4DUYF

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 21
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4duyF00
5AJ3F 4JI6F 1IBMF 2B7BB 2BVZA 2RJZA 4DR2F 4LF5F 4JV5F 1N32F 3OTOF 4DR1F 1F60B 4NXNF 5LMUF 4LF8F 5LMNF 4JI2F 4JI3F 4YY3F 4B3MF 1HNWF 4DV0F 2UXCF 4DV1F 4JI0F 3T1HF 1IJFB 2UU9F 4X66F 4DR7F 4LFBF 4DV7F 2HHHF 4GKKF 2ZM6F 1I94F 4X62F 1LOUA 4LF6F 4K0KF 1FJGF 4OX9F 1HNZF 1HR0F 2UXDF 4YHHF 2E5LF 2VQEF 4JYAF 1QJHA 1N34F 5IWAF 2UXBF 4DV4F 1RISA 1CQNA 3R3TA 4X64F 3T1YF 4JI7F 1B64A 2F4VF 4GKJF 4DV6F 4AQYF 2KJVA 1IBLF 3ZZPA 1IBKF 1CQMA 4DV2F 1XNQF 4DUZF 2YY3A 4JI4F 1N33F 1XMOF 4DV5F 4KHPF 4NXMF 1IJEB 4DUYF 2BXJA 4JI1F 1N36F 4X65F 4LFCF 2B7CB 1HNXF 4LFAF 1G1XA 4DV3F 2J5AA 2UUCF 2UUBF 4DR3F 4B3TF 5BR8F 4JI8F 1GH8A 4B3RF 4B3SF 1XNRF 4DR4F 2KJWA 2VQFF 4JI5F 4LF4F 4LF7F 4DR6F 1VMBA 4DR5F 1G7CB 4LF9F 1J5EF 2UUAF 1XMQF 1FKAF
chains in the Genus database with same CATH superfamily
1WC5A 1RTJB 4JV5F 3R27A 1EP4A 4W4MA 3MPWA 4FKYA 4LR9A 1Q4RA 1TL1B 4A46A 3AQPA 2L9WA 4QWEA 2EKYA 2MMYA 3EVMA 3MM7B 2RILA 4P7VA 3FUYA 3DGPB 4K59A 2H3EB 3MD1A 1RWOB 3TAMB 3CPWR 1WC4A 3EDQB 3AJ2A 2KFZA 5FDLB 1AA1B 3ET6A 2HLTA 2AJ0A 3TJ8A 2XSJA 4TVAB 4DSEA 3AFGA 4A8QA 2OLWA 1FWPA 1IR2A 4P2FA 1X4AA 3RB4A 5EX0A 1RA7A 2V8HA 2RF2B 4E2FB 4LSZB 2B3TB 2LEAA 3MPDA 3NBPB 2ZHBA 4MK7A 3LW5C 1PBAA 3VAHA 5KFKA 1CJKA 4DQRA 2AGQA 1IQZA 4TY8B 1YHQS 4H4OA 1XNRJ 2R3VA 2ZC3A 1TKDA 2C3YA 2U2FA 1S6PA 2CQ4A 1M5VC 1AROP 2BRKA 3QWUA 3KMQA 3HVRA 2LQ9A 1KVIA 3M32B 1SH3A 4OMFG 3ISZA 1TL7B 3T41A 1EB0A 1VRQC 3H0PA 2DR9A 4NX9A 1NSKL 3SFGA 1YITS 2UXBF 1U6ZA 2RQKA 4QIWD 3LO3A 3OLAA 4DBQA 2MZQA 3MMBA 4DQSA 2AJ1A 2DHGA 3CXCR 1R89A 2FJBB 1V3SA 4C7QA 4KBIA 2AMCB 4LQ9A 2HS4A 2UUBF 3H8YA 2NPFA 4QW8A 4YFUA 1HL6A 1VK3A 4WU2A 2B4UA 3ZZYA 1YK9A 3MMAB 3IWNC 4OLPA 3M9NB 3NMRA 3AB4B 1IR0A 2JWNA 2GVDB 4JI5F 4WCEQ 3CJ3A 1I5OB 3GJSB 3ENWA 4ZPBA 2WOMA 3OL8A 2E29A 2RHSB 2KZZA 1QY7A 4DU7A 4IO1A 3SYZA 1Q8LA 4ZLNA 2OEKA 3LWMA 2Y8YA 2D41A 3JTNA 1K8AT 1YLXA 1D8YA 1QDUB 4DR6J 4Q45A 1MWZA 4CDIA 4Z2XA 2YNHA 1J5EJ 5KAKA 1BLUA 5A8RA 4F4YA 2OGUA 4QBUA 3IO1A 1HMVB 3KK2B 1KKHA 2HGLA 4ZJLA 4P9SA 1NPPA 2VQEF 4M5HA 3OL7A 1DTQB 2OP5A 2HHPA 1V5IB 2HFUA 1U0HB 4QCLA 1ZYQA 2F4VF 1RHMB 2DEIA 4PG7A 3ZZPA 2H4WB 4DV2F 1F5CA 2HQCA 1Q7LB 4K4TA 3HFVA 1A7GE 3IP0A 4DG1A 2DRDA 4ANCA 4Y2CA 2E5HA 5D4OA 4WKYA 4DU8A 1D0EA 2F1FA 2RH3A 2BKPA 5K8NA 5CYQA 1YBAA 1ZAXA 2GGPB 4N47A 3G87A 1HIYA 2LMIA 3DRSA 3T1AA 3RAXA 4F7VA 3N28A 1MMLA 4USIA 1NK9A 3M8SA 1HLWA 1R6YA 1TK5A 3NS5A 5J2MA 3W62A 4DV1F 2MQ8A 2ASJA 3MM9A 3V6DB 1WELA 2PA8D 3GQCA 1NK8A 4KPYA 4ICLB 1JJCB 5F0UA 4USMA 1VQKS 3M8PA 3GG1A 3CC7S 4NOHA 3R5DA 2A6MA 2KI2A 1PJ5A 4DPUA 4FPIA 2IM2A 2JJ4D 2MQPA 2JFKA 3IAS9 4HI2A 2XS5A 2IA6A 1WNEA 3GV5B 2I0XA 4OV1A 3UCGA 3DLLQ 4LT6A 1CSJA 1SJRA 1HBOA 2GQQA 2HSEB 5J1PA 4PXCA 2H5IB 1B0VA 2IRYA 4J7CA 3KFWX 2K06A 2V34A 3PW7A 2XYGB 1VIOA 4MKAA 3SZ2A 2QA4S 3TI0A 4CRJA 1KEKA 2RJZA 3POTA 3GONA 3J7AN 2YNGB 1VLYA 1RA6A 3FK4A 2JOQA 1JNRB 1KQFB 2DO0A 2F8MA 1YZ6A 5K14A 3UO0A 1ZM2A 2P9EA 4JV2A 1IM4A 3HMJG 3OL9A 2CPJA 3QSYB 5KT3A 4ECWA 2DR6A 4DEZA 2DJWA 4GKKJ 1T05A 1JLFB 4LUBA 4N77A 3DC2A 2XEXA 1VISA 2OIHA 1J2VA 1VQMS 4USJC 1FA0A 2YX7A 5HBMA 4NCGA 1VJQA 2OAUA 4ANDA 3L09A 5MLCV 3E8OA 4Q7AA 4PR6A 2J7KA 4KSEB 4OZJA 2ZH9A 1VI7A 3JSBA 2RUSA 3D28A 4DL2A 1RI7A 2ZBPA 1KC8T 1RT2A 4M63A 5A8WB 1L3KA 1EARA 4AE5A 2KKHA 1OJ4A 2DNPA 4RNHA 4ZS6A 1HKAA 3KLIA 2PI4A 2HYIB 1NHVA 3RG6A 2AEJA 4G1IA 1FKOA 4CLUA 2L9DA 2A1BA 4FBTA 5LMUJ 2DGQA 4NEYA 1SL1A 2H4YB 3FEZA 3I31A 3D7SB 3V2UC 3KJVB 1HPZB 3C66A 2O3DA 3SIPB 2PEBA 4KIAA 3HFZB 2ZD1B 2Z0GA 2FJXA 4CWBA 2L41A 5B0EA 1J5OB 2BM0A 1IJEB 2B43A 5EWEA 4LJMA 1DQ9A 1SJ4P 2QO3A 3OHAA 1XBWA 1FDNA 4PYAA 1WWHA 4G1QB 4ETXA 1XMBA 5CAAA 4DV3J 3PKYA 2YWFA 2E9ZA 4ZCMA 2PA3A 3A8EA 3S7RA 3OJUA 2VOPA 1VQ8S 3P4UB 2XB2D 3TZYA 5D4PA 3OHBA 3R9LA 5KT4A 3ITHB 2ZKTA 2HHUA 2C1EB 3NNCA 5KT6A 4JV5J 1UP1A 5KOWA 1S1VA 2PO4A 3V4MA 1C0TB 2HS0A 2VA3A 5MAOA 1SJQA 1LK5A 2J9DE 1YJRA 4M5GA 4O0IA 4DQQA 2EC0A 3TUPA 2ZNYA 2BQ3A 1HWIA 2Y3YA 4JI7F 1PAUB 3G86A 4MMOA 2DY1A 1UA0A 1JLQA 4DX5A 3DYAA 1NJXA 1VYAA 4K4XA 3I0SB 1XJWB 1TTHB 2ILZA 4AXIA 1Q1KA 2QG9B 1ZTTA 1VQ5S 4B3SF 4X4OA 2DGOA 3A3NB 1Q8BA 2KJWA 5KFPA 4KKOB 3S01A 5AE1A 4HH1A 4FVMA 1CC7A 3W3SA 1G2EA 3N0VA 3FQLA 1LQ9A 4HTJA 2ZUGA 4USVA 4GO7X 3RR8A 3PM9A 2AZ1A 4CTAB 3Q8YA 3LP0A 2CQ1A 2EBEA 1ZPWX 2C2EA 1KVJA 2XNRA 2UUWA 4O3SA 2YWWA 1XIQA 5LXRA 2B5JB 4JYAF 2IJRA 3CJTA 2CDRB 1YX2A 2MKCA 3QJPA 3DOKB 5C2GA 2OELA 1UEVA 4K8RA 1UFKA 4NI2B 2CJKA 2YH0A 2CQCA 1NJWA 3WHIA 3AD9C 2UXBJ 2DHHA 3LF0A 4J37A 2ACYA 4LFAF 2Z2MA 2VD3A 3OUYB 1LNQA 1SC1B 1JKHB 1HNIA 5DLFA 5H9FJ 3V4IB 3CB4A 2CQPA 3HKWA 5LSLA 2O01C 4DL0C 4QPXA 1RE1B 5CD4H 2PN6A 2HNZA 2UUBJ 4IFYA 4EBEA 3DLKB 3BSNA 1U1RA 2VICA 2YPYA 4JI5J 1BE4A 1NPKA 3JB9k 2OPQB 4CLFA 1ZZFA 1FE4A 4MFBB 1S6QA 2QRRA 1VK8A 3VQSA 4TQSA 1ZPVA 1URRA 1O6XA 2ZDOA 4HEA9 2I5JB 2IDEA 3UWTA 3TVYA 1KONA 1M1KT 2JHEA 4GVBA 1QJHA 2V4JA 1AT1B 3NGDA 3QIPB 3KUHA 3D0IE 4DHVA 1S5ZA 2GHPA 4C3MA 2HHXA 2QL5B 1R6VA 1NB2A 3Q2SC 3TRGA 2VQEJ 2FHMA 1TFWA 1RT7A 5KT2A 3BREA 3RR7A 4KO0A 4PQUB 4PKDB 5BR8J 5ETRA 3H90A 5B0CA 3UR0A 2F4VJ 3FCVA 3EGNA 4DV2J 2C2DA 1SC6A 2EFQA 4UT4A 2RE1A 1PIEA 5LL6d 4U7UK 3RBXA 1RWKB 3GE9A 3W63A 3CDBA 1LWCA 4RW4B 3W9JA 3ILOA 4LF8F 4DFJA 1RT1A 3UCZP 4NLSA 4J9OA 4F2RA 2AF6A 2JVOA 1ROFA 2J7WA 1B99A 2COLA 1U1LA 6AT1B 3DLJA 2KL8A 3DOMA 2D69A 4K5SA 3WZ0A 4C3KA 3QZ7A 1BUXA 1HNZF 1CPZA 1S9FA 2AYBA 4EBDA 3EWGA 1HBMA 4RPFA 4Y65A 4HKQA 1FK9B 3KHHA 3CEDA 4XPEA 3HSDA 3DRRB 3SBMA 2WAQD 1IKYA 4QWDA 3FDSA 1IKXA 3GZ7A 5KFFA 1BXNA 1JLAA 1VRUB 1B0TA 1ZM4A 1CJVB 1YI2S 5B08A 3P5TL 2MLXA 4RNNA 2LQJA 1LWEA 4ZVRB 3K2YA 1H2VZ 1S1XB 4M5LA 1QAIA 4LSLA 5AE2A 4ZJOA 4URSA 4P2SA 1XWLA 4G6VB 3TVKA 1MU2B 1KLMB 2IM0A 2ZEJA 2R4FA 4OIXA 2I6WA 1LW0B 4D3GA 2MHNA 4NA2A 5KFVA 2IMOA 5DQHA 4ED2A 1B0PA 1EETA 4XAKA 3PIOQ 4RNOA 3V6JA 3JXOA 3I9V9 2IIHA 2JVRA 3GLJA 1FRKA 1S12A 5E3CA 3VQTA 3D1OA 2C2ZB 2G0JA 1Z1ZA 2MGZA 5CCMA 1Y5NB 4N41A 3EMTA 4ZVQB 1RTDA 4EU0A 2IDLA 4WF9Q 3O2IA 2CQBA 3TAQA 4Y6IA 1HBNB 3OSNA 3B54A 3TOQA 1N5VA 5SZTA 3I82A 1QSYA 2ZH2A 2KYXA 2PT0A 3GYNA 3HVAA 4PXBA 2RDDA 3MEGB 1L3VA 3H25A 1U02A 3M7VA 3PYEA 3IAM9 2PFFB 3NGKA 4DN0A 3BV8A 4K2JA 4CO2A 2Y1RI 2YNIA 4DF4A 4HLBA 1N5TA 4ELTA 4OYAA 2VFUA 3CJRA 4NA3A 4ECVA 1WF1A 3D3CJ 3PZPA 1DY3A 1M5HA 1CG2A 1T7PA 3C16A 4KFBB 5HROB 1RBAA 5FLXU 5LT5A 1U1PA 1LOUA 4A8MP 7FDRA 4Z7CA 2NXJA 2DXEA 2N7CA 3IS9A 4LIWA 2CJBA 4Y00A 2RRAA 2V69A 1EIYB 3W9IA 1Y10A 1T9VA 4O3RA 4OHVA 3CO0P 5J2NA 3JTPA 1C1CB 2ZVIA 2AYMA 4FXDA 3KLHA 1S6UA 1F0XA 3OSPA 4RW8A 1UFWA 2V2QA 5HLFB 2E9TA 2HK2A 1DTTA 2L48A 3MDFA 4I7FB 2YXLA 1U47A 3OTEA 2NREA 1RKIA 3FBCA 4CT8A 5CYMB 2CNOB 4P71A 4ES2A 5IT9Y 1WC0A 4XPCA 3J7ZT 4B9MA 4PUOB 3HULA 4UOHA 5KFNA 4ZPCA 2GIFA 2NXUA 4LREA 2XGQA 2W7PA 3I56S 4YHHF 1Q16B 4LVOP 1RCXB 1SKUB 3W5YA 1UKUA 3K59A 3D5MA 2DHSA 1CJTB 2V2VA 5E2QA 4EYHB 2ZNZA 1RHRB 2BDPA 4ZVHA 2WB1D 1YKWA 3OPKA 1TELA 4KR0B 1REGX 1TFYA 1WTBA 4H54A 1WC6A 2J7UA 3DRPA 3Q8PB 3BPDA 4O44B 1RT6B 5IT9U 1IBCB 3MM5A 3TR5A 4H4KA 2CQ3A 2W2QP 4DR5F 2EFGA 2GC8A 4B3SJ 2MKYA 4NWBA 1LW2B 2XNQA 3DLHA 3W5XA 5IV4A 4I6WA 3Q0AA 5E3QA 1BY9A 4HACA 5IM0B 2AWZA 4IG0B 4PXDA 1Y3JA 4YR2A 3MUVP 2BW7A 2NXNA 1NKEA 1I94J 3CJ0A 3DXSX 1PGZA 1UA1A 2PC6A 2E1CA 1EZZB 4UUXA 3JSMA 4UW2A 1YJUA 2ZBRA 1OIAA 1F2GA 3I9ZA 1R0BG 1EKSA 1JLCA 1VC0A 1JLBB 2N3LA 4DV5J 3HHLB 3ILLA 4DSKA 3MAHA 2EI5A 2AW0A 4FP9A 2O5DA 5D8HB 4J9MA 2R2TA 3PR5B 3MFIA 1GNKA 4LRBA 2KXFA 3MM6B 1U1KA 1Q78A 2JC0A 3W8GA 3J81Y 1N52B 2D9PA 4FZVA 1VQNS 2HIYA 4LFAJ 2NS1B 1T9YA 3F44A 3CVKA 2DKOB 2W2NP 4CLPA 2BACA 3C6UA 2ZFHA 2KB2A 4DOZA 1X9SA 2YKNB 3H2LA 5LMNF 2J6TA 4Q43A 3RZAA 1FXLA 1VBXA 2VA2A 2XG8A 3M6VA 2YKMB 3BR8A 2HAFA 2JNJA 2KZMA 1BQXA 4DFKA 1F9FA 3NWGA 5F0WA 2XCPA 4OI0A 1SVDA 3MEEA 2B51A 2FTRA 2H54B 3C15A 1CQNA 2LXUA 2XHWA 3K17A 1B64A 5L1LA 4MK8A 1H0HB 5BXIA 1WORA 2RMLA 1RYSA 2JL9A 4JI4F 2VBYA 3HFKA 3HHEA 4X65F 2W9CB 3NS7B 2FYXA 4USKA 1GQEA 1FRHA 3H5YA 1ZM9A 2WZ1A 3VVTA 4LSNB 4PXEA 5E3RA 1PJ7A 2HW3A 3TUJC 1XR5A 2VF3A 3BSOA 1HQ2A 3QAEA 4MTPA 5J1NA 1FHTA 2NPIA 1SXLA 4N7TA 4OYIA 4LRFA 3VF0B 3BM7A 1TVRB 4HYKA 1H98A 3RTVA 5D0GA 4F4XA 2EVZA 4ZP7A 1JWWA 4YR3A 3Q22A 4FXWA 3HO1A 4LF8J 3GWCA 1DFDA 4FPRA 1AUDA 3W7BA 3LQVA 1WKLA 4X4VA 2RKIA 4DSIA 5LSOA 4CLZA 3PTWA 1VQOS 3FSYA 3CMES 4GKJF 1HNZJ 1HQUB 2KHDA 4QYZK 2RQMA 3D68A 5KTQA 3GV7B 4OZLA 3MWBA 1D9AA 1R27B 2XMAA 2ZH6A 2HQ3A 3VAIA 4OYBA 3T6BA 1WI8A 4LR7A 4WK3A 2ZDPA 3TP2A 3I4HX 3CJ4A 3UQSA 2CNNB 4PYDA 5C25A 4YB6A 5EUHA 2FC9A 2J0WA 3B8HA 3E01A 5B09A 2PMHA 2OHDA 1GTHA 2Z2YB 3OQ2A 4EFAC 4QR2A 3IM9A 3C14A 1PBUA 2K1RB 4RW7A 1U6FA 3QJJA 3GILA 2EC2A 4C0BA 2HEKA 3MMCA 1NBEB 4ZN1A 1MSWD 1Y5LB 1X31C 3TVZA 2J9CA 2FGCA 1TQLA 1OMSA 2DNKA 2FPHX 3K5OA 1H38A 4DPTA 1N8RT 1RTZA 2HFVA 2BKOA 2HNYA 4DV6J 4I64A 1ELOA 4RUHA 2VPYB 2O67A 4X4NA 3M05A 2NZ4A 2VFRA 3KMSA 4DPWA 4BWMA 1U0SA 2OPSB 3A1YG 3RYLA 1YRUA 2GO8A 4B3RF 1RTHB 3QT5A 5HP1B 3FRYA 5KFQA 4M5MA 4RBVA 5KFOA 2DO4A 4TN2A 2WONA 3J80Y 3U27A 2W9BA 3IMQJ 4J9RA 4R5PB 1O51A 3V81A 2ZOFA 2UVUA 4OZ3A 4IRDA 3D4JA 5H9EJ 3NL0A 3D6TB 4DR7F 1SH0A 4FXVA 2LXFA 3RB0A 4IQXA 3BKTA 5EWGA 4TQRA 1BQNB 1R31A 2J9DA 2W8KA 4DZDA 2OPPA 4ZPVR 5T14A 3BYRA 2XS2A 3R1HA 2ILYA 2V0NA 5IC4B 1SJ1A 2RRBA 1ZA1B 3CWJA 2HHSA 5JMNA 1UZHA 1PILA 1HI1A 3J80U 2YKAA 1YDLA 5E5NA 4ED7A 4QYRA 1CULA 1TV6A 3MURP 4MK9A 1RTJA 4J9KA 1R0AB 4U67Q 3EX7B 3M6XA 1TL1A 5KFHA 5ETVA 4YP3A 1SI9A 1BD6A 1LFWA 1WF0A 2ZWOA 1FTCA 2RDJA 4Q5VA 1YBUA 3MM7A 4PEOA 4MIBA 4ED4A 2KO1A 5KG3A 1XERA 3DGPA 2KH9A 3GYXB 4AUKA 3QRQA 4X66F 4C3LA 3QQCD 3QGGA 3PR4A 3TAMA 3AOBA 3ZO7A 2DIVA 4FF4A 1P27B 5FDLA 2J8SA 3TANA 3CCMS 1VHFA 1N34F 5M2UA 4WPAA 3SQOP 2XWYA 1X4EA 1LWFB 1U24A 4OX8A 2VV5A 3QMQA 4NLXA 2XI3A 2RF2A 1XMOF 1FJEB 3IR5B 3NBPA 1P6TA 2UVRA 1UCNA 4QIVA 4DCJB 1K0VA 3D2WA 4J9PA 5ETMA 4B3TF 3H5SA 1OY9A 2J6UA 2G2OA 4UQGA 4TY8A 4F50A 4E98A 1FKPB 1SV5B 3RGIA 2QC3A 3CJQA 4MYUA 3W61A 2P6SA 5EX3A 3ULHA 1NNDA 1TUWA 1U25A 3ENVA 4O4RA 3M32A 5EGYA 2MSSA 3Q8UA 5F41A 4V19X 1TL7A 2XYPB 3Q89A 4P74A 4DR5J 4NASA 1VQPS 4B3MF 4ED1A 1JJ2R 5K5MA 3D6HB 5AXKA 2ALYB 1KQSR 2WVEA 1R8PA 3NNHA 4ELVA 3PNIA 4U7UD 1N4LA 1Q53A 3CDWA 2FHJD 4ECRA 4DF8A 4LF1A 4AFFA 5L1JA 5HQ8A 3H98A 2HGNA 3H7HB 3GSIA 3FFIB 4IR1A 3L9ZA 2X51A 2CA9A 3MMAA 4KB7A 1S0MA 4NXMF 2GVDA 3TJAA 2JEJA 5DM7Q 1OQ3A 2QT7A 2F40A 3JYTB 1TUVA 5DDRC 1N54B 5F8JA 3ZZUA 3G6YA 2F3JA 5GAGU 2CG4A 2WVFA 4WZMA 1PKUA 1FXDA 3IR7B 1NHKL 3ZZRA 1DLOB 4WE1B 3VAKA 2HRYA 5KFZA 1JK9B 4EZ9A 4PZVA 3WX4A 1AUSL 3ISND 1HNVB 4YR0A 4DS4A 2JSXA 2CYYA 5AXNA 2DYAA 3H5XA 1HMVA 2ZHAA 3KK2A 3Q8RB 2WSFC 2MKSA 2W2MP 3MUTP 1DTQA 4BLGA 1U0HA 5LMNJ 4LMZA 2R42A 1R8HA 4A8YA 2BYCA 4DS5A 2HFZA 1TAUA 3GFXA 3P45B 4XIUA 1YTYA 1HWJA 1PAEX 2GGPA 1Q81T 4JI1F 3VZHA 1FRJA 4A48A 2A10A 4PWDB 2K3KA 4NLQA 4DSJA 2ABYA 5GAEU 2F7VA 2MKHA 4Z37A 4JI4J 3G6VA 1BWVA 2XS7A 4DX8H 2FLLA 3MECB 3UD4P 2OSQA 1O8BA 2LECA 2VBZA 2YWEA 3V6DA 3DFEA 4WIQA 3KLVA 2JLEA 2R8JA 2W7OA 4M5DB 4ICLA 2B8PA 3ZZOA 3QAUA 4CO4A 4B9VA 4JI3F 5E41A 4BWJA 3UDEA 4CM2A 2LEBA 4WU3A 1Q8IA 2A2DA 5AT1B 1FD8A 1FJGF 2D3ZA 2P6TA 1RU2A 2FVSA 2XLJA 3TX8A 2FDNA 5ETNA 4GRSA 9RUBA 3IBWA 2N3OA 1VQ7S 1SCJB 4OFZA 3V6KA 4AYBD 2FHKA 4RKUC 3P8BB 1F9EB 1TU0B 2E1RA 3CT9A 4RNMA 3TNVA 1RHKB 1FESA 1PJ6A 1CQMA 3HSGA 3EM1A 2Y8WA 4DX6A 4O4GB 2IYGA 1DBDA 2J5AA 4GKJJ 3M8RA 3NRBA 3CJ8A 1M5OC 2CZ4A 3Q24A 2IBKA 4J5OA 3K57A 3GPAA 3ZTPA 1RK8A 2YNGA 5B7WA 3EUNA 4ELUA 5C2CA 4G3IA 1M5PC 3Q8SB 3PO5A 1SQEA 4UQTA 1VR6A 3HSJA 3CJ5A 4YDDB 2GO9A 2F63A 1K9MT 4KGXB 1H2TZ 1WG4A 4X62J 4QWAA 1JLFA 3UFCX 3SSRA 2Y1JA 4KYZA 5E7OB 3W66A 2OMOA 1JNZB 5IT0A 2QLFB 4F26A 1H7XA 5D0HA 2YBVA 3K58A 1XNQF 2RD5C 4TU7A 2CQIA 1EKRA 3VVUA 3CCTA 2BKNA 5CHCB 2XGPA 5KT5A 3NP5A 1FF2A 4Q0BB 1FFGB 1OY6A 1LK7A 2J9EA 3PW5A 4LF7J 2VDIA 4O3OA 1FX4A 5A8WA 3BO3A 4IRCA 4A8FA 2QA4G 1FEEA 2ZH5A 1RT3B 1JLEB 4F4AA 3GIRA 3KJQB 4I69A 3R5GA 3GR0A 2P2CB 2B9WA 1KNZA 2M7SA 3KJVA 1Q86T 1HPZA 2XMUA 3PYFA 2ZD1A 5RUBA 1TR0A 1NU4A 4DR7J 1J5OA 2RSQA 3FNNA 3VGUA 4ZP9A 1GMWD 3CMQA 4RL1A 4O3NA 4ZIVA 3GSDA 4P73A 5IFMA 5ETLA 4FF2A 2EK1A 2XWXA 4OJ1A 2JFDA 2DNZA 3UDCA 2DK2A 4G1QA 5KG4A 2UVWA 2V2KA 2XHCA 2ZOMA 5B0DA 5HQLA 5D77A 3I4PA 2LQBA 4I2PB 1XR6A 3JS9A 5D4LA 5LOQA 3I6PA 2ZH3A 4YQWA 4USHA 1RDRA 1S1UB 5SUHA 5J2PB 3ITHA 4CO1A 3CCVS 3PCOB 3OXGA 3DN9A 2W24A 5CZVA 2BVZA 1D8ZA 1N32F 4CIOA 3T5LA 1TL5A 2GQCA 3N4WA 4DQIA 1C0TA 3IWXA 3N6MA 1RLDA 2V67A 1VQ6S 1A9NB 4WXWA 2AX0A 2IAJB 3PRVA 1HBUB 3QSIA 5KFAA 1TL3B 1T9WA 3R97A 1PSDA 4X66J 1VC5A 1D9DA 3RAMA 2FJAB 5HMXA 1NK5A 2V9WA 2QLWA 3I0SA 1MNEA 2AYGA 1T3NA 3KUGA 1WDDA 2K3IA 1FFWB 2BMBA 3PVXA 1CBKA 2VUGA 3SV3A 5E33A 4DFPA 1N34J 1KR4A 2F5GA 4DUYF 4KKOA 5KFSA 3KDOA 2BABA 1G1XA 3MTKA 5IXUA 4L3KA 2G0IA 1AZSB 3GFYA 4U96A 2QFJA 4A8XA 4OI2A 3CSKA 1YG0A 4ZPDA 2WSCC 3UN2A 3AY0A 4W92B 5D78A 3FBEA 1H3DA 2RHQB 4CTAA 2QX0A 3ICLA 2MEWA 1VS3A 4U8VA 1IBMF 3WC2A 1X4GA 1YJ9S 4W90B 3BSAA 4EK2A 5I4MA 2V4QA 3T1HF 4YOEA 4AL7A 2B5JA 2HHHJ 2F9JA 4OYMA 1X4HA 1NJYA 2E1AA 2EPIA 1F9HA 3DOKA 2HIQA 2HNDB 1HHSA 5ETPA 1HYSB 3H4BA 4B3MJ 2AJQA 4NI2A 2KTQA 1WHYA 3OR2B 3KLGB 2D74B 3MAAB 5DQIA 1Y3KA 4NEZA 4IG3B 4X4TA 4NRTA 3OUYA 3LPYA 4R25A 1JKHA 2DHXA 1OQ6A 3V4IA 5ETOA 1U8SA 3AA9A 3NLCA 4RO0A 1X9WA 4HDGA 3U7JA 3G6XA 2VG5B 1Q8KA 4J9UE 3RUBL 2HS3A 4HHHA 2QJ3A 4CH7A 3DLKA 1URNA 3DOLB 3UDLA 3IFEA 3X3UA 2D9OA 1VQSA 3IRWP 2OPQA 5DQGA 4Y2IA 4HVZA 3FBBA 4WFNQ 2XMVA 4MFBA 1SQFA 4X4PA 1RXOB 2CNKB 2R2SA 3OTOF 3IBFB 1UVKA 4ZVPB 3U1NA 2I5JA 4YN3B 1GFWB 3BGRB 3QIPA 2XULA 2FVPA 2LA4A 3P3DA 3M1VB 1NRKA 3MXHP 4A8KA 4OI6A 3E3XA 5CH7B 2OFHX 3PJXA 1TMJA 3VGSA 2FJVA 3I96A 5E3PA 2UXDF 5HVFA 4ILRA 1C4CA 2BOAA 2AHOB 4PQUA 2R7VA 2XC9A 3M6WA 1GXUA 1IBKJ 2ROPA 1KTQA 2VBXA 3VV2B 4BDPA 2DNRA 4N8NA 2QMUB 1X7VA 3BKFA 2BJ7A 3QJLA 1P9QC 4NL5A 4DPXA 3AOAA 2CPIA 3MMJA 3BGOP 1IKWB 3A12A 2PE8A 3AJDA 3OVSA 1OYDA 2P9CA 4C8NA 1EJ7L 3ZZZA 4JI1J 4RW4A 3D0GE 3R7SB 3CCJS 3UD3P 4IOBA 4RW6B 4CNYA 3HM9A 4EO6A 1RAFB 2UUAF 3ELHA 5DGBA 2OPRB 2XM3A 3RBZA 7FD1A 3EXYA 5F8HA 1F5AA 4CLWA 1GXLA 1FK9A 3M2RB 4IYQA 3DRRA 3NNAA 3FBFA 1K47A 2ZE2B 2IFXA 2PGCA 4JI3J 2CKWA 1VRUA 2PEHA 4X4QA 1CJVA 4NRUA 3CJ2A 3LPEA 2CJ9A 4K5RA 3BQ2A 3TQ1A 2PD1A 3QFHA 1S1XA 2CG8A 1FJGJ 3D9BA 2GJ2A 4WTOB 3ZZTA 3L95X 1NSQA 2P9GA 2ZJPQ 2OMLA 4DLGA 1CEZA 1F1BB 3MHYA 3IXQA 1U26A 1MU2A 4KHMA 1KLMA 1TL4A 4ECSA 2IM1A 1RAAB 4NZ6A 4A4JA 2CQ0A 5D6GA 4TXSA 1RADB 3M30B 1LW0A 3HT3A 3PDNA 2AYEA 2H9ZA 1FDAA 1MW7A 2D3UA 2ASLA 1EQMA 3CDEA 2B7BB 3UNYA 4DR2F 1S72S 4I6YA 5KFEA 3R7NB 1WEYA 1KOHA 2BJ3A 4IDKB 1FNXH 3TEGA 2JDJA 2AT1B 4LR8A 1HBNA 5F3TA 4KGVB 4C2MA 2KT2A 8ATCB 2YH1A 5JVHQ 4C11B 1RAHB 3M4XA 4KV8B 4ENOA 1D9FA 3MEGA 2CRLA 5LSRA 3BDEA 3J7YU 3OJSA 3GV8B 5BJRA 3HI9A 4P7TA 4HL9A 1WC1A 5B0BA 2Z2ZA 1OO0B 3BKUA 4C8ZA 2AZ3A 3SCKE 2UV8G 4WP9A 2M88A 1RTIB 4DR4J 1JX4A 3FMBA 4NMXA 5L38A 1XNQJ 1KDNA 4ZCIA 5IQQA 3PIPQ 2FJDB 1VMBA 4KFBA 3DHXA 5HROA 5JJBA 3BO4A 4J9NA 5F8NA 2ZZTA 1QM9A 1FO1A 1U09A 4OZ0A 2VDHA 2HG4A 3KG0A 4DV0F 2UXCF 1WHXA 1IJFB 3OT9A 2IPOB 4OHZA 1NM2A 3EPGA 1Y0HA 3TX0A 4CNZA 1XN9A 4RWXA 3LTOA 2E5GA 3CO9A 3PFEA 1U2RA 2BM1A 3EE3A 2E5IA 4K50A 2YQ1A 2FJWA 2E5LF 3CIZA 5E3AA 6FDRA 5HVHA 1P1LA 3CUNA 1JJ4A 4FYYB 4HDHA 2HHWA 1AXQA 4QYZJ 4QIFA 1C1CA 4ZIWA 4QIEA 1IBLJ 5THWA 3OW2R 1UEUA 4F25A 2IC3B 1KN6A 4DUZF 2ZC4A 3N01A 2EW9A 5HLFA 4KTQA 2IVFB 3KHLA 4I7FA 2V63A 4ZN3A 2C3OA 2YWGA 2F65A 1GH8A 3M8QB 1QTMA 4OLOA 5CYMA 2DY9A 2V68A 3GYGA 1REVB 1I51B 1LXNA 1XMQJ 4FF1A 1VBKA 4PUOA 2QGFB 1X5TA 5AJ3F 3IG1B 4U7CA 4UF4A 1NB7A 4QU6A 2C28A 1RBLA 1U1QA 3EZOA 1IN0A 2HQIA 3UVJB 1S6OA 4ZHRB 4ED8A 2AX1A 1N32J 4RNFA 5EHHA 1CJTA 1FXRA 2E1PA 5D15A 4OX9F 2WVCA 3IGVA 3KG4A 5GAGI 1KFSA 3CCZA 4RJVA 1EX8A 2V8VA 4J9SA 2H1YA 3AT1B 1NK0A 1U7LA 2AIRB 4OJGA 1RISA 4BC7A 5ETSA 3Q83A 2GX8A 5BYRA 3FRZA 1RUSA 3OXFA 4O44A 3DM2B 1RT6A 4J91A 4NA1A 2GMHA 5J2QB 1OSCA 2D3OR 3FCWA 4DSLA 3TA0A 2H5EA 3DRYA 4ZPTR 2NSBA 2BQRA 1LW2A 4WP3A 3D66A 3B4MA 1NZ8A 1SL2A 3RB3A 5IM0A 1WF2A 4IG0A 4IQMA 3KK1B 5KG1A 3CF5Q 3SDEB 4NLGA 2PDAA 4Z7YA 3PRBA 1FKAF 2R8KA 3W9HA 1UAWA 3QT6A 2GHVC 1EAYC 1D3WA 3JSYA 3W2VB 2G0CA 1DHMA 4KH0B 1H72C 2WVDA 1IBMJ 1JLBA 2GJFA 3HHKA 2F8EX 2XY7A 1Z4UA 3EGVA 3T1HJ 1ZBTA 3HHLA 2Y9HA 2CPDA 3I0RB 5KFTA 4C8KA 1RLCL 2AP6A 2VG6B 2VBWA 3WIVA 2XO7A 1AW0A 3A4TA 1L5UA 2HVHA 3MM6A 2Z58B 2R8IA 2PMZD 3AXKA 3S8SA 1KS2A 1S7IA 3MR5A 4ALZA 2AJFE 2VPZB 2DH7A 1R43A 5GMKa 2Q6CA 2ZZMA 5DDPC 6FD1A 5D3GB 2FY1A 1S1WB 1OPIA 2YKNA 2VPXB 3Q8VA 1Y9OA 2O66A 2DT9A 4IH5A 3HXMA 1H2UX 2DGTA 2FHJA 1H73A 4ZDNA 4EYIB 4L74A 2YKMA 2R7OA 2QYGA 3D6MB 4WYWA 4Y28C 1QVGR 3MFHA 3OTOJ 4C98A 5FD1A 2Z57B 2HKEA 4CLTA 4LF2A 1NK6A 5IT4A 3N5BA 1N5QA 4B3OB 3QO9B 4NYOA 1M5SA 4PABA 1BGXT 2W9CA 1YRXA 2E9RX 1DQ8A 1UZDA 2QA1A 4XDCA 4JV1A 2JX2A 1HW8A 4DL7A 4N76A 2WHOA 1LEOA 4AL6A 2BUNA 2FVRA 4LSNA 4Y2KA 2VL1A 4HT5A 2DNYA 1NMEB 1GX5A 2F4FA 1X5PA 2X1GA 1VQLS 5GAHI 2DGXA 3H2VE 4P75A 2GFFA 3HHDA 1Q95G 3MOJB 4E0DA 1TVRA 4DQPA 2PFDA 2BBEA 3OTDA 4EEYA 3R6LB 3W60A 2PI5A 5CZXA 2ADBA 2MZJA 2R7SA 2NYIA 4ED6A 2ROGA 3UD5A 2C2NA 4NLUA 2JC1A 4ATNA 1PC4A 1T9UA 2NQPA 1IQTA 3BDPA 3H42A 4Y3CA 5DM6Q 4FYDA 5KFIA 2HQGA 2I2YA 4NZ0A 4ER8A 1AFIA 5BYQA 1VJWA 1HQUA 2VKZG 5F9NA 3HP6A 3QPIA 2ZBCA 4FVCA 2AJ2A 1B3TA 4M8LA 4ITSA 3R5BA 2HVEA 4WYLA 1U6BA 3IN5A 1RT4B 4YMEA 1F5BA 3R5AA 4AXJA 5DZ6A 3AA8A 4KY3A 1WHVA 1YGYA 4KPCA 2SXLA 2UUCF 4ZCLA 3HK2A 3ADAC 3Q8QB 1K1SA 1TKXB 2B4OA 3G82B 3HZGA 1RJJA 2K1RA 3Q2TC 1HI8A 2CVIA 3MEDB 1KTVA 1IKVB 3UN3A 1IWAA 3DU6A 2R8HA 3CJKB 2UUTA 3N6LA 3BQ0A 3V6HA 2QIFA 2DIUA 1O5JA 1VCTA 4KGKA 3RAQA 1QAXA 2FC8A 3DLBA 3T6JA 3P49B 2F8HA 4MAKA 4ECZA 2HFOA 4U9RA 4ZVSB 2DHAA 4OQJA 1KLNA 2MTLA 3L3CA 3THVA 2GJIA 4K4SA 3KDNA 2HHQA 3CCSS 2XCAA 3NCRA 2J0SD 4MYTA 3FJ2A 2ROEA 4IOCQ 3OFEA 1T0TV 2OPSA 3MTJA 4MH8A 1UFLA 1RTHA 5JUMA 5HP1A 1K0TA 1S0OA 5IZHA 5IQ6A 4HTIA 3MF5A 2M3DA 5KT7A 3MZIA 4CI0B 1U1OA 4WKRA 4TKTA 1KVKA 4R5PA 3MR7A 3L4BC 2LDIA 4OHXA 2EWHA 1XK8A 1T9XA 5L8RC 4F0MA 2M9KA 2ADCA 2W4PA 3N5FA 3CCRS 4DR1F 2LFVA 2IRUA 5ETKA 1C2PA 3M2UB 1BQNA 2ZUAA 2NLWA 2G2YA 3S6EA 2C3UA 2XMJA 4MKBA 2ZM6F 2Q43A 2XZTB 3LGMA 3SI8A 2UXCJ 4M95A 1HW9A 5F3ZA 5G0RB 3ONQA 3GU0A 1SC3B 2DVIA 3BYPA 4L3NA 3R3TA 2Z4PA 2H5JB 1TUGB 5K20B 5C5JA 1S97A 3GIJA 4IKAA 2E5LJ 5I42B 3LA0A 3MEKA 2JLFA 4QWBA 1X4DA 4LVNP 1R0AA 1XQIA 2Z8QA 4C8YA 3FQKA 4IFVB 3T3FA 4F36A 2OI2A 4DUZJ 1IXKA 1JXLA 1RAOA 3DMJB 3K8VA 2WRMA 2IVYA 4X2BA 2W4DA 3ILJA 2VU5A 1SUQB 3QLHB 1S79A 5A6PA 5K8OA 1VBYA 4DV1J 3FEYB 4JI2F 4F04B 3HJVA 3CC4S 5CQGA 1FNOA 2Z2LA 1R3NA 3CCES 4K7QA 3G71S 4FS1A 4TNOA 4H4MB 1BC6A 2RQ4A 4FYWB 2GAHC 2WB4A 1XTZA 1LWFA 4YDXA 4USUA 3EZ5A 3DDIA 1GAOA 1NCLA 4OX9J 3WQPA 1W7WA 5ETQA 1FKPA 1SV5A 1ZZNA 2OFGX 4G65A 1S9GB 3TARA 3A8KA 5GADI 4UZCA 4LIRA 4DWIA 4L73A 5KFGA 1TKTB 2DR8A 5AE3A 2R9LA 2HFNA 2M4MA 4BS2A 4ZOSA 2VIHA 4W98A 2GW8A 3PX4A 2DCUB 3AH6A 2D3O1 2GIQA 3F56A 4RUCA 2W8LA 5DDOC 3HDSA 5CD4A 2JEGA 3SSQA 4OJHA 1C1BB 1M5KC 5HJYA 2GMLA 2NSCA 2B9YA 4EI2A 1LV5A 3AHPA 2KT3A 3M2VB 2HZVA 4ILMA 5FLXY 1HI0P 3WBZA 3FFIA 4RBUA 4K0KF 3T9NA 2NXEA 4IUFA 3SQGB 2DB1A 2GHWA 3RW6A 2V94A 1HHTP 3R6GB 3NXZA 1S76D 2XMKA 2LVWA 1S9EB 2WCXA 3H20A 2LQ5A 2QL9B 3JYTA 2ALZA 2XBPA 3CC2S 4EGLA 1IUJA 4LRDA 3KJFB 2LP4A 5HVGA 1G4CA 1ZS6A 2GZOA 2DBBA 3IC1A 3O44A 1DLOA 4O3QA 3A3OB 1Q5VA 4WE1A 3HVTB 4IH7A 2MZRA 4KH1B 3HF5A 2HBYB 3D3BJ 1HNVA 3PY8A 2MKJA 1NZAA 2MHEA 2LU2A 1NSAA 1VOMA 1R8AA 3CDAA 2QYCA 4PAAA 4LF9F 2BRLA 3RRGA 4OYOA 1N0VC 1S7HA 3US5A 2C2KB 2HBQB 5HAOA 1GT8A 4KGZB 3AXMA 3PYDA 3OVBA 4JOUA 2N4CA 2HMIB 2YKOA 3HSZA 3ZC4A 3SXLA 2UU9F 2OTLS 1X4CA 3Q86A 3W2WB 3K5NA 4OZ1A 1K1QA 2K8GA 3W1YC 1FVQA 2JEFA 4QWCA 3OR1B 3E51A 1MROB 2V8PA 2XO6A 3C2PA 2HFSA 3I5AA 4PWDA 1SC4B 2L08A 5GMEA 2GIRA 4K4VA 3HD2A 3VAGA 1QUPA 4MT1A 1WUUA 4N5SA 4F4ZA 3CCWA 1SJ3P 3BN4A 4QPTA 3VCDA 5A8KB 2OTJS 1KBRA 3MECA 4QOTA 2KM8C 1NXIA 3LP1B 4OHWA 3U02A 3DU5A 2JZ5A 4M5DA 4CYUB 4PCQA 1FDDA 2B6AB 4I1TA 1CLFA 4OYWA 4P10A 3KUEA 1EHWA 1WOOA 3HPOA 1S57A 3T9ZA 3JQJA 5KFDA 1FTRA 2XLKA 2YPZA 4FKXA 1H7WA 1U49A 3J7YI 2DR7A 3AOCA 5F8IA 1ICEB 1YSJA 4TLQA 2CWXA 1L3SA 3PEJA 1QVFR 2BEFA 4CP5A 4HR2A 2R7WA 3FSIA 4OJ3A 2KHCA 3BJYA 4ID8A 4O4GA 4JI7J 2DCLA 1ZETA 4ETZA 1BQMB 4V19J 4ECXA 2CZVC 3ENAA 2FQQB 1S1TB 2R7UA 2POKA 2W2PP 5HO4A 3QYYA 4URQU 3PG9A 2KM8B 1RWNB 2MLZA 2CPHA 3UNGC 5KFWA 5BR8F 3TAPA 2HWHA 2GS8A 5B0AA 4HHUA 1I1GA 2IJFA 2UUCJ 1U2CA 5L39A 4RUBA 3VR1A 3MR3A 3LWLA 3V5RA 2HVDA 3MPUB 5AXLA 2DH9A 2AKWB 1V3ZA 3BGUA 1HARA 2J8AA 1X4FA 4KHRA 1U4BA 1S0NA 1V6HA 2MSTA 4RWWA 4J9QA 3GP9A 3FSXA 4P72A 2LEPA 5K8PA 4JYAJ 3PEHA 4TY9A 4M5NA 2KXNB 1UVMA 4R8UB 3PKMA 5H9EK 3CMAS 2AD9A 1G6BA 4B9NA 1RACB 1RWPB 4Q0BA 3F0NA 3R5JB 3ZTOA 3ISNC 1N33F 5A0YB 2Q79A 3VAJA 2BE2B 1RT3A 2P8IA 1JLEA 3GCXP 4BCAA 2MKKA 3GJTB 1M1HA 3UPFA 2J0XA 1RGVA 4DL5A 4YUDA 4IOAQ 2VJVA 2CXEA 4LF4F 2ZKUA 1X8DA 1TKZB 1N48A 1SKWA 5C42B 2P5VA 4BC9A 4DI6A 1JXEA 4JI6F 4X4RA 3NG8A 4WXOA 2I1RA 4YY3F 3BZQA 4CH1A 4A8WA 4CLYA 4CQ1A 4F8RA 1YZ7A 2CQ2A 3QATA 4PRFA 1HHQA 4M94A 1JLGB 4C97A 4DR1J 4AL5A 2LYVA 5HMYA 4F2SA 2M8DB 2UV8A 4L76A 4U6PA 4WFBQ 2ZHOA 2ZM6J 2XI2A 1OWXA 4YB1P 3KLFB 3TO8A 3KOAA 3H40A 4I2PA 4DPOA 3LP2B 3LAKA 1SKRA 3CD7A 4DL4A 1T03B 4KAIA 2E1MC 2HRUA 1DQAA 4CO0A 1S1UA 3HCXA 5J2PA 1TP7A 3CE8A 4QW9A 3B6BA 1G3OA 5BYSA 2RUGA 4Y2MA 3RW7A 4L6V3 2GAGC 2MZTA 3QGIA 3LGHA 3LOUA 3BQ1A 2V8DA 1CJUB 3TYTA 1OS5A 1RWWB 4DMZA 2IAJA 5KG5A 3WX8A 1HBUA 4FYVB 5LJ3Y 4PG6A 3AD8C 3PFOA 1TL3A 1HWUA 2AU0A 3IRXB 1N5YB 4ID5B 2QZ8A 3FZBA 1VFJA 2ZZNA 2Z56B 1S99A 2OSRA 4ES1A 1RWUA 1FWLA 3LALA 2OUGA 4TYAA 2C42A 4JI2J 5DETA 1N0UA 4I0WA 2GMJA 2GVZB 1ITPA 1CS4B 2XZWA 3CCQS 1RHUB 2XMMA 4P6QA 2Q3PA 5H1SV 4C48A 5KFMA 1AZSA 3DHWC 4OHYA 3H4DA 3KLEB 4Q2MA 1LWXA 3MGJA 3TJ9A 1UW4A 3DLEB 4ECUA 5KFLA 3MPVA 2V2ZA 5B0FA 4DSFA 3N6NA 2YQ0A 2DXDA 3HHNB 2LDYA 5U47A 1UEKA 2BQUA 1YWXA 4AD6A 1Y5IB 2WVBA 2R2RA 2HNDA 1HYSA 4FNHA 1X0PA 3OR2A 3KLGA 3CIMA 2C22A 3MAAA 1RHJB 5T7LB 2AEMA 1WJ9A 4IG3A 2B9EA 2XLIA 1GX6A 1KFDA 1VRTB 4DPYA 4RW9B 2HURA 4I2QB 4MIAA 2VG7B 3NWRA 2VFTA 2KFNA 2FZGB 4RUAA 2VG5A 1KD1T 3QZ8A 2KRBA 4K0KJ 3EZUA 2DRAA 3DOLA 3GTYX 3TZXA 3KJNB 2QA2A 5EDWA 1ZA2B 2ZH8A 5HATA 4ZVFA 2DPJA 3KK3B 1VDHA 1HD1A 1DZ5A 2YNFB 2W2OP 4EMDA 2HZAA 1ZH5A 3TW0A 1PYOB 4IR9A 2BR0A 2M8HA 3EJMA 1N56A 2MZSA 1T8EA 2VKRA 3BGRA 5HANA 5IV3A 1A0OB 5L46A 5KG7A 4DLEA 5LXYA 2MDAA 2RU3A 3DCAA 3M1VA 3DI6B 3O6QA 4CLKA 3BO2A 3RRKA 4LF9J 2R7XA 1QE1B 3MD3A 1NKCA 2J6SA 1QLNA 1I3OB 4U95A 1HQEB 1I94F 1SIZA 2F9DA 4IRKA 2UU9J 3GIIA 5HMWA 1WEZA 1D1UA 2VC1A 2RIJA 1IKWA 1N6QB 1RCOB 2XTJP 3T5KA 4B17A 3A13A 3SV4A 4DV5F 3BBCA 1FX2A 4KGMA 1WSRA 2BA9A 3PX6A 4RW6A 4C4WA 4YEAA 1T94A 2OPRA 1BHNA 1J27A 2QEXS 1N5SA 1RHQB 1F6TA 4DN9A 4M1KA 3SCLE 4ZLLA 2UP1A 4QR1A 5J1EB 2ZBIA 2BANB 3DLGB 4CT9A 3JQKA 4C8OA 3M2RA 5C24B 3C3LA 2C2OB 1YIJS 2DNHA 2ZE2A 1VLOA 3HVWA 2U1AA 2E44A 1RKJA 1RAEB 1C0UB 1UWBB 5L1IA 3OL6A 1E6VB 3SCIE 3A8IA 5FJ4A 2WTFA 2CWKA 1UJ5A 4LF6F 4YHHJ 1SBRA 2DISA 2ZITA 3BH6B 1NH8A 1E6YB 3TEHB 1U1MA 4DV4F 3G2XA 2FLOA 2M70A 3T1YF 1MN7A 1K73T 3GR1A 5I3UB 3B4DA 5ITHA 3M30A 4RX6A 2VHGA 4CO3A 3OTCA 1U8WA 1YJTA 4DL6A 1HA1A 1RT5B 3OFHA 3NGRA 2I8EA 4ES3A 4UY85 3C6TB 3B78A 4IDKA 1YVFA 4LF5F 2Y0BB 2GA7A 5L1KA 3KYLA 2YWHA 1GTEA 4ED0A 4OYZA 1ZTWA 1NEEA 4NLDA 3MM8B 1U1NA 2JEIA 1QSSA 1WG1A 4F0HA 1W25A 4C11A 4DV7F 5FIIA 2MB0B 4KV8A 1EP4B 2CADA 5LM7E 4JP8A 3OD2A 3TWZA 3ENQA 3O8WA 3VTIA 3G4SS 2CQGA 2BJDA 5D0EA 1RTIA 4N56A 5HSPA 1UJ4A 1HWKA 2XZDB 3PX0A 4M5IA 4ZMMA 4HT7A 3PRDA 3TUZC 3ET6B 4F0KA 1N33J 1F2HA 2VFSA 3IR6B 2DGVA 3QT7A 2XSJB 3LGNA 2VQFF 2X1FA 3PHTA 2GQ2A 3BB5A 1KOOA 3BS9A 3QRRA 3N79A 1A6LA 1AFJA 4QR0A 2IM3A 5DLGA 3PACA 5IS2A 4LF4J 2YKQA 4A8SA 2E5JA 4KJIA 3CCLS 1F3FA 3K5PA 4DCPB 2C2RA 1CJKB 3M8ZA 3K5LA 4H4OB 4OX6A 4JI6J 3M8WA 3SMZA 2DD8S 1S6PB 4YY3J 1RSCA 2X3GA 2IC3A 2XY6A 2M0GB 2UZAA 4GC6A 2B9XA 5KOXA 2FHOB 2QLJB 2V9KA 4B9TA 1PCAA 1TZ0A 3NCPA 3PW2A 4DV6F 3M8QA 2MQNA 3PV8A 2Q66A 4X65J 4KHPF 4NE9C 5CCLA 5EN1A 1REVA 3HX9A 3BBFA 3MCOA 2RT3A 5ADZA 1KQKA 5F9LA 1MMNA 4USWA 3MMBB 3IG1A 4NPOA 2H48B 3GCWP 1NDKA 1M90T 2I9SA 5HMZA 3QIDA 4Q8EA 3UVJA 1OY8A 2A0FB 1S49A 2CFXA 4ZHRA 1R0CB 3R1LA 2ZWPA 3GIMA 2BX6A 1YJWS 1FJ7A 1R8CA 1F60B 3RJMB 2DITA 2WOMB 1NSPA 4ZVUB 4KT0C 2V50A 2BJ8A 1MMDA 4ED3A 1WI6A 2IVMA 1HR0F 1B4SA 2YNHB 3VZIA 2QE5A 3K8WA 3DM2A 1QUVA 5A8RB 2NUUG 3F73A 4I4BA 4NYPA 5J2QA 2GV1A 2RB7A 1H74A 4F4WA 1RP5A 3ZZ0A 4F67A 5F8LA 1W2BR 3UR3C 4MJKA 1QD1A 1YQHA 4ILLA 1PG5B 4ED5A 2G1HA 2Y1LB 3Q23A 4ZVEA 2RS8A 2VFVA 2HHTA 3KK1A 3SDEA 4ZLJA 1VHIA 2FGOA 3BN7A 1DURA 3QWPA 2B0GA 2YTCA 1XEZA 2E66A 3MCSA 5KFYA 1SB6A 1FE0A 4DG1B 2ATLA 5KG0A 3PYGA 1NDCA 3DRXA 3H59A 3W2VA 1APSA 5KFXA 2DR5A 2W4CA 5CYQB 4KE5A 4JV0A 4LBHA 3QFWA 1JMTA 2R2UA 4DFMA 3NGSA 3I0RA 3DRSB 2DNMA 5KFJA 3W65A 2EKNA 2VG6A 1HFEL 2HVZA 1KRPA 3PW4A 1V9OA 5J2MB 3RBDA 3MM9B 3X1LB 3ETMA 2CVEA 3L7OA 4NCBA 2HRTA 2OEJA 2HQFA 3R8YA 3UCUP 2DNNA 2QLBB 3M8PB 1FRMA 5D3GA 1PYSB 5DG7A 1S1WA 3WIUA 4DUTA 2FZCB 5M2RA 3OLBA 2OEMA 4K4ZA 5F8MA 4B3RJ 5F8GA 1NJIT 1UPMB 3M6UA 4N8OA 3HHLC 5GMDA 3NEKA 3NS6A 4OYXA 3PXGa 1B70B 3AB2B 4OI3A 4WTYA 2NXCA 3TA1A 2GCFA 3ZTSA 1HBOB 1GMUA 3O1LA 2ZJRQ 4X4UA 2WW8A 4B3OA 2YX4A 3QO9A 2ZH1A 1UVLA 3UE2A 3POTB 2G2ZA 2AQ4A 4I67A 1CVJA 1SH2A 5HK4A 3P5BP 3HZEA 4ZITA 3A8JA 3THTA 3FC9A 3PJWA 4QQBA 3TZZA 4NLVA 1SPBP 1RZMA 3SEOA 4TLRA 4M5KA 3T5HA 4AT1B 1IR1A 2Q6BA 5K14B 2VH7A 1WOPA 2QMWA 1KWMA 2DNOA 4XO0A 3B82A 2YX1A 2KG0A 1T05B 2JRSA 4E8UA 4TU8A 4C9DA 4PWUA 3IWLA 3QRPA 3EPIA 4NLRA 3KG1A 1WACA 3LH2S 5HBMB 3KNAA 4XTTA 4NCGB 3KTQA 3K0JA 4ZCKA 2XMTA 3LUYA 1P8GA 4OZ2A 2C2MB 5D0RA 4NYZA 2G1DA 2ZH7A 2NUHA 2OD4A 1NDPA 1HNWF 5CA5A 4RZRA 2E7VA 2MLYA 3OTBA 5T41A 4UOGA 1RT2B 2KN4A 4LFBF 4NLYA 5LJ5Y 3NAHA 3M9MB 1UL3A 1FRXA 2YQ3A 2VOOA 2MQLA 1Y00A 1RT4A 3BH7B 4NLWA 1PC5A 3WC0A 3KLIB 4NZ7A 4ECQA 1FKOB 4LF6J 4MKYA 2MY7A 3EDRB 1S0VA 3A3PB 1M1GA 1XMOJ 4KC5A 2R8GA 4R0EA 1TKXA 3G82A 4Y34A 4U8YA 2X7IA 4DV4J 4B3TJ 3MEDA 1IKVA 5HI7A 3T1YJ 3WDOA 3CJKA 3NOGA 2ZJQQ 3J81U 4WZQA 4JUZA 2DEJA 3SCJE 3PW0A 2EBGA 3TUIC 2CIMA 2FUG9 2V8GA 4F3OA 3FEXB 2KYZA 3SFUA 2AV5A 4J9VA 4F3MA 3IM8A 3NGTA 2FVQA 3VALA 2LU1A 3OFFA 3IA0A 3P96A 2RNEA 5CXTA 2HQDA 3THPA 4LF5J 2OH2A 3VGTA 3DGVA 5DJBA 2OKQA 2G4BA 3GFHA 2CJYB 4J9LA 1T02A 1X9MA 3G8QA 4XK8C 4F4KA 4K2XA 4I56A 4DV7J 3DDNA 3NCQA 2B4VA 3J81j 2HHVA 2D1CA 2EXUA 4X64F 1S1VB 2IA0A 2YKPA 4IH6A 4NXMJ 5AXMA 2AGPA 2QMXA 3F41A 4YB7A 4ECYA 1S59A 3ZNUA 1RU1A 3K5MA 4WJBA 5KFRA 4KRWA 3S1TA 2EFPA 3D1HA 2OJ3A 1JLQB 9ATCB 3CNQP 2CPZA 3DYAB 2KVQE 2DH8A 1VIXA 3M2UA 4K4YA 1Q5YA 3HT0A 1NDLA 2RS2A 2WK4A 4LQ3A 3C46A 2CNLB 5L9XA 3G9CA 3MOZA 2VQFJ 3JQMA 4Q8FA 4Y0FA 3MAQA 4CM0A 4NXNF 3MCMA 3DDKA 4URGA 5G0RA 3BGLA 1UVIA 1Z2ZA 4ZLPA 2M52A 2LQ8A 2CJAA 4X62F 2VASA 1RB0A 1T95A 1X5SA 1GMVA 3EVOA 3CULA 3LP0B 5I42A 5JXSA 4ZVTB 3TZWA 5IWAF 3AQOA 3EXCX 4A47A 1FI4A 4IFVA 2HWTA 1NJZA 4Y2AA 4AQYF 5HL7Q 4CLSA 5EWFA 3DMJA 1X0FA 2Q1LA 2EG1A 3BPSP 2RU9A 1Y7PA 1HNXF 2DGWA 2KVIA 1FEHA 2FIUA 1V5VA 2B56A 4OI1A 1PYTA 1SUQA 3QLHA 4KHPJ 1W2IA 1SIWB 3KHRA 4B08A 4LF7F 8RUCA 1FDBA 3EYZA 1Q0NA 3GIKA 2MQMA 4PG4A 1NHUA 1HNIB 1KP6A 1NK7A 1AB8A 1DARA 4H4MA 1PO6A 2KDOA 2XY5A 3K89A 2HNZB 2AGOA 4ERDA 4IFYB 2HBRB 3PO4A 5DO2A 5G4DA 4DXLA 4RLEA 3G6ES 3O5TB 1WTFA 1QTNB 4NCAA 1S6QB 1UMJA 4B02A 4WFYA 3FCHA 1S9GA 3LANA 1UPPA 3VAMA 2MPUA 1RYRA 1TKTA 1HR0J 3U1LA 1VC6A 5K8MA 3BEGB 4GVBB 2BJ9A 3OV7A 4L75A 3ZTQA 2V4JB 3RBEA 1Q7YT 2AJ4A 5DZ7A 4DR3F 1FRIA 4JI8F 2HK3A 2W1BA 1VQYA 1RT7B 2CPXA 4I6AA 2BOPA 4ZPAA 4KO0B 1C1BA 2IHR1 3D6FB 2LLZA 1MN9A 1FCAA 4P52A 3IGNA 4PPZA 3RB6A 3M2VA 4P2MA 2JH3A 4FNIA 2W7AA 2ASDA 4C8LA 3EGZA 4CLLA 2KXHA 2L3MA 2CDQA 3SQGA 1TK0A 4B9SA 4DX7A 1JQGA 2BE9B 1UWAA 1LWCB 1S9EA 4HHJA 2FJEB 4P2XA 1YJVA 3G8SA 1RT1B 4QIGA 3P6YC 1NUEA 4UOCA 2NYHA 2ERRA 1WHWA 3U1MA 2FZKB 1Z2LA 1D09B 2V5HG 2ZH4A 2K7KA 3DOMB 3I55S 3HVTA 1R8BA 4CZCA 2FVCA 4J90A 4BBYA 1HBMB 1S48A 3D67A 2BXJA 4L72B 4TU9A 3G8TA 1WD6A 1LKZA 1IKYB 1IKXB 2B4PA 1JLAB 2CQDA 5A76A 4BHQA 4OYPA 3L7PA 2DRBA 2XYHB 2KRRA 1LWEB 5D4NA 2XMWA 2HMIA 1NK4A 1G7CB 2Y0SD 3I87A 2DPIA 3T19A 3VWSA 4LSLB 3W2WA 3HHLD 4GVLA 1MG7A 2VJUA 1H6KX 4WFZA 2EFOA 4MIWA 4USTA 3FVYA 1WKJA 1L3TA 3I5BA 3N9UC 3NKYA 3OR1A 4JI0F 1RWXB 1IWGA 1FWKA 1MROA 1NO8A 4GC7A 2HHHF 3VAFA 1WDTA 2XSFA 1EETB 2A18A 5E0OA 1MWQA 4LBPA 1T3OA 3R7BB 2MKIA 3ILIA 1WG5A 2XQCA 2LXIA 5A8KA 2QL7B 1IM6A 1RABB 4NLOA 3LP1A 4CH0S 2MGZB 3NY0A 2N7YA 5IC6B 4CYUA 2L9NA 4ZP6A 3H5UA 1OPZA 4LFCF 3R2DJ 1JB0C 2B6AA 3C19A 1RTDB 2N82B 4FDFA 5IOLA 2Y1IA 3JAMY 1GK8A 3RRHA 3KKFA 3AJ1A 2BV3A 1FVSA 4LRCA 2B8QA 1ZAWA 2DNQA 4ECTA 4GMKA 2RRNA 2LCWA 2YNIB 2E7WA 1CC8A 4K4WA 1IVZA 1VQ9S 3DXBA 1KSPA 1WEXA 2QN6B 3NMAA 1V3RA 1BQMA 2IBOA 1TMMA 2ZVSA 1HNWJ 3C16B 1ZAVA 1S1TA 3FZ2A 2EG2A 1JIHA 4O0NA 4UZBA 4LFBJ 4FBUA 2WBRA 1SQGA 4ANEA 2R7QA 2NCKL 3MUMP 4DUYJ 2QTWA 1IBKF 4C0OC 4HI1A 3EGWB 3JAMU 2H51B 1N36F 2B7CB 3IS9B 2IMWP 2DTJA 2M2BA 1U48A 3CD0A 2HGMA 1S77D 3G96A 1KHWA 2VC0A 3QBCA 2DGSA 4OV6A 4MKVA 5H9FK 2LKZA 5M2PA 4V1Ak 3CD6S 5J2NB 1UTAA 2ACMA 3KLHB 3UI3A 3CCUS 1L3UA 4Q44A 1O0PA 4RW8B 2CZ9A 1GEHA 2Z30B 3CD5A 2VODA 4UTGA 2K7JA 3TQEA 5GAEI 5DG9A 4C6AA 1DTTB 5KFBA 5L9NA 4H4KC 5HQMA 1DJ0A 1YJ7A 3FGVA 2A3JA 2FY8A 1UJ6A 4R8UA 1X60A 1UVNA 1B7FA 2KU7A 1JJHA 1BMQB 5A0YA 4OX7A 3D1QA 1UVJA 2EFNA 2BE2A 3O3LA 4ZPWR 3QGPA 4XDDA 3NGUA 3ZNJ1 2KJVA 4ZKAA 4UOFA 2C3MA 1AYEA 4GO5X 2KFYA 4K4UA 3GJQB 3PJ9A 1FNMA 4X64J 1TKZA 2CJXB 2MJUA 5C42A 2EK6A 4EZ6A 3QT8A 3KWMA 1XNRF 2RVJA 4WFXA 2MYFA 1Y11A 2HZCA 3GG0A 3DNCA 4X84A 2MXYA 2IRXA 1U2FA 2HWIA 4JB8B 2G13A 3DRPB 1NKBA 2PIIA 1JLGA 5DGAA 2D7SA 3MM5B 4NLTA 1N88A 4RU9A 3UDVA 2X1AA 2G9OA 3K7RA 1S4EA 2DGUA 4RU2A 4G1PA 4QJVA 2O1PA 4EBCA 2UXDJ 4M5JA 4NXNJ 3KLFA 2FLNA 2VPWB 4HACB 1HD0A 1MLAA 3LP2A 4DJBA 3D0HE 1QAJA 1R7IA 3T5JA 1T03A 4O3PA 4CO5A 2OD6A 4ZVOB 3MPYA 3JSMB 3CDUA 2WW4A 5GAHU 4OL8A 4YS2A 5IWAJ 2IJNA 1M0SA 1JLCB 1VGYA 4DDFA 1GXTA 2BJ1A 1CJUA 3RU0A 1S10A 4AQYJ 1B7YB 3VGVA 2QFIA 4DR4F 3H2UB 3BF4A 3R5CA 3FKBA 2CPEA 1HNXJ 2QSWA 1FD2A 4WIIA 4DR6F 4PPDA 2UUAJ 2MQOA 3IRXA 1N5YA 3NOCA 4ID5A 1J5EF 2EEYA 2VB6A 4EWTA 3OVAA 4B9UA 1UETA 1YBTA 5ETTA 1Q82T 4ZP8A 2IYIA 4OI4A 1NAQA 3R2CJ 4EUVA 2GVZA 2BE7D 2NZCA 2MJNA 7AT1B 3ZFVA 1CS4A 2W01A 3D54A 2MZ1A 1SL0A 3C6UB 2K2PA 5K9FA 5C7PA 1JXVA 3MCNA 1Y4ZB 2W9AA 4ZVGA 5I3PA 3GFZA 4D3HA 2EFVA 2PSZA 1YRTA 3KLEA 1LFPA 1ZOTA 1K44A 2FLPA 1WC3A 4ZA1A 4LRAA 2R7TA 3DLEA 3L7UA 2R7RA 4IO9Q 3IBCB 4LBIA 2YVSA 1ULRA 1NH7A 1IBLF 2KT5A 4FS2A 2QV6A 1X5OA 4DZ6A 5HJXA 3UW1A 4QU7A 3PHEA 4OZNA 3MEEB 3CGIA 3C15B 3AD7C 4I68A 4QZVB 3BBBA 3QNWB 4FYXB 4WBFA 2RDIA 3OXLA 3OFGA 2KG1A 3AODA 3KXDA 1NPRA 3J7Z5 2HPUA 3OBIA 3I32A 4Q2LA 4DR3J 4JI8J 4O23A 3J7A1 2X1BA 5T7LA 4DR2J 1DRZA 1XMQF 3FMWA 3M9OB 3W8PA 1ZM3A 1RWVB 2FD2A 1VRTA 4RW9A 4RBTA 4X4SA 3DKDA 1WSVA 4I2QA 2V4RA 2LA6A 4WP8A 3W64A 2VG7A 2QSFA 4RR5A 4HH0A 4UY8T 2IY5B 5CYJA 1RWMB 2WBMA 1TAQA 3CW2C 2FB0A 2RAQA 4YB5A 4PWWA 1P9YA 2ZOGA 3M8YA 1TK8A 1FRLA 4R0JA 2H65B 1LXJA 2CPYA 4S0MA 2WSEC 3JTOA 3JSRA 3KK3A 4FN5A 2YNFA 3GMGA 1SKSA 2RKIB 1VQ4S 4NMLA 3NAIA 5DRKA 4F02A 3ZTRA 5B0GA 1W26A 2PMWA 3MR6A 4TYBA 5KG6A 5CABA 2BW2A 4OZ5A 2X3DA 3DI6A 3VHQA 3LAMA 1DAXA 1T11A 5DDQC 4C8MA 2E7XA 1QE1A 3TA2A 2APOA 4ZJQA 2A6OA 4C0HA 2ATCB 3C8YA 5A6WA 3GB0A 4DV0J 1HQEA 3SSSA 5C25B 1EQ0A 3E2EA 2QLXA 3E01B 2MQQA 1BWEA 3UN5A 5KFUA 1I6JA 3BSCA 1SJFA 3CTRA 4KQZA 4F3QA 4GKKF 3C14B 1FT8A 4RW7B 1U45A 1N6QA 4JI0J 2HVIA 1RAJA 3MMCB 2CUYA 2V6AA 3HLUA 1QAYA 1KHVA 2VZ9A 2CQHA 1RBOB 3I5CA 5DS7A 4A8OA 4JBCA 2W25A 3QGHA 4WK1A 4CCHA 3AAWB 2AEFA 2JLGA 3HKZD 3W5ZA 1RQ0A 8AT1B 2HNYB 2C3PA 1MWYA 1Q79A 5J1EA 4WWSA 4PQAA 3KHGA 1GMWA 2BANA 3DLGA 1HWLA 5C24A 4DCOB 4LFCJ 2N4DA 1FJCA 3ETOA 2BJEA 4PG8A 1C0UA 5AJ3J 1UWBA 5A2QY 1VBZA 1P1TA 1E6VA 1WKKA 3EVWA 4ZK7M 4EO8A 2M5YA 3CJSA 3BR9A 1RAIB 1OSDA 2J0QD 1FFSB 1RAGB 1X4BA 2HAIA 2I38A 1NLKL 5LMUF 5I3QA 2WONB 1T9TA 4FF3A 4NLPA 5GVQA 3ZXWA 2CAJA 2W9BB 3KNGA 4DL3A 5KFCA 1E6YA 1WOSA 2YWKA 3V81B 1KQGB 3HJFA 1ACMB 2UVVA 5I3UA 2CJQA 2ASYA 2OO4A 5GADU 4UUWA 2HLUA 2NR0A 2GNKA 1F3VA 3MI7X 1QSLA 1C4AA 3BGFA 4B9LA 1RT5A 2HBZB 2YY3A 2ZBQA 1S4FA 2DXFA 1FERA 2OPPB 3GJRB 2RQCA 4DV3F 2BZ2A 5A2QU 2CPFA 5HN0A 3C6TA 3HD1A 3EICA 2A2CA 5KG2A 1XC9A 1N36J 1YJNS 2DNGA 2J76E 2MY8A 4WFAQ 1XR7A 2DNLA 1OYEA 3MR2A 3MM8A 4PG5A 1CULB 2VONA 1TV6B 5DG8A 5JVGQ 1UW9A
chains in the Genus database with same CATH topology
1S49A 3OQ2A 2CFXA 4ZDNA 4EFAC 4QR2A 4ZHRA 3R1LA 3GIMA 4EYIB 1RTJB 4JV5F 3R27A 1EP4A 2K1RB 4RW7A 1YJWS 1FJ7A 1R8CA 2YKMA 1F60B 3MPWA 1U6FA 1Q4RA 2R7OA 1TL1B 4A46A 2DITA 2WOMB 3AQPA 2L9WA 4QWEA 3QJJA 3GILA 4C0BA 4WYWA 3MMCA 4Y28C 4KT0C 2EKYA 2MMYA 1QVGR 3MM7B 1MSWD 3MFHA 1MMDA 1Y5LB 4ED3A 2RILA 4P7VA 4C98A 5FD1A 3TVZA 1WI6A 2IVMA 2J9CA 5IT4A 1NK6A 1HR0F 2YNHB 3N5BA 3VZIA 2FGCA 1N5QA 1TQLA 2QE5A 4B3OB 3K8WA 4K59A 3DM2A 1QUVA 2DNKA 5A8RB 2FPHX 3K5OA 3MD1A 3QO9B 4NYOA 2NUUG 1H38A 3F73A 4I4BA 3TAMB 1M5SA 4NYPA 3CPWR 5J2QA 2GV1A 1BGXT 1N8RT 2W9CA 2HNYA 2RB7A 1YRXA 4I64A 1ELOA 1DQ8A 2QA1A 3AJ2A 1RP5A 4XDCA 4F4WA 4JV1A 2E9RX 4RUHA 2JX2A 2KFZA 2VPYB 5FDLB 3ZZ0A 4F67A 5F8LA 1HW8A 4DL7A 3UR3C 1W2BR 4N76A 4MJKA 2O67A 4X4NA 2WHOA 1YQHA 2HLTA 2AJ0A 4AL6A 4ILLA 2BUNA 2XSJA 2FVRA 3M05A 4LSNA 4DSEA 4ED5A 2NZ4A 2VFRA 3KMSA 3Q23A 4Y2KA 4A8QA 2OLWA 4ZVEA 4BWMA 2RS8A 2VL1A 4HT5A 2OPSB 1X4AA 2VFVA 3A1YG 2HHTA 3KK1A 2DNYA 5EX0A 1RA7A 3SDEA 2V8HA 3RB4A 3RYLA 1YRUA 2GO8A 4B3RF 1RTHB 5HP1B 1GX5A 2RF2B 1X5PA 2FGOA 3BN7A 3FRYA 5KFQA 1DURA 2B3TB 2X1GA 2B0GA 2YTCA 3QWPA 1XEZA 1VQLS 5GAHI 2LEAA 2E66A 2DGXA 3MCSA 3H2VE 3NBPB 4MK7A 2GFFA 5KFYA 2ZHBA 4RBVA 3HHDA 3LW5C 5KFOA 1SB6A 1FE0A 3MOJB 2DO4A 4TN2A 4DG1B 2ATLA 2WONA 3VAHA 4E0DA 1TVRA 5KG0A 5KFKA 3J80Y 4DQPA 3DRXA 3U27A 2W9BA 4DQRA 3H59A 3W2VA 2BBEA 2AGQA 1IQZA 4TY8B 1YHQS 3OTDA 4H4OA 4J9RA 5KFXA 4EEYA 1APSA 2DR5A 2W4CA 4R5PB 5CYQB 2PI5A 1O51A 5CZXA 4KE5A 3V81A 2ZOFA 4JV0A 2MZJA 2ADBA 2ZC3A 2NYIA 4ED6A 1TKDA 2ROGA 2C3YA 2R7SA 2U2FA 4NLUA 1S6PA 4IRDA 1JMTA 2CQ4A 5H9EJ 2JC1A 1M5VC 4ATNA 1AROP 1PC4A 2R2UA 2BRKA 3QWUA 3KMQA 3NL0A 2NQPA 4DFMA 1IQTA 3BDPA 4DR7F 4Y3CA 3I0RA 1SH0A 4FXVA 2LXFA 5DM6Q 3DRSB 3HVRA 3RB0A 2DNMA 5KFJA 4FYDA 2LQ9A 4IQXA 5KFIA 2VG6A 1HFEL 2HVZA 1KVIA 3M32B 1SH3A 4OMFG 3ISZA 2I2YA 4NZ0A 1KRPA 1AFIA 3PW4A 5EWGA 1V9OA 1VJWA 5BYQA 4TQRA 1BQNB 1HQUA 5J2MB 2VKZG 5F9NA 3HP6A 3QPIA 2ZBCA 1R31A 3RBDA 3MM9B 2J9DA 3X1LB 2W8KA 4FVCA 2CVEA 3L7OA 2DR9A 4NCBA 4NX9A 3SFGA 1YITS 2UXBF 2OPPA 4M8LA 4ITSA 1U6ZA 2RQKA 4ZPVR 4QIWD 3LO3A 5T14A 2XS2A 3R5BA 3R1HA 4WYLA 3OLAA 3UCUP 1U6BA 2ILYA 2DNNA 3IN5A 2V0NA 3M8PB 1FRMA 1SJ1A 1RT4B 5D3GA 2RRBA 4DBQA 5DG7A 2MZQA 1S1WA 4YMEA 3MMBA 4DQSA 1F5BA 3CWJA 2AJ1A 5M2RA 2DHGA 2HHSA 3OLBA 3CXCR 1R89A 3R5AA 2FJBB 1PILA 4K4ZA 1HI1A 4AXJA 1V3SA 4C7QA 2YKAA 3AA8A 5F8MA 1WHVA 1YGYA 4KBIA 5E5NA 2SXLA 4LQ9A 2HS4A 4ZCLA 5F8GA 2UUBF 2UUCF 3H8YA 2NPFA 4QW8A 4ED7A 4YFUA 3HK2A 1HL6A 4QYRA 3Q8QB 1K1SA 1VK3A 4WU2A 2B4UA 1TV6A 3ZZYA 1TKXB 2B4OA 3MMAB 1NJIT 3HZGA 3IWNC 4OLPA 3MURP 1RJJA 4MK9A 3M6UA 4N8OA 3M9NB 3NMRA 1RTJA 3AB4B 3HHLC 1IR0A 2JWNA 2K1RA 2DPJA 4JI5F 4WCEQ 4J9KA 3Q2TC 1R0AB 1HI8A 2CVIA 4U67Q 3CJ3A 3MEDB 1KTVA 1IKVB 3ENWA 3EX7B 3M6XA 3NS6A 1TL1A 4ZPBA 2WOMA 5KFHA 5JUMA 3PXGa 3OL8A 2E29A 4YP3A 2KZZA 1QY7A 3DU6A 1SI9A 1BD6A 2R8HA 3CJKB 2UUTA 3AB2B 4IO1A 3SYZA 1LFWA 1WF0A 3N6LA 4OI3A 1Q8LA 1FTCA 3BQ0A 4WTYA 2RDJA 4Q5VA 3MM7A 3V6HA 2QIFA 3TA1A 2DIUA 2GCFA 3LWMA 4MIBA 1O5JA 1HBOB 2D41A 3JTNA 1K8AT 2KO1A 1D8YA 3O1LA 5KG3A 1XERA 4Q45A 4KGKA 3RAQA 2ZJRQ 1MWZA 4X4UA 2WW8A 3DGPA 4Z2XA 2YNHA 2KH9A 3GYXB 5KAKA 1BLUA 1QAXA 4AUKA 4B3OA 2YX4A 4X66F 2FC8A 5A8RA 3DLBA 3T6JA 4F4YA 3QO9A 4C3LA 2ZH1A 3QGGA 1UVLA 3P49B 2F8HA 3PR4A 4MAKA 3TAMA 4ECZA 2HFOA 4U9RA 3UE2A 3POTB 3IO1A 4QBUA 2DIVA 2AQ4A 1HMVB 2DHAA 4FF4A 3KK2B 4I67A 1P27B 2HGLA 1CVJA 1SH2A 4OQJA 5FDLA 1KLNA 3TANA 3HZEA 3L3CA 3THVA 2VQEF 3THTA 2GJIA 3PJWA 4QQBA 4NLVA 3OL7A 3CCMS 1VHFA 1N34F 4K4SA 5M2UA 1DTQB 2OP5A 2HHPA 3SEOA 3CCSS 2HHQA 4TLRA 2XCAA 3NCRA 3T5HA 2J0SD 4MYTA 3FJ2A 2ROEA 4IOCQ 2XWYA 2Q6BA 5K14B 3OFEA 2OPSA 2VH7A 4QCLA 1ZYQA 2F4VF 1X4EA 3MTJA 4MH8A 1LWFB 1U24A 2QMWA 4OX8A 1UFLA 1RTHA 2VV5A 3QMQA 4NLXA 4PG7A 2XI3A 3ZZPA 2RF2A 5IZHA 5IQ6A 1F5CA 4DV2F 5HP1A 1S0OA 1XMOF 4HTIA 2DNOA 1Q7LB 4K4TA 1FJEB 4XO0A 3IR5B 3MF5A 3NBPA 3B82A 1P6TA 2M3DA 2YX1A 2UVRA 2KG0A 5KT7A 1T05B 1A7GE 3MZIA 4QIVA 4CI0B 2JRSA 4E8UA 4TU8A 4DG1A 1U1OA 1K0VA 4WKRA 3D2WA 4J9PA 4C9DA 4PWUA 4TKTA 4B3TF 4Y2CA 3H5SA 2E5HA 5D4OA 4WKYA 2J6UA 4UQGA 4TY8A 1D0EA 2F1FA 2RH3A 4F50A 3IWLA 5K8NA 4E98A 1FKPB 4R5PA 5CYQA 1YBAA 3KG1A 4NLRA 3EPIA 1WACA 1ZAXA 2LDIA 3LH2S 4OHXA 1SV5B 5HBMB 2GGPB 2EWHA 1XK8A 4N47A 3KNAA 4MYUA 4NCGB 3KTQA 5L8RC 3K0JA 2P6SA 5EX3A 2LMIA 4ZCKA 2M9KA 1NNDA 2XMTA 3DRSA 3T1AA 3ULHA 2ADCA 3LUYA 1U25A 1P8GA 2W4PA 3RAXA 3N5FA 3ENVA 3N28A 1MMLA 4O4RA 4USIA 3CCRS 1NK9A 3M32A 5EGYA 2MSSA 4DR1F 3M8SA 5F41A 4V19X 4NYZA 2G1DA 2IRUA 2ZH7A 2NUHA 1C2PA 2OD4A 1R6YA 3M2UB 1TK5A 3NS5A 1VQPS 1BQNA 5J2MA 4B3MF 2NLWA 1HNWF 4DV1F 4ED1A 1JJ2R 5K5MA 2ASJA 5CA5A 4RZRA 3MM9A 3S6EA 3OTBA 5AXKA 5T41A 3V6DB 1WELA 2C3UA 2PA8D 3GQCA 1KQSR 1NK8A 1RT2B 2KN4A 4LFBF 2XMJA 4KPYA 1R8PA 4NLYA 3NNHA 4MKBA 4ELVA 5LJ5Y 3NAHA 3M9MB 1UL3A 3PNIA 4ICLB 2ZM6F 1FRXA 2YQ3A 2Q43A 2VOOA 5F0UA 2MQLA 1N4LA 1VQKS 3LGMA 3M8PA 1Q53A 3SI8A 1Y00A 1RT4A 4NLWA 3GG1A 4M95A 3CC7S 1HW9A 1PC5A 3CDWA 3WC0A 3KLIB 4NOHA 5F3ZA 2FHJD 4ECRA 4NZ7A 5G0RB 4DF8A 3R5DA 4AFFA 5L1JA 5HQ8A 2KI2A 3ONQA 3H98A 4ECQA 2HGNA 2DVIA 1FKOB 2IM2A 3FFIB 4MKYA 4L3NA 3R3TA 2MY7A 1S0VA 2JJ4D 2Z4PA 4IR1A 2MQPA 2X51A 5C5JA 1S97A 3GIJA 4KC5A 2JFKA 4IKAA 2R8GA 4R0EA 1TKXA 3MMAA 5I42B 4KB7A 3IAS9 3MEKA 2JLFA 4HI2A 1S0MA 4QWBA 4NXMF 2XS5A 2IA6A 1X4DA 1WNEA 2JEJA 4LVNP 4Y34A 5DM7Q 1R0AA 1OQ3A 3MEDA 3GV5B 1IKVA 5HI7A 2Z8QA 4C8YA 2I0XA 3FQKA 3WDOA 4IFVB 2QT7A 2F40A 3JYTB 3T3FA 1TUVA 5DDRC 3CJKA 1N54B 5F8JA 3ZZUA 3G6YA 4OV1A 3UCGA 2ZJQQ 3DLLQ 4LT6A 2F3JA 5GAGU 1CSJA 4WZQA 2CG4A 1IXKA 1JXLA 4JUZA 3DMJB 1SJRA 3K8VA 4WZMA 2WRMA 1HBOA 2IVYA 3SCJE 2GQQA 1FXDA 5J1PA 4PXCA 3PW0A 2EBGA 3TUIC 3IR7B 2CIMA 1B0VA 2IRYA 3ZZRA 1DLOB 3KFWX 4X2BA 4WE1B 3VAKA 2HRYA 2W4DA 1K0TA 2FUG9 2V8GA 5KFZA 1JK9B 3PW7A 4EZ9A 4F3OA 1VIOA 4MKAA 3FEXB 3SZ2A 3WX4A 2QA4S 3TI0A 2KYZA 1SUQB 3ISND 3QLHB 1KEKA 3SFUA 2AV5A 1HNVB 1S79A 4YR0A 4DS4A 4F3MA 5A6PA 2JSXA 2CYYA 2RJZA 3POTA 5AXNA 5K8OA 1VBYA 3H5XA 1HMVA 2ZHAA 2FVQA 3KK2A 3FEYB 3VALA 2LU1A 3OFFA 3Q8RB 3IA0A 3P96A 4JI2F 2RNEA 2WSFC 2YNGB 5CXTA 1VLYA 1RA6A 3CC4S 5CQGA 2MKSA 1FNOA 2JOQA 2Z2LA 3THPA 1R3NA 1JNRB 1KQFB 3MUTP 3G71S 3CCES 4FS1A 4TNOA 4H4MB 1DTQA 1BC6A 2RQ4A 2DO0A 2F8MA 2OH2A 5DJBA 5K14A 2OKQA 2G4BA 1ZM2A 2P9EA 2WB4A 3GFHA 4JV2A 1IM4A 1XTZA 3HMJG 4J9LA 1T02A 1LWFA 1R8HA 2CPJA 4YDXA 4A8YA 3OL9A 4LMZA 1X9MA 3G8QA 2BYCA 4DS5A 5KT3A 4ECWA 4XK8C 4DEZA 4F4KA 2DJWA 3EZ5A 2HFZA 4K2XA 4I56A 3DDNA 3NCQA 1T05A 1JLFB 1TAUA 3GFXA 2B4VA 4LUBA 1GAOA 2HHVA 4N77A 3DC2A 2D1CA 4X64F 2XEXA 1S1VB 2IA0A 2OIHA 1J2VA 2YKPA 1VQMS 4IH6A 4XIUA 4USJC 5AXMA 1FA0A 2AGPA 1YTYA 2QMXA 3F41A 1FKPA 4YB7A 1HWJA 2YX7A 4ECYA 5HBMA 1SV5A 2GGPA 1ZZNA 1Q81T 2OFGX 4JI1F 1S9GB 3K5MA 3TARA 5GADI 4WJBA 3VZHA 4NCGA 1FRJA 4A48A 2OAUA 5KFRA 4LIRA 4DWIA 2A10A 4KRWA 3S1TA 4PWDB 2EFPA 2K3KA 4NLQA 5KFGA 1TKTB 4DSJA 2ABYA 3L09A 5GAEU 5MLCV 2DR8A 2F7VA 3D1HA 2MKHA 4Z37A 5AE3A 2OJ3A 3E8OA 1JLQB 3G6VA 4Q7AA 2R9LA 2HFNA 2M4MA 2CPZA 3DYAB 2DH8A 4PR6A 2J7KA 4BS2A 4KSEB 2XS7A 4OZJA 4DX8H 2ZH9A 1VIXA 3M2UA 4ZOSA 4K4YA 2FLLA 3MECB 2GW8A 3UD4P 2OSQA 3PX4A 1VI7A 1O8BA 2RS2A 2DCUB 2WK4A 3AH6A 3JSBA 2LECA 4LQ3A 2VBZA 2GIQA 2YWEA 3F56A 3V6DA 3C46A 4RUCA 3D28A 3DFEA 4DL2A 2W8LA 5DDOC 1RI7A 3KLVA 3HDSA 2JLEA 1KC8T 1RT2A 5L9XA 2R8JA 4M63A 3G9CA 3MOZA 2JEGA 2W7OA 4M5DB 4ICLA 1L3KA 5A8WB 3SSQA 4AE5A 2KKHA 4OJHA 3ZZOA 4Q8FA 4Y0FA 3MAQA 3QAUA 4CO4A 4B9VA 1C1BB 4NXNF 4JI3F 1M5KC 5E41A 2DNPA 4RNHA 4BWJA 2GMLA 2NSCA 4ZS6A 2B9YA 1LV5A 3KLIA 3DDKA 4URGA 2PI4A 2HYIB 1NHVA 3AHPA 5G0RA 2KT3A 2LEBA 3BGLA 3M2VB 1UVIA 1Z2ZA 4ILMA 4WU3A 1Q8IA 4ZLPA 5FLXY 1HI0P 2M52A 4G1IA 1FKOA 3WBZA 2A2DA 3FFIA 2CJAA 4RBUA 2L9DA 4X62F 2VASA 1FD8A 4K0KF 2A1BA 4FBTA 1FJGF 2DGQA 1T95A 3T9NA 1X5SA 3FEZA 1SL1A 2D3ZA 2P6TA 3I31A 4IUFA 3CULA 2FVSA 2XLJA 3LP0B 3SQGB 3TX8A 5I42A 2DB1A 2GHWA 3RW6A 5JXSA 2FDNA 2V94A 1HHTP 3V2UC 3KJVB 5IWAF 3IBWA 2N3OA 1VQ7S 1HPZB 1S76D 2XMKA 3AQOA 3C66A 2O3DA 2LVWA 4OFZA 4AYBD 3V6KA 3EXCX 4KIAA 2FHKA 1S9EB 4RKUC