4DUIA

Darpin d1 binding to tubulin beta chain (not in complex)
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
165
structure length
164
Chain Sequence
HHHHHHGSDLGKKLLEAARAGQDDEVRILMANGADVNATDASGLTPLHLAATYGHLEIVEVLLKHGADVNAIDIGSTPLHLAALIGHLEIVEVLLKHGADVNAVDTWGDTPLHLAAIMGHLEIVEVLLKHGADVNAQDKFGKTAFDISIDNGNEDLAEILQKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An Anti-Tubulin Darpin Caps the Microtubule Plus-End
rcsb
molecule keywords DESIGNED ANKYRIN REPEAT PROTEIN (DARPIN) D1
molecule tags De novo protein
source organism Artificial gene
total genus 53
structure length 164
sequence length 165
ec nomenclature
pdb deposition date 2012-02-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4duiA00
4B93B 4BSZB 3HRAA 1DC2A 3V79K 4U96D 3NOCD 2FO1E 3V30A 5AQ7A 4J8YA 2XZTG 1BI7B 2HE0A 1BD8A 1BI8B 3EHRA 4ZHBA 5CERB 2DZOA 2ETBA 4HI8A 1MX6A 3ZUVB 1DCQA 2KBXA 3EU9A 3JXJA 1AWCB 4HI9A 3TWSA 4DX6D 4G8LA 3UXGA 2BKKB 4LSZE 3V31A 4BEPA 5CBNA 3B95A 4ZFHA 3HG0D 4JB8P 3ZNGA 2P2CP 2RFMA 4HRMB 4LNUD 4YDWA 3TWRA 3DEOA 5EIBE 1IKND 4O1OA 5ENPD 1IHBA 3TWXA 4HRLA 2V5QC 4O60A 2ZGDA 3LJNA 3B7BA 4DX5D 4DX1A 4A63B 1N11A 4DX7D 4N5QA 1D9SA 3ZKJA 3NOGD 1BU9A 2QC9A 4DX2A 2MYOA 3AAAC 4HBDA 4Z68A 4HQDA 4HNAD 2BKGA 3JXIA 3D9HA 1AP7A 1K1BA 2F8XK 2Y1LE 3V2OA 2QYJA 5KNGA 2KXPC 1YMPA 5FINA 5AQ9A 4J7WA 3DEPA 1SVXA 1SW6A 2ETCA 2XEHA 5ENQD 4GPMA 2AJAA 3T9KA 5ENSD 5CEAA 2L6BA 2Y0BG 3TWTA 1IXVA 1MX2A 4TUMA 3NBNB 2DVWA 4O1PA 2V4HC 3TWWA 1UOHA 3KEAA 3Q9NC 4HLLA 2RFAA 2B0OE 4RLYA 4U8YD 4G8KA 1A5EA 5EYLA 3AJIA 1NFIE 5JMND 2DWZA 3TWQA 3IXEA 2A5EA 4QQIA 5KBAA 3J5QB 2F8YA 4F6RD 4UUCA 3C5RA 5CBOA 5AQBA 4BESA 2ETAA 2XZDG 5EYPF 1OT8A 1YYHA 3F6QA 3EHQA 1TR4A 5EILA 5D66A 5BXOA 4K5BA 4YDYA 4HB5A 4F1PA 1BLXB 5AARA 4NIKA 4OAVB 3JUEA 5JA4D 5HRYA 1MJ0A 1K3ZD 2XENA 2ZGGA 5AN8A 5KWDA 4HRNA 3T8KA 5BXUA 5FIOA 5KNHD 4DUIA 5CECB 1OY3D 2JABA 4QFVA 1N0RA 1N0QA 4OAUC 4CYMD 1S70B 5AAOA 4CZ2D 3UTMA 3W9GA 3Q9UC 5EIDA 1MX4A 4DRXE 4GMRA 2VGEA 2XEEA 5AQAA 1G3NB 1MYOA 2DZNA 4BETA 5CEDB 3V2XA 3ZU7B 3TWUA 2F37A 5HKPA 4K5CA 4K5AB 3W9FA 1WG0A 1QYMA 3J5PA 1K1AA 2PNNA 4U8VD 4BERA 4C48B 5ENTD 4ATZD 3SO8A 1YCSB 5ENRD 1WDYA 5ENOD 2NYJA 4LG6A 5HS0A 3UI2A 5ITZF 3TWVA 4U95D 5EN5D 2J8SD
chains in the Genus database with same CATH superfamily
4HLEA 3HRAA 4FHKA 1DC2A 1PY1A 4I9CA 1BD8A 2ETBA 4KT6B 4MRUA 4I9EA 1LD7A 1U3CA 3IHYA 4I43A 3UM3A 4OVUA 1A5EA 4DLOA 1Z3YA 5DBKA 3CGHA 4DX5D 1N11A 4N5QA 3CVYA 3AU5A 4UWKA 3PZ4A 5G04J 2BKGA 3ZEFA 4J8DA 1JCSA 2CFUA 4G2VA 4DI4A 4UWLA 3ZYQA 2I9CA 3R9AB 4GPMA 4ILIA 5ENSD 1OWMA 1MX2A 3KEAA 3OAWA 3G2TA 4B89A 3VLFA 1TEZA 3DWLG 3IBEA 3RO3A 5JMND 3TWQA 3WXXA 1NL4A 1LF8A 4UUCA 2FBNA 3F6QA 1FVFA 1ELWA 1S63A 4JXTA 3UT8A 4LRZA 1Q2ZA 3HDXA 2KZTB 3RAUA 1WY6A 3LDZA 5C1DA 1WG0A 3QB2A 4L9PA 1Z5SC 3L16A 3ABLE 4ILHB 5BV1A 1HX8A 3C3RA 3RSEG 3ZYLA 4GZDA 2XZTG 3FTSA 4HI8A 2KBXA 4EZLA 3JXJA 3AU4A 2GROB 3JQ0A 4EZKA 3RO2A 3DEOA 2CHXA 1IHBA 3TWXA 2MOWA 3CVNA 3Q7AA 4AOFA 4KZCA 4UQZA 1HE8A 1QZ2A 2MHKA 4TXRA 1MHQA 2A4ZA 2OEWA 1FCHA 1YMPA 2XEHA 1N4QA 4TRQA 4U8YD 3SZ7A 2J9QA 5BW8C 3PH0C 2J4DA 4HFGA 4QQIA 4BX9A 1HO8A 4LUNU 2YNQA 4K5BA 1NP7A 1KT1A 2WXNA 4JD2G 2JABA 3ZIMA 3CHRA 4JPSA 3SNXA 4YNDA 3ABME 3HXBA 4BT8A 1DNPA 3ASNE 4X8QA 4CDNA 1O1TA 1HG2A 3RIBA 2NYJA 4I1OB 3GW4A 3E34A 3UX4A 3BQOA 3L17A 4N2QA 5E75A 5CERB 3DSTA 3BEEA 4HOUA 1OCCE 1NA0A 4BEPA 1JUQA 3V31A 5CCLA 3SF4A 3HG0D 3LYAA 3S7BA 2L9BA 3ZXSA 3CV0A 5IY5E 2I6HA 4GA1A 3UM1A 2X6IA 4XEIG 3RJVA 1AP7A 1EDUA 3KAEA 1OWLA 1IYGA 3L54A 3GZSA 3NB2A 4XE0A 1IXVA 3C3QA 3UINC 3FU5A 4RG9A 1X81A 3QARA 2FULA 3DSVA 1NFIE 3IXEA 3AG1E 2F8YA 4BSXA 5AIJA 4BESA 5BXOA 1TR4A 2QZAA 2J4BA 3PREA 3AS8A 3QWVA 3UUXA 4FA6A 4XI9A 3PUJA 4U8HA 5AAOA 4M7CA 5EIDA 4PS7A 4UWFA 2PQRA 3ONKA 1D8DA 4KVMA 3TG5A 4UQYA 4GZCA 1TNOA 3Q47B 3CK9A 2L0IA 3ZYKA 2H6FA 5B1AE 3V30A 3CVQA 5AQ7A 2OVBA 2MRIA 3K9IA 4I6JA 3UM2A 3D9NA 2LO6A 3Q4AB 4HI9A 2WXRA 2P9IG 2P9LG 3O48A 2IQCA 3BU8A 2VSXE 2R5SA 1UJKA 3E4BA 3S7FA 3S7DA 4AP2A 4JHRA 3U66A 2X6HA 5FZQA 4GTVA 2KXPC 5D2MC 2ZU6B 4TUUA 2PQNA 3CVLA 1Z6TA 3HVEA 3ZHEB 1ELKA 1UG3A 1EYHA 4Y6CA 1TNBA 4G11A 3U3WA 5KBAA 2IONA 3DSWA 2IEJA 4GB9A 2WPVA 5EILA 2PM6A 2XHEA 5M72A 3HXCA 3TXNA 1QBQA 2H6GA 5KWDA 3PRZA 2AXVA 1E8XA 5CECB 4GPKA 4NQ0A 3EUVA 2GW1A 4OAUC 1V54E 3E37A 3PNLB 3QWPA 4AM9A 2CFZA 1E8WA 4R7LA 4LG6A 1B89A 1QQEA 2WM9A 1HU3A 2R03A 3DSSA 2FO1E 2VTBB 4FLBA 4GZ5A 3ZUVB 3EU9A 4AVXA 4PUCA 1N4RA 5KCMA 4NURA 4JB8P 2P2CP 4HRLA 3GZ2A 5BV0A 4DX2A 4UWHA 1O5MA 4HQDA 2EINE 3FFLA 1KPSB 3CHPA 3FY4A 2UY1A 3LPZA 4JVSA 2FF4A 4FADA 1EPUA 2XGSA 4A3VA 4MS6A 2L6BA 2Y0BG 3TAXA 2PM7A 1N54A 4G26A 4HLLA 1E8ZA 3CK7A 2XPZA 3ZFWA 3Q49B 4DLQA 5FJYA 4UWGA 4HVBA 3FH8A 5EYPF 1YYHA 5HI7A 2AXUA 2WQ7A 2VSNA 2XENA 5AN8A 5HQ8A 2VSYA 4DUIA 4XX5A 2Y69E 3CVVA 4I1MA 4QFVA 1RZ4A 3LS8A 3TG4A 5BNWA 3PNTB 3B7RL 1TYQG 4WNGA 3SGHA 4H7XA 4BERA 1XNFA 1ELRA 3LY9A 3TWVA 5EN5D 3PE4A 4B93B 2EILE 5JJ7A 2PZIA 3OXGA 4JA7A 2FO7A 3B7UX 4OYSA 4XIFA 4ZFHA 3U4TA 1H19A 2XEVA 4O60A 1WAO1 5FQ6A 4DX7D 4AEZC 2MYOA 4GCOA 2WMOA 5JHAA 2BEDA 4GTRA 4Q94A 4B8CB 1Y8MA 2Y1LE 4XI0A 2Y3AA 2KCLA 4I2WA 2WXHA 2OV8A 3DSUA 1OXJA 4WNDA 1D8EA 4CRWA 3PS6A 4Y6WA 2WXJA 2V0PA 4ANWA 2VGYA 4F1PA 3JUEA 5BXUA 4AY5A 2XQ0A 3EHMA 1N0QA 1SZ9A 3FUHA 2XPYA 1S70B 5A7DB 3GZ1A 3EHNA 3PEUB 2VGEA 1G3NB 4B8AA 3ULEG 4K5CA 4WAFA 3UI2A 2GRRB 3APFA 1VDYA 3PUKA 4L1BA 3L13A 3CHSA 1IHGA 1MX6A 3S2AA 1SZAA 3ASDA 3CR3A 4AIFA 4GYOA 4PDXA 3ML8A 4YDWA 4ABNA 5ANRA 2E2EA 2BTDA 2X6KA 3CLJA 2CHZA 3URZA 4YVOA 3RRMB 4Z68A 1JWGA 1LD8A 2J09A 2KCVA 3ASHA 1HS6A 2RG8A 4FHJA 5CRVA 4JHKA 5BPPA 2I1KA 3CK8A 3E33A 4O1PA 3TWWA 3Q9NC 2DBAA 4G8KA 3GYZA 5LP0A 1U2VG 2WXIA 4M3OA 4CDMA 3CKCA 3ENEA 3DRAA 4L2YA 3LEWA 3NZSA 3D9MA 5AARA 2GRPB 5HRYA 2LSUA 4HRNA 5A6CA 5FTPA 1MQSA 2VJ8A 3UKUG 4B0ZA 3QC1A 3QNKA 4BTAA 3Q9UC 3ASOE 2R05A 3SI5A 3AS4A 4BT9A 4RG6A 3ESKA 4IRUA 3I3NA 3BG0B 1L5JA 4U7EB 5ENRD 5ENOD 2RKKA 5HS0A 3WG7E 4GAAA 3ISMC 3FWVA 5JJTA 5B3SE 4A1SA 3KS2A 4AXHA 4UI9C 3ZPJA 3PDNA 1H2UA 4GTOA 3U64A 3MA5A 3CEQA 2R02A 4DX6D 3FU0A 1E96B 2VGXA 4EBAG 4CEMA 4HRMB 2AVPA 1JWFA 5ENNA 3MCXA 3CSTA 4NRHB 1BPOA 4EPZA 1D9SA 5D0OD 2NXPA 3S7JA 1SQMA 4HNAD 2F8XK 3MKQB 3LVQE 3D9LA 2OCCE 4L7TA 4OVVA 1SVXA 3T9KA 1IQUA 2V4LA 3TL5A 3R7RA 3CVWA 4A1GA 4CT4A 2X6FA 3ULYA 2A5EA 3DXMG 4LNGA 4KMOA 1TNYA 3AS5A 4NIKA 1MJ0A 2ZGGA 2WXMA 3T8KA 5AJDA 3DXKG 3HXEA 3Q15A 5EX0A 1WM5A 4HORA 4A3TA 1HXIA 3CSFA 5JJ6A 3FTYA 3UT7A 3MV3B 3KSQA 2F37A 4URKA 4ANVA 3IV0A 5BT1A 4U0ZA 3R9MA 4U8VD 1YCSB 4U63A 2WXOA 4BTBA 2J49A 3KD7A 2YHCA 2J8SD 4ATGA 1E7UA 3NOCD 2KZTA 1FT1A 4U0UA 2I1JA 3FTVA 3CVPA 1AWCB 1DVPA 2EQXA 2Q7FA 3I5PA 4RQIA 3TWRA 2P9NG 3TGOA 3SY2A 3LJNA 4EZJA 2EIME 4DX1A 4YDEA 3C3OA 5FQ8A 3IKOB 1FT2A 4KBQA 5H7PA 3JXIA 3SD5A 3BUAA 3C72A 3UT4A 3X2QE 3V2OA 2XRYA 5AENA 1K8KG 4TV3A 1TNZA 2XRZA 5KJMA 1MZCA 3EDTB 4YDOA 4WUYA 1ZBPA 3J5QB 4IYPA 3SHFA 2AXZA 5B1BE 1TN6A 5FQ4A 1N95A 5C2YA 1K3ZD 5CMWA 4G25A 3RRUA 2WQHA 2L0TB 3DBSA 4D10C 3U9WA 1N0RA 3QWWA 3Q7FA 2XGOA 2WB2A 1KT0A 2VYIA 3TJPA 3TXMA 2QY7A 3PEVB 3I4RB 4CGWA 4RVBA 5CRUA 3ESLA 4FP7A 3G2WA 4GTPA 4DI3A 3ABKE 3ASGA 3Q73A 4APOA 1BI7B 2LXLA 1BI8B 3FH7A 3Q5MA 4JA9A 5FT9A 1DCQA 3UIPC 3UXGA 2BKKB 4G23A 4LCTA 5CBNA 2JLBA 4GYWA 4GTMA 5EIBE 1IKND 2HYZA 4H7YA 2IOSA 2OEVA 1E8YA 1NA3A 5D0QD 1OCZE 3KSLA 5EDSA 4Q69A 3B7TA 5FINA 1OWOA 4FULA 5ENQD 4RLYA 5BUZA 2VSOE 5EYLA 3PVLA 5JHBA 1HFAA 3LXUX 4JEHA 2OVFA 4TXQA 2ETAA 5J08A 5FZSA 4J8FA 4HB5A 3HXFA 2J07A 4DJAA 2V8SE 2ZIRA 4NACA 4FJZA 4J8EA 5G04C 3UPVA 3P2BA 1H2TC 4F3VA 3LY7A 3ULQA 3FH5A 4WNFA 2XEEA 1OCOE 4P29A 4GA0A 2KC7A 1INZA 3LCAA 4K5AB 3APCA 1WDYA 3ZXPA 2ILRA 4U95D 5EX3A 4C0EA 5LOZA 5KJNA 2C2LA 3OTNA 4ANXA 4JC8A 4PS3A 5T4YA 2WMNA 2DZOA 2LUHA 5T8IA 4BY6A 3C98A 3D9IA 3G2SA 1SA4A 2M63A 2E0IA 3KEZA 4LSZE 4GTTA 3SFZA 4V3IA 3FUMA 4UI9K 5ENPD 3R7QA 2LAIA 1TJCA 3RK6A 4AY6A 3FULA 4HOQA 3CVXA 2XPIA 2J08A 4GZ3A 5AYWD 5KJKA 5A23A 4J7WA 3IEGA 2A5UA 5LCWJ 3CVUA 3TWTA 3FUFA 4TUMA 2CG3A 2LXMA 2RFAA 1UW4B 4PH4B 5AJLA 1A17A 1S64A 4FC8A 1LTXA 4JW1A 2QYUA 5CBOA 1HG5A 2P58C 2XZDG 1OT8A 3EHQA 2EIJE 5D66A 1S0PA 2R59A 4BX8A 3DPYA 2DCPA 3E32A 4WNEA 3ZHEA 4CYMD 4ACLA 4PS8A 3ML9A 4GMRA 1MYOA 2H6IA 3OXLA 4I6EA 3CHQA 3UKRG 1E90A 1K1AA 2XGMA 2Y4TA 4GTQA 2P9UG 5G05J 1TJFA 4G24A 4W9RA 3SBSA 4IN3B 4A63B 4N5CA 3BG1B 4GMLA 4U96D 4FLHA 3LY8A 4J8YA 3FUEA 5CCMA 1KLXA 4XKBA 3G2UA 4MLPA 3I4GA 4N2SA 4G8LA 5LFAA 4RSYA 3ZRHA 4BWRA 4HOSA 3AG3E 2C0MA 2ZGDA 3DPDA 3Q78A 3FEXA 2HO1A 5EKQD 2KCKA 1YA0A 3QDNA 3AAAC 2VTBA 3D9HA 1RW2A 2IF4A 4GMJA 4AV7A 4CDRA 5ARGA 1HZ4A 1XGWA 1N52A 5ARFA 4ILGA 3Q79A 3D9PA 1SW6A 2AW6A 2IO3C 3PZ3A 3NBNB 1ZU2A 3UQ3A 3B13A 2UWJG 2XS8A 3AJIA 3JQ1A 4L23A 3MV2B 1N4PA 1N94A 2WXPA 3MEKA 5AQBA 1P5QA 3DSXA 1NI1A 3CIAA 2IJGX 1BLXB 4LERA 2XCCA 4K03A 4Q96A 3PZ2A 4U04A 3FTZA 3SBTB 2LNIA 4LEUA 3W9GA 3UIOC 1MX4A 3QK0A 4DRXE 4WWPA 3JYSA 4BETA 3QOUA 1HF8A 1QYMA 2GRMA 1H2VC 2BF0X 4JZYA 2PNNA 1OUVA 1Z3XA 4F53A 3EIQC 5ITZF 3VTXA 4BSZB 3CQCB 3V79K 3SQVA 1PAQA 3EHRA 4ZHBA 2NC9A 3FU6A 1W3BA 3ZVVA 2ONDA 2GRLA 4EHMA 2X6JA 4U0SA 2P9PG 4LNUD 3HXDA 4N39A 4CGVA 1H6KA 1E7VA 4KZ0A 2X38A 3HVEB 3ZKJA 4EECA 3PZ1A 2R17C 2R2LA 3ZYMA 2GRNB 3FTUA 3T8MA 5AQ9A 2IU1A 2AJAA 1JCQA 3MKRA 2NSZA 4N3BA 3CQGB 4KVOA 1V55E 2FI7A 2PL2A 4F6RD 1O1RA 5T3RA 1U3DA 1KZOA 4GA2A 1FPPA 4GU5A 1FVHA 1GW6A 3D9OA 5CMYA 2KATA 4JEUA 3P1UA 4GYYA 2BUGA 5G2NA 5AQAA 2DZNA 3FUNA 3MGBA 4J6IA 3EU5A 1H6PA 2YINA 4ATZD 3LVRE 3D9JA 3UTMA 4BFRA 5J90A 3OXFA 2RD0A 3LKUA 5E76A 1ZB1A 2FEZA 4GTSA 2V5FA 3Q75A 2HM8A 4HS2A 2L6JA 1SA5A 3QJZA 2UY1B 2C0LA 2DYSE 4U07A 1QNFA 4WWOA 4CCAA 4O1OA 3AG4E 2V5QC 3G2VA 4XKCA 1NZNA 3MZLB 3ZN3A 4EBAA 1BU9A 4HBDA 3D9KA 2XS1A 3ZW3A 3VLDA 5DIZA 3FP3A 2WXFA 4K0RA 4HOTA 3ONLA 3ASFA 2DYRE 1KZPA 2ETCA 3DEPA 4KYOB 2I2OA 3QKYA 3MX3A 5CHEE 2V4HC 2B0OE 3E30A 4ME2A 2WVIA 2DWZA 4UI9J 3L22A 3C5RA 2H6HA 4EQFA 3SFYA 4C0MA 3MJWA 4UQXA 1UN9A 4APFA 4MKTA 3T5VA 3UMVA 3V2XA 3ZU7B 3AG2E 1UJJA 4JL0A 2JEKA 4L2LA 5HKPA 3W9FA 4ANUA 3J5PA 2LAHA 4I17A 4F1SA 2GRQB 2P9SG 2IY0C 4CT0A 3JCKC 1H6OA 4J0UA 2WXGA 2ZXWE 2Y4UA 3FUJA 4I1AA 2F0YA 3N71A 4JHJA 2B6CA 1IQRA 2VQ2A 4YVQC 4TXPA 2WQ6A 3FEYA 3FUKA 4G1TA 5LX8A 3B95A 2RFMA 4DK5A 3NF1A 2CHWA 1OWPA 4E6HA 3B7BA 3IHVA 3L82A 1PC2A 3NOGD 2QC9A 4KXKB 1N4SA 4DPRA 5KNGA 2DIWA 3CKBA 1OCRE 2WXKA 1UOHA 3NQPA 1OWNA 3EJNA 2EIKE 2AWIA 1UN8A 3L08A 4XZ4A 5LCWC 3MKQA 3SFXA 3FTXA 3FU3A 3HHMA 3EIJA 4YDYA 1H0AA 3O4ZA 5FZRA 2LSVA 4A55A 4O6FA 5FIOA 4FU3A 1JCRA 4I6GA 4FJYA 1HH8A 3VTYA 5CEDB 5G55A 3TWUA 3PZDA 3NZUA 5ENTD 4C48B 3SO8A 2P9KG 2GGFA 3HIZA 1Y6IA 3FUIA 3L6AA 3PE3A 1JPLA 4WWNA 5ANLA 2WXQA 2YHEA 2CG2A 3FTWA 3FUDA 3RRNB 4C9BB 3CHOA 2HE0A 5G05C 1N9AA 3CHMA 4F7AA 2YQ8A 3MYVA 3TWSA 2IO2C 3ZNGA 4GCNA 3D3MA 4LNBA 3RKVA 4E85A 1TN7A 4AJWA 3ZGQA 2IOLA 4I2ZA 1K1BA 3UM0A 3VLEA 2QYJA 3APDA 2OOEA 4B94A 5CEAA 2XCBA 2DVWA 5FWQA 2IFUA 2X3MA 5KJLA 3QAQA 3JUIA 3LJ3A 4N3AA 1O1SA 3T5XA 1TNUA 4OAVB 3FDHA 5JA4D 3L9TA 4ACKA 5KNHD 2KM4A 3HYMB 4N3CA 1OY3D 4MBGA 1TN8A 4CZ2D 2ZISA 1DCEA 1EF1C 4HXIA 3RU0A 2HR2A 5FQ7A 3FHEA 3B7SA 2QFCA 3NAWA 2VGXB 4IULA 1X5BA 2WXLA 4J8SA 4GZ6A
chains in the Genus database with same CATH topology
4B93B 4BSZB 3HRAA 1DC2A 3V79K 4U96D 3NOCD 2FO1E 3V30A 5AQ7A 4J8YA 2XZTG 1BI7B 2HE0A 1BD8A 1BI8B 3EHRA 4ZHBA 5CERB 2DZOA 2ETBA 4HI8A 1MX6A 3ZUVB 1DCQA 2KBXA 3EU9A 3JXJA 1AWCB 4HI9A 3TWSA 4DX6D 4G8LA 3UXGA 2BKKB 4LSZE 3V31A 4BEPA 5CBNA 3B95A 4ZFHA 3HG0D 4JB8P 3ZNGA 2P2CP 2RFMA 4HRMB 4LNUD 4YDWA 3TWRA 3DEOA 5EIBE 1IKND 4O1OA 5ENPD 1IHBA 3TWXA 4HRLA 2V5QC 4O60A 2ZGDA 3LJNA 3B7BA 4DX5D 4DX1A 4A63B 1N11A 4DX7D 4N5QA 1D9SA 3ZKJA 3NOGD 1BU9A 2QC9A 4DX2A 2MYOA 3AAAC 4HBDA 4Z68A 4HQDA 4HNAD 2BKGA 3JXIA 3D9HA 1AP7A 1K1BA 2F8XK 2Y1LE 3V2OA 2QYJA 5KNGA 2KXPC 1YMPA 5FINA 5AQ9A 4J7WA 3DEPA 1SVXA 1SW6A 2ETCA 2XEHA 5ENQD 4GPMA 2AJAA 3T9KA 5ENSD 5CEAA 2L6BA 2Y0BG 3TWTA 1IXVA 1MX2A 4TUMA 3NBNB 2DVWA 4O1PA 2V4HC 3TWWA 1UOHA 3KEAA 3Q9NC 4HLLA 2RFAA 2B0OE 4RLYA 4U8YD 4G8KA 1A5EA 5EYLA 3AJIA 1NFIE 5JMND 2DWZA 3TWQA 3IXEA 2A5EA 4QQIA 5KBAA 3J5QB 2F8YA 4F6RD 4UUCA 3C5RA 5CBOA 5AQBA 4BESA 2ETAA 2XZDG 5EYPF 1OT8A 1YYHA 3F6QA 3EHQA 1TR4A 5EILA 5D66A 5BXOA 4K5BA 4YDYA 4HB5A 4F1PA 1BLXB 5AARA 4NIKA 4OAVB 3JUEA 5JA4D 5HRYA 1MJ0A 1K3ZD 2XENA 2ZGGA 5AN8A 5KWDA 4HRNA 3T8KA 5BXUA 5FIOA 5KNHD 4DUIA 5CECB 1OY3D 2JABA 4QFVA 1N0RA 1N0QA 4OAUC 4CYMD 1S70B 5AAOA 4CZ2D 3UTMA 3W9GA 3Q9UC 5EIDA 1MX4A 4DRXE 4GMRA 2VGEA 2XEEA 5AQAA 1G3NB 1MYOA 2DZNA 4BETA 5CEDB 3V2XA 3ZU7B 3TWUA 2F37A 5HKPA 4K5CA 4K5AB 3W9FA 1WG0A 1QYMA 3J5PA 1K1AA 2PNNA 4U8VD 4BERA 4C48B 5ENTD 4ATZD 3SO8A 1YCSB 5ENRD 1WDYA 5ENOD 2NYJA 4LG6A 5HS0A 3UI2A 5ITZF 3TWVA 4U95D 5EN5D 2J8SD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B93 B;  4BSZ B;  3HRA A;  1DC2 A;  3V79 K;  4U96 D;  3NOC D;  2FO1 E;  3V30 A;  5AQ7 A;  4J8Y A;  2XZT G;  1BI7 B;  2HE0 A;  1BD8 A;  1BI8 B;  3EHR A;  4ZHB A;  5CER B;  2DZO A;  2ETB A;  4HI8 A;  1MX6 A;  3ZUV B;  1DCQ A;  2KBX A;  3EU9 A;  3JXJ A;  1AWC B;  4HI9 A;  3TWS A;  4DX6 D;  4G8L A;  3UXG A;  2BKK B;  4LSZ E;  3V31 A;  4BEP A;  5CBN A;  3B95 A;  4ZFH A;  3HG0 D;  4JB8 P;  3ZNG A;  2P2C P;  2RFM A;  4HRM B;  4LNU D;  4YDW A;  3TWR A;  3DEO A;  5EIB E;  1IKN D;  4O1O A;  5ENP D;  1IHB A;  3TWX A;  4HRL A;  2V5Q C;  4O60 A;  2ZGD A;  3LJN A;  3B7B A;  4DX5 D;  4DX1 A;  4A63 B;  1N11 A;  4DX7 D;  4N5Q A;  1D9S A;  3ZKJ A;  3NOG D;  1BU9 A;  2QC9 A;  4DX2 A;  2MYO A;  3AAA C;  4HBD A;  4Z68 A;  4HQD A;  4HNA D;  2BKG A;  3JXI A;  3D9H A;  1AP7 A;  1K1B A;  2F8X K;  2Y1L E;  3V2O A;  2QYJ A;  5KNG A;  2KXP C;  1YMP A;  5FIN A;  5AQ9 A;  4J7W A;  3DEP A;  1SVX A;  1SW6 A;  2ETC A;  2XEH A;  5ENQ D;  4GPM A;  2AJA A;  3T9K A;  5ENS D;  5CEA A;  2L6B A;  2Y0B G;  3TWT A;  1IXV A;  1MX2 A;  4TUM A;  3NBN B;  2DVW A;  4O1P A;  2V4H C;  3TWW A;  1UOH A;  3KEA A;  3Q9N C;  4HLL A;  2RFA A;  2B0O E;  4RLY A;  4U8Y D;  4G8K A;  1A5E A;  5EYL A;  3AJI A;  1NFI E;  5JMN D;  2DWZ A;  3TWQ A;  3IXE A;  2A5E A;  4QQI A;  5KBA A;  3J5Q B;  2F8Y A;  4F6R D;  4UUC A;  3C5R A;  5CBO A;  5AQB A;  4BES A;  2ETA A;  2XZD G;  5EYP F;  1OT8 A;  1YYH A;  3F6Q A;  3EHQ A;  1TR4 A;  5EIL A;  5D66 A;  5BXO A;  4K5B A;  4YDY A;  4HB5 A;  4F1P A;  1BLX B;  5AAR A;  4NIK A;  4OAV B;  3JUE A;  5JA4 D;  5HRY A;  1MJ0 A;  1K3Z D;  2XEN A;  2ZGG A;  5AN8 A;  5KWD A;  4HRN A;  3T8K A;  5BXU A;  5FIO A;  5KNH D;  4DUI A;  5CEC B;  1OY3 D;  2JAB A;  4QFV A;  1N0R A;  1N0Q A;  4OAU C;  4CYM D;  1S70 B;  5AAO A;  4CZ2 D;  3UTM A;  3W9G A;  3Q9U C;  5EID A;  1MX4 A;  4DRX E;  4GMR A;  2VGE A;  2XEE A;  5AQA A;  1G3N B;  1MYO A;  2DZN A;  4BET A;  5CED B;  3V2X A;  3ZU7 B;  3TWU A;  2F37 A;  5HKP A;  4K5C A;  4K5A B;  3W9F A;  1WG0 A;  1QYM A;  3J5P A;  1K1A A;  2PNN A;  4U8V D;  4BER A;  4C48 B;  5ENT D;  4ATZ D;  3SO8 A;  1YCS B;  5ENR D;  1WDY A;  5ENO D;  2NYJ A;  4LG6 A;  5HS0 A;  3UI2 A;  5ITZ F;  3TWV A;  4U95 D;  5EN5 D;  2J8S D; 
#chains in the Genus database with same CATH topology
 4HLE A;  3HRA A;  4FHK A;  1DC2 A;  1PY1 A;  4I9C A;  1BD8 A;  2ETB A;  4KT6 B;  4MRU A;  4I9E A;  1LD7 A;  1U3C A;  3IHY A;  4I43 A;  3UM3 A;  4OVU A;  1A5E A;  4DLO A;  1Z3Y A;  5DBK A;  3CGH A;  4DX5 D;  1N11 A;  4N5Q A;  3CVY A;  3AU5 A;  4UWK A;  3PZ4 A;  5G04 J;  2BKG A;  3ZEF A;  4J8D A;  1JCS A;  2CFU A;  4G2V A;  4DI4 A;  4UWL A;  3ZYQ A;  2I9C A;  3R9A B;  4GPM A;  4ILI A;  5ENS D;  1OWM A;  1MX2 A;  3KEA A;  3OAW A;  3G2T A;  4B89 A;  3VLF A;  1TEZ A;  3DWL G;  3IBE A;  3RO3 A;  5JMN D;  3TWQ A;  3WXX A;  1NL4 A;  1LF8 A;  4UUC A;  2FBN A;  3F6Q A;  1FVF A;  1ELW A;  1S63 A;  4JXT A;  3UT8 A;  4LRZ A;  1Q2Z A;  3HDX A;  2KZT B;  3RAU A;  1WY6 A;  3LDZ A;  5C1D A;  1WG0 A;  3QB2 A;  4L9P A;  1Z5S C;  3L16 A;  3ABL E;  4ILH B;  5BV1 A;  1HX8 A;  3C3R A;  3RSE G;  3ZYL A;  4GZD A;  2XZT G;  3FTS A;  4HI8 A;  2KBX A;  4EZL A;  3JXJ A;  3AU4 A;  2GRO B;  3JQ0 A;  4EZK A;  3RO2 A;  3DEO A;  2CHX A;  1IHB A;  3TWX A;  2MOW A;  3CVN A;  3Q7A A;  4AOF A;  4KZC A;  4UQZ A;  1HE8 A;  1QZ2 A;  2MHK A;  4TXR A;  1MHQ A;  2A4Z A;  2OEW A;  1FCH A;  1YMP A;  2XEH A;  1N4Q A;  4TRQ A;  4U8Y D;  3SZ7 A;  2J9Q A;  5BW8 C;  3PH0 C;  2J4D A;  4HFG A;  4QQI A;  4BX9 A;  1HO8 A;  4LUN U;  2YNQ A;  4K5B A;  1NP7 A;  1KT1 A;  2WXN A;  4JD2 G;  2JAB A;  3ZIM A;  3CHR A;  4JPS A;  3SNX A;  4YND A;  3ABM E;  3HXB A;  4BT8 A;  1DNP A;  3ASN E;  4X8Q A;  4CDN A;  1O1T A;  1HG2 A;  3RIB A;  2NYJ A;  4I1O B;  3GW4 A;  3E34 A;  3UX4 A;  3BQO A;  3L17 A;  4N2Q A;  5E75 A;  5CER B;  3DST A;  3BEE A;  4HOU A;  1OCC E;  1NA0 A;  4BEP A;  1JUQ A;  3V31 A;  5CCL A;  3SF4 A;  3HG0 D;  3LYA A;  3S7B A;  2L9B A;  3ZXS A;  3CV0 A;  5IY5 E;  2I6H A;  4GA1 A;  3UM1 A;  2X6I A;  4XEI G;  3RJV A;  1AP7 A;  1EDU A;  3KAE A;  1OWL A;  1IYG A;  3L54 A;  3GZS A;  3NB2 A;  4XE0 A;  1IXV A;  3C3Q A;  3UIN C;  3FU5 A;  4RG9 A;  1X81 A;  3QAR A;  2FUL A;  3DSV A;  1NFI E;  3IXE A;  3AG1 E;  2F8Y A;  4BSX A;  5AIJ A;  4BES A;  5BXO A;  1TR4 A;  2QZA A;  2J4B A;  3PRE A;  3AS8 A;  3QWV A;  3UUX A;  4FA6 A;  4XI9 A;  3PUJ A;  4U8H A;  5AAO A;  4M7C A;  5EID A;  4PS7 A;  4UWF A;  2PQR A;  3ONK A;  1D8D A;  4KVM A;  3TG5 A;  4UQY A;  4GZC A;  1TNO A;  3Q47 B;  3CK9 A;  2L0I A;  3ZYK A;  2H6F A;  5B1A E;  3V30 A;  3CVQ A;  5AQ7 A;  2OVB A;  2MRI A;  3K9I A;  4I6J A;  3UM2 A;  3D9N A;  2LO6 A;  3Q4A B;  4HI9 A;  2WXR A;  2P9I G;  2P9L G;  3O48 A;  2IQC A;  3BU8 A;  2VSX E;  2R5S A;  1UJK A;  3E4B A;  3S7F A;  3S7D A;  4AP2 A;  4JHR A;  3U66 A;  2X6H A;  5FZQ A;  4GTV A;  2KXP C;  5D2M C;  2ZU6 B;  4TUU A;  2PQN A;  3CVL A;  1Z6T A;  3HVE A;  3ZHE B;  1ELK A;  1UG3 A;  1EYH A;  4Y6C A;  1TNB A;  4G11 A;  3U3W A;  5KBA A;  2ION A;  3DSW A;  2IEJ A;  4GB9 A;  2WPV A;  5EIL A;  2PM6 A;  2XHE A;  5M72 A;  3HXC A;  3TXN A;  1QBQ A;  2H6G A;  5KWD A;  3PRZ A;  2AXV A;  1E8X A;  5CEC B;  4GPK A;  4NQ0 A;  3EUV A;  2GW1 A;  4OAU C;  1V54 E;  3E37 A;  3PNL B;  3QWP A;  4AM9 A;  2CFZ A;  1E8W A;  4R7L A;  4LG6 A;  1B89 A;  1QQE A;  2WM9 A;  1HU3 A;  2R03 A;  3DSS A;  2FO1 E;  2VTB B;  4FLB A;  4GZ5 A;  3ZUV B;  3EU9 A;  4AVX A;  4PUC A;  1N4R A;  5KCM A;  4NUR A;  4JB8 P;  2P2C P;  4HRL A;  3GZ2 A;  5BV0 A;  4DX2 A;  4UWH A;  1O5M A;  4HQD A;  2EIN E;  3FFL A;  1KPS B;  3CHP A;  3FY4 A;  2UY1 A;  3LPZ A;  4JVS A;  2FF4 A;  4FAD A;  1EPU A;  2XGS A;  4A3V A;  4MS6 A;  2L6B A;  2Y0B G;  3TAX A;  2PM7 A;  1N54 A;  4G26 A;  4HLL A;  1E8Z A;  3CK7 A;  2XPZ A;  3ZFW A;  3Q49 B;  4DLQ A;  5FJY A;  4UWG A;  4HVB A;  3FH8 A;  5EYP F;  1YYH A;  5HI7 A;  2AXU A;  2WQ7 A;  2VSN A;  2XEN A;  5AN8 A;  5HQ8 A;  2VSY A;  4DUI A;  4XX5 A;  2Y69 E;  3CVV A;  4I1M A;  4QFV A;  1RZ4 A;  3LS8 A;  3TG4 A;  5BNW A;  3PNT B;  3B7R L;  1TYQ G;  4WNG A;  3SGH A;  4H7X A;  4BER A;  1XNF A;  1ELR A;  3LY9 A;  3TWV A;  5EN5 D;  3PE4 A;  4B93 B;  2EIL E;  5JJ7 A;  2PZI A;  3OXG A;  4JA7 A;  2FO7 A;  3B7U X;  4OYS A;  4XIF A;  4ZFH A;  3U4T A;  1H19 A;  2XEV A;  4O60 A;  1WAO 1;  5FQ6 A;  4DX7 D;  4AEZ C;  2MYO A;  4GCO A;  2WMO A;  5JHA A;  2BED A;  4GTR A;  4Q94 A;  4B8C B;  1Y8M A;  2Y1L E;  4XI0 A;  2Y3A A;  2KCL A;  4I2W A;  2WXH A;  2OV8 A;  3DSU A;  1OXJ A;  4WND A;  1D8E A;  4CRW A;  3PS6 A;  4Y6W A;  2WXJ A;  2V0P A;  4ANW A;  2VGY A;  4F1P A;  3JUE A;  5BXU A;  4AY5 A;  2XQ0 A;  3EHM A;  1N0Q A;  1SZ9 A;  3FUH A;  2XPY A;  1S70 B;  5A7D B;  3GZ1 A;  3EHN A;  3PEU B;  2VGE A;  1G3N B;  4B8A A;  3ULE G;  4K5C A;  4WAF A;  3UI2 A;  2GRR B;  3APF A;  1VDY A;  3PUK A;  4L1B A;  3L13 A;  3CHS A;  1IHG A;  1MX6 A;  3S2A A;  1SZA A;  3ASD A;  3CR3 A;  4AIF A;  4GYO A;  4PDX A;  3ML8 A;  4YDW A;  4ABN A;  5ANR A;  2E2E A;  2BTD A;  2X6K A;  3CLJ A;  2CHZ A;  3URZ A;  4YVO A;  3RRM B;  4Z68 A;  1JWG A;  1LD8 A;  2J09 A;  2KCV A;  3ASH A;  1HS6 A;  2RG8 A;  4FHJ A;  5CRV A;  4JHK A;  5BPP A;  2I1K A;  3CK8 A;  3E33 A;  4O1P A;  3TWW A;  3Q9N C;  2DBA A;  4G8K A;  3GYZ A;  5LP0 A;  1U2V G;  2WXI A;  4M3O A;  4CDM A;  3CKC A;  3ENE A;  3DRA A;  4L2Y A;  3LEW A;  3NZS A;  3D9M A;  5AAR A;  2GRP B;  5HRY A;  2LSU A;  4HRN A;  5A6C A;  5FTP A;  1MQS A;  2VJ8 A;  3UKU G;  4B0Z A;  3QC1 A;  3QNK A;  4BTA A;  3Q9U C;  3ASO E;  2R05 A;  3SI5 A;  3AS4 A;  4BT9 A;  4RG6 A;  3ESK A;  4IRU A;  3I3N A;  3BG0 B;  1L5J A;  4U7E B;  5ENR D;  5ENO D;  2RKK A;  5HS0 A;  3WG7 E;  4GAA A;  3ISM C;  3FWV A;  5JJT A;  5B3S E;  4A1S A;  3KS2 A;  4AXH A;  4UI9 C;  3ZPJ A;  3PDN A;  1H2U A;  4GTO A;  3U64 A;  3MA5 A;  3CEQ A;  2R02 A;  4DX6 D;  3FU0 A;  1E96 B;  2VGX A;  4EBA G;  4CEM A;  4HRM B;  2AVP A;  1JWF A;  5ENN A;  3MCX A;  3CST A;  4NRH B;  1BPO A;  4EPZ A;  1D9S A;  5D0O D;  2NXP A;  3S7J A;  1SQM A;  4HNA D;  2F8X K;  3MKQ B;  3LVQ E;  3D9L A;  2OCC E;  4L7T A;  4OVV A;  1SVX A;  3T9K A;  1IQU A;  2V4L A;  3TL5 A;  3R7R A;  3CVW A;  4A1G A;  4CT4 A;  2X6F A;  3ULY A;  2A5E A;  3DXM G;  4LNG A;  4KMO A;  1TNY A;  3AS5 A;  4NIK A;  1MJ0 A;  2ZGG A;  2WXM A;  3T8K A;  5AJD A;  3DXK G;  3HXE A;  3Q15 A;  5EX0 A;  1WM5 A;  4HOR A;  4A3T A;  1HXI A;  3CSF A;  5JJ6 A;  3FTY A;  3UT7 A;  3MV3 B;  3KSQ A;  2F37 A;  4URK A;  4ANV A;  3IV0 A;  5BT1 A;  4U0Z A;  3R9M A;  4U8V D;  1YCS B;  4U63 A;  2WXO A;  4BTB A;  2J49 A;  3KD7 A;  2YHC A;  2J8S D;  4ATG A;  1E7U A;  3NOC D;  2KZT A;  1FT1 A;  4U0U A;  2I1J A;  3FTV A;  3CVP A;  1AWC B;  1DVP A;  2EQX A;  2Q7F A;  3I5P A;  4RQI A;  3TWR A;  2P9N G;  3TGO A;  3SY2 A;  3LJN A;  4EZJ A;  2EIM E;  4DX1 A;  4YDE A;  3C3O A;  5FQ8 A;  3IKO B;  1FT2 A;  4KBQ A;  5H7P A;  3JXI A;  3SD5 A;  3BUA A;  3C72 A;  3UT4 A;  3X2Q E;  3V2O A;  2XRY A;  5AEN A;  1K8K G;  4TV3 A;  1TNZ A;  2XRZ A;  5KJM A;  1MZC A;  3EDT B;  4YDO A;  4WUY A;  1ZBP A;  3J5Q B;  4IYP A;  3SHF A;  2AXZ A;  5B1B E;  1TN6 A;  5FQ4 A;  1N95 A;  5C2Y A;  1K3Z D;  5CMW A;  4G25 A;  3RRU A;  2WQH A;  2L0T B;  3DBS A;  4D10 C;  3U9W A;  1N0R A;  3QWW A;  3Q7F A;  2XGO A;  2WB2 A;  1KT0 A;  2VYI A;  3TJP A;  3TXM A;  2QY7 A;  3PEV B;  3I4R B;  4CGW A;  4RVB A;  5CRU A;  3ESL A;  4FP7 A;  3G2W A;  4GTP A;  4DI3 A;  3ABK E;  3ASG A;  3Q73 A;  4APO A;  1BI7 B;  2LXL A;  1BI8 B;  3FH7 A;  3Q5M A;  4JA9 A;  5FT9 A;  1DCQ A;  3UIP C;  3UXG A;  2BKK B;  4G23 A;  4LCT A;  5CBN A;  2JLB A;  4GYW A;  4GTM A;  5EIB E;  1IKN D;  2HYZ A;  4H7Y A;  2IOS A;  2OEV A;  1E8Y A;  1NA3 A;  5D0Q D;  1OCZ E;  3KSL A;  5EDS A;  4Q69 A;  3B7T A;  5FIN A;  1OWO A;  4FUL A;  5ENQ D;  4RLY A;  5BUZ A;  2VSO E;  5EYL A;  3PVL A;  5JHB A;  1HFA A;  3LXU X;  4JEH A;  2OVF A;  4TXQ A;  2ETA A;  5J08 A;  5FZS A;  4J8F A;  4HB5 A;  3HXF A;  2J07 A;  4DJA A;  2V8S E;  2ZIR A;  4NAC A;  4FJZ A;  4J8E A;  5G04 C;  3UPV A;  3P2B A;  1H2T C;  4F3V A;  3LY7 A;  3ULQ A;  3FH5 A;  4WNF A;  2XEE A;  1OCO E;  4P29 A;  4GA0 A;  2KC7 A;  1INZ A;  3LCA A;  4K5A B;  3APC A;  1WDY A;  3ZXP A;  2ILR A;  4U95 D;  5EX3 A;  4C0E A;  5LOZ A;  5KJN A;  2C2L A;  3OTN A;  4ANX A;  4JC8 A;  4PS3 A;  5T4Y A;  2WMN A;  2DZO A;  2LUH A;  5T8I A;  4BY6 A;  3C98 A;  3D9I A;  3G2S A;  1SA4 A;  2M63 A;  2E0I A;  3KEZ A;  4LSZ E;  4GTT A;  3SFZ A;  4V3I A;  3FUM A;  4UI9 K;  5ENP D;  3R7Q A;  2LAI A;  1TJC A;  3RK6 A;  4AY6 A;  3FUL A;  4HOQ A;  3CVX A;  2XPI A;  2J08 A;  4GZ3 A;  5AYW D;  5KJK A;  5A23 A;  4J7W A;  3IEG A;  2A5U A;  5LCW J;  3CVU A;  3TWT A;  3FUF A;  4TUM A;  2CG3 A;  2LXM A;  2RFA A;  1UW4 B;  4PH4 B;  5AJL A;  1A17 A;  1S64 A;  4FC8 A;  1LTX A;  4JW1 A;  2QYU A;  5CBO A;  1HG5 A;  2P58 C;  2XZD G;  1OT8 A;  3EHQ A;  2EIJ E;  5D66 A;  1S0P A;  2R59 A;  4BX8 A;  3DPY A;  2DCP A;  3E32 A;  4WNE A;  3ZHE A;  4CYM D;  4ACL A;  4PS8 A;  3ML9 A;  4GMR A;  1MYO A;  2H6I A;  3OXL A;  4I6E A;  3CHQ A;  3UKR G;  1E90 A;  1K1A A;  2XGM A;  2Y4T A;  4GTQ A;  2P9U G;  5G05 J;  1TJF A;  4G24 A;  4W9R A;  3SBS A;  4IN3 B;  4A63 B;  4N5C A;  3BG1 B;  4GML A;  4U96 D;  4FLH A;  3LY8 A;  4J8Y A;  3FUE A;  5CCM A;  1KLX A;  4XKB A;  3G2U A;  4MLP A;  3I4G A;  4N2S A;  4G8L A;  5LFA A;  4RSY A;  3ZRH A;  4BWR A;  4HOS A;  3AG3 E;  2C0M A;  2ZGD A;  3DPD A;  3Q78 A;  3FEX A;  2HO1 A;  5EKQ D;  2KCK A;  1YA0 A;  3QDN A;  3AAA C;  2VTB A;  3D9H A;  1RW2 A;  2IF4 A;  4GMJ A;  4AV7 A;  4CDR A;  5ARG A;  1HZ4 A;  1XGW A;  1N52 A;  5ARF A;  4ILG A;  3Q79 A;  3D9P A;  1SW6 A;  2AW6 A;  2IO3 C;  3PZ3 A;  3NBN B;  1ZU2 A;  3UQ3 A;  3B13 A;  2UWJ G;  2XS8 A;  3AJI A;  3JQ1 A;  4L23 A;  3MV2 B;  1N4P A;  1N94 A;  2WXP A;  3MEK A;  5AQB A;  1P5Q A;  3DSX A;  1NI1 A;  3CIA A;  2IJG X;  1BLX B;  4LER A;  2XCC A;  4K03 A;  4Q96 A;  3PZ2 A;  4U04 A;  3FTZ A;  3SBT B;  2LNI A;  4LEU A;  3W9G A;  3UIO C;  1MX4 A;  3QK0 A;  4DRX E;  4WWP A;  3JYS A;  4BET A;  3QOU A;  1HF8 A;  1QYM A;  2GRM A;  1H2V C;  2BF0 X;  4JZY A;  2PNN A;  1OUV A;  1Z3X A;  4F53 A;  3EIQ C;  5ITZ F;  3VTX A;  4BSZ B;  3CQC B;  3V79 K;  3SQV A;  1PAQ A;  3EHR A;  4ZHB A;  2NC9 A;  3FU6 A;  1W3B A;  3ZVV A;  2OND A;  2GRL A;  4EHM A;  2X6J A;  4U0S A;  2P9P G;  4LNU D;  3HXD A;  4N39 A;  4CGV A;  1H6K A;  1E7V A;  4KZ0 A;  2X38 A;  3HVE B;  3ZKJ A;  4EEC A;  3PZ1 A;  2R17 C;  2R2L A;  3ZYM A;  2GRN B;  3FTU A;  3T8M A;  5AQ9 A;  2IU1 A;  2AJA A;  1JCQ A;  3MKR A;  2NSZ A;  4N3B A;  3CQG B;  4KVO A;  1V55 E;  2FI7 A;  2PL2 A;  4F6R D;  1O1R A;  5T3R A;  1U3D A;  1KZO A;  4GA2 A;  1FPP A;  4GU5 A;  1FVH A;  1GW6 A;  3D9O A;  5CMY A;  2KAT A;  4JEU A;  3P1U A;  4GYY A;  2BUG A;  5G2N A;  5AQA A;  2DZN A;  3FUN A;  3MGB A;  4J6I A;  3EU5 A;  1H6P A;  2YIN A;  4ATZ D;  3LVR E;  3D9J A;  3UTM A;  4BFR A;  5J90 A;  3OXF A;  2RD0 A;  3LKU A;  5E76 A;  1ZB1 A;  2FEZ A;  4GTS A;  2V5F A;  3Q75 A;  2HM8 A;  4HS2 A;  2L6J A;  1SA5 A;  3QJZ A;  2UY1 B;  2C0L A;  2DYS E;  4U07 A;  1QNF A;  4WWO A;  4CCA A;  4O1O A;  3AG4 E;  2V5Q C;  3G2V A;  4XKC A;  1NZN A;  3MZL B;  3ZN3 A;  4EBA A;  1BU9 A;  4HBD A;  3D9K A;  2XS1 A;  3ZW3 A;  3VLD A;  5DIZ A;  3FP3 A;  2WXF A;  4K0R A;  4HOT A;  3ONL A;  3ASF A;  2DYR E;  1KZP A;  2ETC A;  3DEP A;  4KYO B;  2I2O A;  3QKY A;  3MX3 A;  5CHE E;  2V4H C;  2B0O E;  3E30 A;  4ME2 A;  2WVI A;  2DWZ A;  4UI9 J;  3L22 A;  3C5R A;  2H6H A;  4EQF A;  3SFY A;  4C0M A;  3MJW A;  4UQX A;  1UN9 A;  4APF A;  4MKT A;  3T5V A;  3UMV A;  3V2X A;  3ZU7 B;  3AG2 E;  1UJJ A;  4JL0 A;  2JEK A;  4L2L A;  5HKP A;  3W9F A;  4ANU A;  3J5P A;  2LAH A;  4I17 A;  4F1S A;  2GRQ B;  2P9S G;  2IY0 C;  4CT0 A;  3JCK C;  1H6O A;  4J0U A;  2WXG A;  2ZXW E;  2Y4U A;  3FUJ A;  4I1A A;  2F0Y A;  3N71 A;  4JHJ A;  2B6C A;  1IQR A;  2VQ2 A;  4YVQ C;  4TXP A;  2WQ6 A;  3FEY A;  3FUK A;  4G1T A;  5LX8 A;  3B95 A;  2RFM A;  4DK5 A;  3NF1 A;  2CHW A;  1OWP A;  4E6H A;  3B7B A;  3IHV A;  3L82 A;  1PC2 A;  3NOG D;  2QC9 A;  4KXK B;  1N4S A;  4DPR A;  5KNG A;  2DIW A;  3CKB A;  1OCR E;  2WXK A;  1UOH A;  3NQP A;  1OWN A;  3EJN A;  2EIK E;  2AWI A;  1UN8 A;  3L08 A;  4XZ4 A;  5LCW C;  3MKQ A;  3SFX A;  3FTX A;  3FU3 A;  3HHM A;  3EIJ A;  4YDY A;  1H0A A;  3O4Z A;  5FZR A;  2LSV A;  4A55 A;  4O6F A;  5FIO A;  4FU3 A;  1JCR A;  4I6G A;  4FJY A;  1HH8 A;  3VTY A;  5CED B;  5G55 A;  3TWU A;  3PZD A;  3NZU A;  5ENT D;  4C48 B;  3SO8 A;  2P9K G;  2GGF A;  3HIZ A;  1Y6I A;  3FUI A;  3L6A A;  3PE3 A;  1JPL A;  4WWN A;  5ANL A;  2WXQ A;  2YHE A;  2CG2 A;  3FTW A;  3FUD A;  3RRN B;  4C9B B;  3CHO A;  2HE0 A;  5G05 C;  1N9A A;  3CHM A;  4F7A A;  2YQ8 A;  3MYV A;  3TWS A;  2IO2 C;  3ZNG A;  4GCN A;  3D3M A;  4LNB A;  3RKV A;  4E85 A;  1TN7 A;  4AJW A;  3ZGQ A;  2IOL A;  4I2Z A;  1K1B A;  3UM0 A;  3VLE A;  2QYJ A;  3APD A;  2OOE A;  4B94 A;  5CEA A;  2XCB A;  2DVW A;  5FWQ A;  2IFU A;  2X3M A;  5KJL A;  3QAQ A;  3JUI A;  3LJ3 A;  4N3A A;  1O1S A;  3T5X A;  1TNU A;  4OAV B;  3FDH A;  5JA4 D;  3L9T A;  4ACK A;  5KNH D;  2KM4 A;  3HYM B;  4N3C A;  1OY3 D;  4MBG A;  1TN8 A;  4CZ2 D;  2ZIS A;  1DCE A;  1EF1 C;  4HXI A;  3RU0 A;  2HR2 A;  5FQ7 A;  3FHE A;  3B7S A;  2QFC A;  3NAW A;  2VGX B;  4IUL A;  1X5B A;  2WXL A;  4J8S A;  4GZ6 A; 
#chains in the Genus database with same CATH homology
 4B93 B;  4BSZ B;  3HRA A;  1DC2 A;  3V79 K;  4U96 D;  3NOC D;  2FO1 E;  3V30 A;  5AQ7 A;  4J8Y A;  2XZT G;  1BI7 B;  2HE0 A;  1BD8 A;  1BI8 B;  3EHR A;  4ZHB A;  5CER B;  2DZO A;  2ETB A;  4HI8 A;  1MX6 A;  3ZUV B;  1DCQ A;  2KBX A;  3EU9 A;  3JXJ A;  1AWC B;  4HI9 A;  3TWS A;  4DX6 D;  4G8L A;  3UXG A;  2BKK B;  4LSZ E;  3V31 A;  4BEP A;  5CBN A;  3B95 A;  4ZFH A;  3HG0 D;  4JB8 P;  3ZNG A;  2P2C P;  2RFM A;  4HRM B;  4LNU D;  4YDW A;  3TWR A;  3DEO A;  5EIB E;  1IKN D;  4O1O A;  5ENP D;  1IHB A;  3TWX A;  4HRL A;  2V5Q C;  4O60 A;  2ZGD A;  3LJN A;  3B7B A;  4DX5 D;  4DX1 A;  4A63 B;  1N11 A;  4DX7 D;  4N5Q A;  1D9S A;  3ZKJ A;  3NOG D;  1BU9 A;  2QC9 A;  4DX2 A;  2MYO A;  3AAA C;  4HBD A;  4Z68 A;  4HQD A;  4HNA D;  2BKG A;  3JXI A;  3D9H A;  1AP7 A;  1K1B A;  2F8X K;  2Y1L E;  3V2O A;  2QYJ A;  5KNG A;  2KXP C;  1YMP A;  5FIN A;  5AQ9 A;  4J7W A;  3DEP A;  1SVX A;  1SW6 A;  2ETC A;  2XEH A;  5ENQ D;  4GPM A;  2AJA A;  3T9K A;  5ENS D;  5CEA A;  2L6B A;  2Y0B G;  3TWT A;  1IXV A;  1MX2 A;  4TUM A;  3NBN B;  2DVW A;  4O1P A;  2V4H C;  3TWW A;  1UOH A;  3KEA A;  3Q9N C;  4HLL A;  2RFA A;  2B0O E;  4RLY A;  4U8Y D;  4G8K A;  1A5E A;  5EYL A;  3AJI A;  1NFI E;  5JMN D;  2DWZ A;  3TWQ A;  3IXE A;  2A5E A;  4QQI A;  5KBA A;  3J5Q B;  2F8Y A;  4F6R D;  4UUC A;  3C5R A;  5CBO A;  5AQB A;  4BES A;  2ETA A;  2XZD G;  5EYP F;  1OT8 A;  1YYH A;  3F6Q A;  3EHQ A;  1TR4 A;  5EIL A;  5D66 A;  5BXO A;  4K5B A;  4YDY A;  4HB5 A;  4F1P A;  1BLX B;  5AAR A;  4NIK A;  4OAV B;  3JUE A;  5JA4 D;  5HRY A;  1MJ0 A;  1K3Z D;  2XEN A;  2ZGG A;  5AN8 A;  5KWD A;  4HRN A;  3T8K A;  5BXU A;  5FIO A;  5KNH D;  4DUI A;  5CEC B;  1OY3 D;  2JAB A;  4QFV A;  1N0R A;  1N0Q A;  4OAU C;  4CYM D;  1S70 B;  5AAO A;  4CZ2 D;  3UTM A;  3W9G A;  3Q9U C;  5EID A;  1MX4 A;  4DRX E;  4GMR A;  2VGE A;  2XEE A;  5AQA A;  1G3N B;  1MYO A;  2DZN A;  4BET A;  5CED B;  3V2X A;  3ZU7 B;  3TWU A;  2F37 A;  5HKP A;  4K5C A;  4K5A B;  3W9F A;  1WG0 A;  1QYM A;  3J5P A;  1K1A A;  2PNN A;  4U8V D;  4BER A;  4C48 B;  5ENT D;  4ATZ D;  3SO8 A;  1YCS B;  5ENR D;  1WDY A;  5ENO D;  2NYJ A;  4LG6 A;  5HS0 A;  3UI2 A;  5ITZ F;  3TWV A;  4U95 D;  5EN5 D;  2J8S D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...