4DUHA

Crystal structure of 24 kda domain of e. coli dna gyrase b in complex with small molecule inhibitor
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
203
structure length
195
Chain Sequence
GLDAVRKRPGMYIGDTDDGTGLHHMVFEVVDNAIDEALAGHCKEIIVTIHADNSVSVQDDGRGIPTGIHPEEGVSAAEVIMTVLHAGGKFDDNSGVGVSVVNALSQKLELVIQREGKIHRQIYEHGVPQAPLAVTGETEKTGTMVRFWPSLETFTNVTEFEYEILAKRLRELSFLNSGVSIRLRDKRDGKEDHFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based discovery of substituted 4,5'-bithiazoles as novel DNA gyrase inhibitors.
pubmed doi rcsb
molecule keywords DNA gyrase subunit B
molecule tags Isomerase/isomerase inhibitor
source organism Escherichia coli
total genus 56
structure length 195
sequence length 203
chains with identical sequence B
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4duhA00
2XJJA 4GFNA 1TH8A 4AWOA 1QY8A 4LWIA 4XTJA 1THNA 2YK2A 2VCJA 3H80A 1YT0A 1UYLA 4MPNA 4U7NA 4UROA 4BAEA 1YC1A 2BSMA 2WI2A 1PVGA 4W7TA 1I5DA 4URNA 2YI7A 3H4LA 3R4MA 3TZ5A 1MX0A 3OWBA 4HZ5A 1TC6A 4EMVA 2UWDA 3K60A 3QDDA 2YEEA 1GKXA 2WI5A 5M4NA 1YERA 4EFUA 2QFOA 1Y8OA 4GQTA 4QPJA 3O0IA 4XCLA 3G75A 3R4NA 4XC0A 3EHFA 4XKKA 4EM7A 5M4PA 2GQPA 2YEFA 5FNFA 1YT1A 3VHAA 3B25A 4KP4A 3HYZA 4AS9A 1Z5CA 2XJGA 5C93A 4PL9A 1UY7A 4LWFA 1US7A 3EHGA 2Q8HA 3HYYA 3RLQA 1Z5BA 2XDXA 4MB9A 4BXIA 4ZVIA 4BQJA 2WEPA 1UYDA 1MU5A 2GFDA 5F5RA 5IDJA 3QTFA 3EKRA 2WI6A 3HZ5A 4LWGA 2IORA 2BU8A 3TZ4A 4HXWA 4URMA 4MBCA 4E00A 3C11A 3G7BA 4AWPA 1YSZA 1I5CA 4O07A 1UYGA 3A0YA 4R3MA 4CWRA 1NHIA 4JAUA 1S16A 2FWZA 1TC0A 3K99A 2XHTA 4L91A 1TIDA 3HZ1A 3INXA 1KZNA 2XX4A 5IN9A 5M4EA 2YE3A 3B24A 3PEHA 3TZ2A 1Z5AA 4FCPA 2YGEA 2K5BA 3IEDA 2YE4A 2H55A 3VHDA 1ID0A 2BREA 3PEJA 3GIEA 3O6OA 4O05A 4FCQA 1AH8A 1BGQA 4FMTA 4PRXA 3T0HA 2JJCA 2YKBA 2WEQA 4JAVA 1AM1A 2YEDA 4DUHA 2XK2A 4YKXA 2WI4A 2XABA 5F3KA 4XITA 2BYIA 4BQGA 1NHJA 3GIGB 4CWNA 2YI6A 4CE2A 2YKCA 5D7RA 4KSHA 2AKPA 1NHHA 1S14A 1YC3A 2ZBKB 1R62A 4CWFA 1UYKA 2BZ5A 4FCRA 5FNCA 2XDUA 2XCMA 4WUBA 1L0OA 3Q5LA 1AJ6A 1ZXMA 2BT0A 1QYEA 3JZ3A 3ZKDA 1ZW9A 2YE2A 4ZKIA 4CE1A 2CG9A 3B26A 4XD8A 2XDKA 4L93A 5CTYA 4YKRA 4K4OA 1B62A 1UY8A 2YEJA 4YKTA 1UYIA 4LP0A 5BODA 2VWCA 3TZ0A 4EEHA 2BTZA 2C2AA 4Q20A 3ZXQA 2XD6A 2XHXA 2YE6A 3A0RA 2YJWA 2IOPA 3GIFA 2YE9A 4I3HA 2QF6A 4E02A 3A0TA 4LWHA 2FWYA 2BU5A 1I58A 3DGEA 4L90A 2YK9A 4YKQA 5D6PA 2YE7A 1UY9A 3HHUA 4NH8A 4CWTA 3R4PA 2YGAA 2ZDXA 2O1VA 4I5SA 4HZ0A 3FV5A 3LPSA 3T10A 4MP2A 4NH9A 5CTWA 4O09A 2FYPA 4CWOA 4R3AA 3MNRP 4EFTA 1AMWA 4O04A 2YECA 3OPDA 3GIGA 3EKOA 3O2FA 2O1WA 4GCZA 3CWVA 3INWA 2BU7A 1I5BA 4MPEA 2HG1A 4H85A 1UYCA 4KQVA 3A0WA 4EGIA 1ZXNA 4XIRA 4XKAA 2EXLA 1YT2A 3U2KA 4ASGA 4FPPA 2YJXA 3RLRA 4CWQA 2VCIA 3D0BA 1GJVA 4PRVA 2VW5A 5FNDA 3ZXOA 4CE3A 1BYQA 1Y8PA 2CCTA 4YKZA 1BKNA 1UYHA 2PNRA 1TILA 1UYFA 2QG2A 2XJXA 2YEBA 4HY1A 3T1KA 1YSRA 4EGKA 4P7AA 4KTNA 5BOCA 2BU6A 2XX5A 3BMYA 2YE8A 2Q8FA 2HKJA 2WI1A 3R4OA 1UYMA 2Q2EB 2QG0A 2YGFA 3R91A 4KFGA 3Q5KA 3BM9A 4H7QA 4DZYA 3TUHA 4O0BA 2JKIA 3T2SA 2WERA 4ASAA 3A0ZA 3D2RA 4GEEA 1Y4SA 3R92A 4MP7A 4L8ZA 4ASFA 4CWSA 4HYPA 4GT8A 4U93A 3CRKA 3Q5JA 2YEIA 2CCSA 4HY6A 3CRLA 1KIJA 4PU9A 4XKOA 5D7DA 5FWKA 2IWXA 2YEGA 1QZRA 2CH4A 2O1UA 2Q8GA 4B7PA 3A0XA 5D6QA 4YKYA 3FT8A 3B27A 3KE6A 1AH6A 2ESAA 4JQLA 2IWUA 2BRCA 3G7EA 3C0EA 1I5AA 5CTUA 1TBWA 5L3JA 2YE5A 4GGLA 2IOQA 1UY6A 3VHCA 2XDLA 2ZKJA 4WUCA 3D36A 2YKJA 5D7CA 2XDSA 3B28A 1A4HA 2YI0A 3U2DA 2Q8IA 2ZDYA 2WI7A 4HXZA 4KSGA 4P8OA 1H7UA 4WUDA 1U0ZA 2E0AA 2YI5A 4V25A 4CWPA 5GGZA 1Y8NA 4E01A 3NMQA 4R1FA 1B3QA 1Z59A 4XIQA 2BYHA 5CPHA 4BIUA 2XHRA 1U2OA 5IDMA 3CGZA 3RLPA 4X9LA 4MOTA 3OWDA 3LNUA 1Y4UA 2YEAA 4U7OA 4XDMA 2CCUA 1YS3A 3K97A 3HEKA 4HYMA 1YC4A 3K98A 4BIZA 4V26A 1OSFA 2IWSA 4L94A 1YETA 5M4KA 2XX2A 1JM6A 2H8MA 4YKWA 3FT5A 4LPBA 3OMUA 4XE2A 3SL2A 3T0ZA 2YEHA 4MPCA 2YKEA 3CGYA 1I59A 5M4MA 3TTZA 3U67A 3ZKBA 4JASA 4XCJA 3WQ9A 4H81A 1GKZA 4YKUA 2YKIA 1UYEA 2CGFA 4ASBA 3OW6A 4URLA 5CTXA 3RKZA 1B63A 1ZWHA 4EGHA 4NH7A 1EA6A 2WI3A 3EHHA 2HCHA 4LWEA 5CF0A 5J71A 1YESA 2FXSA 3ZM7A 1EI1A 2BU2A 1BXDA 1H7SA 3VADA 3WHAA 4AWQA 3EHJA 5J6AA 4B6CA 4XIPA 5M4HA 4QPKA
chains in the Genus database with same CATH superfamily
2XJJA 4GFNA 1TH8A 4AWOA 1QY8A 4LWIA 4XTJA 1THNA 2YK2A 2VCJA 3H80A 1YT0A 1UYLA 4MPNA 4U7NA 4UROA 4BAEA 1YC1A 2BSMA 2WI2A 1PVGA 4W7TA 1I5DA 4URNA 2YI7A 3H4LA 3R4MA 3TZ5A 1MX0A 3OWBA 4HZ5A 1TC6A 4EMVA 2UWDA 3K60A 3QDDA 2YEEA 1GKXA 2WI5A 5M4NA 1YERA 4EFUA 2QFOA 1Y8OA 4GQTA 4QPJA 3O0IA 4XCLA 3G75A 3R4NA 4XC0A 3EHFA 4XKKA 4EM7A 5M4PA 2GQPA 2YEFA 5FNFA 1YT1A 3VHAA 3B25A 4KP4A 3HYZA 4AS9A 1Z5CA 2XJGA 5C93A 4PL9A 1UY7A 4LWFA 1US7A 3EHGA 2Q8HA 3HYYA 3RLQA 1Z5BA 2XDXA 4MB9A 4BXIA 4ZVIA 4BQJA 2WEPA 1UYDA 1MU5A 2GFDA 5F5RA 5IDJA 3QTFA 3EKRA 2WI6A 3HZ5A 4LWGA 2IORA 2BU8A 3TZ4A 4HXWA 4URMA 4MBCA 4E00A 1IXMA 3C11A 3G7BA 4AWPA 1YSZA 1I5CA 4O07A 1UYGA 3A0YA 4R3MA 4CWRA 1NHIA 4JAUA 1S16A 2FWZA 1TC0A 3K99A 2XHTA 4L91A 5JENA 1TIDA 3HZ1A 3INXA 1KZNA 2XX4A 5IN9A 5M4EA 2YE3A 3B24A 3PEHA 3LMMA 3CYGA 3TZ2A 1Z5AA 4FCPA 2YGEA 2K5BA 3IEDA 2YE4A 2H55A 3VHDA 1ID0A 2BREA 3PEJA 3GIEA 3O6OA 4O05A 4FCQA 1AH8A 1BGQA 4FMTA 4PRXA 3T0HA 2JJCA 2YKBA 2WEQA 4JAVA 1AM1A 2YEDA 4DUHA 2XK2A 4YKXA 2WI4A 2XABA 5F3KA 4XITA 2BYIA 4BQGA 1NHJA 3GIGB 4CWNA 2YI6A 4CE2A 2YKCA 5D7RA 4KSHA 2C1GA 2AKPA 1NHHA 1S14A 1YC3A 2ZBKB 1R62A 4CWFA 1UYKA 2BZ5A 4FCRA 5FNCA 2XDUA 2XCMA 4WUBA 1L0OA 3Q5LA 1AJ6A 1ZXMA 2BT0A 1F51A 1QYEA 3JZ3A 3ZKDA 1ZW9A 2YE2A 4ZKIA 4CE1A 2CG9A 3B26A 4XD8A 2XDKA 4L93A 5CTYA 4YKRA 4K4OA 1B62A 1UY8A 2YEJA 4YKTA 1UYIA 4LP0A 5BODA 2VWCA 3TZ0A 4EEHA 2BTZA 2C2AA 4Q20A 3ZXQA 2XD6A 2XHXA 2YE6A 3A0RA 2YJWA 2IOPA 3GIFA 2YE9A 4I3HA 2QF6A 4E02A 3A0TA 4LWHA 2FWYA 2BU5A 1I58A 3DGEA 4L90A 2YK9A 4YKQA 5D6PA 2YE7A 1UY9A 3HHUA 4NH8A 4CWTA 3R4PA 2YGAA 2ZDXA 2O1VA 4I5SA 4HZ0A 3FV5A 3LPSA 3T10A 4MP2A 4NH9A 5CTWA 4O09A 2FYPA 4CWOA 4R3AA 3MNRP 4EFTA 1AMWA 4O04A 2YECA 3OPDA 3GIGA 3EKOA 3O2FA 2O1WA 4GCZA 3CWVA 3INWA 2BU7A 1I5BA 4MPEA 2HG1A 4H85A 1UYCA 4KQVA 3A0WA 4EGIA 1ZXNA 4XIRA 4XKAA 2EXLA 1YT2A 3U2KA 4ASGA 4FPPA 2YJXA 3RLRA 4CWQA 2VCIA 3D0BA 1GJVA 4PRVA 2VW5A 5FNDA 3ZXOA 4CE3A 1BYQA 1Y8PA 2CCTA 4YKZA 3S5TA 1BKNA 1UYHA 2PNRA 1TILA 1UYFA 2QG2A 2XJXA 2YEBA 4HY1A 3T1KA 1YSRA 4EGKA 4P7AA 4KTNA 5BOCA 2BU6A 2XX5A 2HHIA 3BMYA 2YE8A 2Q8FA 2HKJA 2WI1A 3R4OA 1UYMA 2Q2EB 2QG0A 2YGFA 3R91A 4KFGA 3Q5KA 3BM9A 4H7QA 4DZYA 3TUHA 4O0BA 2JKIA 3T2SA 2WERA 4ASAA 3A0ZA 3D2RA 4GEEA 1Y4SA 3R92A 4MP7A 4L8ZA 4ASFA 4CWSA 4HYPA 4GT8A 4U93A 3CRKA 3Q5JA 2YEIA 2CCSA 4HY6A 3CRLA 1KIJA 4PU9A 4XKOA 5D7DA 5FWKA 2IWXA 2YEGA 1QZRA 2CH4A 2O1UA 2Q8GA 4B7PA 3A0XA 5D6QA 4YKYA 3FT8A 3B27A 3KE6A 1AH6A 2ESAA 4JQLA 2IWUA 2BRCA 4E72A 3G7EA 3C0EA 1I5AA 5CTUA 1TBWA 5L3JA 2YE5A 2C1IA 4GGLA 2IOQA 1UY6A 3VHCA 2XDLA 2ZKJA 4WUCA 3D36A 2YKJA 5D7CA 2XDSA 3B28A 1A4HA 2YI0A 3U2DA 2Q8IA 2ZDYA 2WI7A 4HXZA 4KSGA 4P8OA 1H7UA 4WUDA 1U0ZA 2E0AA 2YI5A 4V25A 4CWPA 5GGZA 1Y8NA 4E01A 3NMQA 4R1FA 1B3QA 1Z59A 4XIQA 2BYHA 5CPHA 4BIUA 2XHRA 1U2OA 5IDMA 3CGZA 3RLPA 4X9LA 4MOTA 3OWDA 3LNUA 1Y4UA 2YEAA 4U7OA 4XDMA 2CCUA 1YS3A 3K97A 3HEKA 4HYMA 1YC4A 3K98A 4BIZA 4V26A 1OSFA 2IWSA 4L94A 1YETA 5M4KA 2XX2A 1JM6A 2H8MA 4YKWA 3FT5A 4LPBA 3OMUA 4XE2A 3SL2A 3T0ZA 2YEHA 4MPCA 2YKEA 3CGYA 1I59A 5M4MA 3TTZA 3U67A 3ZKBA 4JASA 4XCJA 3WQ9A 4H81A 1GKZA 4YKUA 2YKIA 1UYEA 2CGFA 4ASBA 3OW6A 4URLA 5CTXA 3RKZA 1B63A 1ZWHA 4EGHA 4NH7A 1EA6A 2WI3A 3EHHA 2HCHA 4LWEA 5CF0A 5J71A 1YESA 2FXSA 3ZM7A 1EI1A 2BU2A 2FTKA 1BXDA 1H7SA 3VADA 3WHAA 4AWQA 3EHJA 5J6AA 4B6CA 4XIPA 5M4HA 4QPKA
chains in the Genus database with same CATH topology
2XJJA 4GFNA 1TH8A 4AWOA 1QY8A 4LWIA 4XTJA 1THNA 2YK2A 2VCJA 3H80A 1YT0A 1UYLA 4MPNA 4U7NA 4UROA 4BAEA 1YC1A 2BSMA 2WI2A 1PVGA 4W7TA 1I5DA 4URNA 2YI7A 3H4LA 3R4MA 3TZ5A 1MX0A 3OWBA 4HZ5A 1TC6A 4EMVA 2UWDA 3K60A 3QDDA 2YEEA 1GKXA 2WI5A 5M4NA 1YERA 4EFUA 2QFOA 1Y8OA 4GQTA 4QPJA 3O0IA 4XCLA 3G75A 3R4NA 4XC0A 3EHFA 4XKKA 4EM7A 5M4PA 2GQPA 2YEFA 5FNFA 1YT1A 3VHAA 3B25A 4KP4A 3HYZA 4AS9A 1Z5CA 2XJGA 5C93A 4PL9A 1UY7A 4LWFA 1US7A 3EHGA 2Q8HA 3HYYA 3RLQA 1Z5BA 2XDXA 4MB9A 4BXIA 4ZVIA 4BQJA 2WEPA 1UYDA 1MU5A 2GFDA 5F5RA 5IDJA 3QTFA 3EKRA 2WI6A 3HZ5A 4LWGA 2IORA 2BU8A 3TZ4A 4HXWA 4URMA 4MBCA 4E00A 3C11A 3G7BA 4AWPA 1YSZA 1I5CA 4O07A 1UYGA 3A0YA 4R3MA 4CWRA 1NHIA 4JAUA 1S16A 2FWZA 1TC0A 3K99A 2XHTA 4L91A 1TIDA 3HZ1A 3INXA 1KZNA 2XX4A 5IN9A 5M4EA 2YE3A 3B24A 3PEHA 3TZ2A 1Z5AA 4FCPA 2YGEA 2K5BA 3IEDA 2YE4A 2H55A 3VHDA 1ID0A 2BREA 3PEJA 3GIEA 3O6OA 4O05A 4FCQA 1AH8A 1BGQA 4FMTA 4PRXA 3T0HA 2JJCA 2YKBA 2WEQA 4JAVA 1AM1A 2YEDA 4DUHA 2XK2A 4YKXA 2WI4A 2XABA 5F3KA 4XITA 2BYIA 4BQGA 1NHJA 3GIGB 4CWNA 2YI6A 4CE2A 2YKCA 5D7RA 4KSHA 2AKPA 1NHHA 1S14A 1YC3A 2ZBKB 1R62A 4CWFA 1UYKA 2BZ5A 4FCRA 5FNCA 2XDUA 2XCMA 4WUBA 1L0OA 3Q5LA 1AJ6A 1ZXMA 2BT0A 1QYEA 3JZ3A 3ZKDA 1ZW9A 2YE2A 4ZKIA 4CE1A 2CG9A 3B26A 4XD8A 2XDKA 4L93A 5CTYA 4YKRA 4K4OA 1B62A 1UY8A 2YEJA 4YKTA 1UYIA 4LP0A 5BODA 2VWCA 3TZ0A 4EEHA 2BTZA 2C2AA 4Q20A 3ZXQA 2XD6A 2XHXA 2YE6A 3A0RA 2YJWA 2IOPA 3GIFA 2YE9A 4I3HA 2QF6A 4E02A 3A0TA 4LWHA 2FWYA 2BU5A 1I58A 3DGEA 4L90A 2YK9A 4YKQA 5D6PA 2YE7A 1UY9A 3HHUA 4NH8A 4CWTA 3R4PA 2YGAA 2ZDXA 2O1VA 4I5SA 4HZ0A 3FV5A 3LPSA 3T10A 4MP2A 4NH9A 5CTWA 4O09A 2FYPA 4CWOA 4R3AA 3MNRP 4EFTA 1AMWA 4O04A 2YECA 3OPDA 3GIGA 3EKOA 3O2FA 2O1WA 4GCZA 3CWVA 3INWA 2BU7A 1I5BA 4MPEA 2HG1A 4H85A 1UYCA 4KQVA 3A0WA 4EGIA 1ZXNA 4XIRA 4XKAA 2EXLA 1YT2A 3U2KA 4ASGA 4FPPA 2YJXA 3RLRA 4CWQA 2VCIA 3D0BA 1GJVA 4PRVA 2VW5A 5FNDA 3ZXOA 4CE3A 1BYQA 1Y8PA 2CCTA 4YKZA 1BKNA 1UYHA 2PNRA 1TILA 1UYFA 2QG2A 2XJXA 2YEBA 4HY1A 3T1KA 1YSRA 4EGKA 4P7AA 4KTNA 5BOCA 2BU6A 2XX5A 3BMYA 2YE8A 2Q8FA 2HKJA 2WI1A 3R4OA 1UYMA 2Q2EB 2QG0A 2YGFA 3R91A 4KFGA 3Q5KA 3BM9A 4H7QA 4DZYA 3TUHA 4O0BA 2JKIA 3T2SA 2WERA 4ASAA 3A0ZA 3D2RA 4GEEA 1Y4SA 3R92A 4MP7A 4L8ZA 4ASFA 4CWSA 4HYPA 4GT8A 4U93A 3CRKA 3Q5JA 2YEIA 2CCSA 4HY6A 3CRLA 1KIJA 4PU9A 4XKOA 5D7DA 5FWKA 2IWXA 2YEGA 1QZRA 2CH4A 2O1UA 2Q8GA 4B7PA 3A0XA 5D6QA 4YKYA 3FT8A 3B27A 3KE6A 1AH6A 2ESAA 4JQLA 2IWUA 2BRCA 3G7EA 3C0EA 1I5AA 5CTUA 1TBWA 5L3JA 2YE5A 4GGLA 2IOQA 1UY6A 3VHCA 2XDLA 2ZKJA 4WUCA 3D36A 2YKJA 5D7CA 2XDSA 3B28A 1A4HA 2YI0A 3U2DA 2Q8IA 2ZDYA 2WI7A 4HXZA 4KSGA 4P8OA 1H7UA 4WUDA 1U0ZA 2E0AA 2YI5A 4V25A 4CWPA 5GGZA 1Y8NA 4E01A 3NMQA 4R1FA 1B3QA 1Z59A 4XIQA 2BYHA 5CPHA 4BIUA 2XHRA 1U2OA 5IDMA 3CGZA 3RLPA 4X9LA 4MOTA 3OWDA 3LNUA 1Y4UA 2YEAA 4U7OA 4XDMA 2CCUA 1YS3A 3K97A 3HEKA 4HYMA 1YC4A 3K98A 4BIZA 4V26A 1OSFA 2IWSA 4L94A 1YETA 5M4KA 2XX2A 1JM6A 2H8MA 4YKWA 3FT5A 4LPBA 3OMUA 4XE2A 3SL2A 3T0ZA 2YEHA 4MPCA 2YKEA 3CGYA 1I59A 5M4MA 3TTZA 3U67A 3ZKBA 4JASA 4XCJA 3WQ9A 4H81A 1GKZA 4YKUA 2YKIA 1UYEA 2CGFA 4ASBA 3OW6A 4URLA 5CTXA 3RKZA 1B63A 1ZWHA 4EGHA 4NH7A 1EA6A 2WI3A 3EHHA 2HCHA 4LWEA 5CF0A 5J71A 1YESA 2FXSA 3ZM7A 1EI1A 2BU2A 1BXDA 1H7SA 3VADA 3WHAA 4AWQA 3EHJA 5J6AA 4B6CA 4XIPA 5M4HA 4QPKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XJJ A;  4GFN A;  1TH8 A;  4AWO A;  1QY8 A;  4LWI A;  4XTJ A;  1THN A;  2YK2 A;  2VCJ A;  3H80 A;  1YT0 A;  1UYL A;  4MPN A;  4U7N A;  4URO A;  4BAE A;  1YC1 A;  2BSM A;  2WI2 A;  1PVG A;  4W7T A;  1I5D A;  4URN A;  2YI7 A;  3H4L A;  3R4M A;  3TZ5 A;  1MX0 A;  3OWB A;  4HZ5 A;  1TC6 A;  4EMV A;  2UWD A;  3K60 A;  3QDD A;  2YEE A;  1GKX A;  2WI5 A;  5M4N A;  1YER A;  4EFU A;  2QFO A;  1Y8O A;  4GQT A;  4QPJ A;  3O0I A;  4XCL A;  3G75 A;  3R4N A;  4XC0 A;  3EHF A;  4XKK A;  4EM7 A;  5M4P A;  2GQP A;  2YEF A;  5FNF A;  1YT1 A;  3VHA A;  3B25 A;  4KP4 A;  3HYZ A;  4AS9 A;  1Z5C A;  2XJG A;  5C93 A;  4PL9 A;  1UY7 A;  4LWF A;  1US7 A;  3EHG A;  2Q8H A;  3HYY A;  3RLQ A;  1Z5B A;  2XDX A;  4MB9 A;  4BXI A;  4ZVI A;  4BQJ A;  2WEP A;  1UYD A;  1MU5 A;  2GFD A;  5F5R A;  5IDJ A;  3QTF A;  3EKR A;  2WI6 A;  3HZ5 A;  4LWG A;  2IOR A;  2BU8 A;  3TZ4 A;  4HXW A;  4URM A;  4MBC A;  4E00 A;  3C11 A;  3G7B A;  4AWP A;  1YSZ A;  1I5C A;  4O07 A;  1UYG A;  3A0Y A;  4R3M A;  4CWR A;  1NHI A;  4JAU A;  1S16 A;  2FWZ A;  1TC0 A;  3K99 A;  2XHT A;  4L91 A;  1TID A;  3HZ1 A;  3INX A;  1KZN A;  2XX4 A;  5IN9 A;  5M4E A;  2YE3 A;  3B24 A;  3PEH A;  3TZ2 A;  1Z5A A;  4FCP A;  2YGE A;  2K5B A;  3IED A;  2YE4 A;  2H55 A;  3VHD A;  1ID0 A;  2BRE A;  3PEJ A;  3GIE A;  3O6O A;  4O05 A;  4FCQ A;  1AH8 A;  1BGQ A;  4FMT A;  4PRX A;  3T0H A;  2JJC A;  2YKB A;  2WEQ A;  4JAV A;  1AM1 A;  2YED A;  4DUH A;  2XK2 A;  4YKX A;  2WI4 A;  2XAB A;  5F3K A;  4XIT A;  2BYI A;  4BQG A;  1NHJ A;  3GIG B;  4CWN A;  2YI6 A;  4CE2 A;  2YKC A;  5D7R A;  4KSH A;  2AKP A;  1NHH A;  1S14 A;  1YC3 A;  2ZBK B;  1R62 A;  4CWF A;  1UYK A;  2BZ5 A;  4FCR A;  5FNC A;  2XDU A;  2XCM A;  4WUB A;  1L0O A;  3Q5L A;  1AJ6 A;  1ZXM A;  2BT0 A;  1QYE A;  3JZ3 A;  3ZKD A;  1ZW9 A;  2YE2 A;  4ZKI A;  4CE1 A;  2CG9 A;  3B26 A;  4XD8 A;  2XDK A;  4L93 A;  5CTY A;  4YKR A;  4K4O A;  1B62 A;  1UY8 A;  2YEJ A;  4YKT A;  1UYI A;  4LP0 A;  5BOD A;  2VWC A;  3TZ0 A;  4EEH A;  2BTZ A;  2C2A A;  4Q20 A;  3ZXQ A;  2XD6 A;  2XHX A;  2YE6 A;  3A0R A;  2YJW A;  2IOP A;  3GIF A;  2YE9 A;  4I3H A;  2QF6 A;  4E02 A;  3A0T A;  4LWH A;  2FWY A;  2BU5 A;  1I58 A;  3DGE A;  4L90 A;  2YK9 A;  4YKQ A;  5D6P A;  2YE7 A;  1UY9 A;  3HHU A;  4NH8 A;  4CWT A;  3R4P A;  2YGA A;  2ZDX A;  2O1V A;  4I5S A;  4HZ0 A;  3FV5 A;  3LPS A;  3T10 A;  4MP2 A;  4NH9 A;  5CTW A;  4O09 A;  2FYP A;  4CWO A;  4R3A A;  3MNR P;  4EFT A;  1AMW A;  4O04 A;  2YEC A;  3OPD A;  3GIG A;  3EKO A;  3O2F A;  2O1W A;  4GCZ A;  3CWV A;  3INW A;  2BU7 A;  1I5B A;  4MPE A;  2HG1 A;  4H85 A;  1UYC A;  4KQV A;  3A0W A;  4EGI A;  1ZXN A;  4XIR A;  4XKA A;  2EXL A;  1YT2 A;  3U2K A;  4ASG A;  4FPP A;  2YJX A;  3RLR A;  4CWQ A;  2VCI A;  3D0B A;  1GJV A;  4PRV A;  2VW5 A;  5FND A;  3ZXO A;  4CE3 A;  1BYQ A;  1Y8P A;  2CCT A;  4YKZ A;  1BKN A;  1UYH A;  2PNR A;  1TIL A;  1UYF A;  2QG2 A;  2XJX A;  2YEB A;  4HY1 A;  3T1K A;  1YSR A;  4EGK A;  4P7A A;  4KTN A;  5BOC A;  2BU6 A;  2XX5 A;  3BMY A;  2YE8 A;  2Q8F A;  2HKJ A;  2WI1 A;  3R4O A;  1UYM A;  2Q2E B;  2QG0 A;  2YGF A;  3R91 A;  4KFG A;  3Q5K A;  3BM9 A;  4H7Q A;  4DZY A;  3TUH A;  4O0B A;  2JKI A;  3T2S A;  2WER A;  4ASA A;  3A0Z A;  3D2R A;  4GEE A;  1Y4S A;  3R92 A;  4MP7 A;  4L8Z A;  4ASF A;  4CWS A;  4HYP A;  4GT8 A;  4U93 A;  3CRK A;  3Q5J A;  2YEI A;  2CCS A;  4HY6 A;  3CRL A;  1KIJ A;  4PU9 A;  4XKO A;  5D7D A;  5FWK A;  2IWX A;  2YEG A;  1QZR A;  2CH4 A;  2O1U A;  2Q8G A;  4B7P A;  3A0X A;  5D6Q A;  4YKY A;  3FT8 A;  3B27 A;  3KE6 A;  1AH6 A;  2ESA A;  4JQL A;  2IWU A;  2BRC A;  3G7E A;  3C0E A;  1I5A A;  5CTU A;  1TBW A;  5L3J A;  2YE5 A;  4GGL A;  2IOQ A;  1UY6 A;  3VHC A;  2XDL A;  2ZKJ A;  4WUC A;  3D36 A;  2YKJ A;  5D7C A;  2XDS A;  3B28 A;  1A4H A;  2YI0 A;  3U2D A;  2Q8I A;  2ZDY A;  2WI7 A;  4HXZ A;  4KSG A;  4P8O A;  1H7U A;  4WUD A;  1U0Z A;  2E0A A;  2YI5 A;  4V25 A;  4CWP A;  5GGZ A;  1Y8N A;  4E01 A;  3NMQ A;  4R1F A;  1B3Q A;  1Z59 A;  4XIQ A;  2BYH A;  5CPH A;  4BIU A;  2XHR A;  1U2O A;  5IDM A;  3CGZ A;  3RLP A;  4X9L A;  4MOT A;  3OWD A;  3LNU A;  1Y4U A;  2YEA A;  4U7O A;  4XDM A;  2CCU A;  1YS3 A;  3K97 A;  3HEK A;  4HYM A;  1YC4 A;  3K98 A;  4BIZ A;  4V26 A;  1OSF A;  2IWS A;  4L94 A;  1YET A;  5M4K A;  2XX2 A;  1JM6 A;  2H8M A;  4YKW A;  3FT5 A;  4LPB A;  3OMU A;  4XE2 A;  3SL2 A;  3T0Z A;  2YEH A;  4MPC A;  2YKE A;  3CGY A;  1I59 A;  5M4M A;  3TTZ A;  3U67 A;  3ZKB A;  4JAS A;  4XCJ A;  3WQ9 A;  4H81 A;  1GKZ A;  4YKU A;  2YKI A;  1UYE A;  2CGF A;  4ASB A;  3OW6 A;  4URL A;  5CTX A;  3RKZ A;  1B63 A;  1ZWH A;  4EGH A;  4NH7 A;  1EA6 A;  2WI3 A;  3EHH A;  2HCH A;  4LWE A;  5CF0 A;  5J71 A;  1YES A;  2FXS A;  3ZM7 A;  1EI1 A;  2BU2 A;  1BXD A;  1H7S A;  3VAD A;  3WHA A;  4AWQ A;  3EHJ A;  5J6A A;  4B6C A;  4XIP A;  5M4H A;  4QPK A; 
#chains in the Genus database with same CATH topology
 2XJJ A;  4GFN A;  1TH8 A;  4AWO A;  1QY8 A;  4LWI A;  4XTJ A;  1THN A;  2YK2 A;  2VCJ A;  3H80 A;  1YT0 A;  1UYL A;  4MPN A;  4U7N A;  4URO A;  4BAE A;  1YC1 A;  2BSM A;  2WI2 A;  1PVG A;  4W7T A;  1I5D A;  4URN A;  2YI7 A;  3H4L A;  3R4M A;  3TZ5 A;  1MX0 A;  3OWB A;  4HZ5 A;  1TC6 A;  4EMV A;  2UWD A;  3K60 A;  3QDD A;  2YEE A;  1GKX A;  2WI5 A;  5M4N A;  1YER A;  4EFU A;  2QFO A;  1Y8O A;  4GQT A;  4QPJ A;  3O0I A;  4XCL A;  3G75 A;  3R4N A;  4XC0 A;  3EHF A;  4XKK A;  4EM7 A;  5M4P A;  2GQP A;  2YEF A;  5FNF A;  1YT1 A;  3VHA A;  3B25 A;  4KP4 A;  3HYZ A;  4AS9 A;  1Z5C A;  2XJG A;  5C93 A;  4PL9 A;  1UY7 A;  4LWF A;  1US7 A;  3EHG A;  2Q8H A;  3HYY A;  3RLQ A;  1Z5B A;  2XDX A;  4MB9 A;  4BXI A;  4ZVI A;  4BQJ A;  2WEP A;  1UYD A;  1MU5 A;  2GFD A;  5F5R A;  5IDJ A;  3QTF A;  3EKR A;  2WI6 A;  3HZ5 A;  4LWG A;  2IOR A;  2BU8 A;  3TZ4 A;  4HXW A;  4URM A;  4MBC A;  4E00 A;  1IXM A;  3C11 A;  3G7B A;  4AWP A;  1YSZ A;  1I5C A;  4O07 A;  1UYG A;  3A0Y A;  4R3M A;  4CWR A;  1NHI A;  4JAU A;  1S16 A;  2FWZ A;  1TC0 A;  3K99 A;  2XHT A;  4L91 A;  5JEN A;  1TID A;  3HZ1 A;  3INX A;  1KZN A;  2XX4 A;  5IN9 A;  5M4E A;  2YE3 A;  3B24 A;  3PEH A;  3LMM A;  3CYG A;  3TZ2 A;  1Z5A A;  4FCP A;  2YGE A;  2K5B A;  3IED A;  2YE4 A;  2H55 A;  3VHD A;  1ID0 A;  2BRE A;  3PEJ A;  3GIE A;  3O6O A;  4O05 A;  4FCQ A;  1AH8 A;  1BGQ A;  4FMT A;  4PRX A;  3T0H A;  2JJC A;  2YKB A;  2WEQ A;  4JAV A;  1AM1 A;  2YED A;  4DUH A;  2XK2 A;  4YKX A;  2WI4 A;  2XAB A;  5F3K A;  4XIT A;  2BYI A;  4BQG A;  1NHJ A;  3GIG B;  4CWN A;  2YI6 A;  4CE2 A;  2YKC A;  5D7R A;  4KSH A;  2C1G A;  2AKP A;  1NHH A;  1S14 A;  1YC3 A;  2ZBK B;  1R62 A;  4CWF A;  1UYK A;  2BZ5 A;  4FCR A;  5FNC A;  2XDU A;  2XCM A;  4WUB A;  1L0O A;  3Q5L A;  1AJ6 A;  1ZXM A;  2BT0 A;  1F51 A;  1QYE A;  3JZ3 A;  3ZKD A;  1ZW9 A;  2YE2 A;  4ZKI A;  4CE1 A;  2CG9 A;  3B26 A;  4XD8 A;  2XDK A;  4L93 A;  5CTY A;  4YKR A;  4K4O A;  1B62 A;  1UY8 A;  2YEJ A;  4YKT A;  1UYI A;  4LP0 A;  5BOD A;  2VWC A;  3TZ0 A;  4EEH A;  2BTZ A;  2C2A A;  4Q20 A;  3ZXQ A;  2XD6 A;  2XHX A;  2YE6 A;  3A0R A;  2YJW A;  2IOP A;  3GIF A;  2YE9 A;  4I3H A;  2QF6 A;  4E02 A;  3A0T A;  4LWH A;  2FWY A;  2BU5 A;  1I58 A;  3DGE A;  4L90 A;  2YK9 A;  4YKQ A;  5D6P A;  2YE7 A;  1UY9 A;  3HHU A;  4NH8 A;  4CWT A;  3R4P A;  2YGA A;  2ZDX A;  2O1V A;  4I5S A;  4HZ0 A;  3FV5 A;  3LPS A;  3T10 A;  4MP2 A;  4NH9 A;  5CTW A;  4O09 A;  2FYP A;  4CWO A;  4R3A A;  3MNR P;  4EFT A;  1AMW A;  4O04 A;  2YEC A;  3OPD A;  3GIG A;  3EKO A;  3O2F A;  2O1W A;  4GCZ A;  3CWV A;  3INW A;  2BU7 A;  1I5B A;  4MPE A;  2HG1 A;  4H85 A;  1UYC A;  4KQV A;  3A0W A;  4EGI A;  1ZXN A;  4XIR A;  4XKA A;  2EXL A;  1YT2 A;  3U2K A;  4ASG A;  4FPP A;  2YJX A;  3RLR A;  4CWQ A;  2VCI A;  3D0B A;  1GJV A;  4PRV A;  2VW5 A;  5FND A;  3ZXO A;  4CE3 A;  1BYQ A;  1Y8P A;  2CCT A;  4YKZ A;  3S5T A;  1BKN A;  1UYH A;  2PNR A;  1TIL A;  1UYF A;  2QG2 A;  2XJX A;  2YEB A;  4HY1 A;  3T1K A;  1YSR A;  4EGK A;  4P7A A;  4KTN A;  5BOC A;  2BU6 A;  2XX5 A;  2HHI A;  3BMY A;  2YE8 A;  2Q8F A;  2HKJ A;  2WI1 A;  3R4O A;  1UYM A;  2Q2E B;  2QG0 A;  2YGF A;  3R91 A;  4KFG A;  3Q5K A;  3BM9 A;  4H7Q A;  4DZY A;  3TUH A;  4O0B A;  2JKI A;  3T2S A;  2WER A;  4ASA A;  3A0Z A;  3D2R A;  4GEE A;  1Y4S A;  3R92 A;  4MP7 A;  4L8Z A;  4ASF A;  4CWS A;  4HYP A;  4GT8 A;  4U93 A;  3CRK A;  3Q5J A;  2YEI A;  2CCS A;  4HY6 A;  3CRL A;  1KIJ A;  4PU9 A;  4XKO A;  5D7D A;  5FWK A;  2IWX A;  2YEG A;  1QZR A;  2CH4 A;  2O1U A;  2Q8G A;  4B7P A;  3A0X A;  5D6Q A;  4YKY A;  3FT8 A;  3B27 A;  3KE6 A;  1AH6 A;  2ESA A;  4JQL A;  2IWU A;  2BRC A;  4E72 A;  3G7E A;  3C0E A;  1I5A A;  5CTU A;  1TBW A;  5L3J A;  2YE5 A;  2C1I A;  4GGL A;  2IOQ A;  1UY6 A;  3VHC A;  2XDL A;  2ZKJ A;  4WUC A;  3D36 A;  2YKJ A;  5D7C A;  2XDS A;  3B28 A;  1A4H A;  2YI0 A;  3U2D A;  2Q8I A;  2ZDY A;  2WI7 A;  4HXZ A;  4KSG A;  4P8O A;  1H7U A;  4WUD A;  1U0Z A;  2E0A A;  2YI5 A;  4V25 A;  4CWP A;  5GGZ A;  1Y8N A;  4E01 A;  3NMQ A;  4R1F A;  1B3Q A;  1Z59 A;  4XIQ A;  2BYH A;  5CPH A;  4BIU A;  2XHR A;  1U2O A;  5IDM A;  3CGZ A;  3RLP A;  4X9L A;  4MOT A;  3OWD A;  3LNU A;  1Y4U A;  2YEA A;  4U7O A;  4XDM A;  2CCU A;  1YS3 A;  3K97 A;  3HEK A;  4HYM A;  1YC4 A;  3K98 A;  4BIZ A;  4V26 A;  1OSF A;  2IWS A;  4L94 A;  1YET A;  5M4K A;  2XX2 A;  1JM6 A;  2H8M A;  4YKW A;  3FT5 A;  4LPB A;  3OMU A;  4XE2 A;  3SL2 A;  3T0Z A;  2YEH A;  4MPC A;  2YKE A;  3CGY A;  1I59 A;  5M4M A;  3TTZ A;  3U67 A;  3ZKB A;  4JAS A;  4XCJ A;  3WQ9 A;  4H81 A;  1GKZ A;  4YKU A;  2YKI A;  1UYE A;  2CGF A;  4ASB A;  3OW6 A;  4URL A;  5CTX A;  3RKZ A;  1B63 A;  1ZWH A;  4EGH A;  4NH7 A;  1EA6 A;  2WI3 A;  3EHH A;  2HCH A;  4LWE A;  5CF0 A;  5J71 A;  1YES A;  2FXS A;  3ZM7 A;  1EI1 A;  2BU2 A;  2FTK A;  1BXD A;  1H7S A;  3VAD A;  3WHA A;  4AWQ A;  3EHJ A;  5J6A A;  4B6C A;  4XIP A;  5M4H A;  4QPK A; 
#chains in the Genus database with same CATH homology
 2XJJ A;  4GFN A;  1TH8 A;  4AWO A;  1QY8 A;  4LWI A;  4XTJ A;  1THN A;  2YK2 A;  2VCJ A;  3H80 A;  1YT0 A;  1UYL A;  4MPN A;  4U7N A;  4URO A;  4BAE A;  1YC1 A;  2BSM A;  2WI2 A;  1PVG A;  4W7T A;  1I5D A;  4URN A;  2YI7 A;  3H4L A;  3R4M A;  3TZ5 A;  1MX0 A;  3OWB A;  4HZ5 A;  1TC6 A;  4EMV A;  2UWD A;  3K60 A;  3QDD A;  2YEE A;  1GKX A;  2WI5 A;  5M4N A;  1YER A;  4EFU A;  2QFO A;  1Y8O A;  4GQT A;  4QPJ A;  3O0I A;  4XCL A;  3G75 A;  3R4N A;  4XC0 A;  3EHF A;  4XKK A;  4EM7 A;  5M4P A;  2GQP A;  2YEF A;  5FNF A;  1YT1 A;  3VHA A;  3B25 A;  4KP4 A;  3HYZ A;  4AS9 A;  1Z5C A;  2XJG A;  5C93 A;  4PL9 A;  1UY7 A;  4LWF A;  1US7 A;  3EHG A;  2Q8H A;  3HYY A;  3RLQ A;  1Z5B A;  2XDX A;  4MB9 A;  4BXI A;  4ZVI A;  4BQJ A;  2WEP A;  1UYD A;  1MU5 A;  2GFD A;  5F5R A;  5IDJ A;  3QTF A;  3EKR A;  2WI6 A;  3HZ5 A;  4LWG A;  2IOR A;  2BU8 A;  3TZ4 A;  4HXW A;  4URM A;  4MBC A;  4E00 A;  3C11 A;  3G7B A;  4AWP A;  1YSZ A;  1I5C A;  4O07 A;  1UYG A;  3A0Y A;  4R3M A;  4CWR A;  1NHI A;  4JAU A;  1S16 A;  2FWZ A;  1TC0 A;  3K99 A;  2XHT A;  4L91 A;  1TID A;  3HZ1 A;  3INX A;  1KZN A;  2XX4 A;  5IN9 A;  5M4E A;  2YE3 A;  3B24 A;  3PEH A;  3TZ2 A;  1Z5A A;  4FCP A;  2YGE A;  2K5B A;  3IED A;  2YE4 A;  2H55 A;  3VHD A;  1ID0 A;  2BRE A;  3PEJ A;  3GIE A;  3O6O A;  4O05 A;  4FCQ A;  1AH8 A;  1BGQ A;  4FMT A;  4PRX A;  3T0H A;  2JJC A;  2YKB A;  2WEQ A;  4JAV A;  1AM1 A;  2YED A;  4DUH A;  2XK2 A;  4YKX A;  2WI4 A;  2XAB A;  5F3K A;  4XIT A;  2BYI A;  4BQG A;  1NHJ A;  3GIG B;  4CWN A;  2YI6 A;  4CE2 A;  2YKC A;  5D7R A;  4KSH A;  2AKP A;  1NHH A;  1S14 A;  1YC3 A;  2ZBK B;  1R62 A;  4CWF A;  1UYK A;  2BZ5 A;  4FCR A;  5FNC A;  2XDU A;  2XCM A;  4WUB A;  1L0O A;  3Q5L A;  1AJ6 A;  1ZXM A;  2BT0 A;  1QYE A;  3JZ3 A;  3ZKD A;  1ZW9 A;  2YE2 A;  4ZKI A;  4CE1 A;  2CG9 A;  3B26 A;  4XD8 A;  2XDK A;  4L93 A;  5CTY A;  4YKR A;  4K4O A;  1B62 A;  1UY8 A;  2YEJ A;  4YKT A;  1UYI A;  4LP0 A;  5BOD A;  2VWC A;  3TZ0 A;  4EEH A;  2BTZ A;  2C2A A;  4Q20 A;  3ZXQ A;  2XD6 A;  2XHX A;  2YE6 A;  3A0R A;  2YJW A;  2IOP A;  3GIF A;  2YE9 A;  4I3H A;  2QF6 A;  4E02 A;  3A0T A;  4LWH A;  2FWY A;  2BU5 A;  1I58 A;  3DGE A;  4L90 A;  2YK9 A;  4YKQ A;  5D6P A;  2YE7 A;  1UY9 A;  3HHU A;  4NH8 A;  4CWT A;  3R4P A;  2YGA A;  2ZDX A;  2O1V A;  4I5S A;  4HZ0 A;  3FV5 A;  3LPS A;  3T10 A;  4MP2 A;  4NH9 A;  5CTW A;  4O09 A;  2FYP A;  4CWO A;  4R3A A;  3MNR P;  4EFT A;  1AMW A;  4O04 A;  2YEC A;  3OPD A;  3GIG A;  3EKO A;  3O2F A;  2O1W A;  4GCZ A;  3CWV A;  3INW A;  2BU7 A;  1I5B A;  4MPE A;  2HG1 A;  4H85 A;  1UYC A;  4KQV A;  3A0W A;  4EGI A;  1ZXN A;  4XIR A;  4XKA A;  2EXL A;  1YT2 A;  3U2K A;  4ASG A;  4FPP A;  2YJX A;  3RLR A;  4CWQ A;  2VCI A;  3D0B A;  1GJV A;  4PRV A;  2VW5 A;  5FND A;  3ZXO A;  4CE3 A;  1BYQ A;  1Y8P A;  2CCT A;  4YKZ A;  1BKN A;  1UYH A;  2PNR A;  1TIL A;  1UYF A;  2QG2 A;  2XJX A;  2YEB A;  4HY1 A;  3T1K A;  1YSR A;  4EGK A;  4P7A A;  4KTN A;  5BOC A;  2BU6 A;  2XX5 A;  3BMY A;  2YE8 A;  2Q8F A;  2HKJ A;  2WI1 A;  3R4O A;  1UYM A;  2Q2E B;  2QG0 A;  2YGF A;  3R91 A;  4KFG A;  3Q5K A;  3BM9 A;  4H7Q A;  4DZY A;  3TUH A;  4O0B A;  2JKI A;  3T2S A;  2WER A;  4ASA A;  3A0Z A;  3D2R A;  4GEE A;  1Y4S A;  3R92 A;  4MP7 A;  4L8Z A;  4ASF A;  4CWS A;  4HYP A;  4GT8 A;  4U93 A;  3CRK A;  3Q5J A;  2YEI A;  2CCS A;  4HY6 A;  3CRL A;  1KIJ A;  4PU9 A;  4XKO A;  5D7D A;  5FWK A;  2IWX A;  2YEG A;  1QZR A;  2CH4 A;  2O1U A;  2Q8G A;  4B7P A;  3A0X A;  5D6Q A;  4YKY A;  3FT8 A;  3B27 A;  3KE6 A;  1AH6 A;  2ESA A;  4JQL A;  2IWU A;  2BRC A;  3G7E A;  3C0E A;  1I5A A;  5CTU A;  1TBW A;  5L3J A;  2YE5 A;  4GGL A;  2IOQ A;  1UY6 A;  3VHC A;  2XDL A;  2ZKJ A;  4WUC A;  3D36 A;  2YKJ A;  5D7C A;  2XDS A;  3B28 A;  1A4H A;  2YI0 A;  3U2D A;  2Q8I A;  2ZDY A;  2WI7 A;  4HXZ A;  4KSG A;  4P8O A;  1H7U A;  4WUD A;  1U0Z A;  2E0A A;  2YI5 A;  4V25 A;  4CWP A;  5GGZ A;  1Y8N A;  4E01 A;  3NMQ A;  4R1F A;  1B3Q A;  1Z59 A;  4XIQ A;  2BYH A;  5CPH A;  4BIU A;  2XHR A;  1U2O A;  5IDM A;  3CGZ A;  3RLP A;  4X9L A;  4MOT A;  3OWD A;  3LNU A;  1Y4U A;  2YEA A;  4U7O A;  4XDM A;  2CCU A;  1YS3 A;  3K97 A;  3HEK A;  4HYM A;  1YC4 A;  3K98 A;  4BIZ A;  4V26 A;  1OSF A;  2IWS A;  4L94 A;  1YET A;  5M4K A;  2XX2 A;  1JM6 A;  2H8M A;  4YKW A;  3FT5 A;  4LPB A;  3OMU A;  4XE2 A;  3SL2 A;  3T0Z A;  2YEH A;  4MPC A;  2YKE A;  3CGY A;  1I59 A;  5M4M A;  3TTZ A;  3U67 A;  3ZKB A;  4JAS A;  4XCJ A;  3WQ9 A;  4H81 A;  1GKZ A;  4YKU A;  2YKI A;  1UYE A;  2CGF A;  4ASB A;  3OW6 A;  4URL A;  5CTX A;  3RKZ A;  1B63 A;  1ZWH A;  4EGH A;  4NH7 A;  1EA6 A;  2WI3 A;  3EHH A;  2HCH A;  4LWE A;  5CF0 A;  5J71 A;  1YES A;  2FXS A;  3ZM7 A;  1EI1 A;  2BU2 A;  1BXD A;  1H7S A;  3VAD A;  3WHA A;  4AWQ A;  3EHJ A;  5J6A A;  4B6C A;  4XIP A;  5M4H A;  4QPK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...