4DTBA

Crystal structure of f95y aminoglycoside-2''-phosphotransferase type iva in complex with guanosine
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
296
structure length
296
Chain Sequence
MRTYTFDQVEKAIEQLYPDFTINTIEISGEGNDCIAYEINRDFIFKFPKHSRGSTNLFNEVNILKRIHNKLPLPIPEVVFTGMPSETYQMSFAGYTKIKGVPLTPLLLNNLPKQSQNQAAKDLARFLSELHSINISGFKSNLVLDFREKINEDNKKIKKLLSRELKGPQMKKVDDFYRDILENEIYFKYYPCLIHNDFSSDHILFDTEKNTICGIIDFGDAAISDPDNDFISLMEDDEEYGMEFVSKILNHYKHKDIPTVLEKYRMKEKYWSFEKIIYGKEYGYMDWYEEGLNEIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APH(2'')-Id
publication title Structural Basis for Dual Nucleotide Selectivity of Aminoglycoside 2''-Phosphotransferase IVa Provides Insight on Determinants of Nucleotide Specificity of Aminoglycoside Kinases.
pubmed doi rcsb
source organism Enterococcus casseliflavus
molecule tags Transferase
total genus 100
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01636 APH Phosphotransferase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4dtbA01
3.90.1200.10 Alpha Beta Alpha-Beta Complex Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 4dtbA02
5B7VA 4GRBA 2PVFA 1QPCA 4TYHA 2C6OA 2VX3A 2QURA 3V8WA 2PL0A 3LCSA 2QC6A 3ZLSA 1UKHA 4X2FA 4HZRA 3CQEA 4RT7A 4BCFA 2CN8A 2X7GA 2XK8A 3WZEA 3R02A 3NLBA 3VUGA 4AE9A 4UN0C 4MBLA 4LOPA 3W0QA 3TUCA 2XK7A 3UO6A 1PW2A 4U42A 4C7TA 1GJOA 4YHFA 4DG3E 3LFCA 3DU8A 3VHKA 4EONA 4L6QA 4EH3A 3R1SA 5EM8A 3CGFA 3MFRA 3W0RA 4GMYA 4IB0A 5ANGA 4O0XA 4EOLA 2UZLA 3VC4A 4XHKB 4ANLA 3JPVA 3KKVA 2ETRA 4YJQA 2ZM1A 4RWJA 3O17A 4MTAA 4ZTQA 1QMZA 2PSQA 4KIPA 4BDJA 3TZ9A 4DGGA 1YDTE 4KIOA 4I23A 3R9HA 4QMPA 1H28A 4MD7E 2P2IA 3BBTB 1PKDA 4DYMA 4FT0A 3LM0A 4O0TA 4QNAA 2XYNA 1AQ1A 1FVRA 1IAHA 3KRJA 4FV1A 2A4LA 4YLJA 4Q9ZA 3ZFYA 3BV3A 3RPYA 5JN2A 5DRDA 5HNBA 2B53A 3TUBA 4YNOA 4S31A 3S2PA 3LJ1A 3R30A 1ZARA 3GC0A 4D4VA 5JFSA 4FKWA 2OO8X 3TV4A 4XG4A 3TNHA 4IAYA 1F3MC 3PTGA 3MJ2A 2BALA 4FK3A 1W83A 3C4WA 2H8HA 2ZAZA 4HNIA 2I0HA 3DXQA 1WBOA 3ORPA 3VN9A 4EH2A 5IA3A 3COKA 1DAWA 1R1WA 3QU0A 3AC1A 4GU6A 4UALA 4F7JA 2W5BA 3MVLA 4GK2A 2I0VA 5C03A 4IVBA 5C8KA 4BCIA 2VGOA 4U3ZA 4JLCA 4PL3A 5FDXA 1W0XC 3IS5A 4ZSLA 2IW9A 3ELJA 3GNIB 3V8SA 3ZUUA 4XP0A 3TIYA 4YZ9A 3KXXA 2PVMA 4HGSA 1H1WA 3R8MA 2J2IB 5IUGA 3FMEA 5J87A 4DEEA 4YZNA 3BZ3A 4FMQA 3MFSA 3WE8A 1XH9A 2ZVAA 4RFZA 4ANMA 2VWBA 3Q2JA 4RVKA 1UU3A 2BMCA 2HW7A 4TYEA 3ROYA 4EOIA 5DIAA 3FMHA 4O7TA 4A9YA 5KBRA 4C36A 2W1HA 2XKEA 3ZMMA 5CU2A 3FZOA 2WQNA 2UUEA 3D2KA 3H30A 5CT0A 4Y72A 3QZGA 4U40A 5FUTA 3WYXA 3P4KA 4YTCA 2IZRA 3BQRA 3EQPA 1JPAA 3FZ1A 2X7OA 4CFNA 5GHVA 3QTRA 5KMKA 2I6LA 3AC2A 3S3IA 3SXFA 1U4DA 5HVYA 2JIVA 5C8MA 3V3VA 2BFXA 2O0UA 5AP6A 4TRLA 2PVRA 4WZYA 4LOOA 1ZZLA 2FGIA 4A4LA 4MXCA 3TTIA 4BDIA 5HZNA 4BGGA 4UZHA 4OW8A 3HV3A 3ETAA 3G9LX 4O38A 5AUYA 2YCFA 4GVJA 4J99A 4EBVA 3D5VA 3Q9WA 4XMOA 5ANOA 5TOZA 3HNGA 1JKKA 3V04A 3DQXA 2EB2A 4YJRA 3OOGA 3VRYA 1ND4A 4EK8A 1HOWA 4KKEA 3GQIA 4YHTA 4O84A 3P5KA 2C1BA 4F0FA 1O6YA 1WBVA 3OWPA 4WRGA 4YGAA 4CT1A 4O0SA 2KTYA 1U54A 3E3PA 5AP0A 3LHJA 2CKOA 4YNEA 4B8LA 5B2KA 3OG7A 2RFDA 3C5IA 3QZIA 3WF8A 2X9FA 3DK7A 3QUDA 3ACKA 4C2VA 3E88A 4NM5A 4XJ0A 1U5QA 3VS7A 5K5XA 4O6EA 4D5KA 4RIYA 3IW5A 2HXLA 1H1QA 3MSSA 2O3PA 2ETKA 2YITA 2R0UA 4BCKA 3O50A 1H1RA 5IH4A 1LEWA 5LMKA 4XX9A 4O2ZA 5K9IA 2CN5A 2ITPA 5IQEA 4ACGA 1WBTA 2BHHA 3GCQA 3GU8A 3ORTA 3FI3A 4FTAA 1NXKA 5HX6A 4XBRA 3BHYA 2HZIA 3AMYA 4HOKA 1WAKA 2Y8OA 1J7UA 2GHMA 2JD5A 3RWQA 2C0OA 3CTJA 2Y7JA 3PJ2A 2VWIA 2NP8A 5IDPA 3QX2A 4W8EA 4IDVA 4G1WA 5BX0A 1H0VA 3CEKA 4C35A 2WMXA 3GB2A 4M0YA 4F1MA 3R0TA 4C33A 5LVOA 4UV0A 2P3GX 4AZWA 4AA5A 2W7XA 3ZZWA 4AW1A 4DG2E 3IO7A 3A7IA 3QD4A 4O7ZA 3TYKA 2CHLA 1PJKA 4O0UA 1YHWA 4RWKA 3UE4A 3DDQA 4WA9A 3R9DA 4CGAA 2PMLX 5DN3A 5L2TA 2ITWA 3CJFA 5CVFA 5E1SA 3HLLA 1Q41A 1FVVA 3QQHA 4MKCA 3CD3A 4W4YA 4DFUA 4GH2A 2C6MA 3QD3A 2YHVA 3DFAA 3ZRKA 5I5ZA 3UP2A 4KRCA 4FIHA 5IA2A 2ETMA 4E4MA 2UW7A 5JQ5A 4BR3A 2XIYA 4R78A 4ZZNA 1Q3DA 1MQBA 2RL5A 2WZJA 4LMUA 3CKXA 3FKNA 5DT0A 2VTRA 3ZEWA 4D55A 4D9TA 1YI4A 3KL8A 3R04A 4HYUA 4RIOA 3IDCA 5A9UA 3DJ7A 5CQWA 4LMNA 3MWUA 2WB8A 4BYIA 5HBEA 3OMVA 2YJSA 3ZO2A 2GNIA 3QL8A 5AP4A 2BZIB 3BGQA 4Q5HA 4FSYA 1CM8A 3CSVA 2W9FB 3D94A 5T6KA 2E9OA 3AT4A 4F6WA 1WBNA 2CNUA 2OJGA 4AN2A 2QKRA 3K2LA 3V6SA 3KU2A 4FA2A 2WTIA 2QHMA 4TW9A 3WF5A 4ZMEA 1A9UA 5KMJA 3UZTA 5IQFA 1FPUA 2W17A 5CY3A 1VYZA 2FUMA 3OXTA 2VD5A 4E5AX 3FMNA 4FTKA 3QRUA 4IZYA 3DJ6A 5CF5A 3LM5A 5CEIA 3S1HA 1MRUA 4L68A 4GW8A 4X6RA 3N4TA 4ONAA 4D9UA 4FL1A 4JBQA 2GNHA 3ORNA 4DH3A 1YRPA 5AP3A 2VWXA 4FTCA 4FV8A 2YISA 4YBJA 3U54A 4QPAA 5ETCA 4O7WA 1G8SA 2F7ZE 3HA8A 1PF8A 2XNPA 2BCJA 5ICPA 3GC9A 4APCA 2DYLA 2YDKA 4YSMA 5CSPA 5LWNA 4FG9A 2FSLX 2WKMA 4X0MA 3R9NA 1IG1A 4AF3A 2GHGA 5CEPA 1GIIA 4D1SA 2W5HA 3W2QA 2ZB1A 5EKNA 5CWZA 2VWYA 3TKUA 3N4UA 3PWYA 4CMTA 2BDFA 4U98A 4L3PA 2IPXA 3SOAA 4C4FA 2IO6A 4HCUA 3PSBA 2IVUA 4AX8A 1BKXA 3D5WA 4RVLA 1AD5A 5JFWA 4BDKA 4ACMA 3K54A 1BLXA 5CEMA 4JIKA 1V1KA 4P7EA 5L6WL 1PMEA 2W1FA 3DGKA 3FKLA 3F7WA 3VNTA 2IWIA 4RSSA 2E9VA 3QTIA 2ZV7A 4XP3A 1URWA 4BIEA 3M42A 3FZPA 5AA9A 1YOMA 3OUKA 4L8MA 2REIA 4AUAA 2YZLA 4WNPA 4Z7GA 2C6DA 3OBJA 4EHVA 4C2WA 4O7LA 1APME 3D2IA 2XEYA 2OJ9A 3MY0A 3UDBA 2XBAA 4B4LA 3C4FA 4U43A 2G2IA 4L00A 3H10A 1H0WA 3RM6A 4OTFA 4W8DA 3PIYA 4AGCA 2C5NA 2JFMA 2PVHA 2W1GA 4USFA 3VBXA 4QO9A 3T8OA 1FMOE 4K33A 1PXMA 3VULA 5B2LA 4Z9LA 5BYYA 3KCFA 4WNMA 4R77A 3V01A 5CU4A 3KRLA 3U9NA 3KQ7A 2B52A 3HYHA 4XCUA 4DBNA 4F7NA 2VTPA 4ZZOA 5JRQA 5I9XA 1UNHA 4I92A 3HP2A 3CTQA 4S34A 4L7FA 2FA2A 4TPTA 2X2MA 4G5PA 5DT3A 4EK3A 1Q8YA 1QPDA 2P4IA 1GZ8A 5DEWA 1MP8A 2W06A 3CBLA 5LVNA 4BTKA 4ZLZA 1NVQA 3UOLA 4ARKA 3V5WA 2WIPA 3RPRA 5EHYA 5HORA 2R64A 3C13A 4RLKA 4DEGA 3OW3A 3MV5A 5I9UA 3R8UA 2XNBA 4OT5A 3ORMA 2HWPA 1UU9A 5E9EA 4ZTRA 3LJ0A 1OM1A 5D1JA 1OIYA 2XNMA 1MRYA 2CKPA 3TJDA 4G3EA 2YACA 4QP4A 1S9JA 4KKGA 3UMXA 3UNJA 3EN6A 1FMKA 2R7IA 5BYZA 4CRLA 1PXKA 3ULZA 3B8RA 4XOYA 4M67A 4FTNA 4ZSAA 3UIXA 2XNGA 3W0MA 5IEXA 4TYJA 5EK7A 4FTJA 3LFAA 4QMOA 4FEQA 4GV1A 4N6ZA 5AUVA 3ZLWA 2J7TA 3G9NA 5EM5A 4AACA 3P7CA 4ACCA 3AD6A 4EK6A 2OIQA 4V04A 3GU5A 4DFXE 2XKDA 4BDCA 5EW9A 3CPCA 3FHIA 2Z7SA 5KMIA 4RG0A 3PP1A 4O2PA 2J9MA 1IAJA 1YXTA 3A4PA 2CCIA 3FMMA 5E8VA 3ORZA 3BU6A 4F6UA 3VS2A 3L8SA 4UY9A 5F95A 3LOKA 4KKHA 2HY81 3W0PA 3FQEA 4TNDA 2UV2A 3EH9A 4K0YA 2H6DA 3MVHA 4O91A 3VW6A 3TIZA 2BRBA 3R1YA 4D2RA 4G9CA 1M2RA 4BGHA 1RE8A 4RWIA 3FSFA 4NCTC 4BDFA 2PUIA 2CDZA 3NUYA 4QMTA 4L45A 3HV5A 3OS3A 4C4HA 3QTSA 1STCE 2G01A 3KGAA 5E8TA 3OCBA 4EK4A 2R3RA 2Y9QA 4R6VA 4DH7A 1V0PA 3EIDA 4XV3A 4YUQA 3NAYA 2EXCX 4JBOA 2F7EE 3PY0A 1GAGA 1O6LA 1ZYSA 2GMXA 4FGBA 3RM7A 3LFFA 4QMZA 4AWIA 2GS6A 2RFEA 4JDKA 4EOPA 3O23A 4X3FC 3V8TA 2XBJA 4C62A 3JXWA 4ACHA 4E20A 4S33A 4EJ7A 1PYXA 3RWPA 4UWBA 3UC4A 2X2LA 2P33A 1F5QA 3MH2A 3Q2MA 4DFLA 4NU1A 4JQ8A 4G3DA 2PZRA 4PNKA 2YM3A 3AGLA 2OFUA 4BDGA 4YPDA 4BCNA 2F7XE 3H0ZA 2YWVA 4QOXA 4CNHA 5BUEA 1Y57A 2J0MB 2WQMA 1G5SA 4GEOA 3Q6UA 2ZOQA 3BEGA 3FY2A 3RK5A 1RDQE 2C1AA 2QOIA 3KXGA 4RWLA 4K8AA 3QQLA 4FYOA 3CIKA 3ZLYA 3FI2A 4R7HA 2WQEA 1XO2B 1A48A 4H3PA 5E91A 3LFSA 2GU8A 4CTCA 3SGCA 2CLQA 3W33A 4IWPA 1FQ1B 5HLPA 2I0YA 5AP1A 5CF8A 3HMNA 2DS1A 2XK4A 4IE9A 4WSYA 5HHWA 3S00A 3LCDA 4KINA 4S2ZA 4O0YA 3IECA 1PMNA 2BZHB 2B54A 2X8DA 4D4RA 3NUXA 1CKPA 2P55A 4E93A 4D58A 4F63A 3QAME 3RK7A 3O8PA 1WMKA 4H39A 3BYMA 1OIUA 1B38A 3I7CA 3OOMA 3R1QA 5T68A 4B8MA 3E63A 4FL2A 2VU3A 4MNFA 3DLZA 2E9NA 2VV9A 1ATPE 4MCVA 2XIRA 4R3CA 5DFPA 1QPEA 3F5PA 4KAOA 3PSDA 3G6HA 3CJGA 5D41A 2HAKA 3E5AA 4CFUA 5CAQA 1J1BA 2BUJA 1SYKA 3LQ5A 4LG4A 4LI5A 4EH5A 1J7IA 2OF4A 2YCQA 3R8VA 4E4LA 2XMYA 5KKRC 3FMKA 2BKKA 3BCEA 2X1NA 5DR9A 3RCJA 3U51A 4C3FA 5JKGA 4IX6A 4YJTA 5ANIA 2BPMA 2X8IA 3OWKA 4NW6A 2E9PA 4FK6A 5CXZA 4C4IA 3G90X 3TNQB 3O51A 3AC5A 1ZAOA 4FZAB 2JGZA 4XV1A 2J0JA 2GQSA 5DR6A 3SQQA 2R3NA 4FTLA 2PZPA 3D4QA 2JBOA 4X2NA 4O7SA 3NS9A 4F9WA 3NNUA 4X3FB 1H26A 4J96A 2FSMX 4GK4A 3FJQE 4IACA 3JR1A 4IB3A 4HNFA 1TQIA 3F61A 3FSKA 3UODA 1V0BA 3QD2B 1LP4A 4DN5A 3IGGA 2WTDA 3AC8A 3DZQA 4I5PA 1YDSE 3FLYA 3HZTA 4C34A 3PE2A 2R3JA 2X81A 4JAJA 3OEZA 2QR8A 4JBPA 2DUVA 4BDEA 3TT0A 2BTRA 1KWPA 5ACKA 3RPSA 3U4UA 3MW1A 3QUEA 4AU8A 5M56A 4EKKA 4F9AA 2VO7A 4K1BA 5TF9A 3MIAA 4MXXA 4XG6A 4XG8A 1UU8A 5FRIA 4BC6A 4HPTE 4ZSEA 3FL5A 4BZOA 5KMNA 4DFNA 2YAKA 4QMLA 3NIZA 4C61A 1OKYA 5TR6A 2AC3A 1KE6A 4O7NA 1VYWA 4TKSA 3TJCA 3GBZA 1XBBA 2WHBA 4FT9A 3V51A 1PXIA 2I1MA 4HVGA 5AA8A 5L2WA 4XLVA 2O8YA 3WIGA 4IDTA 3TV7A 4OBOA 4AP7A 2XVDA 3M11A 4KABA 2GNJA 4RJ3A 4IC7A 4ZTNA 4AFEA 5JFXA 3R28A 4G3CA 1P14A 2J6MA 5F1ZA 2X4ZA 5AUXA 3EN9A 3ZU7A 5KHWA 3TZ8A 2BTSA 3UPZA 2ZV2A 4O21A 3BE9A 4ZTSA 1JOWB 4GUBA 2HYYA 2GPHA 2OXXA 2VUWA 3SAYA 3F2AA 3UNZA 3DA6A 3ITZA 2ITZA 1LUFA 3EN7A 3L9PA 4ZS0A 4J8MA 4ASZA 4BBMA 5JMSA 3LFDA 5ACBC 4FG7A 5EI2A 1UA2A 4RA5A 3NSZA 4FV4A 2NNWB 5ETIA 3FWQA 2Y0AA 4FV9A 2R4BA 5L6PA 4MX9A 4NM0A 5KKRB 1Q8TA 2JDRA 4GIIA 4D1XA 2C69A 4F7SA 5LJJA 4I0RA 3CCNA 4FTMA 3QYWA 4J52A 4L43A 5CENA 3I4BA 3VF9A 4DT8A 4W4XA 1XBCA 5KZ0A 5HGIA 5GJFA 4F0GA 5AV3A 4P2KA 3R63A 3Q4ZA 3U55A 1XJDA 3JY9A 4WG4A 5KMOA 4AZSA 5D11A 2WNTA 3ORLA 3THBA 1OECA 4EQUA 5CI7A 5FD2A 3QLFA 2CLXA 4L9IA 3BPRA 4PQNA 1XR1A 1QCFA 3FE3A 4BCOA 4XG7A 2WTJA 5H8BA 3EKKA 4OBPA 4D0WA 2QO2A 3ET7A 3BHUA 2YM5A 3MN3A 4FKUA 4YSJA 3I7BA 4WBBB 3TKIA 3Q5IA 4Q2AA 2HZNA 3W2CA 2G9XA 3ODYX 4M84A 4A4OA 4DHFA 4EOMA 3SX9A 3EL8A 1T46A 2QONA 4EYJA 4MVFA 5CF6A 4RJ6A 3COHA 3EQBA 4TYIA 4EOQA 3FUPA 3QA0A 3LCKA 5HNIX 5M4IA 4DC2A 3CGOA 4ITIA 4RIYB 5HX8A 2BRNA 4WO5A 2CSNA 3UQFA 3BX5A 3NCGA 3PXFA 4C02A 5K4JA 4O96A 5TO8A 3PP0A 2E9UA 3WYYA 2H96A 2W0JA 4K9YA 3LFEA 2BROA 5KMMA 2X0GA 4YJNA 4QT1A 5DLSA 4M97A 3LFNA 3MIYA 2IZUA 3EZRA 4NW5A 4XUFA 2Z60A 3D15A 4E1ZA 5L2SA 4S30A 4D4SA 1RW8A 3QCSA 3GCUA 3QZFA 3BGZA 4M7IA 3R7OA 5CSVA 4P4CA 2CKEA 4GG5A 4EOOA 1UU7A 3BQCA 3OUNB 4G16A 3KB7A 3FYKX 4M0ZA 3FMJA 4FEVA 3EQFA 3C7QA 5IDNA 1B6CB 4BYJA 2BIYA 1PXOA 5ETFA 4XP2A 3QUPA 1GIHA 2BAKA 1ZRZA 3Q4TA 3HUBA 3PPJA 4EZ3A 3TEIA 4NCTA 2BDJA 3Q4UA 3QRKA 3ZONA 4J97A 3RAIA 4F7LA 4LM5A 3FAAA 3ODZX 3UYSA 3CY3A 2Z7LA 3KK8A 4AT3A 3OTUA 4KUJA 2XNEA 2QO7A 3PIXA 2R3HA 2W1ZA 4OBQA 4PMMA 5D7AA 2X6DA 3P7AA 4D28A 3MA3A 4DFBA 2PZIA 2JDTA 1G8AA 4X3FA 2WMSA 3UC3A 3ZXTA 3PZHA 2BAJA 4GT5A 4QP8A 3H9FA 2B9FA 5T3QA 4Y5HA 2QI8A 4IH8A 3R7VA 3D14A 3KMWA 4OUCA 1OKVA 1JKLA 4MK0A 3D83A 1KOAA 4L42A 3BYOA 4KIQA 4NT4A 4AOJA 2PPQA 4BI0A 5CALA 3ZFXA 3UG1A 4IX4A 4G6NA 4MWIA 4FR4A 5D12A 3Q96A 4RA4A 3VW8A 2QOLA 3KVWA 1V0OA 2QCSA 1DI8A 4RC3A 2Y4PA 5K5NA 2BZJA 2X9EA 4WBOA 2GFCA 2RGPA 3ID6C 4M13A 5AMNA 5LXMA 4YC6A 4QTCA 4M12A 3QA8A 5DR2A 3RTPA 3QTUA 4ZP5A 3VS0A 4FOCA 4N4SA 3QCXA 4G2FA 3PE1A 4UWYA 5I9WA 3VS3A 4BY9E 2ITYA 3O2MA 3BE2A 1I09A 4DT9A 3N4VA 3FHRA 4DH1A 5M06A 3SVVA 3WE4A 2YZAA 4QP7A 3P79A 2OBJA 5AP7A 4AFJA 2F9GA 3ZH8A 5B0XA 2JAVA 2C68A 4CRSA 2Q0NA 2RIOA 3LKMA 5G6VA 3GCSA 2YA9A 3W10A 1ZXEA 3PXZA 4FUXA 2AUHA 3HEGA 3NW5A 2CNVA 4F65A 2C30A 1H8FA 3GC8A 2R3OA 2B9JA 3C51A 2CPKE 5A3XA 2YDJA 3DXPA 4HJOA 4J71A 2WEVA 3NUAA 4QRCA 2NPQA 5DVRA 2OFVA 3NUNA 2V5QA 5LQFA 3OZ6A 2FSTX 2IZSA 2WTVA 4XLIA 1GIJA 3QQKA 2WO6A 3LE6A 5BMSA 4ORKA 5A6OA 5KX8A 2VX1A 3F69A 4B0GA 2JBPA 4RX5A 5A4CA 3Q9XA 2QLUA 4LYNA 1ZLTA 5FEQA 3KVXA 4TZRA 4Y5QA 4EORA 3ANRA 5HNGA 4Z55A 1K3AA 4L46A 2OH4A 5AIRA 5E90A 4DFYA 2UZUE 5LCJA 4RX9A 2JKQA 4C58A 2X6EA 3MH3A 4ASXA 3F5GA 4J8NA 4LGGA 4R7BA 2XCHA 2Z2WA 3VJNA 3PVUA 1XH5A 4WT6A 3ZC6A 4I21A 4BCMA 2R3LA 2WD1A 4OR5A 4KNBA 3BLRA 3SXRA 3IPHA 2C5VA 2Z7RA 4YTFA 5AUWA 1BI8A 3R6XA 3UIBA 1OPKA 1URCA 1YWRA 1YQJA 4F6SA 5GNKA 3UOKA 1ZY4A 2QKWB 4OTDA 4JG8A 1REKA 4FKTA 4CFVA 3DT1A 4HYSA 5H8EA 4BZDA 3MS9A 5DPVA 4XS2A 3F88A 3WF7A 3G5DA 5BVEA 2W1CA 3AXWA 4JIAA 3OY3A 4LUEA 3PXQA 4JG6A 2FH9A 4HYHA 3C0GA 2W1IA 5FXQA 2B7AA 5DH3A 3QCYA 2R5TA 3FMDA 4MF1A 4ZMFA 2VX0A 5FG8A 5BQ0A 5CEKA 4ZS4A 5F9EA 5JGDA 1Q8ZA 3I60A 1NT2A 2JIUA 3HAMA 2VWUA 4C4EA 3C4CA 5LMBA 3OY1A 3Q9YA 5CX9A 3DFCB 5C8NA 4UB7A 2YEXA 2C47A 3DK6A 3KRWA 5GJDA 2R3FA 5G1XA 4FIIA 2CJMA 3VUIA 4HCTA 4QYGA 5C1QB 3I81A 4BBEA 4HVIA 3HVCA 3IW4A 5DNRA 5EDRA 1Q62A 4O0VA 5DBXA 2PU8A 2XP2A 2QOFA 4RJ7A 4C3PA 3UOHA 3W1FA 4F08A 2PZYA 2YM8A 4XEYA 3GU6A 3SC1A 1FVTA 5IA4A 5M4UA 4NSTA 4B9DA 4UX9A 4FT5A 2FVDA 4C3RA 2YIYA 3F5XA 3ZO1A 3QX4A 1WBPA 2B1PA 4I5HA 4YR8A 5ITAA 5HESA 5HCZA 3U6HA 4KWPA 2OIBA 2KULA 3HA6A 3Q32A 4GS6A 4P5QA 5LWMA 5DRBA 5M44A 4YTIA 1L3RE 3HKOA 5HO7A 2SRCA 2PY3A 2HWOA 2GDOA 5CZHA 2VTHA 2PMIA 5EW3A 2YDIA 4G6OA 3RI1A 2UW3A 3GENA 3DBEA 4M3QA 5GIOE 1CSNA 2GNGA 3V5TA 3PXYA 2EVAA 3VUDA 3R21A 1YHVA 5IMEA 5EQPA 2EUFB 4NKSA 4FVPA 5CNOA 2O65A 5I9YA 1JNKA 3L8VA 4YZMA 2PHKA 1KE8A 3DKFA 5F94A 4EH9A 4RMZA 4YTHA 3VUMA 3W0NA 2OZAB 3AD4A 2VN9A 3BGPA 3OVVA 5CU0A 4XNEA 4GT4A 3NYOA 3FBVA 5KHXA 4WIHA 2J50A 4O6LA 5A4LA 2HCKA 3HL7A 3M1SA 4WUAA 3A61A 2B4SB 4QTDA 3ROCA 1TQPA 4BVUA 5KBQA 2XK6A 4I4EA 1MUOA 2JKKA 3GFEA 4KRDA 4HGLA 5BVFA 3IDBA 4IAIA 4AW5A 3IW6A 2WMVA 3NZ0A 3PJ1A 4PTCA 4BTFA 3BEAA 4NYEA 5AAFA 1M52A 4KBCA 4YURA 4FTOA 1DM2A 4CEGA 2CKQA 1VJYA 3G6GA 5HVKA 4E4XA 3FYJX 4DEAA 3NVMB 2VAGA 3HAVA 2VTNA 5EOLA 5FXRA 1YI6A 2GS2A 5M09A 4FKRA 5E8UA 2UVXA 3RNIA 4RIWB 4NJDA 4O82A 3BBWA 4GYIA 4YP8A 3CKWA 3DQWA 1OZ1A 2ZMDA 3PA3A 2PULA 3TN8A 2W5AA 4AN3A 1BL6A 3F82A 1NVSA 2OG8A 2R0IA 2YN8A 3JVSA 2WQBA 4QP3A 4S32A 3UG2A 3R8PA 2ZB0A 5KCVA 4Z16A 4TWNA 3OFMA 4JT3A 4EI4A 3ZBXA 5AADA 4APPA 4O81A 1NY3A 3VS5A 4GL9A 4IADA 3OXIA 4EL9A 5HBJA 2UZOA 3N51A 3P08A 1ZMUA 4FKJA 2XIKA 3TDWA 3EMGA 4L67A 4NFNA 5JSMA 2X7FA 5FTQA 1OL2A 3AC4A 3LXPA 3W0OA 3U6IA 4JS8A 1SVGA 2IVSA 3D0EA 2RG6A 3QBNA 3PA4A 4NFMA 3HV7A 3VBTA 4F1TA 2OZOA 3DOGA 5FP5A 3F3VA 3MTLA 4QTBA 4U81A 1OIRA 3NGAA 4CLJA 3GEQA 1IR3A 2A0CX 1DI9A 4QNYA 2XA4A 1GOLA 2QOHA 5LVPA 4RC4A 2BILB 4MXYA 3O7LD 4QTAA 4IB5A 4U0IA 5CSXA 2UZTA 2WPAA 3SW4A 5JGBA 2R3PA 4ALWA 4BCGA 2Y4IC 1MQ4A 3ZTXA 5DG5A 2OIDA 3E7VA 3ALOA 3OT8A 2IW6A 5JZJA 5CF4A 1T45A 3OCTA 3WZKA 2V7AA 1U46A 2VTLA 3NYXA 2PK9A 3R83A 2J5EA 3NRMA 2W9ZB 5GIPE 1E1VA 1OIQA 3NIEA 4TY1A 3ULIA 3C9WA 4WD5A 3NNWA 4RFMA 3MPMA 3DZOA 4O7OA 3QALE 5EH0A 3UOJA 3E62A 1KE7A 5ANKA 2XIZA 3AMAA 3LQ8A 4JX3A 2WELA 3EZVA 4Y8DA 5HCYA 3ZFMA 4QPSA 3LXNA 4B7TA 2UW0A 1BL7A 3PY3A 5A4EA 3FKOA 4FSQA 5LVMA 5C27A 3BRBA 4BIDA 2LAVA 2W05A 1FGIA 1Q8UA 2R2PA 3MY1A 2CGUA 2CGXA 3MPAA 3F2RA 4LL0A 3ZHPC 4M68A 1CMKE 3GUBA 5EM7A 3KA0A 5BUJA 5HLNA 1YI3A 4U5JA 5ANDA 5KZIA 4CV8A 4IX3A 5EYMA 5CU6A 2ZYBA 3AQVA 3LFBA 2QG5A 1W82A 4H58A 3AT3A 1BMKA 3LCTA 3LMIA 3KF7A 2R3KA 4ZJJA 1TVOA 3PY1A 2VRXA 4DLJA 3JS2A 2JDVA 4JXFA 5HG8A 3VS4A 3R2BA 3BKBA 2UW8A 5CZIA 4RRVA 2W1DA 4G31A 4UEUA 5AP5A 3TXOA 4E26A 2ACXA 1LPUA 1ZY5A 1WBWA 3TNWA 4CD0A 3KRXA 4FE2A 5A46A 3F6XA 2WQOA 4IIRA 4NKAA 1GNGA 2R3QA 4Y73A 2P2HA 2HW6A 1ZOHA 1H1SA 3VUHA 4BCQA 2B9HA 3LPBA 2R3MA 1CDKA 1CKJA 4FV0A 5IG1A 4CT2A 3PVBA 4JL9A 3E87A 1W7HA 5C4LA 4U9AA 1ZOEA 4U80A 2J0KA 2OW3A 4EC9A 3QKLA 2OZAA 3GI3A 5BVNA 3R7UA 4F0IA 4RBLA 4BDDA 3ERKA 4U41A 2XJ1A 3BLHA 3TDVA 1Y8GA 3WILA 3HGKA 4QP6A 4FNZA 2XCKA 5DWRA 3HV6A 3LW0A 2ITNA 2PVKA 5HG5A 3ZUTA 3OCGA 3PVWA 3HMOA 1E1XA 4A7CA 4DITA 4KSQA 3IONA 4I6HA 5C26A 4ENXA 4J1RA 3UQCA 2UW9A 4V01A 4WG3A 4PMTA 4XV2A 2BR1A 1OL7A 2PMNX 4FSTA 3QTZA 4CFMA 2GQRA 5JH6A 1H08A 2PZ5A 3O71A 3ORXA 4GSBA 4XV9A 5AJQA 3ZSIA 4MHAA 3SHEA 4J7BA 2VTTA 4RIWA 5AUZA 3REPA 3V5LA 4PMPA 2OU7A 3QRTA 4C37A 5EDQA 2WAJA 3ENHA 4N6YA 4RQVA 1YXUA 4KBAA 3ALNA 3Q4CA 2C4GA 3UGCA 3EN4A 2BKZA 3QYZA 5HO8A 3CR0A 3MBLA 3Q5ZA 3DV3A 2FO0A 4N0SA 4B6LA 5FQDC 3F66A 4U3YA 2F4JA 3L1SA 2QNJA 2YM7A 1Z57A 4XG2A 4MD8E 4O22A 4QYHA 4BCPA 3ZBFA 4IZ5A 3ZOSA 1NW1A 4IQ6A 5CI6A 5FM2A 4U6RA 5CAUA 1IA9A 4IAZA 3ZXZA 2CGVA 4RC2A 4OGRA 2OJIA 3JUHA 3NW7A 4CVAA 5IPJA 2O2UA 3K5VA 3MA6A 3ZM9A 3IQ7A 4EBWA 3NWWA 2PYWA 4GFGA 2ONLC 2UVZA 5ANJA 4QTEA 3EOCA 5I9ZA 4FKOA 3WARA 4I5MA 4HPUE 4ZAUA 2VNWA 4YMJA 3SOCA 3EQGA 2PE2A 2YCRA 1JSVA 4ZSGA 1SVHA 3VS6A 5AUUA 3GOKA 3QLGA 4L52A 4I6FA 1DS5A 3WI6A 3MGYA 3EJ1A 5CS6A 3FLWA 4MBJA 4DTAA 5HIEA 3FC1X 2A1AB 1Q5KA 4RZWA 4ZIMA 4IVAA 1H25A 2QG7A 3O7LB 3O8UA 1OPJA 2QQ7A 3OROA 4CKIA 1YHSA 3FMLA 5J9LA 3FLNC 1OUYA 3FV8A 4BKJA 1FBNA 1P4FA 1W98A 4NUSA 5C9CA 3ZZEA 5L2IA 1JKSA 3A8WA 3FPQA 4AZFA 1M2QA 3EN5A 4GCJA 1IA8A 3PLSA 4BB4A 3K3IA 3PJCA 2YM6A 5IQGA 1PKGA 2W4OA 4FV7A 2OXYA 1Q3WA 2W1EA 3MYGA 5E8SA 4UWCA 2QVSE 2OI4X 1S9IA 4D0XA 4N70A 4U44A 4EUTA 2ITOA 4X2KA 1A06A 3UVPA 4FKGA 3DLSA 3PJ3A 3HX4A 1M2PA 2X39A 4IFCA 2QO9A 3UBDA 1GY3A 3RP9A 3F9NA 3RPOA 5IQCA 2PMOX 1PXNA 2PUUA 4BCJA 1PXPA 3T3VA 4MH7A 2WXVA 4F70A 3CS9A 5I9VA 1R0EA 3V5PA 1OKZA 3WBLA 3I0OA 4DINA 4GVAA 4D5HA 3KREA 2OKRA 2YCSA 4WNKA 4YJSA 4AA0A 4KA3A 3DAJA 5H8GA 2HELA 3UVQA 4O83A 3EQHA 4JVGA 3QFVA 2BDWA 1GZNA 1IEPA 5CT7A 5IEVA 1JSTA 2C5OA 5LARA 3KCKA 3MB6A 3VHEA 4ZTMA 2XJ2A 2C6IA 3CQWA 3Q9ZA 4JI9A 4AGDA 4C4JA 3GU7A 4FUYA 1BI7A 2CMWA 2FYSA 4IVCA 3GOPA 4Y85A 4ZK5A 4Q5EA 1W84A 4JDJA 5HTCA 3UVRA 4PUZA 3BLQA 4JR7A 4I4FA 3IGOA 4AXAA 3QQJA 4E6DA 4R7IA 1P2AA 4K2RA 4EWHA 2VO6A 4PTEA 5AM6A 4EC8A 4FV5A 5CNNA 3FC2A 4JDIA 4KS8A 5AV4A 3OEFX 2IG7A 5EYKA 4G17A 4JRVA 3ZC5A 4K6ZA 2QR7A 3U87A 3LXLA 4JAIA 4O0WA 3BYSA 2V62A 3KMUA 4YO6A 5AP2A 5DYJA 2OH0E 2RG5A 4GKIA 2W4KA 2J90A 1ZWSA 2HIWA 3KN6A 3EQCA 4FT7A 3KY2A 3BYUA 4OTWA 2JAMA 5FBNC 5HBHA 5FEDA 5AUTA 3CLYA 3DBQA 4NH1A 2OICA 2ZJWA 2YIXA 5HE1A 2RKUA 4IWOA 1JLUE 4R3RA 1UWHA 5DOSA 3E8NA 3GXLA 3BIZA 4BCHA 2GNFA 4DLIA 2F2CB 5EM6A 2WOTA 5LMAA 4BI2A 4RVTA 1H01A 4LUDA 5JRSA 3V5JA 4CFXA 4MQ2A 3LZBA 4FODA 3O8TA 3OP5A 4YPSA 4FKPA 3ATSA 2DQ7X 4PRJA 5CVHA 4AW0A 3R9RA 5A4QA 2UZEA 3E93A 4MXOA 2JDSA 3H3CA 4FZ7A 4CXAA 3ATTA 4FSRA 5EQYA 4E8AA 5HG9A 4EOKA 3TV6A 4H1MA 3HV4A 3UZPA 3JY0A 2JKMA 2WMWA 3SRVA 2IW8A 2ZV8A 3EYHA 3SD0A 4FYNA 4IEBA 1JQHA 3CTHA 5IA0A 4FIJA 2W96B 4FTQA 1M17A 1OBGA 3LJ2A 2GTNA 1U5RA 2NRUA 2WTWA 2XEZA 4K11A 4PTGA 4B99A 4FTRA 2UZNA 1UNGA 3OD6X 4PX6A 5IU2A 4FEXA 3Q60A 3F5UA 2UZBA 3HDMA 3QCQA 3E64A 4R1YA 5IQHA 4FZFB 4M14A 5FM3A 3LVPA 4IC8A 4V0GB 3S4QA 3QWJA 3BWFA 1OVEA 4AT4A 4LV8A 3FQHA 3W2OA 3AMBA 4FEWA 4O7YA 3UJGA 4TTHB 3R71A 4EK5A 1U59A 2XUUA 5CASA 1JSUA 1XQZA 3UQGA 4TWOA 3OWJA 3WF6A 1WBSA 1ERKA 4DEIA 2X4FA 3C5UA 4WOVA 4EHZA 1J7LA 4I3ZA 3DNEA 2C0TA 3DBCA 3FPMA 3F2NA 4A07A 5HQ0A 3POZA 4LGHA 4ZSJA 2G1TA 5EW8A 5C01A 2UZDA 3E7OA 4F09A 4I94A 3DDPA 3O96A 4X21A 1R39A 3RAWA 4R1VA 4FX3A 3W2RA 3A62A 1J3HA 4U97A 2Y6MA 5HIBA 4X2JA 4X7QA 4FBXA 3DTWA 2XM9A 5GJGA 3RHXA 3W16A 3R2YA 1G3NA 3IW7A 4E5BA 3QQGA 2WEIA 5IUIA 5J1WA 2CNQA 4OTHA 5CEQA 5IQAA 3ZO3A 4EKLA 3CXWA 3HDNA 3WZJA 1JKTA 2OF2A 2YIRA 5JQ8A 1ZZ2A 3KXNA 4TYGA 3D7ZA 4HYIA 4BGQA 4F9BA 1J1CA 2JDOA 5CAPA 3IW8A 2O5KA 4RVMA 2QODA 5D10A 5IA1A 4E73A 4CSVA 3HRFA 5D7VA 1HCKA 4XG3A 1BX6A 5AX3A 3VIDA 4NZWB 5F20A 3QZHA 5EDPA 4MNEA 4FGRA 5FP6A 2C6TA 5L8KA 3RINA 4O7VA 5A14A 4GFMA 4GIHA 4X2GA 5E8WA 5IQIA 2X8EA 1F0QA 2HY0A 1OB3A 4K18A 5IA5A 4Y83A 4LQMA 3SXSA 4FTTA 3P86A 4FSMA 5AM7A 2VTIA 4IZAA 5M51A 4UZDA 3KC3A 2EB3A 3AG9A 1SMHA 4J95A 3R1NA 2V55A 1NA7A 4EZ7A 5JGAA 3KMMA 5K3YA 5H9BA 3CC6A 3FY0A 5CU3A 3TL8A 3NVKI 1SNXA 4NJ3A 2J0LA 4GJ3A 2ONLA 1ZMWA 2ERZE 3QGWA 2WMAA 1RJBA 4O7RA 5AFVA 1OBDA 3MVJA 2WTKC 5DEYA 4E5WA 5KUPA 1R3CA 3PXRA 4XBUA 4BTMA 5LOHA 4N57A 1IRKA 3FL4A 4PL4A 3RMFA 4RGJA 2Q83A 1XH8A 3GCPA 4DG0E 5J9ZA 4YU2A 5FEEA 4FOBA 2BRMA 5FLFA 3KULA 4BI1A 1H00A 4AG8A 2EU9A 3FQSA 1PXJA 4RZVA 2ZM4A 4H3BA 4YZCA 3NPCA 2VWZA 3MI9A 3PPKA 2XRWA 4IW0A 2VWWA 5J9YA 3QHWA 4FEUA 4WUNA 4BBFA 4QMQA 4QQTA 3NUUA 4O7PA 1YXSA 5M53A 5LVLA 1NVRA 4IWQA 1KV2A 2BAQA 3PFQA 2I40A 1VEBA 4TWPA 3A4OX 4DAWA 4E4NA 4DBXA 4WKQA 2I7QA 5IISA 1GZKA 3BHVA 3MVMA 3NYNA 5HG7A 3W0SA 4ID7A 3L8PA 4NL0A 4J98A 4ZTLA 5EYDA 3ZEPA 2BZKB 3C4ZA 4CV9A 4DE4A 3RKBA 5HE3A 3AC3A 5J7HA 4UXQA 3HMMA 2XF0A 3PIZA 3VRZA 2OJJA 3QRJA 4U79A 4QYYA 4AS0A 1J91A 1FINA 5IUHA 4YHJA 1YDRE 2A19B 3U6JA 1WCCA 3PRFA 5M08A 5CSWA 4WNOA 2VO3A 1MRVA 3QWKA 4YZDA 2RF9A 2OWBA 3GCVA 3FEGA 1Y91A 4A9RA 3DK3A 3QHRA 2C3IB 3BV2A 5J5SA 4I0TA 5EYCA 2YJRA 3R01A 5DT4A 4PL5A 3BWJA 2XNOA 2H9VA 3EFJA 5HD4A 2JC6A 2Q0BA 2YAAA 2C3KA 3A99A 3QTWA 4FV3A 5CQUA 3ZRMA 4UBAA 1IASA 1H4LA 2XIXA 3KFAA 3QC9A 5FTOA 5LCKA 5F4NA 3KN5A 5A6NA 5JEBA 2VTAA 3TKHA 3ACJA 4LFIA 4FKQA 4C0TA 4OTIA 5CTPA 4ANSA 4BTJA 4UYAA 2VGPA 3HRCA 4TN6A 1JWHA 4HGEA 3R9OA 3OWLA 1BYGA 1Y6BA 2UW5A 5HKMA 4CMUA 5HE0A 3UO4A 3FDNA 2WTKB 4FV2A 4V0GA 3IK3A 4ERWA 3NDMA 2XK3A 4U45A 4E7WA 4FICA 4G5JA 3PG1A 4BHNA 3CE3A 5EHOA 4O0RA 4RJ4A 2OLCA 5L8LA 2VTJA 3Q6WA 3P0MA 4PDYA 2C6EA 4FVRA 2PTKA 4H1JA 2JKOA 4HVSA 3DTCA 2R9SA 4R5YA 5BUIA 1Z9XA 1KE9A 1JVPP 2YM4A 4FSNA 4H05A 5FXSA 4EOSA 1YXXA 4U7ZA 4E6CA 2CGWA 4W4VA 3SG9A 2C6KA 3UMWA 4E6QA 3ANQA 3S0OA 5KMLA 5KE0A 4QMVA 3QC4A 3H0YA 3PDTA 5M55A 1UV5A 3OC1A 4IWDA 4MD9E 5BNJA 1ZMVA 4NTSA 4NTTA 3MDYA 5DHJA 3DBFA 4EQCA 4JNWA 4QYEA 3TCPA 2V0DA 1ZOGA 4AN9A 2EWAA 4AZVA 2QD9A 4I93A 5I4NA 3H9OA 3UYTA 4CG9A 3IDPA 4FSUA 3LCOA 3II5A 5CANA 3ZRLA 2Z02A 3COIA 3RAKA 4I1ZA 5HIDA 3R73A 3NEWA 3B2TA 4F9CA 4MYGA 3VAPA 3OBGA 4FKSA 4IM3A 3NUSA 2GCDA 4M15A 4I41A 5EFQA 3V5QA 4EH6A 2OSCA 3RAHA 3OT3A 4DGMA 1WFCA 2FSOX 3ENMA 5JK3A 4YBKA 2QU6A 3R8ZA 2G2FA 3PLAE 4ZOGA 5J1VA 4PF4A 4GJ2A 4QMMA 2PVYA 3KXMA 4IX5A 3NUPA 4BF2A 1SVEA 1XBAA 3COMA 4U8ZA 2LGCA 3DNDA 1DAYA 4R5SA 5E8YA 3RVGA 3PSCA 5TKDA 5M4CA 4FIGA 4FT3A 4CZUA 2YABA 4EOJA 4FI1A 3VQUA 3NNXA 4KD1A 5A4TA 2XKCA 5DGZA 4FNXA 4BRXA 5AV0A 2C5XA 2XNNA 4F9YA 3IG7A 3QQUA 4AA4A 3RGFA 3CP9A 1OPLA 4DA5A 4EYMA 1XH4A 5IQDA 3DB8A 3QXOA 2NO3A 3TI1A 3CQUA 2WTCA 1OMWA 3UIMA 2IN6A 5L8JA 2IZTA 2OJFE 5BVWA 3PG3A 2VWVA 2V7OA 4IZ7A 4F64A 4MAOA 2PUPA 3RALA 3F3TA 4MXAA 1SNUA 4CTBA 5IQBA 3FI8A 4ZJIA 4MQ1A 5BVOA 3NNVA 3ZCLA 4PNIA 4FSWA 1OL6A 4AE6A 3B2WA 3OXZA 4FZ6A 4NWMA 2PVNA 5AIKA 4AGWA 5AV2A 4F4PA 3I0QA 1OUKA 4ALUA 2C3LA 4GKHA 5HLWA 1WVYA 2WU6A 3FLSA 1UVRA 2GTMA 3L9NA 3CPBA 4II5A 4KSPA 5BYLA 3U9CA 3QKMA 4RIXB 2OXDA 4ERKA 4KS7A 4CKJA 1XWSA 3NAXA 4RX7A 2HENA 1Q99A 4C38A 4DH5A 3H4JA 4IBMA 4ZTHA 4FG8A 3Q53A 3EFWA 3H9RA 3SW7A 5CXHA 4P5ZA 5IH5A 5H3QA 2Y6OA 3FZRA 3VS1A 2BVAA 4GT3A 3EQRA 4YC3A 3FXZA 3ZYAA 4ALVA 5IF1A 4LL5A 2R7BA 4Z3VA 5CLPA 4IB1A 4AAAA 2Z8CA 4X6QC 1SZMA 4ZZMA 1WVWA 3DAEA 3R7EA 4AZTA 4YJOA 5HICA 2GQGA 1EH4A 2JEDA 3DB6A 2J5FA 1ZYJA 1YXVA 3FLZA 4FZDB 2WMBA 3GC7A 3LIJA 4GU9A 2O63A 1GZOA 4O27B 3VBQA 5KNJA 5M4FA 5FDPA 5HU3A 2BRHA 4QMWA 3G2FA 2V22A 3IOKA 4NM7A 4PMSA 4YLLA 3C1XA 4RJ8A 1Q97A 4IAFA 3W32A 4ANQA 2A2AA 3KK9A 4BHZA 5M07A 3RCDA 3D7TB 3POOA 3ZLXA 4PP7A 5IMXA 5EHLA 3EB0A 3TM0A 2HZ4A 5BMMA 4A4XA 4D1ZA 1YOJA 5JZNA 1O9UA 3NX8A 4FKVA 4K77A 4GUEA 3RJCA 5CAOA 2HXQA 1OGUA 2UW4A 1JAMA 3HP5A 2HK5A 3KXHA 2OGVA 3OTVA 3W8QA 2C0IA 2XYUA 3FLQA 4G9RA 4A9TA 3FZTA 4HGTA 4JDHA 3A7GA 3W2PA 4ZLOA 3MFUA 4TXCA 1QPJA 3UO5A 4WG5A 4L7SA 5CSHA 3AOXA 4I20A 1YOLA 1R78A 3MB7A 1CTPE 4NM3A 5E1EA 3VBYA 4AW2A 4C59A 3LXKA 3QD0A 4IFGA 3SG8A 4ZXTA 4TT7A 4NIFB 3T9IA 4IVDA 4EWQA 2WU7A 3EFKA 4G3FA 1ZYCA 3MESA 3QKKA 4LRKA 3I5NA 3QF9A 4RLLA 5HVJA 1CKIA 3PVGA 3WIKA 4DGOA 1WVXA 2B0QA 3HMPA 3ZUVA 3MH0A 3TG1A 4MWHA 3FXWA 5AWMA 4JQ7A 3R7YA 3EQDA 3G15A 4QQCA 4JR3A 1L8TA 3UIUA 4FTUA 4FL3A 3U4WA 4DGLC 3P9JA 3Q04A 5EOBA 5AX9A 4CKRA 4OTRA 3MH1A 4I22A 3E92A 3OF0A 5HD7A 4IAAA 3T9TA 2C6LA 3PJ8A 4IM2A 2QOBA 2YIQA 5HCXA 2XRUA 1JBPE 4DEBA 3MJ1A 3IOPA 4FTIA 4HVDA 3P78A 1WZYA 3GT8A 4AQCA 3QQFA 3W18A 4QP9A 2QHNA 3L9LA 4LRMA 2B9IA 4EH7A 2WGJA 3PWDA 4OT6A 2XH5A 1Q8WA 5EG3A 3TTJA 3P7BA 4V05A 5EI6A 2JFLA 3I5ZA 3PRIA 3QRIA 2RFSA 1KE5A 3QXPA 4RFYA 3B8QA 3IKAA 2Y4IB 4USDA 4XG9A 3VBWA 2WMTA 3QTQA 4ITJA 4Q9SA 3C0IA 2RFNA 2ESMA 2YWPA 3LAUA 2PVJA 4IJPA 1KOBA 3EWHA 4I5CA 1PXLA 5HI2A 2G15A 1Q61A 1Y8YA 3I6UA 5JFVA 1LEZA 3WZUA 4L53A 1K2PA 3D9VA 2UVYA 3C50A 3QGYA 4BN1A 2YFXA 3KF4A 3HUCA 2R3IA 3C4EA 3DKOA 1Q24A 4DEHA 2BHEA 3ORKA 4GG7A 4USEA 2UZVA 4UYNA 2B55A 4BDHA 5CYIA 2GSFA 4IM0A 4AZEA 4IMYA 4I6QA 3O0GA 5AV1A 4FVQA 4QMNA 3E8EA 1KSWA 2UW6A 4KBKA 3R22A 4JBVA 2X2KA 3L9MA 3P23A 4ITHA 4BZNA 1XH7A 4OTQA 4L44A 5E8ZA 3VBVA 1FGKA 4IANA 3HECA 4JJRA 5M57A 5CVGA 4H36A 1H1PA 3T3UA 5L3AA 4F99A 3LMHA 5HE2A 3UPXA 2P0CA 3SKCA 4G34A 3DS6A 4QMYA 1UWJA 3VUKA 4AOTA 3DAKA 3BU3A 3ZS5A 5A54A 1REJA 3E3BX 4W4WA 5ANEA 3K5UA 3SRVB 3NCZA 1OI9A 2GHLA 4RX8A 1PY5A 2WMQA 3VO3A 2J4ZA 3KRRA 2YERA 3DCVA 3LFQA 5E7RA 1P5EA 4YJUA 4Y46A 1YKRA 3ORIA 4FKLA 4XRJA 3DKGA 3TNPC 4RIXA 4EZ5A 1E9HA 3ZM4A 2JLDA 5KO1A 4ANBA 3FI4A 3F3UA 1RQQA 3F3WA 4I0SA 1PMVA 3TWJA 4DEDA 1SM2A 3QTXA 4YC8A 5C4KA 5JT2A 3S95A 4FC0A 4YLKA 3KXZA 3L8XA 3TACA 1K9AA 4XRLA 2H34A 2XKFA 2XJ0A 1Q4LA 1H24A 2VNYA 4RJ5A 3ZSGA 1Z5MA 1BUHA 3UNKA 4GK3A 5E92A 4QP1A 5I0BA 1R0PA 1P4OA 3CD8A 4EQMA 5DE2A 4BDBA 4D4YA 5IH6A 1OL1A 4P90A 4MBIA 2VTQA 4DCAA 5BVDA 4TL0A 4FNYA 4FSZA 3E8DA 4X3JA 3TUDA 2ITUA 4JQEA 4IJ9A 3W2SA 4OLIA 4XH6A 4EHEA 1UNLA 4CFWA 1LR4A 3A60A 4FKIA 4AT5A 3GP0A 4R3PA 1OKWA 3JVRA 1XH6A 3E8CA 3PYYA 2IVTA 4QMSA 4BIBA 3LMGA 1FOTA 4TYHB 2R3GA 4QQJA 4ZLYA 1TQMA 2WOUA 4GFOA 4ZY4A 5EQEA 5BVKA 3D7TA 3OHTA 4BDAA 5TT7A 3HRBA 4RPVA 4EH4A 5FTGA 4I24A 3VQHA 4QMXA 5BPYA 3LLAA 4L3JA 3C0HA 4CCUA 4U94A 3OCSA 5EKOA 3WOWA 2J51A 3G33A 4JRNA 4IHPA 3SLSA 3ZDUA 3MFTA 5K4IA 3I79A 4AOIA 4L3LA 4TWCA 3MTFA 3VJOA 3I1AA 2VO0A 3BYVA 3D5XA 4PY1A 4XYFA 3Q52A 2AC5A 3RZBA 3GU4A 1KUTA 2WMUA 5E4HA 4G3GA 3TZ7A 4DTBA 2VTSA 1YVJA 3NYVA 2BFYA 3UP7A 1VZOA 3U8WA 1PHKA 5DA3A 2DWBA 3GQLA 3FZSA 4QMUA 3DPKA 5E8XA 4Z7HA 3PUPA 4MNEB 3V6RA 3VVHA 2I0EA 3ZDIA 3EFLA 2WMRA 4PP9A 4HVHA 4ASEA 1B39A 3BI6A 3RK9A 3EHAA 2Z7QA 1YWNA 4CG8A 2XS0A 2EXMA 4CCBA 2W4JA 4IAKA 4UXLA 4KB8A 4QYFA 4NK9A 5J95A 1UKIA 2NRYA 4G6LA 3Q3BA 3SV0A 2GNLA 3GVUA 2J0IA 2WFYA 1M7NA 3PPZA 4L01A 4DTKA 4DF3A 2QOKA 3G51A 4HCVA 1W8CA 4C4GA 2VTMA 3GGFA 3F3ZA 3NR9A 4LOQA 5D9HA 5HEZA 4A9SA 5HTBA 2OK1A 3PA5A 3SA0A 4DGNA 5AAGA 4CFFA 4A06A 4PDSA 4WRSA 1HCLA 2HZ0A 2VZ6A 2W99B 5LMKC 4WHZA 4FIFA 2QLQA 3G0FA 4PV0A 5CEOA 3A2CA 3EKNA 3OW4A 3NMUF 2A27A 3KULB 3VWAA 2BRGA 4JX7A 4YJVA 4A9UA 3RPVA 2IVVA 3BELA 4YO4A 1I44A 5L6OA 4CZTA 3EYGA 3FXXA 4HZSA 3DKCA 3KEXA 2QU5A 2ZDTA 3HMIA 4EJNA 4ZY6A 5AEPA 3PXKA 4FNWA 4DH8A 4M69B 3TNIA 4HW7A 4AGUA 4JOAA 1M7QA 2IJMA 4CMOA 1TKIA 3DXNA 2WIHA 2G2HA 1H07A 2XK9A 4I6BA 5ETAA 4QP2A 2PWLA 4M8TA 2ITXA 4Y95A 1PYEA 4PDPA 3SDJA 3AT2A 5IEYA 2ERKA 2JITA 3PZEA 3F7ZA 1O6KA 4ZJVA 3AGMA 3MY5A 5FGKA 4EH8A 4ENYA 2XZSA 3EQIA 4LV5A 1PRYA 4PDOA 2BIKB 2F49A 4PWNA 4JG7A 4QQ5A 4RQKA 4TNBA 2HOGA 5DI1A 3DBDA 3UTOA 2ZDUA 4XOZA 3A8XA 3LLTA 2YIWA 3WZDA 3ZO4A 4D2SA 3BU5A 1PMUA 5J8IA 3D5UA 4E6AA 4O86A 2JIIA 4H3QA 3MPTA 3RHKA 3CY2A 4CQEA 4F1OA 1YW2A 2PE0A 4DFZE 1M14A 3W8LA 3DJ5A 4BICA 5CAVA 2C3JA 3K3JA 1KV1A 2CCHA 1AGWA 4EEVA 3P1AA 3R00A 4ASDA 2F2UA 1VR2A 1X8BA 1OITA 1H27A 1YWVA 2QOOA 2QOCA 4MEDA 4CLIA 3R8LA 2ZM3A 3C4XA 2VTOA 5AAEA 3AD5A 2GFSA 5HU9A 2PE1A 4ZEGA 3EL7A 2ZV9A 4GYGA 3W55A 2PUNA 2QOQA 4ZY5A 1OL5A 2F57A 2AYPA 1XKKA 1U54B 4EUUA 4DCEA 3BHHA 1ZYDA 2XB7A 2XM8A 2ITQA 4FIEA 4LRJA 5EI8A 2FB8A 3G0EA 3A7JA 3BHTA 2E2BA 1QL6A 3A7FA 3JYAA 4FV6A 4YJPA 3NW6A 4ACDA 4MXZA 2ITTA 3LQ3A 5B2MA 3WF9A 5IZFA 2O64A 3M2WA 3R7IA 3DY7A 3GFWA 2C5YA 3VF8A 4OTGA 3TZMA 5FBOA 5H2UA 2UZWE 3UZRA 2ITVA 3ZSHA 2PVLA 3N9XA 2ZMCA 5GINE 4YZBA 2GS7A 4EHGA 3I6WA 1XHAA 3A7HA 4J53A 1Y6AA
chains in the Genus database with same CATH superfamily
5B7VA 4GRBA 2PVFA 1QPCA 4TYHA 2C6OA 2VX3A 2QURA 3V8WA 2PL0A 3LCSA 2QC6A 3ZLSA 1UKHA 4X2FA 4HZRA 3CQEA 4RT7A 4BCFA 2CN8A 2X7GA 2XK8A 3WZEA 3R02A 4LV7A 3NLBA 3VUGA 4AE9A 4UN0C 4MBLA 4LOPA 3W0QA 3TUCA 2XK7A 3UO6A 1PW2A 4U42A 4C7TA 1GJOA 4YHFA 4DG3E 3LFCA 3DU8A 3VHKA 4EONA 4L6QA 4EH3A 3R1SA 5EM8A 3CGFA 3MFRA 3W0RA 4GMYA 4IB0A 5ANGA 4O0XA 4EOLA 2UZLA 3VC4A 4XHKB 4ANLA 3JPVA 3KKVA 2ETRA 4YJQA 2ZM1A 4RWJA 3O17A 4MTAA 4ZTQA 1QMZA 2PSQA 4KIPA 4BDJA 3TZ9A 4DGGA 1YDTE 4KIOA 4I23A 3R9HA 4QMPA 1H28A 4MD7E 2P2IA 3BBTB 1PKDA 4DYMA 4FT0A 3LM0A 4O0TA 4QNAA 2XYNA 1AQ1A 1FVRA 1IAHA 3KRJA 4FV1A 2A4LA 4YLJA 4Q9ZA 3ZFYA 3BV3A 3RPYA 5JN2A 5DRDA 5HNBA 2B53A 3TUBA 4YNOA 4S31A 3S2PA 3LJ1A 3R30A 1ZARA 1G8JA 3GC0A 4D4VA 5JFSA 4FKWA 2OO8X 3TV4A 4XG4A 3TNHA 4IAYA 1F3MC 3PTGA 3MJ2A 2BALA 4FK3A 4AQKA 1W83A 3C4WA 2H8HA 2ZAZA 4HNIA 2I0HA 3DXQA 1WBOA 3ORPA 3VN9A 4EH2A 5IA3A 3COKA 1DAWA 1R1WA 3QU0A 3AC1A 4GU6A 4UALA 4F7JA 2W5BA 3MVLA 4GK2A 2I0VA 5C03A 4IVBA 5C8KA 4BCIA 2VGOA 4U3ZA 4JLCA 4PL3A 5FDXA 1W0XC 3IS5A 4ZSLA 2IW9A 3ELJA 3GNIB 3V8SA 3ZUUA 4XP0A 3TIYA 4AXCA 4YZ9A 3KXXA 2PVMA 4HGSA 1H1WA 3R8MA 2J2IB 5IUGA 3FMEA 5J87A 4DEEA 4YZNA 3BZ3A 4FMQA 3MFSA 3WE8A 1XH9A 2ZVAA 4RFZA 4ANMA 2VWBA 3Q2JA 4RVKA 1UU3A 2BMCA 2HW7A 4TYEA 3ROYA 4EOIA 5DIAA 3FMHA 4O7TA 4A9YA 5KBRA 4C36A 2W1HA 2XKEA 3ZMMA 5CU2A 3FZOA 2WQNA 2UUEA 3D2KA 3H30A 2XALA 5CT0A 4Y72A 3QZGA 4U40A 5FUTA 3WYXA 3P4KA 4YTCA 2IZRA 3BQRA 3EQPA 1JPAA 3FZ1A 2X7OA 4CFNA 5GHVA 3QTRA 5KMKA 2I6LA 3AC2A 3S3IA 3SXFA 1U4DA 5HVYA 2JIVA 5C8MA 3V3VA 2BFXA 2O0UA 5AP6A 4TRLA 2PVRA 4WZYA 4LOOA 1ZZLA 2FGIA 4FJVA 4A4LA 4MXCA 3TTIA 4BDIA 5HZNA 4BGGA 4UZHA 4OW8A 3HV3A 3ETAA 3G9LX 4O38A 5AUYA 2YCFA 4GVJA 4J99A 4EBVA 3D5VA 3Q9WA 4XMOA 5ANOA 5TOZA 3HNGA 1JKKA 3V04A 3DQXA 2EB2A 4YJRA 3OOGA 3VRYA 1ND4A 4EK8A 1HOWA 4KKEA 3GQIA 4YHTA 4O84A 3P5KA 2C1BA 4F0FA 1O6YA 1WBVA 3OWPA 4WRGA 4YGAA 4CT1A 4O0SA 2KTYA 1U54A 3E3PA 5AP0A 3LHJA 2CKOA 4YNEA 4B8LA 5B2KA 3OG7A 2RFDA 3C5IA 3QZIA 3WF8A 2X9FA 3DK7A 3QUDA 3ACKA 4C2VA 3E88A 4NM5A 1TFFA 4XJ0A 1U5QA 3VS7A 5K5XA 4O6EA 4LDTA 4RIYA 3IW5A 4D5KA 2HXLA 1H1QA 3MSSA 2O3PA 2ETKA 2YITA 2R0UA 4BCKA 3O50A 1H1RA 5IH4A 1LEWA 5LMKA 4XX9A 4O2ZA 5K9IA 2CN5A 2ITPA 5IQEA 4ACGA 1WBTA 2BHHA 3GCQA 3GU8A 3ORTA 3FI3A 4FTAA 1NXKA 5HX6A 4XBRA 3BHYA 2HZIA 3AMYA 4HOKA 1WAKA 2Y8OA 1J7UA 2GHMA 2JD5A 3RWQA 2C0OA 3CTJA 2Y7JA 3PJ2A 2VWIA 2NP8A 5IDPA 3QX2A 4W8EA 4IDVA 4G1WA 5BX0A 1H0VA 3CEKA 4C35A 2WMXA 3GB2A 4M0YA 4F1MA 3R0TA 4C33A 5LVOA 4UV0A 2P3GX 4AZWA 4AA5A 2W7XA 3ZZWA 4AW1A 4DG2E 3IO7A 3A7IA 3QD4A 4O7ZA 3TYKA 2CHLA 1PJKA 4O0UA 1YHWA 4RWKA 3UE4A 3DDQA 4WA9A 3R9DA 4CGAA 2PMLX 5DN3A 5L2TA 2ITWA 3CJFA 5CVFA 5E1SA 3HLLA 1Q41A 1FVVA 3QQHA 4MKCA 3CD3A 4W4YA 4DFUA 4GH2A 2C6MA 3QD3A 2YHVA 3DFAA 3ZRKA 5I5ZA 3UP2A 4KRCA 4FIHA 5IA2A 2ETMA 4E4MA 2UW7A 5JQ5A 4BR3A 2XIYA 4R78A 4ZZNA 1Q3DA 1MQBA 2RL5A 2WZJA 4LMUA 3CKXA 3FKNA 5DT0A 2VTRA 3ZEWA 4D55A 4D9TA 1YI4A 3KL8A 3R04A 4HYUA 4RIOA 3IDCA 5A9UA 3DJ7A 5CQWA 4LMNA 3MWUA 2WB8A 4BYIA 5HBEA 3OMVA 2YJSA 3ZO2A 2GNIA 3QL8A 5AP4A 2BZIB 3BGQA 4Q5HA 4FSYA 1CM8A 3CSVA 2W9FB 3D94A 5T6KA 2E9OA 3AT4A 4F6WA 1WBNA 2CNUA 2OJGA 4AN2A 2QKRA 3K2LA 3V6SA 3KU2A 4FA2A 2WTIA 2QHMA 4TW9A 3WF5A 4ZMEA 1A9UA 5KMJA 3UZTA 5IQFA 1FPUA 2W17A 5CY3A 1VYZA 2FUMA 3OXTA 2VD5A 4E5AX 3FMNA 4FTKA 3QRUA 4IZYA 3DJ6A 5CF5A 3LM5A 5CEIA 3S1HA 1MRUA 4L68A 4GW8A 4X6RA 3N4TA 4ONAA 4D9UA 4FL1A 4JBQA 2GNHA 3ORNA 4DH3A 2NYAA 1YRPA 5AP3A 2VWXA 4FTCA 4FV8A 2YISA 4YBJA 3TMOA 3U54A 4QPAA 5ETCA 4O7WA 1G8SA 2F7ZE 3HA8A 1PF8A 2XNPA 2BCJA 5ICPA 3GC9A 4APCA 2DYLA 2YDKA 4YSMA 5CSPA 5LWNA 4FG9A 2FSLX 2WKMA 4X0MA 3R9NA 3BLAA 1IG1A 4AF3A 2GHGA 5CEPA 1GIIA 4D1SA 2W5HA 3W2QA 2ZB1A 5EKNA 5CWZA 2VWYA 3TKUA 3N4UA 3PWYA 4CMTA 2BDFA 4U98A 4L3PA 2IPXA 3SOAA 4C4FA 2IO6A 4HCUA 3PSBA 2IVUA 4AX8A 1BKXA 3D5WA 4RVLA 1AD5A 5JFWA 4BDKA 4ACMA 3K54A 1BLXA 5CEMA 4JIKA 1V1KA 4P7EA 5L6WL 1PMEA 2W1FA 3DGKA 3FKLA 3F7WA 3VNTA 2IWIA 4RSSA 2E9VA 3QTIA 2ZV7A 4XP3A 1URWA 4BIEA 3M42A 3FZPA 5AA9A 1YOMA 3OUKA 4L8MA 2REIA 4AUAA 2YZLA 4WNPA 4Z7GA 2C6DA 3OBJA 4EHVA 4C2WA 4O7LA 1APME 3D2IA 2XEYA 2OJ9A 3MY0A 3UDBA 2XBAA 4B4LA 3C4FA 4U43A 2G2IA 4L00A 3H10A 1H0WA 3RM6A 4OTFA 4W8DA 1ST0A 3PIYA 4AGCA 2C5NA 2JFMA 2PVHA 2W1GA 4USFA 3VBXA 4QO9A 3T8OA 1FMOE 4K33A 1PXMA 3VULA 5B2LA 4Z9LA 5BYYA 3KCFA 4WNMA 4R77A 3V01A 5CU4A 3KRLA 3U9NA 3KQ7A 2B52A 3HYHA 4XCUA 4DBNA 4F7NA 2VTPA 4ZZOA 5JRQA 5I9XA 1UNHA 4I92A 3HP2A 3CTQA 4S34A 4L7FA 2FA2A 4TPTA 2X2MA 4G5PA 5DT3A 4EK3A 1Q8YA 1QPDA 2P4IA 1GZ8A 5DEWA 1MP8A 2W06A 3CBLA 5LVNA 4BTKA 4ZLZA 1NVQA 3UOLA 4ARKA 3V5WA 2WIPA 3RPRA 5EHYA 5HORA 2R64A 3C13A 4RLKA 4DEGA 3OW3A 3MV5A 5I9UA 3R8UA 2XNBA 4OT5A 3ORMA 2HWPA 1UU9A 5E9EA 4ZTRA 3LJ0A 1OM1A 1ST4A 5D1JA 1OIYA 2XNMA 1MRYA 2CKPA 3TJDA 4G3EA 2YACA 4QP4A 1S9JA 4KKGA 3UMXA 3UNJA 3EN6A 1FMKA 2R7IA 5BYZA 4CRLA 1PXKA 3ULZA 3B8RA 4XOYA 4M67A 4FTNA 4ZSAA 3UIXA 2XNGA 3W0MA 5IEXA 4TYJA 5EK7A 4FTJA 3LFAA 4QMOA 4FEQA 4GV1A 4N6ZA 5AUVA 3ZLWA 2J7TA 3G9NA 5EM5A 4AACA 3P7CA 4ACCA 3AD6A 4EK6A 2OIQA 4V04A 3GU5A 4DFXE 2XKDA 4BDCA 5EW9A 3CPCA 3FHIA 2Z7SA 5KMIA 4RG0A 3PP1A 4O2PA 2J9MA 1IAJA 1YXTA 3A4PA 2CCIA 3FMMA 5E8VA 3ORZA 3BU6A 4F6UA 3VS2A 3L8SA 4UY9A 5F95A 3LOKA 4KKHA 2HY81 3W0PA 3FQEA 4TNDA 2UV2A 3EH9A 4K0YA 2H6DA 3MVHA 4O91A 3VW6A 3TIZA 2BRBA 3R1YA 4D2RA 4G9CA 1M2RA 4BGHA 1RE8A 4RWIA 3FSFA 4NCTC 4BDFA 2PUIA 2CDZA 3NUYA 4QMTA 4L45A 3HV5A 3OS3A 4C4HA 3QTSA 1STCE 2G01A 3KGAA 5E8TA 3OCBA 4EK4A 2R3RA 2Y9QA 4R6VA 4DH7A 1V0PA 3EIDA 4XV3A 4YUQA 3NAYA 2EXCX 4JBOA 2F7EE 3PY0A 1GAGA 1O6LA 1ZYSA 2GMXA 4FGBA 3RM7A 3LFFA 4QMZA 4AWIA 2GS6A 2RFEA 4JDKA 4AXFA 4EOPA 3O23A 4X3FC 3V8TA 2XBJA 4C62A 3JXWA 4ACHA 4E20A 4S33A 4EJ7A 1PYXA 3RWPA 4UWBA 3UC4A 2X2LA 2P33A 1F5QA 3MH2A 3Q2MA 4DFLA 4NU1A 4JQ8A 4G3DA 2PZRA 4PNKA 2YM3A 3AGLA 2OFUA 4BDGA 4YPDA 4BCNA 2F7XE 3H0ZA 2YWVA 4QOXA 4CNHA 5BUEA 1Y57A 2J0MB 2WQMA 1G5SA 4GEOA 3Q6UA 2ZOQA 3BEGA 3FY2A 3RK5A 1RDQE 2C1AA 2QOIA 3KXGA 4RWLA 4K8AA 3QQLA 4FYOA 3CIKA 3ZLYA 3FI2A 4R7HA 2WQEA 1XO2B 1A48A 4H3PA 5E91A 3LFSA 2GU8A 4CTCA 3SGCA 2CLQA 3W33A 4IWPA 1FQ1B 5HLPA 2I0YA 5AP1A 5CF8A 3HMNA 2DS1A 2XK4A 4IE9A 4WSYA 5HHWA 3S00A 3LCDA 4KINA 4S2ZA 4O0YA 3IECA 1PMNA 2BZHB 2B54A 2X8DA 4D4RA 3NUXA 1CKPA 2P55A 4E93A 4D58A 4F63A 3QAME 3RK7A 3O8PA 1WMKA 4H39A 3BYMA 1OIUA 1B38A 3I7CA 3OOMA 3R1QA 5T68A 4B8MA 3E63A 4FL2A 2VU3A 4MNFA 3DLZA 2E9NA 2VV9A 1ATPE 4MCVA 2XIRA 4R3CA 5DFPA 1QPEA 3F5PA 4KAOA 3PSDA 3G6HA 3CJGA 5D41A 2HAKA 3E5AA 4CFUA 5CAQA 1J1BA 2BUJA 1SYKA 3LQ5A 4LG4A 4LI5A 4EH5A 1J7IA 2OF4A 2YCQA 3R8VA 4E4LA 2XMYA 5KKRC 3FMKA 2BKKA 3BCEA 2X1NA 5DR9A 3RCJA 3U51A 4C3FA 5JKGA 4IX6A 4YJTA 5ANIA 2BPMA 2X8IA 3OWKA 4NW6A 2E9PA 4FK6A 5CXZA 4C4IA 3G90X 3TNQB 3O51A 3AC5A 1ZAOA 4FZAB 2JGZA 4XV1A 2J0JA 2GQSA 5DR6A 3SQQA 2R3NA 4FTLA 2PZPA 3D4QA 2JBOA 4X2NA 4O7SA 3NS9A 4F9WA 3NNUA 4X3FB 1H26A 4J96A 2FSMX 4GK4A 3FJQE 4IACA 3JR1A 4IB3A 4HNFA 1TQIA 3F61A 3FSKA 3UODA 1V0BA 3QD2B 1LP4A 4DN5A 3IGGA 2WTDA 3AC8A 3DZQA 4I5PA 1YDSE 3FLYA 3HZTA 4C34A 3PE2A 2R3JA 2X81A 4JAJA 3OEZA 2QR8A 4JBPA 2DUVA 4BDEA 3TT0A 2BTRA 1KWPA 5ACKA 3RPSA 3U4UA 3MW1A 3QUEA 4AU8A 5M56A 4EKKA 4F9AA 2VO7A 4K1BA 5TF9A 3MIAA 4MXXA 4XG6A 4XG8A 1UU8A 5FRIA 4BC6A 4HPTE 4ZSEA 3FL5A 4BZOA 5KMNA 4DFNA 2YAKA 4QMLA 3NIZA 4C61A 1OKYA 5TR6A 2AC3A 1KE6A 4O7NA 1VYWA 4TKSA 3TJCA 3GBZA 1XBBA 2WHBA 4FT9A 3V51A 1PXIA 2I1MA 4HVGA 5AA8A 5L2WA 4XLVA 2O8YA 3WIGA 4IDTA 3TV7A 4OBOA 4AP7A 2XVDA 3M11A 4KABA 2GNJA 4RJ3A 4IC7A 4ZTNA 4AFEA 5JFXA 3R28A 4G3CA 1P14A 2J6MA 5F1ZA 2X4ZA 5AUXA 3EN9A 3ZU7A 5KHWA 3TZ8A 2BTSA 3UPZA 2ZV2A 4O21A 3BE9A 4ZTSA 1JOWB 4GUBA 2HYYA 2GPHA 2OXXA 2VUWA 3SAYA 3F2AA 3UNZA 2XAMA 3DA6A 3ITZA 2ITZA 1LUFA 3EN7A 3L9PA 4ZS0A 4J8MA 4ASZA 4BBMA 5JMSA 3LFDA 5ACBC 4FG7A 5EI2A 1UA2A 4RA5A 3NSZA 4FV4A 2NNWB 5ETIA 3FWQA 2Y0AA 4FV9A 2R4BA 5L6PA 4MX9A 4NM0A 5KKRB 1Q8TA 2JDRA 4GIIA 4D1XA 2C69A 4F7SA 5LJJA 4I0RA 3CCNA 4FTMA 3QYWA 3NFFB 3ML1A 4J52A 4L43A 5CENA 3I4BA 3VF9A 4DT8A 4W4XA 1XBCA 5KZ0A 5HGIA 5GJFA 4F0GA 5AV3A 4P2KA 3R63A 3Q4ZA 3U55A 1XJDA 3JY9A 4WG4A 5KMOA 4AZSA 5D11A 2WNTA 3ORLA 3THBA 1OECA 4EQUA 5CI7A 5FD2A 3QLFA 2CLXA 4L9IA 3BPRA 4PQNA 1XR1A 1QCFA 3FE3A 4BCOA 4XG7A 2WTJA 5H8BA 3EKKA 4OBPA 4D0WA 2QO2A 4DDGA 3ET7A 3BHUA 2YM5A 3MN3A 4FKUA 4YSJA 3I7BA 4WBBB 3TKIA 3Q5IA 4Q2AA 2HZNA 3W2CA 2G9XA 3ODYX 4M84A 4A4OA 4DHFA 4EOMA 3SX9A 3EL8A 1T46A 2QONA 3O5AA 4MVFA 4EYJA 5CF6A 4RJ6A 3COHA 3EQBA 4TYIA 4EOQA 3FUPA 3QA0A 3LCKA 5HNIX 5M4IA 4DC2A 3CGOA 4ITIA 4RIYB 5HX8A 2BRNA 4WO5A 2CSNA 3UQFA 3BX5A 3NCGA 3PXFA 4C02A 5K4JA 4O96A 5TO8A 3PP0A 2E9UA 3WYYA 2H96A 2W0JA 4K9YA 3LFEA 2BROA 5KMMA 2X0GA 4YJNA 4QT1A 5DLSA 4M97A 3LFNA 3MIYA 3NFGB 2IZUA 3EZRA 4NW5A 4XUFA 2Z60A 3D15A 4E1ZA 5L2SA 4S30A 4D4SA 1RW8A 3QCSA 3GCUA 3QZFA 3BGZA 4M7IA 3R7OA 5CSVA 4P4CA 2CKEA 4GG5A 4EOOA 1UU7A 3BQCA 3OUNB 4G16A 3KB7A 3FYKX 4M0ZA 3FMJA 4FEVA 3EQFA 3C7QA 5IDNA 1B6CB 4BYJA 2BIYA 1PXOA 5ETFA 4XP2A 3QUPA 1GIHA 2BAKA 1ZRZA 3Q4TA 3HUBA 3PPJA 4EZ3A 3TEIA 4NCTA 2BDJA 3Q4UA 1XMLA 3QRKA 3ZONA 4J97A 3RAIA 4F7LA 4LM5A 3FAAA 3ODZX 3UYSA 3CY3A 2Z7LA 3KK8A 4AT3A 3OTUA 4KUJA 2XNEA 2QO7A 3PIXA 2R3HA 2W1ZA 4OBQA 2XARA 4PMMA 5D7AA 2X6DA 3P7AA 4D28A 3MA3A 4DFBA 2PZIA 2JDTA 1G8AA 4X3FA 2WMSA 3UC3A 3ZXTA 3PZHA 2BAJA 4GT5A 4QP8A 3H9FA 2B9FA 5T3QA 4Y5HA 2QI8A 4IH8A 3R7VA 3D14A 3KMWA 4OUCA 1OKVA 1JKLA 4MK0A 3D83A 1KOAA 4L42A 3BYOA 4KIQA 4NT4A 4AOJA 2PPQA 4BI0A 5CALA 3ZFXA 3UG1A 4IX4A 4G6NA 4MWIA 4FR4A 5D12A 3Q96A 4RA4A 3VW8A 2QOLA 3KVWA 1V0OA 2QCSA 1DI8A 4RC3A 2Y4PA 5K5NA 2BZJA 2X9EA 4WBOA 2GFCA 2RGPA 3ID6C 4M13A 5AMNA 5LXMA 4YC6A 4QTCA 4M12A 3QA8A 5DR2A 3RTPA 3QTUA 4ZP5A 3VS0A 4FOCA 4N4SA 3QCXA 4G2FA 3PE1A 4UWYA 5I9WA 3VS3A 4BY9E 2ITYA 3O2MA 3BE2A 1I09A 4DT9A 3N4VA 3FHRA 4DH1A 5M06A 3SVVA 3WE4A 2YZAA 4QP7A 3P79A 2OBJA 5AP7A 4AFJA 2F9GA 3ZH8A 5B0XA 2JAVA 2C68A 4CRSA 2Q0NA 2RIOA 3LKMA 5G6VA 3GCSA 2YA9A 3W10A 1ZXEA 3PXZA 4FUXA 2AUHA 3HEGA 3NW5A 2CNVA 4F65A 2C30A 1H8FA 3GC8A 2R3OA 2B9JA 3C51A 2CPKE 5A3XA 2YDJA 3DXPA 4HJOA 4J71A 2WEVA 3NUAA 4QRCA 2NPQA 5DVRA 2OFVA 3NUNA 2V5QA 5LQFA 3OZ6A 2FSTX 2IZSA 2WTVA 4XLIA 1GIJA 3QQKA 2WO6A 3LE6A 5BMSA 4ORKA 5A6OA 5KX8A 2VX1A 3F69A 4B0GA 2JBPA 4RX5A 5A4CA 3Q9XA 2QLUA 4DHIB 4LYNA 1ZLTA 3PUFC 5FEQA 3KVXA 4TZRA 4Y5QA 4EORA 3ANRA 5HNGA 4Z55A 1K3AA 2XAOA 4L46A 2OH4A 5AIRA 5E90A 4DFYA 2UZUE 5LCJA 4RX9A 2JKQA 4C58A 2X6EA 3MH3A 4ASXA 3F5GA 4J8NA 4LGGA 4R7BA 2XCHA 2Z2WA 3VJNA 3PVUA 1XH5A 4WT6A 3ZC6A 4I21A 4BCMA 2R3LA 2WD1A 4OR5A 4KNBA 3BLRA 3SXRA 3IPHA 2C5VA 2Z7RA 4YTFA 5AUWA 1BI8A 3R6XA 3UIBA 1OPKA 1URCA 1YWRA 1YQJA 4F6SA 1G8KA 5GNKA 3UOKA 1ZY4A 2QKWB 4OTDA 4JG8A 1REKA 4FKTA 4CFVA 3DT1A 4HYSA 5H8EA 4BZDA 3MS9A 5DPVA 4XS2A 3F88A 3WF7A 2ZFYA 3G5DA 5BVEA 2W1CA 3AXWA 4JIAA 3OY3A 4LUEA 3PXQA 4JG6A 2FH9A 4HYHA 3C0GA 2W1IA 5FXQA 2B7AA 5DH3A 3QCYA 2R5TA 3FMDA 4MF1A 4ZMFA 2VX0A 5FG8A 5BQ0A 5CEKA 4F78A 4ZS4A 5F9EA 5JGDA 1Q8ZA 3I60A 1NT2A 2JIUA 3HAMA 2VWUA 4C4EA 3C4CA 5LMBA 3OY1A 3Q9YA 4QDEA 3DFCB 5CX9A 4UB7A 2YEXA 2C47A 3DK6A 3KRWA 5GJDA 2R3FA 5G1XA 4FIIA 2CJMA 3VUIA 4HCTA 4QYGA 5C1QB 3I81A 4BBEA 4HVIA 3HVCA 3IW4A 5DNRA 5EDRA 1Q62A 4O0VA 3BL7A 5DBXA 2PU8A 2XP2A 2QOFA 4RJ7A 4C3PA 3UOHA 3W1FA 4F08A 2PZYA 2YM8A 4XEYA 3GU6A 3SC1A 1FVTA 5IA4A 5M4UA 4QEBA 4NSTA 4B9DA 4UX9A 4FT5A 2FVDA 4C3RA 2YIYA 3F5XA 3ZO1A 3QX4A 1WBPA 2B1PA 4I5HA 4YR8A 5ITAA 5HESA 5HCZA 3U6HA 4KWPA 2OIBA 2KULA 3HA6A 3Q32A 4GS6A 4P5QA 5LWMA 5DRBA 5M44A 4YTIA 1L3RE 3HKOA 2AEGA 5HO7A 2SRCA 2PY3A 4DHZA 2HWOA 2GDOA 5CZHA 2VTHA 2PMIA 5EW3A 2YDIA 4G6OA 3RI1A 2UW3A 3GENA 3DBEA 4M3QA 5GIOE 1CSNA 2GNGA 3V5TA 3PXYA 2EVAA 3VUDA 3R21A 1YHVA 5IMEA 5EQPA 2EUFB 4NKSA 4FVPA 5CNOA 2O65A 5I9YA 1JNKA 3L8VA 4YZMA 2PHKA 1KE8A 3DKFA 5F94A 4EH9A 4RMZA 4YTHA 3VUMA 3W0NA 2OZAB 3AD4A 2VN9A 3BGPA 3OVVA 4JMQA 4XNEA 4GT4A 3NYOA 3FBVA 5KHXA 4WIHA 2J50A 4O6LA 5A4LA 2HCKA 3HL7A 3M1SA 4WUAA 3A61A 2B4SB 4QTDA 3ROCA 1TQPA 4BVUA 5KBQA 2XK6A 4I4EA 1MUOA 2JKKA 3GFEA 4KRDA 4HGLA 5BVFA 3IDBA 4IAIA 4AW5A 3IW6A 2WMVA 3NZ0A 3PJ1A 4PTCA 4BTFA 3BEAA 4NYEA 5AAFA 1M52A 4KBCA 4YURA 4FTOA 1DM2A 4CEGA 2CKQA 1VJYA 4I6LA 3G6GA 5HVKA 4E4XA 3FYJX 4DEAA 3NVMB 2VAGA 3HAVA 2VTNA 5EOLA 5FXRA 1YI6A 2GS2A 5M09A 4FKRA 5E8UA 2UVXA 3RNIA 4RIWB 4NJDA 4O82A 3BBWA 4GYIA 4YP8A 3CKWA 3DQWA 1OZ1A 2ZMDA 3PA3A 2PULA 3TN8A 2W5AA 4AN3A 1BL6A 1XMMA 3F82A 1NVSA 2OG8A 2R0IA 2YN8A 3JVSA 2WQBA 4QP3A 4S32A 3UG2A 3R8PA 2ZB0A 5KCVA 4Z16A 4TWNA 3OFMA 4JT3A 4EI4A 3ZBXA 5AADA 4APPA 4O81A 1NY3A 3VS5A 4GL9A 4IADA 3OXIA 4EL9A 5HBJA 2UZOA 3N51A 3P08A 1ZMUA 1VLRA 4FKJA 2XIKA 3TDWA 3EMGA 4L67A 4NFNA 5JSMA 2X7FA 5FTQA 1OL2A 3AC4A 3LXPA 3W0OA 3U6IA 4JS8A 1SVGA 2IVSA 3D0EA 2RG6A 3QBNA 3PA4A 4NFMA 3HV7A 3VBTA 4F1TA 2OZOA 3DOGA 5FP5A 3F3VA 3MTLA 4QTBA 4U81A 1OIRA 3NGAA 4CLJA 3GEQA 1IR3A 2A0CX 1DI9A 4QNYA 2XA4A 1GOLA 2QOHA 5LVPA 4RC4A 2BILB 4MXYA 3O7LD 4QTAA 4IB5A 4U0IA 5CSXA 2UZTA 2WPAA 3SW4A 5JGBA 2R3PA 4ALWA 4BCGA 2Y4IC 1MQ4A 3ZTXA 5DG5A 2OIDA 3E7VA 3ALOA 3OT8A 2IW6A 5JZJA 5CF4A 1T45A 3OCTA 3WZKA 2V7AA 1U46A 2VTLA 3NYXA 2PK9A 3R83A 2J5EA 3NRMA 2W9ZB 5GIPE 1E1VA 1OIQA 3NIEA 4TY1A 3ULIA 3C9WA 4WD5A 3NNWA 4RFMA 3MPMA 3DZOA 4O7OA 3QALE 5EH0A 3UOJA 3E62A 1KE7A 5ANKA 2XIZA 3AMAA 3LQ8A 4JX3A 2WELA 3EZVA 4Y8DA 5HCYA 3ZFMA 4QPSA 3LXNA 4B7TA 2UW0A 1BL7A 3PY3A 5A4EA 3FKOA 4FSQA 5LVMA 5C27A 3BRBA 4BIDA 2LAVA 2W05A 1FGIA 1Q8UA 2R2PA 3MY1A 2CGUA 2CGXA 3MPAA 3F2RA 4LL0A 3ZHPC 4M68A 1CMKE 3GUBA 5EM7A 3KA0A 3P5JC 4QDVA 5BUJA 5HLNA 1YI3A 4U5JA 5ANDA 5KZIA 4CV8A 4IX3A 5EYMA 5CU6A 2ZYBA 3AKJA 3AQVA 2QG5A 3LFBA 1W82A 4H58A 3AT3A 1BMKA 3LCTA 3LMIA 4DDIA 3KF7A 2R3KA 4ZJJA 1TVOA 3PY1A 2VRXA 4DLJA 3JS2A 2JDVA 4JXFA 5HG8A 3VS4A 3R2BA 3BKBA 2UW8A 5CZIA 4RRVA 2W1DA 4G31A 4UEUA 5AP5A 3TXOA 4E26A 2ACXA 1LPUA 1ZY5A 1WBWA 3TNWA 4CD0A 3KRXA 4FE2A 5A46A 3F6XA 2WQOA 4IIRA 4NKAA 1GNGA 2R3QA 4Y73A 2P2HA 2HW6A 1ZOHA 1H1SA 3VUHA 4BCQA 2B9HA 3LPBA 2R3MA 1CDKA 1CKJA 4FV0A 4BJJB 5IG1A 4CT2A 3PVBA 4JL9A 3E87A 1W7HA 5C4LA 4U9AA 1ZOEA 4U80A 2J0KA 2OW3A 4EC9A 3QKLA 2OZAA 3GI3A 5BVNA 3R7UA 4F0IA 4RBLA 4BDDA 3ERKA 4U41A 2XJ1A 3BLHA 3TDVA 1Y8GA 3WILA 3HGKA 4QP6A 4FNZA 2XCKA 5DWRA 3HV6A 3LW0A 2ITNA