4DUYF

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 21
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4duyF00
1N33F 2BXJA 1J5EF 4GKKF 4DV5F 4DV6F 2YY3A 5LMUF 4DV0F 4DR5F 4NXMF 1B64A 1HNWF 1IJEB 4LF4F 4LF7F 2UXCF 2B7CB 3OTOF 4LF8F 1IBKF 2RJZA 4DV1F 4DR2F 4B3SF 3T1HF 1HNZF 2UUCF 1G7CB 5IWAF 4OX9F 4X66F 1XMQF 1I94F 1CQMA 2B7BB 1QJHA 4K0KF 1FJGF 2BVZA 1N32F 1N34F 2UUAF 4JI7F 4JI2F 4AQYF 1GH8A 4JI6F 4LFCF 4JV5F 2UXDF 1RISA 4DR4F 4LFBF 1VMBA 1XMOF 4JI0F 4DR3F 4YHHF 1IBLF 4LFAF 1HNXF 1G1XA 2VQFF 2J5AA 2HHHF 4B3MF 4DV7F 1N36F 4NXNF 4DUYF 4JI1F 4DUZF 4DV4F 5LMNF 4JI3F 1HR0F 4DR6F 2F4VF 4X62F 4LF9F 4DV3F 4KHPF 4JI8F 1IBMF 1CQNA 4DV2F 2KJVA 2KJWA 5BR8F 1IJFB 4DR7F 4X64F 2ZM6F 4DR1F 4JYAF 3T1YF 4LF6F 1F60B 2UUBF 3ZZPA 1XNQF 2VQEF 4GKJF 4B3TF 4LF5F 4X65F 2UU9F 2E5LF 2UXBF 1FKAF 4YY3F 4JI4F 1LOUA 3R3TA 4B3RF 5AJ3F 4JI5F 1XNRF
chains in the Genus database with same CATH superfamily
3CDUA 4CO5A 1PGZA 4AL5A 1SUQA 4OHZA 2BE9B 2AGPA 2AGQA 3DOMB 4KO0A 5DDQC 3TZXA 2UXCJ 1CS4B 4KKOA 1C1BB 4M5HA 4ZPAA 2CFXA 3LGMA 4JI0J 1SPBP 1MLAA 2H3EB 2J0XA 2BKOA 2ZBCA 1IKWB 4JB8B 3PRDA 2GVDA 4TVAB 3VV2B 2KM8B 2LP4A 1R43A 4IFYA 4N8OA 3PW0A 4BBYA 3V4MA 4C6AA 3UPFA 1P8GA 3T1HJ 4D3GA 3QPIA 3VAIA 4NLRA 3TANA 1B7YB 3LPEA 5ETLA 2XY5A 4A8SA 1TL5A 4ED5A 3DHWC 4TLQA 3FFIA 4C11B 3CMAS 1C0UA 1OSCA 3IRWP 1F3VA 2MZQA 1Y9OA 2CNKB 3DLEB 3R5GA 2O67A 2DKOB 3AB2B 2B4VA 3MUTP 2Z58B 3RAQA 4RNNA 2Y8YA 1B3TA 2A18A 3OTDA 5LMNJ 2G4BA 1FO1A 2X1GA 4RW4B 1HIYA 3IG1A 1S0MA 1MU2B 1VJQA 5T41A 4X66F 3VVUA 3RJMB 2C2OB 1I94F 1CQMA 3NGTA 4J37A 1FWLA 2VPXB 3BGRB 3HHLD 4USTA 1KDNA 2MLZA 2V8HA 2R2TA 2KB2A 4LSNB 2GGPB 5M2PA 4DL7A 3NNCA 1NK8A 1GMWA 2V69A 3GU0A 3UD4P 1TQLA 2CQCA 2VBZA 2ZZNA 4KV8B 2ZH7A 2RD5C 1RGVA 4HTIA 3BQ2A 1SJ4P 3KG0A 1ZPVA 3AA9A 3CSKA 1GH8A 3MMCB 1IQTA 2HBRB 2ACMA 4A8WA 2XWYA 4NA2A 3MTKA 2L08A 3N6LA 3N79A 4PXBA 3H4BA 2KM8C 1WDTA 4W92B 2NSBA 3OR1A 3C16B 2BRLA 2F3JA 3BS9A 1QUVA 3IR7B 4KGMA 4M5GA 3MXHP 1NJWA 4F50A 4B3OA 3FSIA 1YJUA 4LR7A 1RDRA 3DXBA 3SMZA 4Z7YA 3GIRA 4UUWA 3M2RA 1YK9A 4ZPCA 2QSFA 3QBCA 4EBEA 3NGUA 3W61A 6AT1B 3C14B 1B0TA 3ZTQA 1SV5A 1TKXA 2Y1RI 1TL1A 3KG4A 1Y5LB 3FMBA 2CIMA 2F8HA 2W25A 1X4FA 3VHQA 2VOPA 5DO2A 3MCMA 2BM1A 4EYHB 5DLFA 5I3QA 1PYTA 1IXKA 2OP5A 1UAWA 1KOHA 4I7FA 4USIA 5HANA 1Z2ZA 3ZNUA 2MGZB 2AQ4A 1KC8T 2ILZA 4XPEA 2KFYA 4FVCA 1NK5A 4OI1A 1HARA 2C1EB 3MMBA 4Y00A 3U7JA 2P8IA 4XTTA 3OPKA 4ELTA 3GR1A 1WI8A 5F9NA 2HFZA 2Z30B 1UPPA 2BANA 3HHKA 3UWTA 2MHEA 4F3QA 2VBWA 4A8OA 1HHTP 2FJVA 2FVRA 1D09B 5KFNA 2M0GB 1NZAA 1URNA 1JXVA 2HFNA 1LFPA 5F3ZA 2R7RA 2QV6A 3I32A 2A6MA 3DRSA 3CCES 2N3OA 2ZHBA 4DL6A 2CPJA 1FD2A 3W64A 1PBAA 2GO8A 4QWCA 4F4ZA 2RRAA 2NZCA 4HDGA 4BCAA 1VQKS 2YWKA 2VC0A 3M05A 3MEGA 4GO5X 1EJ7L 4L3NA 4NLPA 4OMFG 4WIIA 5AXKA 5C5JA 5GAGI 1KLMA 4F04B 4CIOA 3BO2A 2C2DA 1NJXA 4ECWA 2IJNA 2D3O1 2Q66A 2V4JA 2UUAJ 2MTLA 1UPMB 1RZMA 2CVEA 2DGXA 3P8BB 2QL9B 1YZ6A 3BR9A 3NMAA 2VONA 3TZYA 2CG4A 3VAHA 1NKEA 1Y4ZB 4JI6J 1GXLA 2KN4A 1SKWA 1DQ8A 1JLBB 3BDEA 4IH7A 2DPJA 1GX5A 4PQUB 4EWTA 1PKUA 2DRDA 3MAQA 1HQ2A 1FE4A 2M3DA 3F41A 4H4KC 2GIQA 3TJAA 3H4DA 3D6MB 2VBXA 1RKJA 1AXQA 2XSJA 2HQ3A 3OXFA 4KT0C 5KFBA 4F4XA 1YX2A 1T3OA 3N5BA 4FVMA 3QATA 3J7AN 1FJCA 4RX6A 4UTGA 3O3LA 4PG6A 3AQOA 3AH6A 4DSLA 1HW8A 1N5VA 2DH9A 1S0VA 3MZIA 1TL7A 3BGOP 5JMNA 3WIVA 4PG7A 3BF4A 1X5SA 2IAJA 2X51A 4IDKA 2BYCA 2CZ9A 4HACB 2AYGA 2YPYA 1FXLA 5DGAA 5DG7A 1R8AA 2B5JA 2HKEA 1VGYA 1GXTA 4LR9A 4NZ6A 2UXCF 1CC7A 3R2CJ 4WZQA 5K8OA 1CJVA 2CPZA 3VGVA 2ZH1A 3R1HA 4DV3J 2HIQA 3AAWB 1YJ7A 2LQ8A 3CJQA 4Q5VA 3CCMS 3HD1A 5T7LB 3ZFVA 4OJ1A 4PXDA 1T95A 4G3IA 3T41A 3SQGA 3Q89A 2VPZB 3GV5B 3T1HF 2EC0A 2UUCF 2RS2A 2IM2A 2HRYA 1KVJA 1BGXT 3EPIA 2P9EA 4DPYA 2CQBA 2E7XA 3KG1A 1S79A 3LOUA 4J9NA 2NPFA 3LW5C 3AHPA 4OYWA 2MJNA 5B0AA 3NNAA 2BABA 3HPOA 1HBNB 3Q2SC 5FLXU 2R7XA 2YBVA 3EYZA 3TA0A 1A6LA 2IM1A 2NUUG 1X0PA 3KLFA 4Z37A 1RAFB 4WP9A 1G3OA 4JI7F 2W2NP 2FLNA 1KNZA 3QJJA 4DR7J 3OHAA 5DG9A 2CQPA 1JLCA 4BS2A 3QT6A 1F9HA 3TZWA 2OUGA 4DSFA 2P6SA 4ILLA 1S48A 1MMLA 4K2JA 1YQHA 2JOQA 2HHPA 3CGIA 1CPZA 1LW2B 1UJ6A 3HO1A 1Z2LA 3M9MB 1FWPA 2C2EA 4YUDA 3J7YU 3JS9A 4ZKAA 3QGGA 4C8ZA 1NJYA 4M95A 2X1BA 1XIQA 2DNLA 4RNOA 1RHUB 3LO3A 2B9EA 3LQVA 4G6VB 4J7CA 4PG5A 2C2MB 2EFGA 2A6OA 1N5TA 3GV8B 2UXBJ 4PAAA 4O23A 4QU6A 5KOXA 1ACMB 1RAAB 3O6QA 3E01B 4AUKA 5IT0A 1HR0F 3LAMA 3MCNA 1NM2A 3SSRA 2UVVA 4O44A 4PPZA 3H59A 2E5HA 2HAFA 2HFSA 3UR0A 2DCUB 2BZ2A 1F6TA 4BLGA 3WX4A 2AGOA 4PWWA 2DJWA 4U67Q 2DR6A 2V2QA 4USKA 2V50A 2HVEA 2Y3YA 4U8VA 1MWZA 1WHWA 2QLWA 5C24B 4HKQA 3KLEB 1IBLJ 4F7VA 4JI3J 3I55S 5IC6B 2KTQA 2MKYA 4F3OA 3MEDB 3SDEA 2WOMB 2GX8A 3HFKA 3PXGa 1ZM3A 1F60B 5KG3A 5J1PA 2OPQB 3ZZRA 2AJ4A 3FK4A 4NRUA 3DLGB 5KT7A 4BWJA 4J9RA 2EVZA 2IM0A 2PE8A 2E5LF 2NYHA 4KH0B 3U1NA 3BN7A 3PHTA 2YNGB 3SCJE 1AUSL 2MKJA 2HNDB 3J7A1 2D3OR 2PD1A 1DFDA 2V68A 1JLGB 2MY8A 4LSLB 3OHBA 3H90A 2O3DA 1N5YB 3BPDA 4JI5F 4ZPVR 1RT2B 2IC3A 1IBMJ 1KP6A 4URGA 3G2XA 2Y9HA 2ZKUA 5KTQA 3RB3A 1HYSA 5C2GA 4JP8A 2PSZA 4ZVEA 2W9CA 4ED1A 3NWGA 1N52B 1IKVA 1MWYA 3A3PB 5ETTA 5KAKA 3ITHA 4YQWA 1VDHA 2XCPA 4PYDA 1UVIA 3AD8C 3GYGA 4IQMA 1R6YA 2U2FA 2OMOA 3DOLA 4OZ0A 1BQNB 3NP5A 2MQLA 2Y1JA 3ZNJ1 3OL8A 1SQGA 4IOCQ 3DHXA 4A8FA 3RAXA 1R89A 3CJ5A 3AODA 3FSXA 2IPOB 5FD1A 3VVTA 3HI9A 1L3TA 1HWLA 5B09A 3C46A 2DIUA 1HNVB 1XBWA 1R8HA 2J7WA 3FBFA 3ILOA 4KTQA 1PC4A 3W60A 2DITA 3UDVA 4O3QA 3BPSP 1JJ2R 2AEFA 3PW7A 4IRDA 4B02A 4NLQA 2HHSA 3GJRB 1FRJA 5C42B 4C8YA 2RSQA 1QSSA 4MKVA 1J27A 1S1WB 4CO3A 1EIYB 2IMOA 2IY5B 2LU1A 2ZH8A 4CLWA 1X0FA 2G0JA 2XGPA 2XYHB 3OW2R 2J8AA 3LP1B 4P2MA 4W90B 6FDRA 4CLSA 2OKQA 3HFZB 2H5IB 1OY6A 3CE8A 3T5KA 1RE1B 2W9AA 2Z2LA 1CJUA 4WYWA 1Q81T 5RUBA 1XNQJ 3D1HA 4USJC 4ZCMA 5D4OA 3MM5B 3R5JB 5CZVA 1WC1A 4DCPB 3SCLE 3MMBB 4J5OA 2JEJA 2PMHA 4I1TA 3KJVA 3SQGB 2XLKA 2IBKA 4P52A 1J2VA 4QYRA 5KFRA 4UOGA 4ZHRB 1TMMA 1TMJA 2XSFA 3IRXA 1O6XA 3RRHA 3OSPA 1TK5A 1N5SA 3ENVA 5CD4A 1Q79A 1QVFR 1UFWA 4PKDB 4TYAA 5F8GA 4K50A 4JI0F 2QFJA 3OFEA 1DARA 3U1MA 3V2UC 1NSQA 3MM6B 3CF5Q 3W5XA 3I82A 4ZOSA 4W4MA 5I3UB 4YMEA 4QIWD 1VQNS 2GQQA 3LP0A 3DU6A 4FNIA 4HR2A 3Q8PB 4AXJA 1AROP 3DU5A 3EDQB 2M9KA 3FRZA 3GJQB 3L4BC 3G8SA 1NKCA 2J9DA 2POKA 2M70A 3MMCA 4DX8H 7FD1A 5HP1A 2CJKA 3W66A 2VPYB 2AX1A 1GQEA 3E3XA 3S01A 1OWXA 3MOZA 1N6QB 1PYOB 2IA0A 4OYMA 1FWKA 1KHWA 2XULA 2VJVA 3QLHA 1HMVB 2A10A 3QZ7A 3KK3B 1IM6A 1WKKA 3OFHA 4I6AA 2OEJA 2XTJP 2W2MP 1UVJA 3AOCA 4KPCA 4ECRA 4LF4J 4QU7A 3D7SB 1KRPA 1HL6A 1SJRA 4N47A 3JAMY 2W4CA 1RTJB 3A3OB 2N3LA 3TA2A 3UD5A 4YHHJ 3KLEA 2ZM6F 2FYXA 2OMLA 3LP2B 5THWA 4R8UB 4PQUA 1G2EA 1NDKA 2FHJD 2PIIA 1S9GA 4NMXA 1SXLA 1UZDA 3ZZPA 1TP7A 2RDDA 2B56A 4EEYA 3Q2TC 3KHGA 5GAEI 4R0JA 1SKUB 1SIZA 3ENWA 2APOA 5IS2A 2HFOA 1FJEB 2RIJA 3P45B 4NL5A 4EO6A 3DRRA 2B4PA 2R7WA 3R3TA 5U47A 4NMLA 2FUG9 1HA1A 1EAYC 3GIIA 2GO9A 1OSDA 3R27A 3OVAA 1HBUA 5B0CA 2DR5A 2AYBA 3TEHB 2L9DA 4ZVHA 1X9SA 1IN0A 3MR2A 3M1VB 4RU2A 3QYYA 2MQQA 1DHMA 1U45A 1HQEB 3N4WA 4A4JA 4JBCA 5F8HA 3PVXA 2MZSA 2W2QP 5KFYA 4ED8A 4ZMMA 2BKPA 3MPDA 3RGIA 4C97A 2QA1A 2R2RA 3PTWA 3NBPA 2CDQA 1JJCB 3PCOB 1FHTA 1RQ0A 4F36A 4ZITA 2YKMB 5ETMA 1T7PA 1HD0A 4EI2A 3HZEA 8RUCA 4AQYJ 4ATNA 3GIKA 1TKTB 1U25A 3AFGA 3OTOF 4LF8F 1RT5A 2I9SA 1U47A 2IRYA 2ZKTA 3C15A 1IKYB 1LKZA 3GYNA 4ZN1A 3G6XA 1XR7A 5JVGQ 2M7SA 1S9GB 2CZ4A 2BA9A 1N5YA 2YKPA 3M4XA 4DR2F 3Q0AA 4FYXB 1VQ4S 1JMTA 1NBEB 4LSLA 2JRSA 1ROFA 1RTIA 2RNEA 3P5TL 3QGHA 4O3PA 4U6PA 2DR7A 4NI2B 4A47A 3M8RA 1PAUB 5DRKA 2VKRA 2W8LA 4ED6A 4I67A 5KG4A 1ITPA 3M7VA 2ZE2A 1WC4A 2R7UA 4OYZA 3CO9A 5K8NA 4CO2A 4RUHA 1TL3A 2BE2A 2R8GA 4M94A 3MECA 9ATCB 4P71A 2OJ3A 2JLGA 1FTRA 2QRRA 3MMAA 3V81A 4MK8A 4IRKA 3BSAA 3V6HA 5C24A 2ZHAA 2E1MC 3MAHA 4DX6A 3CT9A 4Y34A 1LWCA 4UZBA 1RISA 1VRQC 3LAKA 1SBRA 2XMJA 2HIYA 2HS3A 4DUZJ 2ATLA 4M5KA 3D2WA 2R8IA 1TL7B 5L8RC 3SSQA 3THPA 2DCLA 1AUDA 2D41A 1DZ5A 1FJGJ 2FJDB 4USVA 4NLGA 2E7WA 4ZA1A 1WHXA 2EFQA 5ETSA 5L46A 1J5EJ 3EM1A 2BV3A 1WTFA 4F3MA 4WF9Q 1TR0A 4I2QA 2XZTB 3MUMP 3KUEA 4I69A 1FNOA 1YDLA 2KG1A 4ID5A 1U8SA 1C0TA 1VC6A 4NA3A 2J8SA 3DCAA 3K5OA 5I42B 4U8YA 1VC0A 4JI1F 2IC3B 3TEGA 2D69A 1D9DA 3DYAA 2HSEB 1HQUA 1XTZA 4OJHA 5D4NA 4RW9B 3GG1A 4DOZA 1SVDA 1S1VB 2F9JA 3KKFA 1RXOB 3T3FA 4JI3F 1CVJA 4DR6F 2DHGA 1V3SA 4MKAA 3FGVA 1I3OB 1NXIA 1RCXB 3DMJB 4FKYA 5CXTA 2XNRA 1M5KC 1GXUA 2V8PA 2CWKA 3RR8A 2DNHA 3ZZTA 4J9VA 4GMKA 2BKNA 3W9IA 2WONA 4MFBB 3MEEB 2LA4A 1S9FA 1LXNA 4C0BA 4M5DA 3MEGB 4URQU 5KG7A 2MDAA 4X4NA 2EBEA 4ZVSB 3MFHA 2A0FB 2W4PA 4B3RJ 3A1YG 4K0KJ 1DQAA 4OJGA 5IWAJ 1P6TA 2MYFA 2WONB 1IUJA 4MFBA 2FLPA 3K8WA 3RR7A 1TU0B 4CI0B 2J6TA 3DOKB 1WG1A 2VG5B 3CVKA 1FKOA 5HN0A 1VBYA 3DRXA 2AJ0A 1K1QA 3CIZA 3FJ2A 5KT2A 3PV8A 4YY3F 1K9MT 1QLNA 3VQSA 4J9LA 3TAQA 1VQ6S 2CPXA 1TAQA 3EGWB 4JV2A 2YH0A 1S5ZA 1NNDA 3RB0A 5CYJA 3EUNA 1NO8A 1REVA 2ZM6J 1RAHB 4QWBA 2HQFA 4NA1A 1RWPB 1FEEA 4IG0A 1UP1A 1TTHB 4FDFA 5E3CA 4WZMA 2ZC3A 1BQNA 4OQJA 1RP5A 1NHKL 2VG6B 4DQRA 3KLVA 4IG3A 3S6EA 4DV6F 1RAGB 1HQEA 4IO9Q 2HWIA 1IBCB 3AD9C 4FPIA 3OLBA 1S0OA 3RBDA 4OYAA 2A3JA 5B7WA 3L95X 2ZJQQ 3I5BA 5AXNA 5CD4H 5L1JA 1XK8A 2OEMA 3GR0A 3GE9A 1FK9A 1YBTA 5KFGA 2VFSA 1FD8A 3DN9A 4X62J 2PT0A 3ISZA 4K59A 2DB1A 4FBTA 2QC3A 2YWEA 3U27A 4UQGA 3I0SB 4K4ZA 2FZGB 3H5YA 3RBXA 3M8ZA 4DFJA 2YX4A 1V5IB 3C3LA 3PYEA 2ZD1A 4TQRA 2AP6A 1VBZA 3R97A 4DQQA 4IFVB 2ZC4A 4OX9F 3G96A 2F4VJ 2CJBA 2VU5A 4Q43A 3PZPA 1K73T 4DQIA 1WEZA 3KTQA 2JH3A 1QJHA 2ZD1B 4M1KA 3ZZYA 5D0EA 2KT3A 3EXYA 1DTTB 3I5CA 3EMTA 4NLYA 5F41A 1NH7A 2AX0A 3IGVA 1LWEA 2H65B 4WBFA 1M5VC 1GFWB 2LXIA 3HJVA 4KSEB 3EPGA 2BDPA 4DV2J 4ZCKA 1K8AT 1VQ5S 4XPCA 5FDLA 3G71S 5DM7Q 5F8IA 2L9NA 4OZJA 4YR2A 3J7Z5 1S6UA 5BYSA 1G4CA 1O51A 3AD7C 3HVAA 3NBPB 1YJWS 1KQGB 2FGOA 3M8WA 4IFYB 3TR5A 2QIFA 2GV1A 4USMA 3H20A 1T02A 2WHOA 3D6FB 5A2QU 2XC9A 1WJ9A 3PYGA 2NUHA 2FY1A 5E3PA 2OLWA 3G87A 3UO0A 1HNXF 5E7OB 4P6QA 1VQLS 1G1XA 1JX4A 2MZ1A 2DEJA 5F0WA 4DV7F 1QTNB 1WC6A 4DUYF 2OD6A 1GEHA 4Y2AA 4NLXA 4CRJA 4DUZF 1JJ4A 1RT3B 3DOLB 3MDFA 1TV6A 3EXCX 3N28A 2YWFA 4NX9A 3W5YA 4EUVA 2DR9A 1CJTB 3VAJA 1UW9A 2P5VA 2RE1A 2ZEJA 4G1QA 4DQSA 2EFPA 2GMLA 1PG5B 4NASA 4MT1A 5LSLA 2WBRA 1S77D 1A9NB 1RWNB 2FIUA 1VQOS 1R0BG 4KBIA 4M5LA 4WE1B 2VHGA 1CJUB 3J81U 3S1TA 4NWBA 2AJ2A 2LLZA 2V2ZA 3GCXP 4OX7A 3S8SA 4WK1A 4C8OA 4LVOP 5GADU 3KHLA 5ADZA 3CD7A 4OI3A 4LFAJ 4UUXA 3GFZA 3D3CJ 3H98A 1S97A 3JTNA 4DPOA 4WU2A 5H9EK 4TY8A 3F56A 2EKYA 3AQPA 3MECB 3UVJA 4DR4J 2HHWA 1YSJA 1S1TA 1UWBB 3A8EA 4CNYA 2KKHA 4I56A 3CC4S 3LUYA 4QYZJ 1RBAA 4OZ3A 2NLWA 3DLJA 3I0RA 1RWOB 1Y11A 3QFWA 1CSJA 5LOQA 2YNFA 2MQOA 2XMTA 4DSIA 2OPPB 1ZM9A 2HWHA 3BGUA 3F0NA 5KFUA 3IS9A 4C4WA 2BE7D 1FEHA 1H2TZ 1S1VA 2HQGA 5E41A 3KJFB 1FK9B 3NCRA 5CYQA 4RPFA 5HMZA 3CCLS 4B3RF 4OI2A 2HHXA 2JEIA 1MWQA 3RYLA 5T14A 2XQCA 2GIFA 4YN3B 2CQ1A 1TVRA 1X4EA 2QN6B 2ZZTA 4QJVA 3TX8A 3CCSS 4F67A 1V3ZA 4A8MP 2V8VA 3GLJA 1HPZB 4NEZA 2I2YA 4WCEQ 3DM2A 4KE5A 1HI8A 5B08A 2LDYA 2J7UA 2Z2YB 1IVZA 5HLFB 3J81j 1PC5A 3ZTPA 1N56A 1NSAA 1WHVA 2AW0A 2XSJB 2XWXA 2MKSA 4OL8A 3KMSA 1SQFA 1JXEA 1PJ5A 2ASLA 3D9BA 5LJ5Y 1PIEA 3GCWP 3O2IA 2DVIA 3CPWR 1U1PA 2CUYA 4LF7F 2V6AA 3UW1A 5J2NB 1UVKA 1LW0B 2W2PP 2HLUA 4UQTA 3KJQB 5KFLA 2YPZA 5KOWA 1N4LA 2OPSB 4YB1P 3IGNA 4QWDA 2XM3A 2E9RX 2E9TA 3G6VA 3CMQA 1AT1B 4BWMA 1C1CA 1UJ5A 1HI1A 2JNJA 3EGVA 3EZUA 3D4JA 5D0HA 3K59A 2ZH4A 4KHPJ 2HHTA 1REVB 4M5IA 4B3SF 3SDEB 3D0IE 3TYTA 3VGTA 1G7CB 2DNNA 1ZTWA 1YBUA 1Q8LA 1UA1A 4QR0A 2I0XA 3DRSB 3CIMA 2JC1A 1WD6A 3BR8A 2DY9A 4ZVTB 1FKOB 3QGPA 3V6DA 4JYAJ 1FJGF 1H72C 1WSVA 4PCQA 1EB0A 5EUHA 4NLTA 2ZH6A 2Z56B 3D6TB 3G86A 2E44A 2QYCA 1L3VA 1ZH5A 3OSNA 5A0YA 4CNZA 2FHMA 1LW0A 1W26A 2KHCA 1JLQB 2K1RB 1QDUB 3UNGC 4ZIVA 4DSEA 1T3NA 4OI4A 1R8BA 2IVMA 5KFQA 2OEKA 5H1SV 5D0RA 3JTOA 5K8PA 3NAHA 1U1MA 3JSMA 1EKRA 1OMSA 1K0TA 3OD2A 2U1AA 2CPYA 2BJ3A 2B9WA 4J9OA 4PEOA 1ULRA 4PXEA 4CLUA 1YRXA 5HATA 3A13A 1NHUA 4KKOB 1BQMA 4DR3F 3HKWA 2UV8G 1XC9A 2PA8D 2XMUA 3DM2B 2MY7A 5HVHA 3LWLA 4RW9A 1N88A 5EHHA 2OSQA 1U1RA 2W8KA 2HHHF 3TWZA 5A8KB 3C19A 4XDCA 1IWAA 4NXNF 1PILA 3M30B 4ID8A 1T8EA 4KY3A 3T5HA 2DGUA 3HLUA 4F0HA 4ID5B 4ANCA 1QTMA 1B99A 4OYBA 4TLRA 1HWUA 1LWFA 1RKIA 1N48A 1T9WA 1U1QA 3VWSA 2VH7A 3CD6S 2KRRA 4K4YA 4C98A 4ED4A 1CJKA 1BWEA 3BM7A 4IG0B 3K2YA 3GJSB 5DDOC 2HVIA 3IRXB 1M90T 4RNMA 4ZP7A 3V6JA 3QSYB 2D9PA 3N6NA 3OFFA 4FF3A 5KT6A 5HROA 2K7JA 3RU0A 3PRVA 4DV2F 5DQIA 4LRBA 3ZTOA 1RTIB 1U1OA 1KN6A 1VHIA 4RNHA 2WCXA 1A0OB 3UD3P 1EQ0A 4B08A 5ITHA 1YJ9S 2KFNA 1O8BA 4GKJF 4AE5A 3T6JA 1EX8A 4LQ3A 4KC5A 3LA0A 2AEMA 4M8LA 1CJVB 1V3RA 2DH7A 4A8QA 1L3UA 2AZ3A 2DISA 4LVNP 4UW2A 1WOOA 5A8RB 2AYEA 1LOUA 2ROGA 3E51A 1NPPA 3WQPA 4F0KA 3GIJA 3R5BA 1TV6B 2IDLA 5E33A 5GAGU 2IAJB 3OUYA 2IMWP 4QIFA 4ZVGA 5C25B 2JX2A 4NRTA 3NMRA 1MMNA 3T19A 1ZS6A 5A8KA 1JLFA 4H4OA 1GMWD 4OYPA 1E6VA 2RDIA 3CC2S 3OR2A 4W98A 3IO1A 1WG4A 3CDAA 4AYBD 1MNEA 2VG6A 4DV0F 1P1TA 2I5JB 1FVSA 1JLFB 3DRYA 3I96A 4H4OB 5GMDA 1RYSA 4B9UA 1JLEA 2G1HA 3DXSX 3I9ZA 2LU2A 1NU4A 4HHUA 3TRGA 3VCDA 1XMBA 4CLKA 2FC9A 3MM7B 5C25A 3ZZZA 4J9MA 5HAOA 5SUHA 2JHEA 2ZBPA 3CEDA 1QD1A 2F9DA 3HD2A 3MHYA 1LV5A 2KYXA 4Z7CA 4IYQA 1SIWB 5IT9Y 5FDLB 4JI2J 1U0SA 2ERRA 3N5FA 1H73A 3HFVA 2WB4A 1U09A 2P2CB 2CJAA 2D1CA 3BZQA 1D8ZA 2AYMA 1XR6A 2ZBQA 2Y0BB 4HHJA 2C3UA 2RQKA 5HMYA 1ZETA 2LDIA 2QSWA 5CAAA 4LBHA 2G2YA 1KLMB 2MQPA 2I38A 4R8UA 4F0MA 1T11A 2KXNB 3IS9B 3TZZA 1OPIA 4X4TA 4ICLA 1YJVA 1XMQF 3DGPA 4ZP8A 2WVFA 3DFEA 4ECZA 3FRYA 2V8DA 4CM0A 4KV8A 1BQXA 4WTYA 3FZ2A 4DMZA 2OFGX 4LSZB 3J7ZT 2UUBJ 4Y2IA 3Q8SB 5DZ7A 1N32F 2UZAA 2DNGA 3FEXB 4MYUA 2OTJS 1VHFA 2E7VA 2YQ0A 2F65A 4PRFA 4C8KA 1DLOB 1WEYA 2M4MA 4JV5F 3VGSA 1WUUA 4AFFA 3QWUA 2V5HG 2JDJA 5ETRA 3AJ2A 4OLPA 1WOSA 5DS7A 1WKLA 2MQMA 2B9YA 2XMWA 3C6UB 3Q23A 4LF5J 1IKYA 1FE0A 4FBUA 5EX0A 2R7TA 1VQYA 4CH1A 2UVRA 1CULA 2YTCA 3JQJA 5HLFA 3C14A 1EKSA 4I2QB 1RI7A 2CJXB 4CLPA 1LWFB 1VC5A 1SJQA 2YX1A 4IG3B 3MMJA 4TNOA 1XJWB 2J5AA 3PACA 5J1EB 1WNEA 1FRXA 3HSGA 3C6UA 2QA2A 3CC7S 1RWMB 5L39A 1JLEB 3MTJA 1FDBA 4Q45A 2GVDB 2HHUA 2UU9J 4GKKJ 1JIHA 3QRPA 1VK3A 2RU9A 2DK2A 2KVIA 3HVTB 1DLOA 3MM6A 4M63A 2C42A 4DX5A 3SIPB 4ERDA 4C8LA 2Q43A 4UOCA 1RADB 5K9FA 2XS7A 3UI3A 1DJ0A 2P9CA 2W1BA 3MM9A 4K2XA 5D4LA 5A0YB 4DV3F 4FS1A 3Q86A 3PIOQ 1SUQB 3BKFA 4WK3A 4FF2A 2LA6A 1YJTA 1PO6A 1R0AA 1RAOA 4KIAA 1K1SA 1IKXB 4DCJB 4NXNJ 5KFXA 4M5MA 2K1RA 4USWA 3WX8A 3CCVS 5EWFA 3CDBA 1FXDA 2EI5A 2M5YA 4ECTA 3D3BJ 2YKOA 4LF6F 1U8WA 3CCJS 3W7BA 2QE5A 4KRWA 2B9XA 2PEBA 5CZXA 2IRUA 4Y6IA 5ETVA 1GMUA 3ILLA 3NAIA 2IVFB 1XR5A 1VS3A 3IAS9 4DX7A 5IC4B 5HO4A 2NS1B 2HZVA 1JKHB 1Y00A 3IMQJ 4FYVB 4DL0C 2MKKA 2Y8WA 1C0UB 2J0WA 4C9DA 5F9LA 2FJBB 5KFOA 5GADI 4CZCA 3IP0A 2JL9A 2B0GA 2KT2A 3GZ7A 3G82B 1Q53A 3H5UA 3HKZD 3M9NB 3NS6A 3DC2A 2DXFA 2ZVIA 1FA0A 1HQUB 1X4GA 4KR0B 4KYZA 2L41A 1UA0A 2GC8A 5C42A 2V8GA 1RBOB 2B4UA 3M6WA 4QQBA 3IM9A 2NXJA 3QT5A 2BOPA 4X84A 3MD1A 2R7OA 2FY8A 3GFYA 1HNXJ 4Q8EA 1WOPA 3Q8RB 3R5CA 1S72S 3TUPA 5HP1B 3PW2A 1MG7A 2DHAA 2OSRA 3JSRA 4YFUA 2KDOA 1HPZA 4WP8A 4PZVA 4U95A 3RBEA 3H7HB 4NXMF 1W25A 3G6ES 5A6WA 3TVKA 1RHQB 2K3IA 3H42A 2ADCA 3EVOA 4A8XA 5M2RA 3KK1A 2VUGA 3CWJA 1NSPA 2R8JA 2QJ3A 4YP3A 1JWWA 4CO0A 1HNIB 2HS0A 3K8VA 5CYMA 2R2UA 4FNHA 4FXDA 2DT9A 4IH6A 1KS2A 4P73A 1BQMB 5BR8J 2UVUA 2QLBB 3OL7A 2B7CB 3MMAB 4CH0S 1QSLA 3GSIA 4GC6A 2F40A 4MJKA 1XWLA 3HT0A 1M5SA 2KHDA 1FFSB 2LEAA 4LQ9A 1XNRJ 1U48A 1S1TB 1UWBA 1M1HA 4B9TA 4JI8J 1S12A 1TKZA 1ZA2B 1H2UX 5L9XA 4QIGA 3QIDA 3M8QB 1WF2A 2OH2A 3PYFA 4I6WA 1B7FA 5L38A 2O01C 3QT7A 4LMZA 3CJ3A 1F5CA 1RT4A 2NYIA 4E2FB 4URSA 3P6YC 1OYDA 2MQNA 2IBOA 3IC1A 1PBUA 3R7NB 1IBKJ 2AF6A 2PGCA 3K5MA 4NE9C 3FEYB 1TKTA 4R5PA 3ISND 4RW8A 3H40A 2C22A 4WKRA 1ELOA 2PFFB 1VIOA 9RUBA 4QR2A 4Y65A 4ENOA 4JI5J 4LFCF 3L09A 4YDXA 3C8YA 4JUZA 4LFBF 1TZ0A 3T1AA 4CLFA 1VR6A 1QAIA 4Q8FA 3IWNC 4C0OC 4OYOA 3BH6B 1LEOA 1AZSB 2G1DA 2F1FA 2QMWA 4DL3A 1XMOF 2M8DB 2XGQA 1UJ4A 4CM2A 1C1BA 2GQCA 4FS2A 4G1QB 2ASDA 1EARA 1OJ4A 4DS4A 4OZ2A 2EEYA 3SXLA 3KMQA 5KFZA 3M1VA 2YQ1A 2ASYA 2VBYA 5M2UA 1Q82T 1KQFB 1N36F 4DWIA 3D54A 4K4UA 1RT1A 1R8CA 3H8YA 1F2HA 2IFXA 1UL3A 3PO5A 3QAEA 4DPWA 3O8WA 1BD6A 5LMNF 2XO7A 4FYYB 5E0OA 1JLQA 4ZLNA 3DRRB 5DG8A 3R7SB 1IWGA 1YG0A 4ZJLA 2G2ZA 3MM8A 2QMUB 4E8UA 4PUOA 4ED0A 1SKSA 3CJTA 3R9LA 2ZHOA 1FKPB 2YNHB 3D5MA 4RW6B 5BYQA 1B0PA 2FVSA 4UY8T 3QJLA 4KHPF 2LCWA 3W5ZA 4KGZB 2CNLB 3DLBA 1Q8KA 4JV0A 2EPIA 1MMDA 4QW9A 3VAMA 3KNAA 1CQNA 1EP4B 4QW8A 3QZ8A 3K17A 2RAQA 3LP1A 4AL6A 4UOHA 3LANA 1UCNA 2OAUA 4R5PB 1FERA 2EK6A 3RB6A 2V2KA 3FNNA 4UOFA 1XNQF 2XY7A 4MK9A 1VBKA 2CPHA 3BBCA 2HBZB 2XLIA 3CJRA 5IOLA 4X65F 5KG2A 2HQCA 3NRBA 3IM8A 5HMXA 4LBIA 5HJXA 4IR9A 8AT1B 3C6TB 1V6HA 2O66A 3NXZA 4WP3A 3WC2A 2C2NA 3RRGA 1FFGB 3FQLA 4HI1A 1UZHA 2CQDA 2LFVA 1YJRA 2VF3A 3EVWA 4IDKB 5JJBA 1Q8IA 3HZGA 1HBOA 5C7PA 2XLJA 2YQ3A 3I4HX 5GAEU 2OTLS 1IQZA 1S1UB 1X4BA 1J5OB 2W2OP 1X4AA 2CXEA 2AKWB 4IOAQ 2XBPA 5IV4A 5HVFA 4MK7A 4J9SA 3ILIA 2NREA 1LK7A 4LR8A 3TAMA 1J5OA 2QA4S 3UE2A 5CCLA 2HURA 2WVDA 4YR3A 1NSKL 3LP0B 5KFFA 3M6XA 5B0GA 1X60A 4NCAA 4N5SA 2ZJRQ 2HPUA 3OTCA 3MUVP 2CA9A 4XDDA 2OHDA 2BR0A 4UY85 3FBBA 2YX7A 1RHJB 3M8PA 4OHXA 2QMXA 1SH3A 3PG9A 5DJBA 2YKQA 5EWEA 2J6SA 2N4CA 2YNFB 3BSCA 4L74A 3OVSA 1T94A 1JLAA 1UFLA 4ZS6A 3CD0A 2KO1A 2W24A 4GVLA 5A2QY 3THVA 3N0VA 1FTCA 3A8JA 2BE2B 2CADA 4K5RA 4J90A 1R31A 5EWGA 4L3KA 2R8HA 2J0SD 1CEZA 1DTQA 3BREA 5DLGA 3B54A 3PIPQ 3CCUS 2HLTA 1RWKB 3N9UC 4B17A 1FNXH 2VA3A 2V67A 5DGBA 4LRDA 1RA7A 2B7BB 3GJTB 5JXSA 1ZAVA 3HM9A 1JKHA 1T0TV 3MM5A 3WZ0A 4F02A 2V4JB 4RUBA 1X5PA 2Y1IA 4DUYJ 4DF8A 5KFPA 1RT7A 4DDFA 2XCAA 4RLEA 4FN5A 3WIUA 2RB7A 1T03A 4EBCA 5L9NA 4MTPA 4ELVA 1AFJA 2HS4A 1KKHA 1LK5A 4WYLA 4ECXA 1ZAWA 3Q8YA 4ILRA 1I1GA 1H0HB 2MKIA 4OIXA 1S9EB 2YXLA 2VICA 1SC3B 3A8IA 4WFZA 4O3NA 4I4BA 3QSIA 3KK3A 2B43A 2NPIA 1I6JA 1S1XA 1TKDA 2R4FA 1OYEA 1GMVA 3CMES 2P9GA 4OLOA 2YWGA 4DU7A 4DV0J 4DXLA 2MHNA 1IBLF 3DOMA 3PY8A 1RK8A 1YVFA 5B0FA 3AJ1A 2HAIA 1V9OA 2GVZB 4L76A 2BUNA 2ZOMA 2KXHA 4A46A 3C16A 2R2SA 3W2VB 4GC7A 3OL9A 3P49B 2JLFA 3ICLA 1D9AA 2FVCA 1TKXB 4Q7AA 1X4CA 3L9ZA 5K14A 3D66A 2RDJA 2NSCA 2ZUAA 5CCMA 1F3FA 3B4DA 2VIHA 1IKVB 1S57A 4CCHA 4CO1A 2E1PA 4D3HA 2FHKA 3MR5A 3FVYA 2V2VA 3JXOA 5JVHQ 3HP6A 1X9WA 1IBMF 5J1NA 5KG6A 1WC3A 2NXNA 2C2ZB 2V94A 2R7SA 4TQSA 1YITS 4O3SA 2BM0A 2F8MA 1LWCB 3LP2A 1Y10A 2AV5A 4CH7A 5KT4A 2FHOB 2HBQB 4V1Ak 2HW3A 4ZDNA 2JC0A 1MU2A 2FPHX 4GO7X 3OTOJ 1SC6A 1Y7PA 3SQOP 4MIAA 2K2PA 2EC2A 2GMHA 1CJKB 2AMCB 2GAGC 2JEGA 1URRA 1X7VA 4ZPTR 4DG1A 2CPDA 4QOTA 3PX6A 4LIWA 3RB4A 1FKAF 2AT1B 2CVIA 2QT7A 4ELUA 3EZOA 3JAMU 2YKMA 1EQMA 4K4VA 4UF4A 3ZZUA 4H54A 2HNYB 1RUSA 3IFEA 4NZ7A 1D1UA 5AJ3F 1EHWA 2CJ9A 2GHVC 3M6VA 3BN4A 4FZVA 3C15B 5J2MB 2GVZA 2BXJA 2WBMA 2YNHA 1J5EF 2EK1A 3CTRA 3MM8B 4EYIB 1Q7LB 1HR0J 3W62A 2BW2A 2LQ5A 1CJTA 4DR1J 1S4EA 1OO0B 2FTRA 1JJHA 3QAUA 2YY3A 3SV4A 1U6BA 4ZCIA 1BE4A 4ECUA 3PX4A 2W4DA 2FJAB 1VYAA 1IR2A 3NGSA 3JB9k 1YIJS 1S6OA 2KL8A 2ZBRA 3PO4A 4WXOA 1FRLA 2ASJA 4ZK7M 1UEKA 1X31C 4L6V3 3IBFB 3C2PA 4RJVA 3MF5A 3MPWA 2DNRA 1ZPWX 4A48A 1QAXA 3GYXB 4OV6A 2YKNB 4J9PA 2LKZA 3ITHB 3CCQS 4NLOA 4ECVA 1SQEA 4XO0A 1JXLA 2J0QD 1CULB 3M6UA 5IT4A 3P4UB 3FUYA 4WPAA 1TUVA 5J2MA 2RJZA 4EU0A 1IBKF 2DHSA 3EE3A 1NB2A 3AA8A 3FC9A 1NKBA 2OFHX 2YNIB 5DDPC 2EFOA 2DGVA 1FF2A 5IWAF 3GIMA 1HWJA 2PDAA 2ZOGA 3VZHA 4ZJOA 2V9WA 1FDDA 1VOMA 1FI4A 3V81B 4X4UA 5AT1B 5D3GA 2H54B 3FDSA 2NXEA 2DHHA 1LXJA 1P9YA 1SB6A 1YJNS 4OI0A 2RQCA 4QZVB 1YRUA 5DZ6A 1HMVA 3MI7X 2ZOFA 1RWVB 3FKBA 2FJEB 4GVBB 4P7TA 4TY8B 3UVJB 5LXRA 3RBZA 2CPEA 2UP1A 5HI7A 1TK8A 5D4PA 1HNWF 4YS2A 4ECSA 2HGLA 1VLYA 2CPFA 4RW4A 3GG0A 4JI4J 4DR5J 2MSTA 2VPWB 3FCWA 3THTA 3CJKB 2OD4A 5T7LA 5LL6d 2GW8A 1SKRA 2ZNYA 3IR6B 5DQGA 4MH8A 3RUBL 3W2WA 2C2RA 2VASA 1IR1A 3NS7B 3TP2A 1S7HA 1KVKA 3J80Y 3NGRA 2ROPA 3FFIB 4FXVA 3QNWB 4RKUC 2FJXA 1KHVA 2DXEA 4J9UE 4YHHF 2QA4G 2CKWA 3OTBA 4HT5A 4F4AA 3FBCA 5FJ4A 1NLKL 2B4OA 4C8NA 2P6TA 2K3KA 4AD6A 1Z1ZA 2JEFA 2PI5A 4QPXA 4MKYA 1QUPA 4ED2A 4KHMA 3MPYA 2KYZA 3W2VA 5HQLA 1HBOB 1YZ7A 1RWWB 2HNZB 5CYQB 1NDPA 4MIBA 3CULA 3GSDA 1VQSA 3E8OA 4USHA 2BJ1A 2CPIA 2HBYB 3HXMA 2CQ4A 2DTJA 4NLUA 4LF9F 1YKWA 3LF0A 3TOQA 2H5JB 1GAOA 5EN1A 1FT8A 1XN9A 3BYRA 1WC0A 5G0RB 4JI8F 4X65J 2CQ3A 2H48B 2RF2B 4RWWA 3WBZA 1P27B 4C48A 5B0EA 4NPOA 4L73A 1R0CB 1FX4A 2X3GA 4K5SA 4OZ1A 5HK4A 4RWXA 2RRNA 4ED3A 2X1FA 3BGRA 4DV4J 5KT5A 2VG7B 1IJFB 4LT6A 1RAJA 4Y2KA 1NH8A 2VDHA 3LALA 3TQ1A 1Z4UA 3AOBA 2W7AA 1P9QC 2FZCB 1QE1A 1KFDA 3BBFA 4B3MJ 4ZPWR 4DS5A 4CT8A 2GMJA 5IT9U 3HSJA 1RYRA 1G6BA 2E5GA 3H2UB 1HWIA 4U9RA 5KFSA 4C3KA 5L1LA 3ISNC 1YLXA 3V6DB 1QE1B 3UR3C 2PMZD 1FNMA 5HBMB 4L72B 1H2VZ 4X4VA 1NK0A 2NXCA 2CQHA 2FC8A 3MR3A 1O0PA 3KLIB 2KH9A 1RTDA 4K4SA 2HVZA 4DCOB 5F8JA 2JZ5A 3UN5A 4ZJQA 5CABA 3QIPA 4LF8J 4O4GA 2EFNA 2JLEA 4ZLPA 2LEPA 1UVNA 3I4PA 3I0SA 1N33F 1NUEA 1RHKB 2BANB 2HYIB 1IKWA 2XMMA 3DLLQ 2RT3A 4P10A 4ZP6A 3OV7A 1L5UA 2ZWPA 3PM9A 2B5JB 3GTYX 4P7VA 4X64J 2YVSA 2XY6A 3R8YA 3CDWA 4DV7J 1D9FA 1AFIA 3VR1A 2G2OA 4IUFA 4PWDA 4Q2MA 2HRTA 2W9CB 3X3UA 2I6WA 4QPTA 4ZP9A 2A2DA 3DDKA 4NYPA 1JB0C 4ES1A 1BMQB 2WZ1A 2ZFHA 4X2BA 1Q95G 3GP9A 1HHQA 4NLWA 1ZYQA 4YR0A 2ROEA 2ZDOA 1BHNA 3M2RB 3PJ9A 4C3LA 4CT9A 2BQRA 3OVBA 2HHVA 4DG1B 2V4QA 1YI2S 3KLFB 3KUHA 4LIRA 4F4WA 2MQ8A 1QSYA 3POTB 2UVWA 2R9LA 4CLYA 1IM4A 1HWKA 2WVBA 2J9EA 3W1YC 3LPYA 3AT1B 1F5AA 5KFHA 2E29A 4E0DA 2DGWA 1WELA 3D28A 4HTJA 3O44A 2C3PA 2X7IA 3TVYA 2VD3A 1PJ6A 4IO1A 2R3VA 1OS5A 1Q5VA 4O4RA 5HROB 2CJYB 3KFWX 4RL1A 1SJFA 1AYEA 2OI2A 1Q5YA 3QRRA 4OX8A 2CJQA 2R42A 3H5XA 2ZJPQ 2NQPA 2GGPA 3BGFA 4CYUA 2DGQA 4NCGA 4O44B 3SCKE 4HH0A 4C11A 1KOOA 1T9UA 2D3ZA 2PEHA 2RS8A 2BX6A 4ECQA 1Y5IB 1HBMB 2X3DA 4M5DB 1RLCL 4F2SA 2IVYA 3UCZP 2UXDF 1N5QA 1HNIA 3MWBA 3L7UA 3W8GA 4C3MA 4ZLJA 4DR4F 5MLCV 3H0PA 5IQQA 4RW7B 3CJ4A 3D1QA 4MMOA 5LT5A 4IKAA 2OPSA 3GONA 4I0WA 1UFKA 2Q6CA 2IHR1 1QM9A 5I4MA 4O3RA 1R27B 1ZOTA 4KO0B 5DQHA 2ZH5A 2EG2A 2MLYA 3R6LB 1O5JA 4Y2CA 2LQ9A 4WWSA 5BXIA 3PJXA 4A8YA 1GT8A 2DNYA 2V34A 4WFYA 4DI6A 5AE2A 2Y1LB 2AJ1A 4CQ1A 1RTDB 3OL6A 2AHOB 3FQKA 3MCSA 4DN9A 4X66J 2IIHA 3HJFA 1M1GA 3K58A 5GMEA 1NJZA 2HK3A 2WK4A 4DPTA 1QAYA 2VG5A 3KLGB 1HBNA 4OHVA 4RW7A 1HYSB 3D1OA 3LGNA 2WW8A 2ZH9A 5LJ3Y 3M2VA 4TXSA 1S4FA 4DSJA 3ONQA 3DI6B 4U96A 3U1LA 5IV3A 2ZBIA 1SL2A 2RRBA 3EICA 3SYZA 2FVPA 2E1RA 2N4DA 1WF1A 2FGCA 3WC0A 4HVZA 4P72A 3R2DJ 2CNNB 2BACA 2VL1A 1TL4A 4G65A 2R7QA 5KT3A 4JYAF 3K5PA 4IOBA 4WFAQ 3GPAA 2VB6A 3PYDA 3PKYA 3KK2B 2J6UA 2Z57B 4CO4A 4LREA 2CYYA 3J81Y 3MFIA 3DMJA 2FZKB 2UXBF 3MM9B 3CJ2A 3N6MA 3P5BP 5DM6Q 4O0IA 4N77A 1FCAA 1T9YA 1RTJA 3DLKA 1EZZB 5IM0B 3PR4A 2VC1A 1RCOB 3KJNB 3NCQA 3VAKA 5DDRC 3KOAA 4DL4A 2XEXA 1LNQA 4WE1A 2XYPB 1JNRB 3KLHA 5H9FK 3B8HA 4HI2A 3DRPA 4OYIA 4I6YA 5D0GA 5E5NA 1NRKA 2MZRA 4KGVB 4Q44A 3ENQA 4BC7A 3WDOA 2QLFB 4DR6J 4PPDA 3I87A 3NOCA 5CYMB 5J2QB 2GNKA 4JV5J 4HACA 2CRLA 2ZNZA 3OLAA 3KHRA 1OY9A 2OELA 4B3OB 2BJ7A 2CQ2A 2DGTA 2NXUA 2OPRA 3AXKA 2CAJA 3RTVA 5I3UA 2IA6A 3JSBA 2G13A 2PA3A 2QL7B 1RLDA 2DR8A 1JLBA 5IM0A 4YEAA 2GHPA 2OPPA 1S76D 1U02A 1HD1A 2YNGA 3R6GB 3ENAA 2D7SA 4MIWA 4ECYA 1VIXA 1HBUB 4ED7A 2QFIA 2XI2A 1S59A 3LWMA 5GMKa 1ZA1B 3JSMB 3QIPB 2WW4A 5D3GB 3QWPA 2AZ1A 1SJ1A 2CDRB 2VFRA 3CB4A 3MEDA 2BJ8A 2M88A 3K7RA 3O5TB 2PMWA 3TA1A 3F44A 4DZDA 1WHYA 3CXCR 1M1KT 3W3SA 2DRBA 1MROA 3ZO7A 3T1YJ 2BVZA 1U2FA 3DOKA 3SZ2A 1VFJA 2A2CA 2FLOA 2Q1LA 1DY3A 4FYWB 1UMJA 3FEZA 2XS5A 3HK2A 3MURP 1U0HA 4KAIA 1MW7A 1Q7YT 4QYZK 4XAKA 4RUAA 4DV6J 2HVHA 2HGMA 3ELHA 2VG7A 3G9CA 3O1LA 2AJQA 2DNKA 4JI6F 4EK2A 1RTHB 3HHLB 1IKXA 1UETA 2RF2A 4IRCA 4ER8A 2UV8A 3T9ZA 2BRKA 1WSRA 1VRUB 3HX9A 3NCPA 4LF2A 4CLZA 3BSOA 2L3MA 2LYVA 1HNVA 2ZH2A 1F9FA 5J2NA 3NGKA 2M2BA 1N6QA 4B9VA 2IM3A 1Q4RA 4LFAF 2PC6A 4NLDA 4Y3CA 1NEEA 3QO9B 4Z2XA 3BO3A 1VRUA 2KT5A 3R7BB 4V19X 3Q8QB 3M8YA 2AIRB 2BBEA 2GJ2A 4DV4F 1FESA 1NAQA 2F8EX 2HNYA 3D6HB 4PWUA 5HJYA 1Q86T 3EGNA 3NL0A 2MKHA 2YWWA 3T9NA 1RWUA 1UVMA 4C0HA 1K47A 2VKZG 2ZH3A 4N76A 4NCGB 4HLBA 1PCAA 1H3DA 2ZUGA 3BKUA 3GB0A 3VAGA 4PQAA 4K4XA 2EXUA 3ULHA 3KUGA 2XI3A 4HEA9 1S10A 1MROB 3MAAA 4BC9A 4N41A 2AJFE 3PJWA 1WEXA 2B8PA 1HI0P 3KJVB 3PW4A 2KJWA 3DLKB 4CP5A 3JYTA 1WC5A 1Y0HA 3L7PA 1U7LA 4DR7F 2DIVA 2MZTA 4TYBA 2UUCJ 3A12A 1Y5NB 3PHEA 5D77A 5HMWA 3EJMA 3CD5A 4KFBA 4DFMA 3CDEA 1M5PC 2UUBF 3IWLA 3V4IA 2VFTA 1SL0A 4B3TF 1KTQA 2ZE2B 1YRTA 3OXLA 3BGLA 2OPQA 3QLHB 4UZCA 3D0HE 5EX3A 5K5MA 4PG4A 1RHRB 1R6VA 3ADAC 4J9QA 4DR2J 1KLNA 4WFXA 4KJIA 3DGPB 5IZHA 1HKAA 5A8WA 1Q0NA 1V5VA 2XB2D 4LRCA 5J2PB 3SSSA 2K8GA 4WTOB 3G8QA 1UTAA 2OPRB 4F4KA 4EFAC 2PI4A 4U7UD 1W7WA 3DLEA 2B6AB 4EMDA 5KFJA 1BLUA 1OIAA 1XQIA 3IA0A 4WU3A 3KHHA 3K5LA 3MOJB 4X4SA 4OFZA 4X4RA 1EETB 3RW7A 4Y28C 3VALA 3SBMA 1F0XA 2V0NA 4KGKA 2CG8A 2Q6BA 2HRUA 1HNZJ 2ZITA 4I2PB 4IQXA 4QBUA 1IJEB 1Q16B 1Q8BA 2I5JA 4B9LA 3KLIA 1NCLA 4ETZA 2HVDA 1RU1A 4WIQA 2Y0SD 3BDPA 4QCLA 3P3DA 1U4BA 1TFYA 2ALZA 3TVZA 2JWNA 1VCTA 2KI2A 3D68A 4B9MA 5E3QA 2M8HA 3HSDA 4DV1F 1QY7A 1RWXB 2HQIA 3AB4B 4HH1A 2CWXA 1SC1B 3OBIA 2I8EA 2HZAA 3QT8A 5SZTA 1KD1T 3S7RA 3I6PA 4LF6J 2RUGA 5ETQA 3FCVA 5LSRA 2HNDA 2ZVSA 3VAFA 3CO0P 3JTPA 2FJWA 2HHHJ 3B4MA 2YKAA 3P96A 2D74B 3H2LA 1C1CB 5AE3A 4U7CA 2QL5B 3CCRS 2VFVA 1PAEX 3J7YI 2WOMA 2GCFA 3KDNA 4TY9A 3TO8A 1N34F 3HVWA 3BYPA 5KFAA 2O5DA 2RMLA 3FCHA 3FZBA 4Q2LA 5IXUA 5KFMA 1DQ9A 1FRIA 1S6QB 3HVTA 2VA2A 4Q0BA 1U6ZA 3ZZOA 3EZ5A 2NR0A 2QG9B 3MAAB 1Q1KA 3VF0B 1N33J 1K44A 4ES2A 1WF0A 1HHSA 2IYGA 3IAM9 1VMBA 2RHQB 4ZPDA 4ZIWA 3LH2S 2YWHA 2ZDPA 3W9JA 2WVCA 1WORA 1RABB 2MLXA 1U24A 1B0VA 1RT6B 2XMKA 4ZVPB 4RBVA 3UDCA 1NJIT 1GNKA 2A1BA 2N7YA 4K7QA 4P2SA 1TVRB 3JSYA 4ZVOB 4PG8A 3BQ1A 2JJ4D 1DRZA 3M30A 1T9XA 1VQ7S 1NK4A 2W7PA 2R7VA 1GTHA 3CJKA 3MGJA 4XK8C 1PYSB 3KXDA 4PWDB 2XG8A 5HQMA 7FDRA 2FLLA 1HBMA 1S6QA 5D78A 2DD8S 3PDNA 3VQTA 1MN9A 5A76A 5EGYA 2ALYB 4HDHA 4MKBA 3DDIA 2H5EA 2VQEJ 4GVBA 1S1XB 1M0SA 2QX0A 1TL3B 5B0DA 5KFCA 4BDPA 3GILA 2KXFA 3TX0A 2N7CA 1XERA 3ETOA 1PJ7A 3BH7B 1T9TA 4OZLA 1RAIB 1IR0A 2JFDA 3CCWA 4R25A 2KJVA 4RO0A 3JYTB 2W7OA 2PO4A 2DO4A 2L48A 4DR1F 1JQGA 4DL5A 5HL7Q 4GRSA 3GFXA 4RBUA 2QLXA 2DNPA 2ZWOA 3IBCB 1YTYA 4LJMA 4PABA 5LM7E 4AXIA 5DETA 4DR5F 3V6KA 2VDIA 1VQ8S 4JI1J 4P74A 3HHNB 3D0GE 4KGXB 3LTOA 2RU3A 1OY8A 3Q83A 5L1KA 2WVEA 4N56A 4P2XA 2J7KA 3NG8A 2Q3PA 3DKDA 1DURA 1ZM4A 5CH7B 4LFCJ 4ANEA 4DR3J 1ZAXA 2HK2A 1NZ8A 2IJFA 3CJSA 1UEUA 2NCKL 3PFOA 3UCGA 2C2KB 2DNOA 1WACA 2RQMA 3BB5A 5E2QA 2XNQA 4EGLA 4K4WA 2MZJA 1XEZA 1YBAA 3AXMA 1VQPS 1FX2A 2E5IA 1KSPA 2VOOA 3UNYA 1KFSA 1VBXA 3QO9A 5KFVA 1FJ7A 4DV5F 3NLCA 3V5RA 1LQ9A 3OR2B 4KQZA 2MEWA 4DUTA 1U1KA 1SH0A 1NHVA 5LMUF 2KRBA 1N36J 1B64A 4C7QA 4RU9A 4LFBJ 2HNZA 3DYAB 5H9FJ 1UW4A 2XZDB 3C66A 3I31A 4ZPBA 1P1LA 2VQFJ 1LW2A 3GFHA 1VI7A 3SCIE 3SFGA 3T6BA 2H4WB 2FQQB 3A3NB 3W63A 4O4GB 2LXFA 4ZVQB 4ZVRB 1TL1B 2QYGA 5J1EA 1XMOJ 5KFIA 2GAHC 4LF4F 2WSFC 3OTEA 1D3WA 1F5BA 2XMVA 1RJJA 4ZVUB 1S99A 5J2QA 3PX0A 4S0MA 2XHCA 1UEVA 1FRHA 2PFDA 2Z4PA 2C3OA 3ZXWA 4RW8B 3ZC4A 2KFZA 2G0CA 5IFMA 5GAHI 1RT7B 4M5NA 1L3SA 4QIVA 3QQCD 4DPXA 3CNQP 1RT2A 1S6PA 4F2RA 3UCUP 3M32A 2KVQE 2EFVA 1HNZF 4USUA 2QZ8A 5H9EJ 1S7IA 4Q0BB 3KDOA 5G4DA 3K89A 1KQKA 1TK0A 1TUGB 1H38A 2MB0B 4QWAA 5D6GA 3D67A 4X4QA 2JSXA 3IN5A 3M2UA 1REGX 4DHVA 3W8PA 1KTVA 3SFUA 4IR1A 5AXMA 1APSA 3POTA 1L3KA 5KFTA 2DY1A 4WFBQ 2CQIA 2GZOA 5KG1A 4YB5A 2KU7A 3I56S 3M8SA 4ICLB 2IJRA 4EZ6A 5E3RA 4M5JA 3Q24A 2D3UA 2YNIA 4LRFA 2LMIA 4E98A 4ANDA 3KK1B 1HLWA 3VZIA 4X4OA 3BQ0A 2XZWA 3PFEA 1I5OB 2EWHA 3R5AA 4I68A 3TAMB 4J91A 4DFPA 1VJWA 2AWZA 4DN0A 2H4YB 2MKCA 2IDEA 4EO8A 2HMIB 1BUXA 4O3OA 4CWBA 3OJUA 2DPIA 2YKNA 1PSDA 4DU8A 2K7KA 8ATCB 5AXLA 2H1YA 4B3MF 2W9BB 2GQ2A 3DRPB 2H51B 3ZTSA 4TU8A 3W2WB 3MM7A 3K5NA 2BJ9A 3CUNA 2RKIA 2XS2A 5BJRA 2LVWA 2V9KA 2ATCB 2QTWA 4ZHRA 1VQMS 4N7TA 5KG5A 3UN3A 4C8MA 1CS4A 4YB6A 3VTIA 3AY0A 3PRBA 1BC6A 2GHWA 1X9MA 3ET6A 2HHQA 5FLXY 4DJBA 4P9SA 2MPUA 4V19J 4U7UK 1C4CA 3RRKA 1BWVA 2HQDA 3EX7B 5MAOA 1D8YA 3OUYB 3DGVA 5E3AA 2KZZA 1K0VA 4JOUA 1H6KX 4NYOA 3F73A 2LXUA 3K57A 4F4YA 2L9WA 2G0IA 2E1CA 4X64F 3T1YF 4DL2A 3PKMA 3H2VE 1EP4A 1VISA 4OYXA 5HQ8A 3G8TA 3HHLC 4RZRA 2FVQA 2VQEF 2XO6A 1DTQB 2CZVC 5ETPA 3US5A 3A4TA 3TAPA 1R0AB 4LF5F 2LQJA 3NNHA 2SXLA 2C3MA 2H9ZA 4KFBB 3MCOA 4OHYA 3BKTA 4QWEA 4B3SJ 1FXRA 3DLHA 2O1PA 4NCBA 4LBPA 2D9OA 1RB0A 3M8QA 2YH1A 2RILA 1KQSR 1B70B 3FSYA 2WAQD 2ZZMA 4I7FB 2MGZA 4DF4A 1NDLA 1TKZB 1NPKA 3M32B 1RHMB 1X5TA 2OO4A 5ETKA 5F0UA 2JVRA 3TUIC 2MXYA 2DHXA 4TU7A 1SL1A 1FFWB 5I42A 1XNRF 2I1RA 2VV5A 3B82A 1WKJA 4CTAB 2KZMA 1EETA 4TN2A 4YDDB 5I3PA 1TUWA 5KFEA 4GKKF 1R3NA 4QIEA 3EDRB 3IXQA 3NOGA 1A7GE 2DYAA 2HMIA 4FF1A 2DH8A 5F8NA 1MSWD 1H74A 3ZZ0A 1DBDA 3DNCA 2B51A 4KPYA 1Y3KA 5KFKA 2C28A 2RVJA 3G6YA 4FP9A 1SH2A 4HYKA 2J9DE 3T5LA 4NLSA 5K8MA 5L1IA 4HT7A 2DNMA 1NK7A 4ITSA 3H5SA 4G1PA 4TU9A 3I9V9 2EKNA 2W01A 3I0RB 3HF5A 2AEJA 3NKYA 2B3TB 3N01A 3L7OA 2UXDJ 2MSSA 4NZ0A 2BMBA 4QR1A 3DLGA 3V4IB 2MJUA 1S9EA 5ETNA 1AW0A 2QGFB 5B0BA 3B6BA 3GMGA 4RBTA 4EBDA 2LQBA 2LEBA 3VGUA 2WB1D 1N0VC 3OFGA 1JLCB 3R5DA 1CG2A 5KFWA 3HSZA 5EDWA 4UT4A 3MEKA 1VRTB 4LRAA 4PR6A 4J9KA 1T03B 4ILMA 3WHIA 3QRQA 3NGDA 2OIHA 3X1LB 1M5OC 4B3TJ 4K0KF 3M2VB 4ZLLA 1U2RA 1KWMA 3PW5A 2F5GA 3R1LA 2E1AA 4F26A 2BJEA 2F63A 1CBKA 4EZ9A 4KB7A 3ET6B 2UUAF 5KG0A 2DEIA 1UWAA 1SI9A 3TJ8A 1VRTA 2BW7A 3HT3A 5F8LA 1YHQS 3TARA 1HW9A 1WWHA 2HZCA 4YY3J 5AJ3J 1T05A 3H25A 3MEEA 3HVRA 1FDAA 1S1WA 4F25A 5IQ6A 1I94J 3UDEA 4IH5A 2ABYA 1X8DA 1F2GA 2PN6A 4O0NA 2XMAA 1S49A 1X5OA 2V4RA 1YWXA 1RACB 3ZTRA 1UVLA 3CW2C 1RTZA 1W2IA 3KLGA 1RBLA 1U1NA 1ZBTA 1KONA 4X4PA 4DBQA 3HMJG 1R8PA 2J76E 2EG1A 3EGZA 2UUWA 1E6VB 4R0EA 2B8QA 6FD1A 2B6AA 1GX6A 1H7XA 1SCJB 2COLA 2J9CA 3B78A 4P75A 1AA1B 2RKIB 3KWMA 4OX6A 5CQGA 1W2BR 3HDSA 1B4SA 3HHLA 4Y0FA 2DNQA 1LWXA 3TNVA 5J2PA 1SV5B 1N8RT 1E6YA 2JFKA 4DLGA 1BXNA 4TKTA 2C3YA 5F3TA 4ZVFA 3CCZA 4H4KA 4NLVA 4OX9J 3EWGA 1QAJA 2GFFA 5HVGA 4X62F 2F4VF 1CC8A 1GK8A 1N0UA 2DNZA 2QO3A 4MYTA 3TJ9A 5LXYA 4LUBA 2FD2A 4CTAA 1S1UA 4DV1J 4OJ3A 4JV1A 3BEGB 2CQGA 3SEOA 1DTTA 3T5JA 2ACYA 1M5HA 1C4AA 5JUMA 1JLGA 1RSCA 2VODA 3U02A 5A8WB 1OQ3A 4FYDA 4IFVA 2WRMA 1TAUA 4DFKA 1CLFA 3Q8VA 1VK8A 3NWRA 1Y3JA 1GTEA 1SJ3P 2GIRA 4YB7A 4ZCLA 2Z2MA 4ETXA 2DGOA 2KG0A 4LSNA 4DV5J 2BQUA 1N34J 1ZM2A 2VJUA 1WTBA 4B9NA 3ILJA 4DQPA 1JLAB 2IRXA 4AT1B 4HL9A 4NI2A 2VZ9A 1XMQJ 1NK9A 3SI8A 4JI4F 3CCTA 4XIUA 4AL7A 3IG1B 4JI7J 3IBWA 2HFVA 2R8KA 4NYZA 3DI6A 3DDNA 2DO0A 1WDDA 5A6PA 3BV8A 1KEKA 3CJ8A 1X4HA 4RR5A 3W65A 3JQMA 2RH3A 1FKPA 3EVMA 4RW6A 4WFNQ 2RHSB 4WXWA 3QMQA 1R7IA 1SC4B 3MR7A 3OXGA 4K8RA 4PXCA 3BSNA 3FMWA 1E6YB 1NMEB 1F1BB 2Z8QA 4FKXA 2EBGA 4OV1A 4G1IA 2GJIA 3AOAA 3UQSA 3OJSA 3A8KA 3KLHB 2BOAA 3L3CA 4GKJJ 3CJ0A 3RW6A 4FF4A 5D15A 3UFCX 1QVGR 3NY0A 4OI6A 3HCXA 2CQ0A 3RG6A 2QEXS 4PYAA 4LF9J 3G82A 1FRKA 1HFEL 2F4FA 7AT1B 4F8RA 5AE1A 2VFUA 3IR5B 2BQ3A 1U0HB 3FBEA 3OQ2A 2ILYA 4LF1A 2F7VA 3I5AA 1T9VA 2RUSA 1U1LA 3E2EA 3IWXA 2NZ4A 5K20B 3HHEA 3KK2A 3MD3A 4C2MA 2MMYA 1D0EA 4H4MB 1RTHA 1N54B 4OZNA 1RA6A 3Q8UA 4B9SA 1U26A 1WG5A 4FXWA 1ZZFA 5KFDA 2E9ZA 1RAEB 1NB7A 5HBMA 1X4DA 5GVQA 2DBBA 5GAHU 5F8MA 1LWEB 1MN7A 3HULA 4WKYA 5C2CA 3TUZC 4BHQA 1BY9A 3NS5A 4CLTA 3ETMA 3M2UB 3QFHA 4CLLA 1ZZNA 3KYLA 1VQ9S 4ZN3A 1S0NA 2E5LJ 1ICEB 2E5JA 3MPVA 4JI2F 3BO4A 1OQ6A 2HGNA 2GJFA 3MR6A 1KR4A 2RQ4A 4AQYF 1LFWA 2EW9A 3M8PB 3TQEA 5D8HB 3TW0A 4I2PA 3UDLA 1F9EB 1S6PB 4KH1B 1RT1B 5ETOA 3GWCA 5G0RA 2V63A 1C0TB 2QLJB 2XHWA 3PEHA 4NEYA 4DZ6A 3GV7B 1AB8A 3QGIA 3UN2A 2W9BA 2DRAA 1RT6A 2HWTA 4MAKA 5LMUJ 3Q22A 1Q78A 4LF7J 4FPRA 2XYGB 1UKUA 3OT9A 2VQFF 1HNWJ 3GQCA 1AZSA 1NPRA 4RUCA 4DLEA 2UUTA 3OR1B 5HSPA 2WSEC 1JK9B 1FDNA 4OHWA 4RNFA 3PR5B 2WTFA 1N32J 2N82B 1ZTTA 4NOHA 3QJPA 3J80U 5A8RA 2ADBA 2HFUA 4KHRA 1OPZA 3C6TA 3AJDA 2DXDA 4L75A 4NXMJ 2DGSA 1TELA 4A8KA 4DEZA 2OGUA 4CYUB 4N8NA 3HHDA 2HEKA 5CHCB 1KBRA 2FDNA 5BYRA 3W9HA 4I64A 2GA7A 2E66A 1FVQA 1RT4B 1VLOA 3RAMA 4Y2MA 4DPUA 5FIIA 2G9OA 2JVOA 1I51B 1RU2A 3PEJA 1WI6A 3BBBA 1DAXA 3LGHA 5LSOA 1FRMA 1T05B 1TFWA 2GS8A 1U2CA 2BEFA 1U6FA 5BR8F 2X1AA 3RZAA 2AD9A 2HG4A 1C2PA 1YGYA 4WJBA 4ES3A 2AU0A 4K4TA 4YOEA 1NDCA 3NEKA 4CDIA 4DSKA 3K0JA 2CNOB 3MPUB 1RT5B 5CA5A 1U49A 2UU9F 2Z2ZA 1JNZB 3SV3A 2FB0A 2Q79A 2FHJA 4PUOB 4HHHA 1H7WA 3E01A 3KNGA 3G4SS 1NK6A 1H98A 3PNIA 2M52A 4OZ5A 2IYIA 2K06A 2Z0GA 5K14B 3TI0A 1RT3A 2WSCC 3JQKA 4H4MA 2BJDA 4P2FA 3TUJC 4ALZA 3M9OB 2LECA 1KVIA 3BJYA
chains in the Genus database with same CATH topology
3CDUA 4CO5A 1PGZA 4AL5A 1SUQA 4OHZA 2AGQA 5DDQC 4KO0A 4ZPAA 4KKOA 1C1BB 2CFXA 3LGMA 4M94A 2ZBCA 2J0XA 1IKWB 3PRDA 2KM8B 1R43A 4IFYA 4N8OA 3PW0A 4BBYA 3V4MA 3UPFA 1P8GA 4D3GA 3QPIA 3VAIA 4NLRA 3TANA 4A8SA 1TL5A 4ED5A 3DHWC 4TLQA 3FFIA 4C11B 3CMAS 1C0UA 1OSCA 3IRWP 2MZQA 4DF4A 1Y9OA 3DLEB 2O67A 3AB2B 2B4VA 3MUTP 3RAQA 4RNNA 2A18A 3OTDA 2G4BA 1FO1A 2X1GA 4RW4B 3IG1A 1S0MA 1MU2B 5T41A 4X66F 1I94F 1CQMA 4J37A 3HHLD 2VPXB 3BGRB 2XY5A 2R2TA 2V8HA 2KB2A 4LSNB 2GGPB 5M2PA 4DL7A 3NNCA 1NK8A 3UD4P 1TQLA 2CQCA 2VBZA 2ZZNA 4KV8B 2ZH7A 2RD5C 1RGVA 4HTIA 3BQ2A 1SJ4P 3KG0A 1ZPVA 3AA9A 3CSKA 1GH8A 3MMCB 1IQTA 4A8WA 2XWYA 4NA2A 3MTKA 2L08A 3N6LA 3N79A 4PXBA 3H4BA 2KM8C 4W92B 2NSBA 3OR1A 2BRLA 3BS9A 2F3JA 1QUVA 3IR7B 4KGMA 3MXHP 1NJWA 4F50A 4B3OA 3FSIA 1YJUA 1RDRA 3DXBA 3SMZA 4UUWA 3M2RA 4ZPCA 2QSFA 4EBEA 1B0TA 1SV5A 1TKXA 2Y1RI 1TL1A 3KG4A 1Y5LB 3FMBA 2CIMA 2F8HA 2W25A 1X4FA 2VOPA 5DO2A 2BM1A 4EYHB 5DLFA 5I3QA 1IXKA 2OP5A 1UAWA 1KOHA 4I7FA 4USIA 2MGZB 1Z2ZA 2AQ4A 1KC8T 2ILZA 4XPEA 2KFYA 4FVCA 1NK5A 4OI1A 1HARA 3MMBA 4Y00A 3U7JA 3OPKA 4ELTA 3GR1A 1WI8A 5F9NA 2HFZA 3HHKA 4KPYA 2BANA 3UWTA 2FJVA 2MHEA 4F3QA 2VBWA 4A8OA 1HHTP 2FVRA 1URNA 5KFNA 2M0GB 1NZAA 2HFNA 5F3ZA 1LFPA 2R7RA 2QV6A 3I32A 3DRSA 3CCES 2N3OA 2ZHBA 4DL6A 2CPJA 1FD2A 4F4ZA 1U47A 2GO8A 4QWCA 2RRAA 4Q8FA 1VQKS 4HDGA 4BCAA 2YWKA 2VC0A 3M05A 3MEGA 4GO5X 4L3NA 4OMFG 4NLPA 4WIIA 5AXKA 5C5JA 5GAGI 4CIOA 1KLMA 3BO2A 2C2DA 1NJXA 4KTQA 4ECWA 2IJNA 2Q66A 2V4JA 2CVEA 2DGXA 3BR9A 3NMAA 2VONA 2CG4A 3VAHA 1NKEA 1Y4ZB 1GXLA 2KN4A 1SKWA 1DQ8A 1JLBB 3BDEA 4IH7A 2DPJA 1GX5A 4PQUB 4EWTA 3MAQA 1FE4A 2M3DA 3F41A 4H4KC 2GIQA 3H4DA 4K50A 2VBXA 1RKJA 1AXQA 2XSJA 2HQ3A 3OXFA 4KT0C 5KFBA 4F4XA 1T3OA 3N5BA 4FVMA 1FJCA 4RX6A 3O3LA 4PG6A 3AQOA 3AH6A 4DSLA 1HW8A 1N5VA 2DH9A 1S0VA 3MZIA 4PG7A 3BF4A 1X5SA 2IAJA 2X51A 4IDKA 2BYCA 2AYGA 1FXLA 5DGAA 5DG7A 1R8AA 2B5JA 1VGYA 1GXTA 2UXCF 4NZ6A 1CC7A 4WZQA 5K8OA 2ZH1A 2CPZA 3R1HA 2HIQA 3AAWB 4Q5VA 3CCMS 3ZFVA 5T7LB 4OJ1A 4PXDA 1T95A 4G3IA 3SQGA 3T1HF 2VPZB 3GV5B 2EC0A 2UUCF 2IM2A 2HRYA 1BGXT 3EPIA 2P9EA 2CQBA 2E7XA 3KG1A 1S79A 3LOUA 4J9NA 2NPFA 3LW5C 3AHPA 5B0AA 2MJNA 3NNAA 2BABA 3HPOA 1HBNB 3Q2SC 2R7XA 3EYZA 3TA0A 1A6LA 2IM1A 2NUUG 1X0PA 3KLFA 4Z37A 4JI7F 1G3OA 3QJJA 2FLNA 1KNZA 3OHAA 5DG9A 2CQPA 1JLCA 4BS2A 4DSFA 2P6SA 4ILLA 1S48A 1MMLA 1YQHA 2JOQA 2HHPA 3CGIA 1CPZA 1LW2B 1UJ6A 3HO1A 1Z2LA 3M9MB 2C2EA 4YUDA 3J7YU 4ZKAA 3QGGA 4C8ZA 1NJYA 4M95A 2X1BA 2DNLA 4RNOA 3LO3A 3LQVA 4G6VB 4PG5A 2EFGA 1N5TA 3GV8B 4QU6A 4O23A 5KOXA 3O6QA 4AUKA 5IT0A 3E01B 1HR0F 3LAMA 3SSRA 2UVVA 4O44A 4PPZA 3H59A 2E5HA 3UR0A 2DCUB 2BZ2A 3WX4A 2AGOA 2DJWA 4U67Q 1MWZA 1WHWA 2QLWA 5C24B 4HKQA 3KLEB 2KTQA 3I55S 4F3OA 3MEDB 3SDEA 2WOMB 2GX8A 3HFKA 3PXGa 1ZM3A 1F60B 5KG3A 5J1PA 2OPQB 3ZZRA 2AJ4A 4NRUA 3DLGB 5KT7A 4BWJA 4J9RA 2EVZA 2IM0A 2PE8A 2E5LF 3U1NA 3BN7A 3SCJE 2YNGB 2MKJA 2HNDB 3J7A1 2D3OR 2PD1A 1DFDA 4LSLB 1JLGB 2MY8A 3OHBA 2O3DA 1N5YB 4JI5F 4ZPVR 1RT2B 2IC3A 4URGA 2ZKUA 5KTQA 3RB3A 1HYSA 4ZVEA 2PSZA 2W9CA 4ED1A 3NWGA 1N52B 1IKVA 1MWYA 5KAKA 3ITHA 4YQWA 2XCPA 1UVIA 4IQMA 1R6YA 2U2FA 2OMOA 3DOLA 4OZ0A 1BQNB 3NP5A 2MQLA 2Y1JA 3OL8A 4IOCQ 4A8FA 3DHXA 3RAXA 1R89A 3CJ5A 3FSXA 5FD1A 3HI9A 1L3TA 1HWLA 5B09A 3C46A 2DIUA 1HNVB 1XBWA 1R8HA 2J7WA 1PC4A 2DITA 4O3QA 1JJ2R 3PW7A 4IRDA 4B02A 4NLQA 2HHSA 1FRJA 5C42B 4C8YA 2RSQA 1QSSA 1S1WB 4CO3A 2IMOA 2LU1A 2ZH8A 1X0FA 2XGPA 3OW2R 2J8AA 3LP1B 4W90B 6FDRA 2OKQA 3CE8A 3T5KA 2W9AA 2Z2LA 1Q81T 4WYWA 3D1HA 4USJC 4ZCMA 5D4OA 3MM5B 5CZVA 3SCLE 3MMBB 4J5OA 2JEJA 2PMHA 4I1TA 3KJVA 3SQGB 2XLKA 2IBKA 1J2VA 4QYRA 5KFRA 4ZHRB 3IRXA 2XSFA 3RRHA 3OSPA 1TK5A 1N5SA 3ENVA 1Q79A 1QVFR 1UFWA 4PKDB 4TYAA 5F8GA 4JI0F 2QFJA 3OFEA 1DARA 3U1MA 3V2UC 3MM6B 3CF5Q 3I82A 4ZOSA 5I3UB 4YMEA 4QIWD 1VQNS 2GQQA 3LP0A 3DU6A 4FNIA 3Q8PB 4AXJA 1AROP 3DU5A 3G8SA 2M9KA 3FRZA 1NKCA 2J9DA 2POKA 2M70A 3MMCA 4DX8H 7FD1A 5HP1A 2CJKA 1N6QB 2VPYB 2AX1A 1GQEA 3E3XA 3S01A 1OWXA 3MOZA 1UVNA 2IA0A 1KHWA 2XULA 3QLHA 1HMVB 2A10A 3QZ7A 3KK3B 3OFHA 4I6AA 1UVJA 4ECRA 4QU7A 1KRPA 1HL6A 1SJRA 4N47A 3JAMY 2W4CA 1RTJB 3TA2A 2N3LA 3KLEA 2ZM6F 4UY85 1G2EA 2OMLA 3LP2B 5THWA 4R8UB 4PQUA 2FHJD 2PIIA 1S9GA 3ZZPA 1SXLA 1TP7A 2B56A 4EEYA 3Q2TC 3KHGA 5GAEI 4R0JA 1SIZA 3ENWA 2APOA 5IS2A 2HFOA 1FJEB 2RIJA 4NL5A 4EO6A 3DRRA 2B4PA 2R7WA 3R3TA 5U47A 4NMLA 2FUG9 1HA1A 3GIIA 2GO9A 1OSDA 3R27A 3OVAA 1HBUA 5B0CA 2DR5A 2AYBA 2L9DA 4ZVHA 1X9SA 1IN0A 3MR2A 3M1VB 4RU2A 3QYYA 2MQQA 1DHMA 1U45A 1HQEB 3N4WA 4A4JA 4JBCA 5F8HA 3PVXA 2MZSA 5KFYA 4ED8A 4ZMMA 4C97A 2QA1A 2R2RA 3NBPA 2CDQA 1FHTA 1RQ0A 2YKMB 1T7PA 1HD0A 3HZEA 4ATNA 3GIKA 1TKTB 1U25A 3OTOF 4LF8F 1RT5A 2I9SA 2IRYA 2ZKTA 1IKYB 1LKZA 3GYNA 3G6XA 1XR7A 5JVGQ 2M7SA 1S9GB 2CZ4A 2BA9A 1N5YA 2YKPA 3M4XA 4DR2F 3Q0AA 1VQ4S 2R7TA 1JMTA 4LSLA 2JRSA 1ROFA 1RTIA 2RNEA 3P5TL 3QGHA 4O3PA 4U6PA 2DR7A 1U6BA 4A47A 3M8RA 5DRKA 2VKRA 2W8LA 4ED6A 4I67A 5KG4A 2ZE2A 2R7UA 3CO9A 5K8NA 4CO2A 4RUHA 1TL3A 2BE2A 2R8GA 3MECA 2OJ3A 2JLGA 1FTRA 2QRRA 3MMAA 3V81A 4MK8A 3BSAA 3V6HA 5C24A 2ZHAA 2E1MC 3MAHA 3CT9A 4Y34A 1LWCA 1RISA 3LAKA 1SBRA 2XMJA 2HS3A 2ATLA 3D2WA 2R8IA 5L8RC 3SSQA 3THPA 2DCLA 1AUDA 2D41A 1DZ5A 2FJDB 4NLGA 2E7WA 4ZA1A 1WHXA 2EFQA 2BV3A 1WTFA 4F3MA 4WF9Q 1TR0A 4I2QA 3MUMP 4I69A 1FNOA 2KG1A 4ID5A 1U8SA 1C0TA 1VC6A 4NA3A 3K5OA 3DCAA 5I42B 1VC0A 4JI1F 2IC3B 1D9DA 3DYAA 4DOZA 1HQUA 1XTZA 4OJHA 5D4NA 4RW9B 3GG1A 1KVJA 1S1VB 2F9JA 3KKFA 3T3FA 4JI3F 1CVJA 4DR6F 2DHGA 1V3SA 4MKAA 3FGVA 3DMJB 5CXTA 2XNRA 1M5KC 1GXUA 3RR8A 2DNHA 3ZZTA 4GMKA 2WONA 4MFBB 3MEEB 2LA4A 1S9FA 1LXNA 4C0BA 4M5DA 3MEGB 4URQU 5KG7A 2MDAA 4X4NA 2EBEA 3MFHA 2W4PA 3A1YG 1DQAA 4OJGA 1P6TA 2MYFA 2WONB 1IUJA 4MFBA 2FLPA 3K8WA 3RR7A 4CI0B 2J6TA 3DOKB 1WG1A 2VG5B 3CVKA 1FKOA 5HN0A 1VBYA 3DRXA 2AJ0A 1K1QA 3CIZA 3FJ2A 5KT2A 3PV8A 4YY3F 1K9MT 1QLNA 3VQSA 4J9LA 3TAQA 1VQ6S 2CPXA 1TAQA 3EGWB 4JV2A 2YH0A 1NNDA 3RB0A 5CYJA 3EUNA 1NO8A 1REVA 4QWBA 4NA1A 1FEEA 4IG0A 1UP1A 5E3CA 4WZMA 2ZC3A 1BQNA 4OQJA 1RP5A 4DQRA 2VG6B 3KLVA 4IG3A 3S6EA 4DV6F 4IO9Q 1HQEA 2HWIA 3OLBA 1S0OA 3RBDA 2A3JA 5B7WA 3L95X 2ZJQQ 3I5BA 5AXNA 5CD4H 5L1JA 1XK8A 3GR0A 3GE9A 1FK9A 5KFGA 2VFSA 1FD8A 3DN9A 2PT0A 3ISZA 4K59A 2DB1A 4FBTA 2YWEA 3U27A 4UQGA 3I0SB 4K4ZA 3H5YA 4DFJA 2YX4A 2ZD1A 4TQRA 2AP6A 1VBZA 4DQQA 4IFVB 2ZC4A 4OX9F 3G96A 2CJBA 4DQIA 4Q43A 3PZPA 1K73T 1WEZA 3KTQA 2JH3A 1QJHA 2ZD1B 4M1KA 3ZZYA 2KT3A 3EXYA 1DTTB 3I5CA 4NLYA 5F41A 1NH7A 2AX0A 3IGVA 1LWEA 1M5VC 2LXIA 4KSEB 3EPGA 2BDPA 4ZCKA 1K8AT 1VQ5S 4XPCA 5FDLA 3G71S 5DM7Q 5F8IA 2L9NA 4OZJA 4YR2A 3J7Z5 1S6UA 5BYSA 1O51A 3HVAA 3NBPB 1YJWS 1KQGB 2FGOA 4IFYB 3TR5A 2QIFA 2GV1A 3H20A 1T02A 2WHOA 2XC9A 2FY1A 2NUHA 5E3PA 2OLWA 1HNXF 5E7OB 4P6QA 1VQLS 1G1XA 1JX4A 2MZ1A 5F0WA 4DV7F 4DUYF 2OD6A 4DUZF 4Y2AA 4NLXA 1JJ4A 1RT3B 3DOLB 3MDFA 1TV6A 3EXCX 3N28A 2YWFA 4NX9A 4EUVA 2DR9A 3VAJA 2P5VA 2RE1A 4G1QA 4DQSA 2EFPA 2GMLA 1A9NB 5LSLA 1S77D 2WBRA 2FIUA 1VQOS 4KBIA 4WE1B 3S1TA 4NWBA 2LLZA 4OX7A 3S8SA 4WK1A 4C8OA 4LVOP 5GADU 3KHLA 5ADZA 3CD7A 4OI3A 4UUXA 3GFZA 3H98A 1S97A 3JTNA 4DPOA 4WU2A 4TY8A 3F56A 2EKYA 3AQPA 3MECB 2HHWA 1YSJA 1S1TA 1UWBB 3A8EA 4CNYA 2KKHA 4I56A 3CC4S 3LUYA 4QYZJ 2NLWA 3DLJA 3I0RA 2MQOA 1CSJA 2YNFA 2XMTA 4DSIA 2OPPB 1ZM9A 2HWHA 3BGUA 5KFUA 4C4WA 3IS9A 2OTJS 1FEHA 1H2TZ 1S1VA 5E41A 3CCLS 1FK9B 3NCRA 5CYQA 5HMZA 4B3RF 2HHXA 4OI2A 2JEIA 3RYLA 5T14A 2CQ1A 1TVRA 1X4EA 4QJVA 3TX8A 3CCSS 4A8MP 2X1FA 4F67A 1V3ZA 2V8VA 2I2YA 1HPZB 4WCEQ 3DM2A 4KE5A 1HI8A 5B08A 2LDYA 2J7UA 5HLFB 1PC5A 1N56A 1WHVA 2AW0A 2XSJB 2XWXA 2MKSA 4OL8A 3KMSA 1JXEA 2ASLA 5LJ5Y 3O2IA 2DVIA 3CPWR 1U1PA 4LF7F 3UW1A 5J2NB 1UVKA 1LW0B 4UQTA 2HLUA 5KFLA 5KOWA 1N4LA 2E9RX 3RW6A 2R7VA 2OPSB 4YB1P 3IGNA 4QWDA 2E9TA 3G6VA 4BWMA 1C1CA 1UJ5A 1HI1A 3EZUA 3K59A 2ZH4A 2HHTA 1REVB 4B3SF 3SDEB 3D0IE 3TYTA 1G7CB 2DNNA 1ZTWA 1Q8LA 1UA1A 4QR0A 2I0XA 3DRSB 3CIMA 2JC1A 1WD6A 3BR8A 3V6DA 1FKOB 3QGPA 1FJGF 4PCQA 5EUHA 4NLTA 2ZH6A 3G86A 2E44A 2QYCA 1L3VA 1ZH5A 3OSNA 5A0YA 4CNZA 2FHMA 1LW0A 2KHCA