZEA 4QDEA 2WZJA 3FKLA 3SRVB 3FC1X 1YQJA 5AUVA 4I0RA 3OT8A 3F2NA 4M0YA 1JLUE 4U42A 3BLHA 4RFZA 1ZMWA 4EK8A 2Z8CA 3IDCA 4FT5A 3PFYA 3F7WA 4MQ2A 4M0ZA 3C5IA 1VYWA 4TN6A 2Z7SA 2YA9A 3MV5A 4NU1A 5KNJA 4N57A 3W32A 4BR3A 5AA8A 3EFJA 4BZDA 4EH6A 3OCBA 3GC9A 2WEIA 3LCSA 4I21A 1DAWA 3COKA 5IQBA 4BJJA 2IN6A 5IEVA 2QHMA 5JKGA 5E9EA 1WAKA 3UP2A 3KRRA 3WILA 1BI7A 3AG9A 4WNMA 3FPMA 2BRMA 2H96A 3BLRA 2X8IA 2BRHA 4BCIA 3C4WA 5K5XA 2FH9A 4EUUA 4KIOA 2QO7A 5AM6A 3EB0A 2V7AA 3BGQA 3DV3A 2YN8A 3P7BA 3RZBA 5B2KA 2CKPA 3FJQE 4BHZA 4EOJA 3A8WA 1KWPA 3OS3A 4KBCA 4MTAA 4GH2A 1H1WA 3QD4A 4JXFA 1XO2B 2PVHA 3JR1A 4FTJA 3RJCA 4EOOA 4PQNA 2YM5A 4N6YA 1OL2A 5IA1A 4QP6A 3R7UA 3V01A 2CPKE 3A61A 4HJOA 1XJDA 3N4TA 4QQJA 3MH1A 1MUOA 4YJSA 3ETAA 3MB7A 5IPJA 3QD2B 1UU8A 1ZYSA 2WNTA 2XBJA 2YFXA 3HMNA 3RPRA 4DE4A 5T6KA 4A4XA 3EN5A 3MVLA 4FL3A 3PP1A 3C13A 3P9JA 1YXVA 3FY2A 3MH3A 1MRYA 3PXQA 1ZOEA 4FSYA 4KD1A 3UDBA 4C4FA 3LOKA 4G3CA 5IQAA 3VN9A 1NXKA 2YJRA 1H0VA 4O7TA 3PSDA 3DBEA 5FQDC 4FSRA 4Z9LA 3VS6A 3MTLA 1B6CB 2R3JA 2GS2A 3NEWA 4XS2A 3L9MA 5F94A 3WZEA 3P0MA 2RG5A 3R7EA 5HBJA 1VZOA 2J0MB 4J95A 3CY2A 3LAUA 1F0QA 2HZIA 2W1ZA 4IH8A 5EYCA 4ZTLA 3TIYA 4RC4A 3C0IA 3IW8A 2B9IA 4L43A 1KOAA 2WTIA 3PG3A 1GZ8A 3E87A 5EFQA 2YISA 1H1QA 4GJ2A 3TEIA 3TDVA 5A6OA 5C9CA 3F88A 3HAMA 3OUNB 3MW1A 4IX6A 4IVDA 4M12A 3A4PA 4E6AA 5LARA 4U94A 5K5NA 5IDNA 3SXRA 2WQOA 1J7UA 5JRQA 3EN9A 2WKMA 2UVYA 5AWMA 4XMOA 4DFZE 5HU3A 5ITAA 3NYOA 3AKJA 5AX3A 3TI1A 4FKIA 3ZLXA 3ZEPA 4L42A 1J3HA 4C36A 4DH3A 4XOZA 5BNJA 4AT3A 3MY1A 5DLSA 1O6LA 3P5KA 5DGZA 5IA4A 1V0OA 4FNZA 2JIVA 2OG8A 3C4FA 2GCDA 4K77A 3VS7A 4BCMA 5IA0A 3KMUA 4IB0A 2F7ZE 3O2MA 2JKKA 2VO6A 4ASZA 5BVFA 4NFNA 4ACGA 3JY9A 1ERKA 3QTIA 4JDIA 3KGAA 2BHEA 2IZUA 3ANRA 4TWOA 4Y73A 5CASA 4C58A 5J7HA 3GENA 2FSTX 3QBNA 1KE7A 5BX0A 2W5BA 2R3GA 3LFDA 2UZNA 5DT4A 1YDRE 3RI1A 4XG7A 4IM2A 5E8UA 1KE8A 3QQLA 5CQWA 1PKDA 3W0QA 2WMBA 3O8UA 2PVFA 4I24A 2JKMA 4UXQA 3MH2A 3R9DA 1GIJA 4F99A 4F7SA 3K3IA 2B9JA 3N51A 3OF0A 3AD5A 1CSNA 2XP2A 4TWNA 4U98A 4JIKA 3D9VA 3ET7A 3V5LA 5KMKA 1PYXA 3KIOC 5E92A 3QCSA 4CRLA 4EUTA 3CP9A 1S9IA 4I0TA 4EH2A 4J98A 2WOTA 5IF1A 5LVNA 2J0LA 2O0UA 3L9PA 5L2WA 2W05A 4ZTMA 3VJOA 4HYHA 4Y95A