4DUYF

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
101
structure length
101
Chain Sequence
b'MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome
publication title A structural basis for streptomycin resistance
rcsb
total genus 21
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4duyF00
4DV0F 4X64F 3T1HF 4JI4F 1GH8A 1G1XA 1LOUA 5BR8F 1B64A 4LF7F 4DUZF 4JI7F 1RISA 4GKKF 2KJVA 2UXDF 4JV5F 1CQMA 2UXBF 1XNRF 2BVZA 4LF9F 4DV3F 4DR5F 1IJEB 1XMOF 4DR6F 2B7CB 4JYAF 1QJHA 4DV6F 4LF8F 4YY3F 2HHHF 4DR7F 1HNWF 3OTOF 5AJ3F 2VQFF 1N36F 4JI5F 3R3TA 1IBLF 1XNQF 1HNZF 4DR3F 2YY3A 4JI8F 4B3SF 2UUBF 2UU9F 2F4VF 4B3RF 4X62F 4B3TF 4JI6F 4DV1F 2UXCF 2UUCF 4JI0F 4GKJF 1FKAF 1VMBA 4DR4F 3T1YF 1IBMF 4JI3F 1F60B 4JI1F 2J5AA 4X66F 2KJWA 5LMNF 1G7CB 1XMQF 1I94F 4YHHF 4DR1F 5LMUF 1HR0F 1N34F 4LFAF 4LFCF 4DR2F 5IWAF 4DV7F 1N32F 4KHPF 4K0KF 1IJFB 4LF4F 2E5LF 4LF6F 4LFBF 2VQEF 4AQYF 2B7BB 2RJZA 1IBKF 2UUAF 4OX9F 4LF5F 2BXJA 4JI2F 4X65F 4DV2F 4DUYF 4NXNF 1CQNA 4DV4F 3ZZPA 4B3MF 4DV5F 2ZM6F 4NXMF 1FJGF 1HNXF 1J5EF 1N33F
chains in the Genus database with same CATH superfamily
4Q8FA 2HG4A 3IP0A 2MZQA 3EVWA 1XEZA 3BQ1A 2GCFA 1T9XA 1EETA 4GMKA 2E44A 3UR3C 2LECA 2LA4A 3KWMA 2QZ8A 2EW9A 4CH0S 2E1AA 2LDYA 3NGUA 4DR2J 1Q82T 4UY8T 4LF1A 4LUBA 4C8KA 1DAXA 4A8MP 2V9KA 1TVRB 1UFWA 4WYLA 3ZTOA 3VAFA 2DO0A 1XQIA 1FX4A 3W2VB 1T02A 3D5MA 3ZZTA 1CQMA 1MWQA 5E2QA 1HWIA 4AL6A 3PKMA 4MK8A 1PBUA 1JJCB 1T95A 2FHJD 2DYAA 2JLFA 5KFGA 5HI7A 2Z56B 4F4AA 3W5ZA 2WW8A 4KPCA 4RBVA 1RTZA 4OL8A 4C97A 1U47A 1RWNB 3SV4A 1QJHA 3A3PB 3C16B 3AJDA 5B08A 1V3RA 1N5TA 4HEA9 3SBMA 3HHNB 2HHHF 2MHNA 3W3SA 2DXEA 2RUGA 3GIJA 2J9EA 3EUNA 5BYRA 3K57A 1IKWA 2AEMA 2BJ1A 1TFWA 4KH0B 1BD6A 1KVKA 3TAMB 3D2WA 2JJ4D 1IKYA 2HHHJ 5G0RB 3M8QB 1X60A 2FHMA 3CCLS 5T14A 4UOCA 3KJVA 5AJ3J 1TL7B 4CLYA 2V4JA 2RE1A 1LWCB 2FC9A 1FHTA 2AJ0A 5MLCV 4WFNQ 5LMUJ 5HMXA 2WAQD 1RAOA 1NB2A 1UKUA 1YZ7A 3AOBA 3MCNA 2CIMA 4K4YA 2KFNA 1HFEL 2DD8S 4B3RF 2XCPA 2HW3A 2ZNZA 2R7SA 2GIQA 1FKPB 4DEZA 1J5OA 5GAEI 2Y8WA 3GIIA 3POTB 2YNGB 3MECB 4P10A 4IQXA 2P9GA 2YKQA 1RAEB 1TAQA 1C0UA 3HJFA 3HX9A 1CS4B 5AXMA 2F7VA 2G1DA 3NWGA 4QR1A 4NLQA 1IBMF 4PG5A 3KK1B 3E51A 4KB7A 4JI3F 3NCQA 4C3LA 5KFJA 1R7IA 2XG8A 3C6UA 3J81j 5J2MA 3S6EA 2OTLS 2FUG9 3TJ8A 3TANA 4C0OC 1JNZB 2W7PA 1DZ5A 4WP8A 4F4XA 1YTYA 3E3XA 3LO3A 3P96A 2E1CA 1NJXA 3IGNA 4LR7A 3J7A1 2IM2A 4A8YA 4G3IA 4R8UA 1U25A 1KHVA 2PI4A 4ICLA 3K5LA 1OSDA 5IQQA 2X1FA 5IWAF 4DV7F 1DLOA 3R1LA 4Q2MA 2BANA 1L3KA 2ROPA 3BKFA 1M1KT 3PRDA 4ECTA 1KLMA 3PJXA 3M8ZA 4K7QA 1HBOA 5H9FJ 1VBZA 3QAUA 3SSRA 1VI7A 2C3OA 3QRRA 3J81U 4ED4A 1K0TA 1TV6B 2QN6B 4X4PA 4IFYB 2EK6A 5KFYA 4AQYF 5C25A 4UUWA 1L3UA 3LWLA 2CYYA 2NLWA 4F4YA 2DRBA 5GADU 1WG5A 1X4HA 1SC4B 4NL5A 4P73A 2Z2LA 4FZVA 1HBMA 5K14B 1MWZA 4ER8A 3D0HE 4X65F 3C6TB 3FEXB 3OTDA 5K20B 4NOHA 2FJXA 4PWDB 4BS2A 3AAWB 3VQSA 4IRDA 3NP5A 4H4MB 1UJ6A 3MMAA 4KE5A 5KFOA 1U1MA 2IJNA 2VONA 3PHTA 4I1TA 4AYBD 3BSNA 3MD1A 1TFYA 1QDUB 1R43A 1GT8A 4PEOA 2ZZTA 3HLUA 4C98A 4N47A 2ZOFA 4P7TA 1N33F 2BMBA 3R5DA 1BQMB 3DDKA 4RO0A 1NDLA 2EFNA 3FNNA 3K8WA 3JQKA 1LNQA 2BKPA 1TKTA 3MM8A 2DR7A 3HFKA 3IR7B 4OQJA 5IT9U 4NZ6A 5HVHA 2DGVA 3FGVA 4NLOA 3UD3P 4C8ZA 2YX4A 3W2WB 2QFJA 3R9LA 2BDPA 1C4AA 2MPUA 2FHOB 3Q22A 3J7AN 1P9YA 4I2PB 4RW4B 4RNMA 3CXCR 3GV8B 3DOKB 3TI0A 2DGQA 2KJVA 1SUQB 3VCDA 4BC9A 2XZDB 1N5SA 3FK4A 4L73A 2GA7A 1PSDA 3M8PA 4DV4J 4QPTA 1FEHA 1QSYA 3U1NA 3OUYA 4FKYA 4QWDA 1U09A 2M0GB 3D1HA 3FJ2A 3LAKA 4FP9A 4PG4A 2XULA 2V0NA 3HCXA 3TOQA 4NLTA 4XPCA 1XN9A 2C42A 5KFBA 1SKWA 2ILYA 4C9DA 3DLGA 3RB3A 4EMDA 1HBNB 3HVTB 4OZ2A 2W2PP 2Y8YA 2R7RA 1HNWF 3Q0AA 4YY3J 4H4KA 2PEBA 5D8HB 5H9FK 1D9DA 2RDJA 4Q0BB 4OV1A 3AJ1A 5C24A 4HACA 4KC5A 5L1LA 3HD1A 3VVTA 4PUOA 2GGPA 1FDDA 1S99A 2DNGA 3AY0A 1P9QC 2BV3A 3THPA 3MM9A 4OYAA 4RNFA 4B9NA 2IVFB 3QJPA 4C4WA 3QLHB 4YR3A 4JYAJ 2BABA 1TUVA 2MKSA 2NSBA 1YZ6A 3M2RA 4LF8J 4ED6A 2EVZA 2H65B 4X4UA 2A6OA 1CLFA 3IRXB 4P2MA 1E6VA 3UE2A 3BGRA 2H3EB 2QYCA 4OI4A 5J2PA 1S6UA 2OSQA 1YKWA 4W4MA 1VHIA 2JVOA 2HNDA 2LEPA 1IR1A 2VUGA 4NLVA 2W7AA 4EFAC 2E7WA 4ID5B 2OHDA 5CYQA 1K1SA 1S97A 4CH1A 1X4FA 2E29A 3NNAA 5M2UA 3N6MA 1TL3B 4ES2A 2XWYA 1CBKA 1D3WA 3D67A 5E33A 3GV5B 1T3NA 1T9UA 4B3RJ 5FIIA 4JP8A 2XS2A 4RBUA 3N0VA 4UW2A 2BR0A 4F8RA 3ZZOA 4RNNA 5KG0A 1S1UB 1X9WA 1WSRA 1F1BB 3C14A 5E3CA 5LMUF 3K0JA 2Y1RI 4ELUA 3W65A 2R8IA 3Q24A 1H7XA 4QU7A 3N6NA 4G1PA 4OLOA 4BHQA 4DL0C 3MMCA 3R7BB 3N01A 5AE3A 2OPQB 3I4PA 4PR6A 5T7LB 4LIRA 1W25A 1TTHB 2CNNB 4U8YA 4ZP7A 1CJKA 1LKZA 2MKCA 2RJZA 2H4WB 4QIEA 4X84A 1WEZA 2G1HA 2DB1A 1P6TA 1TKXB 2BXJA 1RHQB 3DXBA 1QVFR 4K4SA 2OFHX 3T1AA 2HWHA 1UEKA 2LXUA 3KUHA 2CQ1A 3N79A 5A8RB 3QFHA 2R8HA 4K4WA 5F9NA 4DV3J 4DFMA 1VC6A 2WZ1A 3GYGA 3EGVA 2PA3A 4ANCA 2ZH3A 1N36J 2C2DA 4O4GA 1EIYB 4LF4J 1VS3A 5E7OB 1HNVA 1B0VA 4OHWA 2FLPA 2LQJA 1TP7A 1LW2A 3K58A 5KT7A 3ZNUA 2BYCA 1NKBA 1RA6A 1VLOA 2YWGA 2FJDB 3ILOA 4KT0C 3DM2B 2UUAJ 4F2RA 1EHWA 3ZZRA 4BBYA 2JNJA 3Q8QB 1G1XA 1RBOB 1FF2A 1RU1A 3KUGA 1X0PA 2MDAA 3HSJA 3MAAB 5C2CA 4CDIA 4ED8A 4ZLLA 2IAJB 4DZ6A 4CTAB 4IG0A 3OFGA 3I5AA 3V6DA 4JV5F 5SUHA 4U6PA 1H38A 3LP0B 5BJRA 2VQFJ 1RTDB 1UCNA 1WUUA 2YX7A 3QWPA 2CPEA 5KG7A 3CF5Q 2HNZB 4CRJA 2WHOA 1UPPA 2FJWA 4B3TJ 1JLAB 2RQMA 1OSCA 3N5FA 2CG4A 2R2SA 2B7CB 2M7SA 2YH1A 4JYAF 3OVBA 2C2OB 3D6HB 3M32B 2IBKA 3UNGC 3NNHA 1MG7A 2W8LA 4IR9A 2DGWA 4URSA 5THWA 4IRKA 1QY7A 3MURP 2WSEC 2DNHA 3P3DA 4ZP9A 2VDIA 1BQNB 5FLXY 3CULA 1TL4A 2PI5A 2WVBA 1K9MT 4NI2A 1U2RA 4DV5J 3BBCA 2KKHA 1FRJA 3TX8A 5HMWA 4EK2A 4A8OA 1WC0A 2V69A 2GHPA 3NBPB 4ZP6A 4KY3A 5EX3A 3R8YA 4AT1B 4U95A 5KFNA 3TX0A 3OLBA 2XI3A 5L1KA 1S1XA 1YG0A 2XHWA 3PHEA 4NYPA 2XGPA 1YI2S 1URRA 1Q7YT 1NB7A 3QGIA 1M5OC 3RR7A 2AX0A 4EBDA 1KWMA 4F50A 3HHDA 3OR1B 4F4ZA 2HFSA 1HMVA 3DRSA 4Q43A 3TRGA 5C42B 5I3PA 2IA6A 3BDPA 4FVMA 4YQWA 2VG5A 3BH7B 1WOSA 4IFVB 3Q8VA 3QBCA 4P2SA 1RTIB 3PYGA 4XIUA 3QZ8A 4JI5J 2K1RB 1AFJA 3EGWB 5GVQA 3DU5A 2H9ZA 2MKJA 4FS1A 2QMUB 2ACMA 2VBYA 5KFEA 2GVDB 2ZZNA 3AA8A 4NX9A 2LVWA 5DG8A 2ALYB 2MJNA 2PN6A 3E01B 4R0EA 4AXJA 2JC0A 3VAKA 2BJ9A 1RAHB 3ET6B 4WYWA 2HVEA 1FJEB 2V8DA 3UW1A 3IWLA 1K44A 3G82B 4PYAA 4USKA 3I82A 4RLEA 2VV5A 3GJQB 2XGQA 4O44A 1XJWB 3EZUA 3TUPA 3VGUA 4DR3J 1HR0F 2N3OA 2XSJB 1N6QB 3FFIA 1VQOS 3HHLD 2LQ8A 4EBCA 2DNNA 3O5TB 8ATCB 4I7FB 4CO5A 3ELHA 2CDRB 4Z37A 2UXDJ 4LRAA 3PW0A 4B02A 3BGLA 3M2UA 4DN9A 4C8MA 1FDAA 1N0VC 4QWEA 1SJ1A 3H5YA 5L9NA 1PG5B 3UO0A 1UFKA 4NMLA 4C3MA 3HT0A 2XLJA 1I94J 4ZIWA 4ELTA 2UUAF 3GR1A 1U6ZA 2IBOA 4NLSA 1RWKB 4KFBA 2WVCA 2ZOGA 3K7RA 2D9OA 2RHQB 4OHXA 3MR3A 1Q86T 1Q7LB 1HBUB 8RUCA 3IFEA 3LH2S 1JLCB 2WTFA 4P72A 2O5DA 3RBZA 2FIUA 1FWLA 1PYTA 4EO8A 5AE2A 2ZM6F 1KQGB 3RG6A 2J9DE 1FTRA 1RWVB 3CD5A 4IOBA 3CEDA 4WZQA 1JLEA 2AEFA 2ADCA 1UFLA 1Y5IB 2K8GA 2B4UA 5HJYA 5K8PA 3DLJA 5L39A 3G2XA 3I9ZA 2VB6A 2E7XA 1GK8A 1RADB 2HAIA 2I0XA 2CJYB 5KFMA 3EVOA 3UVJA 1NU4A 1PAUB 4WP9A 4KTQA 2IY5B 2DNYA 1ZAWA 3GG0A 1YDLA 3W60A 3NGTA 5ETMA 1N56A 1T03A 1JLBB 3BB5A 3OVAA 2I5JA 3ZTRA 1KEKA 3KK2A 2VBZA 4DL7A 4X4VA 1IBLJ 4RW9B 1EX8A 4J7CA 4LQ9A 2VF3A 2GJFA 2WBRA 2Z2YB 3AOCA 4TLQA 4UUXA 2L3MA 5ETNA 4CM0A 5J1EB 2QA4G 1EKRA 1XMOF 2VOPA 2MQLA 3FRZA 2RF2A 3IR6B 4GVBA 3C2PA 2RUSA 5K8MA 1N54B 2M2BA 1FI4A 5F8IA 3D3BJ 4Y2AA 4HHUA 4G1QA 4ZCKA 1K8AT 3EZOA 1HQUA 1Q53A 3C19A 5KFQA 1S0NA 3M1VB 3RUBL 3TAPA 4NXMJ 6AT1B 3BBFA 2GJIA 1WG4A 3OTOF 1YWXA 3MMBB 1NDKA 3TQEA 4OMFG 5JUMA 1MN9A 2DR9A 3I6PA 4DN0A 1TQLA 2R8JA 4X4NA 1UVKA 4DPOA 3MR6A 3MM7A 2M4MA 1N8RT 3M2VA 2AJ2A 4WU3A 2BJ8A 4A8XA 5A2QY 4K4TA 4LR9A 1NDPA 2VA3A 4K4VA 1VC5A 2F4VF 3MZIA 1SVDA 3TUZC 1F3FA 4K5RA 5KG3A 3LANA 2R7VA 2VFTA 3DOLA 2GVZB 4FPIA 2YTCA 4WFXA 5LT5A 2ALZA 1BE4A 4NCGA 2H54B 3HF5A 1S9EB 4MKBA 4CLKA 1D1UA 3OPKA 2DVIA 1WC3A 4LRBA 3CTRA 4P71A 1MU2A 3QO9B 2DISA 4NRTA 4DR4F 1P1TA 2WW4A 2HVHA 2KZZA 1Z2LA 1KR4A 2QJ3A 4OV6A 4FBUA 1JLQB 4MT1A 4ILLA 3PJ9A 2DR5A 1D0EA 2AJQA 1XMOJ 5AT1B 1WTFA 1VRQC 3KG0A 1AZSA 2I6WA 3KJQB 4PXBA 1F5AA 3H0PA 4OHYA 3GFXA 1SQFA 2U2FA 4DR1F 1AFIA 1QE1A 2UXCJ 4OI0A 4WCEQ 4I0WA 1YHQS 3MCOA 2ZE2B 4ZOSA 5C2GA 1UEVA 4NA3A 1DQ8A 1TVRA 5GMKa 3BPDA 4ZLNA 1JX4A 1NPKA 1N32F 3VGTA 3AFGA 4KJIA 4HVZA 1HHSA 4DCJB 1IBKJ 3FKBA 1PC4A 2HLTA 2E5LF 2M9KA 2HKEA 1XMBA 4H54A 5KAKA 4QWBA 2JH3A 1NMEB 3KLIB 5I3QA 2VQEF 1SQEA 2ZJPQ 2BJ7A 2FHKA 3CJTA 1DTQB 5CHCB 1OY8A 1NO8A 2KYXA 3BREA 2C3UA 2CPDA 4DU8A 2X1AA 3CJKA 3C16A 1SIWB 3ISNC 3TZZA 2AGOA 7AT1B 4DR5J 4TQRA 2W2OP 3O44A 1RWWB 3WIUA 6FDRA 3B54A 1VQNS 2HHTA 1GQEA 4MIBA 1U45A 3NAIA 1WNEA 3GFHA 4IG3B 4UQGA 3TAMA 2IYGA 3KLHA 1YJNS 1T05B 1S4EA 2KL8A 1S1TB 3QAEA 4H4KC 1M5KC 1HNXF 3KJVB 2E5IA 1TL7A 2KN4A 3L7OA 4ZA1A 2V4JB 1EB0A 1LWCA 3D3CJ 3I5CA 4OYPA 5E0OA 3ZZYA 1VK8A 1FRHA 2L41A 4B9SA 2B4VA 2HGLA 3HFZB 2IHR1 3HD2A 5LJ5Y 4P2FA 2B0GA 4F67A 4DR6J 2XMWA 2JSXA 2F1FA 5IZHA 4LF7J 2HRYA 2N4DA 1S9GA 1N34J 1QTNB 1JLGB 2GMJA 5KG4A 4C6AA 4KPYA 2UXBJ 2AEJA 3POTA 2CQ0A 3MECA 4RW8A 2BJDA 3NOCA 1C0UB 1RXOB 4NLUA 2GQQA 1N32J 2BACA 1FRIA 2NXCA 1MROA 3HVAA 4TYAA 2DNOA 2VDHA 3KK1A 1WKKA 3H7HB 2W9BA 2VJUA 4C8LA 1CVJA 2P5VA 3FCVA 2H5JB 1YJWS 4EUVA 3VR1A 1F5CA 4M8LA 3MEEB 4RL1A 5J2MB 2HFVA 4HT5A 4QYZJ 4CO1A 3CPWR 1RGVA 1C4CA 4B3SJ 2WOMA 1HKAA 5IT0A 1KD1T 1GEHA 2CQHA 2HFNA 1LEOA 1WEXA 3AD8C 3FQKA 1SH3A 3GR0A 1KOOA 5LOQA 2MB0B 1FJ7A 2F5GA 4R8UB 2PMZD 4ZVRB 5U47A 5CD4H 1S0OA 2CQ4A 1N36F 4OX7A 2DGSA 1R0CB 5HSPA 4DFPA 3Q86A 3I5BA 2AYEA 2BANB 3LA0A 3SEOA 3PV8A 1XERA 5KFZA 1KLMB 2E5HA 3JSRA 4C3KA 5LSLA 3I32A 5L1IA 4NLGA 1UEUA 1FFWB 2YY3A 3FC9A 2I38A 1TV6A 4ZS6A 4X2BA 4IFYA 3U1MA 5C25B 3I87A 2K3KA 2WB4A 4DPXA 1JLFA 4DSEA 3X1LB 3D54A 3JXOA 3BKUA 5E3PA 3HSGA 1HBMB 2IM0A 4F3MA 3AJ2A 4ZN1A 2UXCF 1TL5A 5K14A 3IM8A 3WHIA 1VQ9S 4ALZA 5RUBA 5LSOA 3CJQA 1NHKL 4L72B 3T6BA 3CCRS 4DG1B 4H4MA 2LQ9A 4ES1A 2HYIB 3F44A 1FXDA 2EI5A 1YJTA 4U67Q 1NHVA 2O66A 4GKJJ 1BWEA 3SCIE 4QIGA 2BA9A 4IDKB 1LWFA 3CD0A 1XNRJ 5H9EK 2RMLA 3A8IA 3PCOB 2E5JA 4FXDA 2OEKA 2R3VA 3SDEB 3MM8B 3HHLB 1UW9A 4OZLA 1W7WA 4YHHF 3DU6A 4N76A 5I4MA 3W2WA 3HM9A 4HHJA 4ZITA 2KHCA 3RAMA 4ECVA 3KG4A 3OT9A 5HJXA 2F8HA 1RT5A 2L9DA 3MAHA 3HJVA 2ZBIA 4LREA 1TELA 4ZKAA 7FDRA 4I2PA 4RW4A 1R0AA 3P8BB 3T9ZA 2KTQA 1F2GA 2H1YA 4WTYA 2M3DA 1IJFB 2NR0A 1AROP 2ZH6A 1SUQA 1NZAA 1TUGB 3TP2A 3J7ZT 4DUTA 4TQSA 3SCKE 3EXYA 3M6VA 3QIPA 2EPIA 3HKZD 4ZCLA 3UDEA 1U49A 4FBTA 3DLEB 2RNEA 3ILIA 1S1VB 3W8PA 4CLLA 2LYVA 5EWEA 3EPIA 4ED7A 3PW7A 3F41A 2BOAA 3BDEA 3TJ9A 2WONA 4ETZA 4ETXA 2XLIA 1WC4A 4DV2F 3D68A 2O67A 1WC5A 1BGXT 2V2QA 3DLGB 4P75A 2F8EX 3TWZA 3ZZPA 1HBNA 3RRKA 4F26A 3LP1B 3KHGA 5J1NA 4DX7A 2H51B 1RUSA 1ZA1B 4Q0BA 3B82A 1CJVA 3FBEA 3R97A 2DEIA 5C24B 4YP3A 2PEHA 4DLEA 4HACB 3RB6A 4PKDB 3PO4A 1RT1B 2JOQA 2GGPB 5L9XA 3GE9A 3HHLC 3H5UA 1Q5YA 3TJAA 2ASJA 2D9PA 2QSFA 3MM9B 1XR5A 1FDNA 3QLHA 4HL9A 1FWKA 5CXTA 3M2RB 3DYAB 3CCUS 4ZPVR 3OXLA 3ADAC 3IRXA 4MKAA 3ZTQA 3LPYA 1WACA 1E6VB 3PR5B 4A8WA 1L3TA 3BGRB 5H1SV 1B7YB 2UXDF 3VHQA 5A76A 4IH7A 1MNEA 3RGIA 4N5SA 3G6YA 2HAFA 2VASA 3I96A 5B0BA 3VAJA 2KXNB 3T6JA 5F8NA 1U2FA 2NSCA 4P74A 5CYQB 2KHDA 4ZPTR 2JWNA 3ZNJ1 4K4XA 3GSIA 3M6XA 5KG5A 1Y00A 1AYEA 4DV6F 2VD3A 5HLFA 1PILA 2AHOB 2HLUA 4HDHA 1RLCL 2OH2A 4HH1A 4Y2CA 3Q8YA 1RHKB 3WX8A 2RRAA 3DLKA 1VK3A 2HHSA 1S1UA 1X4EA 2W2QP 4KHMA 3RB0A 2KG1A 1IQTA 1LQ9A 5F41A 2F9JA 3KKFA 4EYIB 3V2UC 2MZ1A 2B9WA 5ETSA 2CJ9A 3VF0B 4ZVHA 2F9DA 5IT4A 4K4UA 3IS9B 2DIUA 2MYFA 1RAFB 2IRUA 1B99A 2UZAA 2G9OA 4R5PA 4DR3F 2LU1A 1HNZF 4LRDA 4PRFA 1LFWA 1TAUA 2I1RA 2XZTB 4ZVUB 1PKUA 5AE1A 3C46A 1CSJA 2KXFA 5GAEU 4B17A 3F0NA 3G4SS 4IOAQ 5GAGI 4GKKJ 1TKXA 2Z57B 1NSKL 3B78A 2UUCF 1RU2A 3DDNA 3FVYA 2CQBA 2QFIA 3O8WA 4O23A 1R89A 5A8RA 4AUKA 2B9XA 3EPGA 2J8AA 1IBCB 5B0EA 2CDQA 2VFRA 3T1YF 4O4GB 1HD1A 2CPFA 4O3OA 1SL1A 5A6WA 1CJTB 4LIWA 3A4TA 4MFBA 4BWJA 1LW2B 1MN7A 5F9LA 1Q95G 2FPHX 4LSZB 3T1YJ 2DPIA 3L4BC 3EZ5A 1UVIA 1S5ZA 3FZBA 1ZM3A 3UDLA 4BC7A 3L9ZA 1H74A 1ULRA 2ZOMA 1RAGB 1CJUA 3F56A 2AWZA 2DCUB 3C15A 1H98A 1RHMB 3PJWA 1KHWA 3GSDA 4GO5X 2VFSA 5KFIA 1YJ7A 2ATLA 1M5PC 4CZCA 1N34F 4RNOA 4A8KA 1VRUB 4DR1J 5A8WA 3K59A 3T5HA 3P5TL 4USVA 4CIOA 3MAAA 4J9QA 3V6JA 4Q7AA 3MOJB 3QFWA 1YBTA 3AXMA 3QPIA 1IKVA 1FD8A 4CTAA 2NUUG 2ZHBA 3AODA 3V6DB 2B5JA 4TU8A 3KLFB 2G2YA 3I56S 4KAIA 4U96A 4GRSA 3E2EA 1N33J 3HP6A 2HNZA 2AZ1A 2VBWA 3NY0A 2IC3A 3MHYA 4MIWA 2OMLA 5JJBA 3KLGB 4QYZK 1CPZA 2K2PA 2HPUA 4Y0FA 3PW4A 4OI2A 3I0SA 2XI2A 4NLPA 2IRYA 5CA5A 2JEJA 4ANEA 4XO0A 4UF4A 1QAXA 2YWEA 2LQ5A 1TK8A 2GX8A 4DXLA 5KFCA 1VQ7S 1HR0J 3UNYA 3H40A 3GJSB 2CZVC 3TQ1A 1RKIA 1UPMB 4DV5F 3A3NB 2M5YA 2PO4A 4LF2A 5KFSA 3FBCA 2ASYA 4PPZA 1XNQJ 3OTCA 1NHUA 2VL1A 2ZKUA 2BUNA 1OPZA 3THTA 4NI2B 1HYSB 1FJGF 3DOMB 4N77A 4QZVB 3UR0A 1S79A 3MOZA 1J5EF 4LF6J 1HI8A 3LF0A 1VJQA 4NLRA 4RNHA 2RH3A 3K5PA 3ZC4A 4O3SA 3VQTA 4CO3A 3QJLA 2GNKA 4PQUA 1FVQA 1S1XB 2H5EA 5IM0A 3AD7C 2X3DA 2Q66A 4ECYA 1R8PA 2BM0A 2JC1A 4QIVA 1QVGR 4ZIVA 3DRSB 3UWTA 3P4UB 4NLDA 8AT1B 4RU9A 5C42A 2PFDA 1WDTA 3MR5A 1N4LA 3HZGA 2VG5B 2GHWA 1I6JA 1PJ5A 4IFVA 3KK3B 3H5XA 1R6YA 1RTIA 1JNRB 1X7VA 4DCOB 4O0IA 2DITA 2KM8B 2BVZA 2V8PA 3CJ5A 4LF9F 1NCLA 2A10A 1O0PA 3OHBA 1HWUA 1SC3B 5CYJA 3D6FB 1F9HA 2GVDA 3OV7A 3LGNA 1LWXA 4U9RA 5H9EJ 2VU5A 1ACMB 3EICA 3E01A 4G1IA 1SCJB 4J37A 2MQNA 4F2SA 1EAYC 3VZIA 2WVFA 3RBEA 2MQMA 4EGLA 3S1TA 4NXNJ 2VPZB 2DTJA 1LXNA 4DSJA 3KLEB 2HQ3A 2CPYA 5LSRA 1G6BA 1N6QA 3FFIB 1AB8A 1PYSB 2LU2A 2VC1A 2YXLA 4JOUA 3W64A 2ZWPA 2UVWA 2IJFA 4I7FA 1KQFB 1KDNA 4PCQA 4QW9A 4E0DA 3MPUB 1VQ6S 3VAIA 3PVXA 3J7YI 3KDOA 3M2UB 4FKXA 1YBAA 2WSCC 4WPAA 2LP4A 2OMOA 3KFWX 2MSTA 1NH8A 4GVLA 2OGUA 3AB2B 4X62J 1NJWA 4C8OA 4TXSA 4M5IA 4CNYA 3CJRA 2GAGC 1VISA 2XB2D 1RWOB 1FCAA 1XIQA 4ENOA 2NXNA 1L5UA 1HNIA 3PTWA 3AD9C 4KFBB 3AH6A 3W5XA 4NYOA 4DV1F 1WI8A 1SI9A 1WKLA 2Z58B 3IWXA 2JDJA 4DV6J 1N5YA 3HHKA 1UAWA 4Y2IA 3FUYA 2KT5A 1NK8A 1XR7A 2C22A 1FKAF 4B9VA 3KNAA 1IM4A 5HBMA 3N28A 2HBRB 5ETTA 2NYIA 2A2DA 3GU0A 3SI8A 4IH6A 1LK5A 2SXLA 3ZFVA 3HXMA 4M95A 4HKQA 4RX6A 2HVZA 1GXTA 2HQDA 4F3OA 2CQCA 3ONQA 4ED1A 1QUPA 1XMQF 5B0AA 2F4FA 2YNHA 3UVJB 2YNFA 4FS2A 3RAXA 2CQPA 2COLA 4P2XA 1NPPA 3AQOA 1IUJA 4CYUB 1YBUA 2Y0BB 4PQAA 2UP1A 1N5VA 3MM5A 2QA4S 2N4CA 3AA9A 3KK2B 4XDCA 2DGUA 3C66A 4CT9A 3DRXA 2RRBA 4RJVA 1RAIB 1MLAA 1F6TA 2XNQA 2KG0A 5DM7Q 4CWBA 3HDSA 3IAM9 4J91A 5EUHA 5AXKA 4DZDA 2JLGA 4DLGA 4LF6F 2ILZA 2FVCA 1PJ6A 4F36A 3J80U 4DL5A 1NPRA 2YQ3A 2UVUA 3DMJB 1FXRA 3MUMP 2J6SA 3OFEA 4CO0A 4F4WA 4DWIA 4PWUA 1IWGA 3QATA 1RSCA 4G1QB 3TZXA 3NEKA 4UOGA 2QE5A 4PPDA 1CQNA 3RJMB 2MGZA 2XMAA 1ITPA 5K9FA 4FF3A 2HFUA 1KP6A 1S57A 2AJ1A 1HARA 3DDIA 4W98A 1VQ8S 2VIHA 2HZAA 3CO9A 2XYPB 3MMBA 4U7UK 4MTPA 2DPJA 1X5PA 3HKWA 5DDRC 2BEFA 2NXEA 2YKPA 3TZYA 4DV0F 4RU2A 4CH7A 3CCVS 3Q8RB 3OVSA 2DHXA 3MM7B 2HFOA 4PABA 3M2VB 3H5SA 2KFYA 4ZHRB 1APSA 2G0CA 2CAJA 2V9WA 5K8OA 1RABB 3DOLB 2CRLA 2GVZA 4FPRA 4OIXA 4J9UE 4EO6A 2C28A 4NCGB 2D3ZA 1U0HB 2RKIB 4ELVA 3R5BA 1KFSA 4P52A 1S0VA 1H72C 2B9EA 1JKHA 1XNRF 2IVMA 2DY9A 4TU9A 3CD7A 4PWDA 1A0OB 2CA9A 3D4JA 1N5QA 1K1QA 4Y00A 2OTJS 1JLQA 3GFYA 3SZ2A 3W5YA 4X65J 4O4RA 1M0SA 4DQQA 4WJBA 2WK4A 2OUGA 4ZLJA 1HQEB 3C8YA 3U27A 2R8KA 2PMWA 2V5HG 5KG6A 1AZSB 3BSOA 1F9FA 1GFWB 5LXRA 2D1CA 2Z4PA 3NGSA 5DS7A 5KFHA 4D3HA 1PBAA 4QWCA 1QE1B 2ZVSA 1OQ3A 4NEZA 2BQUA 2ZE2A 2DRAA 4PWWA 2K7JA 4UY85 2YWWA 4ILRA 2DT9A 3R5CA 4USMA 3BQ2A 5M2PA 1DTTB 1S12A 1VCTA 5M2RA 2Z0GA 1WSVA 5KT2A 2JX2A 3KOAA 1YK9A 4NYZA 2L08A 2BBEA 2HBQB 3WC0A 3QRQA 2R7UA 1Q78A 3G8QA 1D8ZA 1OYEA 4WXWA 1WTBA 2EC2A 2F3JA 3KLIA 1REVB 4KRWA 4OX6A 4OZ0A 4S0MA 1HIYA 3OJSA 4ZVSB 1DTQA 3B4MA 3GQCA 3OL7A 3TAQA 2FVPA 4NCBA 4B3TF 3H2LA 4JI6F 4A48A 3W9IA 2P6SA 2PIIA 2XHCA 3CJKB 2W8KA 2J7UA 4OYOA 2W2MP 3NL0A 3X3UA 2CJXB 3D6TB 2DRDA 4C7QA 1WI6A 4IUFA 3LP2B 1Y3KA 1RT2B 4IG3A 3DKDA 3C3LA 2G0JA 3MR2A 3J7YU 4MJKA 5KFWA 3KLHB 1T05A 3MEDA 4LVOP 2PFFB 1S1TA 3MPWA 1HW9A 5HMYA 3CC7S 1T7PA 3IGVA 3N4WA 2VHGA 1KRPA 4DF4A 2JEFA 1G7CB 5D4PA 3TVYA 4A46A 3J7Z5 4R25A 4RWXA 1OMSA 2HWIA 2YWKA 5HQMA 3BQ0A 1LXJA 2QL7B 4KGMA 3W62A 1OO0B 3JTNA 3FSYA 1S9GB 1WHWA 5D4OA 2BJ3A 5K8NA 3CVKA 4LFCF 1JLGA 3PIPQ 3NXZA 1F9EB 3FMBA 3IBFB 1X4AA 3CO0P 4YB5A 4RW8B 1IQZA 4U7CA 1S48A 5GAGU 3T3FA 4ZP8A 1UWBA 2V2ZA 3KDNA 5J2QB 4I68A 1UVLA 1MROB 4WK3A 2OJ3A 5JXSA 4MH8A 1QAJA 3HI9A 1W26A 2W9BB 1WF2A 2DY1A 2JEIA 2G2OA 5EHHA 4NPOA 4M5DB 1IN0A 1ZAXA 2HHVA 1U6FA 2EK1A 5I42A 1S59A 2OEMA 3LUYA 2RVJA 3MEEA 4XAKA 2E1RA 3A12A 2V8VA 3Q2SC 2QRRA 2PD1A 3SFGA 2MLYA 3DLLQ 2HRTA 2WOMB 2ZH5A 2AGQA 2V8HA 2MMYA 3RW6A 3K2YA 4QQBA 4I2QA 4USWA 4FF4A 2MHEA 3SQGB 4WKYA 2D7SA 4M5GA 2VFUA 2IDLA 5CH7B 1DQ9A 1FK9A 1X5TA 5KFKA 2J6UA 4ED5A 4XK8C 1S4FA 4W90B 1GAOA 3H20A 3QT7A 3B6BA 3D0GE 2KB2A 2ACYA 3NGDA 3KLVA 4QIFA 3M8RA 2UVVA 3G8TA 4JI4F 1BHNA 2GO9A 4C8YA 1HPZB 5ETRA 4OFZA 1GH8A 5HP1A 1KTVA 1Q4RA 2CQ3A 3OR2A 2XY7A 1T9WA 1MW7A 1JLFB 4JI7J 1EARA 3IN5A 2FB0A 2L48A 3S01A 1RTJA 2FY8A 2Z2ZA 4RUHA 3MFIA 3DLHA 5GMEA 5IV3A 1L3VA 4JI7F 1P8GA 2MXYA 2E9TA 5B0GA 2NXJA 3HSZA 4DG1A 2A18A 2ZZMA 1FNOA 1RAJA 1PJ7A 3EVMA 2CPJA 4NA2A 2MQQA 3WQPA 3CB4A 5L46A 2GV1A 2MKKA 3TA1A 4IDKA 2GMLA 1LWFB 1NNDA 5CCMA 4ERDA 1U7LA 4P6QA 2UV8A 4I4BA 4AL7A 4TY9A 4FNHA 2PGCA 1S49A 3N5BA 4I6YA 3SDEA 4Y28C 1NXIA 3HHLA 3M7VA 2VFVA 3W9JA 1LWEA 2D3O1 1RKJA 2RQCA 1ZAVA 3Q23A 4ZVQB 2MZRA 3R6LB 3O1LA 4OZ3A 2B4OA 2AKWB 4O3PA 2B3TB 1FFGB 4KGXB 1FEEA 4DFKA 1RT5B 1XNQF 1R0AB 1AA1B 4JUZA 2V2VA 5ETKA 4I6AA 1TZ0A 2V2KA 4ZN3A 1CULB 4U8VA 2KO1A 2F8MA 2OPRB 4XPEA 3OTBA 3IBCB 2B6AA 2VZ9A 3QIPB 5ETPA 3W63A 3DLEA 2UUBF 3SCLE 2R7WA 1S1VA 4DS5A 3LGHA 3CIMA 4Y65A 2F65A 1RQ0A 2UUTA 2OSRA 1Y5NB 2WONB 1DRZA 3MXHP 2FD2A 1UA1A 2BM1A 3K17A 5E41A 2BKOA 4K2XA 4LF9J 2OAUA 4FYYB 4GKJF 4QU6A 1YRUA 3SYZA 3LGMA 3LP1A 1VMBA 1H2TZ 1VDHA 4Y2KA 2B51A 2CADA 4PXDA 4FYXB 1OY9A 2LCWA 1TL1B 2J0WA 3CCTA 1CJVB 2EXUA 4Y34A 3FZ2A 4NZ7A 3BH6B 4F3QA 1RT1A 2WCXA 5E3RA 1BQXA 3MMJA 4FNIA 1JXEA 2VG6B 4M63A 5DLGA 3MM6B 3NS5A 3D6MB 3R5AA 2ZHAA 4EBEA 3V4IB 1D9AA 1NM2A 1ZPVA 4CLFA 1CC8A 4KV8B 4CO4A 2E7VA 1VBXA 1NEEA 3DYAA 2F63A 2O3DA 3IAS9 1J5EJ 2KH9A 3MR7A 2LEBA 4PXEA 1FRXA 3BO4A 2DHGA 1NKEA 1U24A 4K0KF 1SB6A 4KHPJ 1VR6A 4C11B 3QRPA 1ZH5A 3ENVA 2CKWA 3O6QA 2JFDA 3ZZZA 4OJ3A 4ZVFA 1IVZA 4DL2A 3A3OB 3ITHA 2FLOA 3WX4A 2R7XA 1NK7A 2XCAA 5HVFA 4W92B 2DO4A 5HLFB 1BLUA 1YJ9S 3SMZA 1I3OB 3BKTA 4MK9A 3CCQS 4TLRA 2B9YA 2KRBA 2MZTA 4B3MF 3DLKB 1RT4B 2PE8A 4DPUA 1UZDA 2RU3A 4DQIA 3EXCX 4D3GA 4FYWB 1CC7A 4NEYA 3BS9A 3IMQJ 4LFBJ 2VQEJ 1UW4A 2GIFA 4USJC 4Q8EA 2QA2A 3FMWA 2GQCA 3IS9A 1OS5A 4R5PB 2J0XA 4ZPAA 2J7KA 6FD1A 4LBPA 3O2IA 3ULHA 3LW5C 2XBPA 3FCWA 4ECXA 1EQMA 1TR0A 2AYBA 4LMZA 2C2NA 5BR8F 5GMDA 5ITHA 4ZMMA 2XY6A 2HS3A 3P49B 1DURA 2NZCA 2FZGB 4TYBA 2AW0A 5G4DA 1YIJS 3MCSA 2EC0A 2NUHA 3PY8A 2AD9A 3CSKA 3MCMA 2YKNA 4P9SA 5B0FA 3Q2TC 5DO2A 1U0SA 1BC6A 3OL8A 1G3OA 4DR5F 1IJEB 4YN3B 3DGPB 3GFZA 5CD4A 1SJRA 1X5SA 1H2VZ 1CJTA 1TU0B 4MFBB 2QA1A 5HK4A 3RBDA 4DR6F 1V5VA 1S6QB 2EG2A 1GX6A 1U2CA 3TYTA 5F8MA 4RZRA 1ZS6A 2YPZA 2FVRA 4MK7A 3DC2A 1S9FA 1LW0A 2NYHA 1CJUB 1HYSA 2WSFC 3C15B 9RUBA 4FYDA 4QBUA 4DV1J 3W61A 1S72S 3ICLA 5KFAA 3KHRA 1M5VC 2G13A 2ABYA 3O3LA 2MTLA 3BBBA 1VRUA 4TU7A 5A8WB 1RCXB 2AYGA 2HMIB 1Z4UA 1NK4A 5AXLA 3H8YA 4UOFA 1FFSB 2R2TA 4R0JA 2DH9A 1IKVB 3NS7B 4IOCQ 3CDUA 1B3TA 1YJRA 2B5JB 3GILA 3N6LA 3KLFA 1SJ3P 4LQ3A 2QTWA 2YWHA 3EMTA 4JI8F 3D7SB 3E8OA 4DSKA 2VOOA 1PCAA 3AB4B 3DXSX 1KQSR 2IC3B 5J1PA 2ASDA 2FLNA 1NLKL 3KLGA 2FY1A 1KOHA 2DGXA 3I31A 2A0FB 3LOUA 3I0SB 3PYFA 4FN5A 4DX6A 2EEYA 3HK2A 3OJUA 3HZEA 3CC4S 2CQDA 5D4NA 2ROGA 4JI0F 4EI2A 3QGGA 4K4ZA 5F0UA 3US5A 2HSEB 3G96A 2WB1D 4UOHA 4JV2A 1EKSA 4OYXA 2QC3A 4OYZA 4OI1A 5DLFA 4DSIA 1M5HA 1WJ9A 5B0CA 1NDCA 2ZFHA 2CPIA 3H25A 4X66F 5F3TA 1U1OA 3DOMA 4OHVA 1JJHA 2V67A 5CYMB 1Y5LB 2BE2A 3Q8PB 3W8GA 3KHLA 3EX7B 4N41A 1T9YA 1JJ4A 4PQUB 1RJJA 4OJGA 3DLBA 1RTHA 4WU2A 3MD3A 4DQRA 3B4DA 3IG1B 5IM0B 2HHXA 1DFDA 3SSQA 2VJVA 2V63A 4LFAF 4EYHB 2W25A 2XY5A 4NWBA 1EP4B 4DR2F 2OIHA 5D6GA 1DARA 2Q3PA 5DQHA 3P6YC 2YKAA 4L6V3 3G9CA 1JWWA 2Y0SD 2ZD1B 4KR0B 3KK3A 3WDOA 1KKHA 2E66A 1T94A 2RT3A 2XMKA 3U1LA 1RP5A 4N56A 3PZPA 1JK9B 3JYTB 4WXOA 2V4QA 4FXVA 2ZDPA 2J7WA 2AIRB 1L3SA 2RB7A 2O01C 1TKZA 1QD1A 2WBMA 2ZEJA 5FDLB 4QPXA 1P1LA 1H3DA 1J27A 2XMMA 1ZOTA 2OP5A 4L75A 1S7IA 4DDFA 2AV5A 4UZBA 3L3CA 3GCWP 1WF0A 5D0HA 1N52B 3SV3A 2GIRA 1VQMS 4I67A 1E6YB 4WKRA 1NUEA 3OQ2A 1F0XA 2RHSB 3NKYA 4LSNA 2ZH4A 4WZMA 2D3UA 2V68A 1JIHA 3NLCA 3Q83A 4Y6IA 4X4SA 3KLEA 3F73A 1RBLA 3MEKA 4JV1A 2C2MB 1I51B 3TW0A 5I3UB 5KFXA 4I69A 5IT9Y 1VHFA 3DRPA 2BE9B 2EG1A 2PSZA 3TNVA 1GX5A 4OX8A 5F0WA 2HK3A 4OZ1A 4X64F 3KNGA 3V81A 3ETMA 2J6TA 1TK5A 1S1WA 5HATA 1C1CB 4N8OA 1FO1A 1RWMB 3V6KA 2PC6A 3IM9A 2VH7A 1JXVA 1FE4A 1UJ5A 5IQ6A 2EBEA 1HNIB 4PG6A 2RS2A 3OFFA 2MSSA 2VKZG 4DX5A 4DUZF 1KTQA 2RSQA 2DNRA 1RI7A 1H6KX 4ANDA 5CABA 3VWSA 1HA1A 1N5YB 4OYBA 3OTOJ 2KVIA 3HVWA 3OL6A 1QUVA 3DNCA 1WC1A 1YRXA 3ENWA 3PRBA 5HBMB 2UVRA 1RT6B 2FHJA 3CJ8A 3QJJA 1RHJB 2MY8A 3OD2A 1V6HA 1WELA 2C2ZB 1J2VA 2W1BA 3IR5B 4CLPA 2IMWP 4LF8F 1SV5B 1MMDA 4KGZB 2IMOA 2RQ4A 2W4DA 2WVDA 2IYIA 1RWPB 3GJRB 3UCGA 3VGVA 4CLUA 1O5JA 1SJ4P 5KFUA 1H7WA 2YNHB 2AJFE 2Q1LA 2ROEA 2YNFB 3BGOP 3D66A 5A2QU 3M9NB 1NRKA 1WEYA 1SQGA 2QLBB 3L7PA 3MGJA 2DIVA 4YHHJ 2IIHA 4CYUA 4DS4A 5DQIA 5AXNA 1QLNA 1IBLF 4USTA 2P8IA 2H48B 4ZJOA 2CQ2A 2ZH2A 5BXIA 2GO8A 2ZDOA 1WD6A 3MM5B 3QGPA 2V34A 4UT4A 3ZZUA 2YQ0A 3BM7A 3PNIA 1H0HB 1XR6A 2HBYB 3L7UA 1FE0A 3JB9k 4J9RA 1ZYQA 3DRRB 3RRGA 5DDPC 3KYLA 1HQ2A 2UU9F 3DMJA 3GIMA 2EFOA 1O51A 2O1PA 2Z2MA 1IM6A 3JQMA 2HHWA 4HDGA 3RU0A 4J9NA 2LXIA 2MGZB 3CCMS 2QLXA 4ED2A 1DJ0A 2HNYA 2ZBQA 4LRFA 4CO2A 3ZTSA 4DSLA 4EEYA 1TMJA 2V50A 2WRMA 4B3MJ 3I0RB 3OXGA 2CWXA 3L09A 5KOWA 4TVAB 3T5JA 3A8JA 1IR0A 2J5AA 2KRRA 5EWFA 4M94A 1WF1A 3PFOA 2W9AA 2HS0A 2ZUGA 4ECRA 4OYMA 1Q8LA 3M30A 2DEJA 4WE1A 3BYRA 3GWCA 3HHEA 2A2CA 4OI6A 4ZHRA 3MUVP 3TA0A 5DDOC 1M1GA 2HVDA 1Y3JA 2VODA 3FSIA 4KQZA 3M6WA 1RT3B 2YKMB 2YNIA 3CJ2A 2DXDA 4KHPF 5HVGA 3S7RA 4RKUC 1CEZA 4QJVA 2QSWA 4K2JA 2GAHC 1U0HA 2RKIA 3GP9A 3DHXA 4DPYA 2XZWA 1GXUA 4FXWA 4QWAA 2UUCJ 4N7TA 1JKHB 1T3OA 2FJAB 1RT7A 1FX2A 1ZM4A 2HWTA 2LA6A 2V6AA 3CE8A 3TO8A 3FEZA 3SIPB 1X4GA 4RW7A 2ADBA 1G2EA 2PDAA 4OX9F 1EJ7L 1OYDA 2HEKA 2HIYA 4I6WA 4IQMA 1QSSA 1UL3A 2CXEA 1HQEA 3JS9A 4M5JA 2DNZA 1YVFA 2XMJA 5A8KB 4ES3A 4Q45A 1X9MA 1YGYA 2D41A 1RE1B 2GW8A 3R7NB 2MLXA 4JV5J 2OPSB 2C3YA 1BXNA 5L38A 9ATCB 1DQAA 4OI3A 1V5IB 4KIAA 2KM8C 5DM6Q 1RAAB 4Q44A 1N48A 4NMXA 1DTTA 2IVYA 5CCLA 2V4RA 2ZKTA 1PYOB 3AQPA 1AUSL 3TVZA 2J9DA 2QV6A 5DZ7A 2DNLA 5D4LA 1REVA 2DKOB 1QAIA 3T9NA 1LOUA 2RILA 3M05A 2N3LA 5ADZA 2BW2A 3MPVA 3HT3A 3CCWA 2X1BA 4V19J 2G0IA 3GIKA 5ETLA 3EDRB 3WBZA 2ASLA 1RISA 4GKKF 2IM3A 2LMIA 3QWUA 1FTCA 2FVSA 2FLLA 1YJVA 2K06A 4FDFA 4MKYA 1WORA 3MF5A 2YQ1A 1C1BB 2HHPA 2CJBA 3BEGB 3LP2A 3M6UA 1RT2A 3R7SB 1ZZFA 5SZTA 2IA0A 5FLXU 4MKVA 4DV3F 1U8WA 3CMAS 1FT8A 3HO1A 3MEDB 4KGKA 4OZ5A 1NZ8A 3OXFA 1S77D 3Q8UA 2GQ2A 4JBCA 1SKSA 1WOPA 4DBQA 2AQ4A 1REGX 2D74B 3IWNC 4HTJA 1MMNA 1JXLA 1QSLA 3PACA 1LV5A 1Q79A 4CLZA 1RLDA 4LSLB 3CDWA 3PR4A 2HGMA 2CFXA 2DHHA 2BQ3A 3H2UB 2EFGA 2EBGA 3TEHB 3CCES 3H2VE 4DF8A 2VQFF 1K47A 3R3TA 2M88A 5IC6B 2KZMA 1QTMA 2DR8A 4B3OA 2GFFA 3TVKA 4IO9Q 2H5IB 4M5HA 4YR0A 1NBEB 1AXQA 2XYGB 2VICA 1ZA2B 1TMMA 2MJUA 2V8GA 3BPSP 1UWBB 3BYPA 4ZLPA 5EWGA 3V6HA 5J2QA 4YB7A 3EDQB 5A0YA 3ZZ0A 5HROA 1X0FA 3TA2A 4Y3CA 1HLWA 3J80Y 4WIQA 4U7UD 4USHA 4JI8J 2ATCB 3QSYB 4O3QA 3CDBA 3HSDA 3NRBA 4KO0A 4M5DA 3PYDA 2B43A 4CNZA 1S0MA 3MEGA 2AMCB 1FRLA 4RR5A 5I42B 3SSSA 4HLBA 1FVSA 5HMZA 3M9OB 3BO2A 2FJVA 2J0SD 1K0VA 2QLWA 3DI6A 5HAOA 4HYKA 2XS5A 3FCHA 4I2QB 3KMSA 3JSMB 2HBZB 1KN6A 3SQGA 1F3VA 5HO4A 1ZETA 3KXDA 2Q43A 5IOLA 1FK9B 1F60B 3UD5A 1VQLS 2W01A 2XTJP 2MY7A 4DV2J 2HVIA 1KS2A 3LTOA 1SL0A 2IFXA 4UQTA 3H4BA 4OHZA 3G71S 3GONA 3HMJG 4KKOB 4RW6B 4TY8A 4USIA 1HPZA 5KOXA 4YR2A 5HP1B 1RYRA 1GTHA 5DG9A 2F40A 4V19X 3OR2B 2W9CA 3KUEA 5JVGQ 3BJYA 4G65A 1HI0P 2M70A 4EWTA 4WFZA 4BLGA 1EZZB 1RTJB 3VZHA 2FGOA 1RHRB 2ZUAA 1OY6A 2JZ5A 1A7GE 2CPHA 4MAKA 4LFCJ 3G6XA 4L3KA 4WFYA 2RDDA 4DFJA 3QIDA 4NLXA 3FBBA 5GADI 4LFBF 1X4BA 3R5GA 3U02A 2PMHA 1YLXA 2C3PA 2J9CA 3L95X 2FJBB 3D28A 3MPDA 4O0NA 5E3QA 3GV7B 2MQOA 5D3GA 2JRSA 4H4OA 4ZDNA 4OZNA 1AUDA 1S10A 1B70B 2EFPA 3PFEA 2CNOB 5ETOA 4JI2F 3NWRA 3RYLA 3T19A 1ROFA 4YB6A 4NXNF 4C48A 1IKXB 1TUWA 2U1AA 2I9SA 2ZNYA 4DV4F 5BR8J 2CQIA 4LT6A 4JI6J 2QL5B 3A8EA 1LWEB 2BW7A 1WHVA 1X9SA 1C0TA 4DL6A 3EWGA 3M9MB 4K0KJ 3PW5A 1AW0A 2P9EA 1UJ4A 5DGBA 4ZPCA 2QLJB 1P27B 2V94A 2KT3A 1ZM9A 1RK8A 1R8BA 4J9MA 4G6VB 2AU0A 1CULA 1VBYA 1FXLA 1IXKA 3NCPA 2OPRA 2K3IA 3QNWB 4PAAA 3UDCA 2B6AB 3A13A 2P2CB 1Q8IA 2DCLA 1FRKA 2OLWA 4TNOA 5CZVA 2C2RA 2CNLB 1X31C 2UV8G 2OPPB 4K50A 3QYYA 1U48A 1HI1A 5IC4B 1SC1B 3JTPA 3M4XA 1SH0A 4FYVB 1UVNA 2HHQA 4AE5A 2MEWA 3RW7A 2VC0A 4YB1P 4DHVA 2FDNA 2CJKA 1FKOA 4DUZJ 2VG7A 2UXBF 4FVCA 1JJ2R 2R8GA 2LXFA 2LFVA 4DV0J 2Y1JA 4B9LA 2IPOB 1VLYA 2IRXA 1ZBTA 2R7OA 2IDEA 1TL1A 3CT9A 2BKNA 3GTYX 3MI7X 3CGIA 1VQKS 4IYQA 4L76A 3G6ES 1SKUB 4BWMA 3PXGa 1PIEA 3WIVA 5J2NA 1X5OA 1NH7A 2VG6A 1S6PB 1Y9OA 2DK2A 2QMXA 2YPYA 3MM6A 2R2RA 3N9UC 5ETQA 2ZC4A 3V4IA 3ISND 2DHAA 2FTRA 2XC9A 1I5OB 1R8CA 4KV8A 3QGHA 3NAHA 1XTZA 4JV0A 2N7CA 1VRTB 3PM9A 1PC5A 1SPBP 3OW2R 3R1HA 3TR5A 1KLNA 4AQYJ 2N82B 3WC2A 3BF4A 3CMQA 4C11A 5KTQA 1EETB 5EGYA 3H98A 3GZ7A 1GXLA 3V5RA 1EQ0A 2ZH8A 2B8QA 1PGZA 2DNPA 5GAHI 3ITHB 1U1KA 3QZ7A 1KNZA 3JTOA 4DPTA 3B8HA 1QAYA 4ATNA 5E3AA 4C0BA 4CLWA 3W2VA 3HPOA 4WF9Q 2LDIA 3NCRA 2DGOA 4K59A 3RBXA 4DCPB 4ECUA 5JVHQ 3OL9A 1VFJA 4RWWA 2DNKA 4ECSA 3MFHA 3KMQA 1U1LA 1RT4A 2Q6CA 2Z8QA 3IC1A 4Y2MA 2J0QD 4J9VA 1R31A 3IRWP 5B09A 3A1YG 1NK9A 1OIAA 5L1JA 2HURA 4JI1F 3PEHA 4DI6A 2ZBCA 2QGFB 5IFMA 4A8SA 3UI3A 4HI1A 5KG2A 4DL4A 4JI3J 4F04B 2F4VJ 4NRUA 3SQOP 1DBDA 3UN5A 4A4JA 5KG1A 1U1QA 5LM7E 1HD0A 2RS8A 3GYNA 2MKHA 3VAHA 1IKWB 4CCHA 3NOGA 2C3MA 2MKIA 2POKA 1IKYB 4IR1A 5G0RA 2GHVC 3G8SA 1FRMA 1YQHA 1NJYA 1NSAA 2XEXA 3FQLA 3M8QA 3SXLA 5C7PA 2Y9HA 2EFVA 2QX0A 2QO3A 2RAQA 2Y1LB 1WKJA 2JVRA 2WVEA 2HZCA 3BSAA 3GCXP 3GG1A 3QSIA 1ZM2A 3TUIC 4X64J 1NK5A 4MYUA 2CJAA 4LF4F 4GC6A 2YKNB 4Z7CA 5DQGA 2JFKA 3LPEA 1X4CA 1VQSA 2YX1A 1H2UX 1SC6A 2KXHA 1HHQA 1SH2A 3DGPA 4PG8A 2NCKL 4DR4J 1AT1B 3BO3A 2C1EB 4ZPWR 1NJZA 1S6QA 1FKPA 1H73A 1J5OB 2QEXS 2YNGA 2EFQA 2IM1A 5BYSA 5KFPA 5KT5A 4DUYF 4LFAJ 4E98A 1LW0B 4K8RA 1CS4A 3IO1A 2BOPA 2W4CA 1KC8T 2BE7D 2VPWB 3TUJC 4HH0A 4NXMF 2HMIA 3C6UB 1BMQB 2LQBA 5DJBA 3NNCA 3PX0A 5KFRA 2M8DB 3D1QA 3DCAA 4DR7J 2OEJA 4JI1J 3T5KA 1V9OA 3NGRA 4IH5A 1QM9A 1IR2A 2R2UA 4ITSA 2RRNA 4KYZA 4LF5J 3BR9A 1NK0A 4ICLB 1O6XA 1OJ4A 2CG8A 3RTVA 1B64A 1Q1KA 2B8PA 4A47A 5FD1A 1DLOB 1RWUA 3VV2B 2ERRA 2XYHB 4KSEB 2QMWA 2EKYA 2RD5C 1HBOB 1WOOA 4BDPA 3H90A 1UETA 3OFHA 4LVNP 4NLYA 4NLWA 2DGTA 4LRCA 5KT6A 1FNMA 5GAHU 2ZITA 2D3OR 2NZ4A 4ZCMA 4OYIA 2CPXA 3KJFB 2KFZA 5HANA 2ZJRQ 4X4OA 1B0PA 2QT7A 3W7BA 2AYMA 2OELA 2LLZA 2QL9B 4HI2A 4RPFA 3ZTPA 3PX4A 5KFTA 1KSPA 5CYMA 3C6TA 2B4PA 2BE2B 1JQGA 2C2KB 2DNMA 2OD4A 2YVSA 3GB0A 4YY3F 1SKRA 2W24A 3CD6S 2CVIA 1R8HA 1NSPA 5KT4A 3MMAB 2GZOA 3QT6A 5JMNA 4EZ9A 4HHHA 1RTHB 4HT7A 4GC7A 2RIJA 3IG1A 3K89A 4AD6A 4X4RA 3CCSS 2FYXA 2VKRA 2MQ8A 4LR8A 4DUYJ 3OHAA 5KFVA 1M5SA 1MWYA 1EP4A 3EYZA 2ZHOA 1WHYA 3IA0A 3QQCD 4OZJA 1NK6A 1U1RA 1FESA 1FNXH 3CIZA 4ZVTB 1BQMA 2RU9A 4YDDB 2ZD1A 4NA1A 3PKYA 3CJSA 1SL2A 1TKTB 3HFVA 1PAEX 4M5MA 1VBKA 3QMQA 3K5MA 3JYTA 5FJ4A 4B3SF 3BGFA 3MWBA 4CM2A 3ILJA 3VAMA 3OBIA 1TKZB 3NG8A 5FDLA 1R6VA 1U8SA 1Y4ZB 1VOMA 1Y0HA 2E1MC 3ENQA 4M5KA 3FEYB 2R9LA 4QOTA 1WWHA 3DOKA 1Q0NA 2L9WA 3DRYA 1IWAA 3MDFA 2UUWA 3R5JB 4QW8A 1E6YA 2YH0A 3ZXWA 3JAMY 4JI2J 4LSNB 1NKCA 4PZVA 5D0GA 3M8PB 3AT1B 3OUYB 5I3UA 4YEAA 4FF2A 2KYZA 3H59A 3GPAA 2L9NA 1A6LA 3DHWC 3DRPB 1DHMA 2KJWA 1ELOA 2KT2A 3P5BP 5LMNF 3CJ3A 3K8VA 2OKQA 1Q16B 1FJCA 2HGNA 3BSCA 5F8JA 5A6PA 1HL6A 1I94F 3V81B 2ZM6J 4YFUA 4KHRA 1S1WB 3HVTA 1HWJA 1Z2ZA 1C1CA 2MZSA 2R42A 4HR2A 2QYGA 3QT5A 4KBIA 2AZ3A 2AF6A 2Q79A 1G4CA 1FD2A 4BCAA 3JSYA 2DH8A 4PG7A 1WDDA 3PX6A 3T41A 2XWXA 2AJ4A 2VBXA 3A8KA 2YBVA 3R27A 4I64A 1T11A 1UTAA 2FQQB 4YDXA 4PUOB 3D9BA 2HS4A 3M8SA 1VIOA 3G86A 1HWLA 3VGSA 3THVA 4NE9C 2HQGA 2CJQA 4LBIA 1RT6A 4V1Ak 3W66A 7FD1A 3CJ4A 2G2ZA 4LF5F 2XQCA 3UCZP 2CVEA 3NMRA 5LXYA 1UVJA 2R7TA 1WHXA 5IV4A 2ZBRA 1SV5A 2GC8A 3CCZA 3M8WA 4F0KA 2X7IA 5IS2A 1WG1A 5J2PB 4LJMA 5D77A 1OPIA 1FERA 5MAOA 2B56A 2HNDB 3GYXB 4CQ1A 4ID5A 4QYRA 2A3JA 2E9RX 1A9NB 2NS1B 2M8HA 2HQIA 3DN9A 2DNQA 1RBAA 1TL3A 3IBWA 1M90T 4RUAA 1ZTWA 4DQPA 2HIQA 5E5NA 5KFFA 5DZ6A 1HNXJ 1MSWD 4ZVGA 5DETA 1M1HA 4TKTA 3EGNA 4AFFA 4F25A 3PO5A 3FRYA 1DY3A 3C14B 3DRRA 3EE3A 3MTKA 4OJHA 4B08A 1VQYA 4WTOB 2CUYA 5HL7Q 1UMJA 4DPWA 5C5JA 2ZH1A 2XNRA 5DDQC 4LF7F 2XM3A 3CC2S 3MMCB 4C2MA 2QIFA 4CLTA 4LBHA 1SJQA 2N7YA 2OPQA 1YRTA 1U1PA 2VPYB 3CUNA 3EGZA 2AX1A 1KVJA 5T7LA 2HNYB 2OD6A 2APOA 4ZPDA 2GJ2A 1CJKB 1VQPS 2E5LJ 2FJEB 3IXQA 2XMVA 3I0RA 4OJ1A 4EU0A 1TKDA 1ICEB 4IRCA 4L3NA 2FZKB 4DQSA 2E9ZA 3G87A 1YX2A 4DMZA 2AT1B 1Z1ZA 3T1HJ 1U1NA 2RQKA 1XMQJ 2FVQA 3I4HX 2CWKA 4KGVB 4Z7YA 3JSBA 2C2EA 5B7WA 2W7OA 4J9LA 4DR7F 4RUBA 3M30B 4WE1B 4O3RA 2BX6A 2NPFA 4IKAA 5DRKA 1BY9A 4B9MA 1VYAA 2JL9A 2X1GA 5KT3A 1HNVB 1RA7A 5AJ3F 1RT3A 2IJRA 2YKMA 1N88A 2YNIB 2E5GA 4ZPBA 5D0EA 1BUXA 2J8SA 4B9UA 3NS6A 3PDNA 4WFAQ 2XMUA 3FDSA 4XDDA 4DU7A 1YJUA 2XMTA 4CI0B 3VAGA 4YS2A 1XBWA 2FGCA 3DM2A 2OI2A 3GJTB 1RT7B 3LALA 2DR6A 4O3NA 4ED0A 1S76D 4WK1A 2R4FA 2Z30B 4UZCA 1Y10A 2MZJA 4RW7B 4YMEA 3RRHA 3I9V9 4X62F 2DXFA 1X4DA 1KONA 1F5BA 4RUCA 3GLJA 1D9FA 4B9TA 3OSNA 2IAJA 4UTGA 4IG0B 4QR0A 1FDBA 1LK7A 3LP0A 1RTDA 1I1GA 3UQSA 3UDVA 5A8KA 1IBMJ 2ZC3A 3BZQA 3W1YC 3ETOA 4YOEA 2OPSA 1JLAA 4X4QA 1CG2A 4OLPA 2QG9B 1T9TA 5F8GA 3LAMA 4P7VA 1UZHA 3OLAA 3M32A 1GMUA 4Q2LA 3UN2A 2NPIA 3UCUP 2ZH9A 3GMGA 1VIXA 3AXKA 3LQVA 4URQU 3CMES 1R3NA 2HZVA 2EWHA 4AXIA 1T8EA 2Q6BA 1BQNA 4URGA 3KHHA 4WBFA 3CCJS 1JMTA 2K7KA 4E2FB 4EZ6A 1NAQA 2CPZA 3PRVA 1UP1A 4J9SA 2AGPA 3RR8A 4JI4J 1Q8KA 4F02A 1KBRA 1YITS 3NBPA 5D78A 4JI0J 2RDIA 1VJWA 5IXUA 3R2DJ 1C1BA 1RHUB 2BZ2A 5F8LA 3DGVA 3UD4P 1B7FA 4I56A 4M5LA 2NQPA 2B7BB 2OO4A 1UA0A 2HQCA 3OR1A 1HMVB 2BJEA 1Y11A 3FBFA 3G6VA 4ECWA 1ZPWX 3JQJA 4ECQA 1Q81T 3SCJE 3BN4A 4M5NA 1LFPA 3UPFA 1N0UA 5T41A 3PIOQ 4Z2XA 1UWAA 1T0TV 4LSLA 5ETVA 2K1RA 1RWXB 4MIAA 3GIRA 2BRLA 3BN7A 1RACB 1VGYA 4ILMA 3MUTP 1XC9A 1HNWJ 3BR8A 2CNKB 4B3OB 2EKNA 4J9OA 1SIZA 1Q8BA 5CZXA 3NMAA 1V3ZA 1GNKA 5KFLA 3ET6A 1B4SA 3D0IE 1W2IA 2E1PA 4WWSA 5HN0A 3HVRA 3G82A 4OYWA 5HROB 3CDEA 5A0YB 3CDAA 3T1HF 1RDRA 4O44B 5EX0A 3TEGA 2XSJA 2MQPA 1GMWA 2BRKA 4ZJQA 3Q8SB 1GTEA 3JAMU 4KO0B 5KFDA 3KG1A 4QR2A 2LEAA 3AHPA 2KI2A 3MEGB 5L8RC 3D1OA 3KTQA 3CJ0A 4F4KA 3LWMA 2H4YB 2XLKA 3OSPA 2LKZA 3DI6B 1MMLA 2GMHA 3KJNB 5D15A 5LL6d 1S7HA 3CWJA 5LJ3Y 2DH7A 3JSMA 4J9PA 3EM1A 3FSXA 3R2CJ 3CNQP 4J9KA 4Q5VA 3J81Y 4A8QA 5DGAA 2W4PA 3V4MA 4X4TA 2XO6A 1U4BA 4DOZA 4E8UA 1HBUA 5F8HA 1D09B 4USUA 2DBBA 4ZVPB 4AL5A 1Y7PA 1JLCA 4JB8B 4KKOA 4M1KA 4RW6A 4TY8B 4C8NA 4ZK7M 3PW2A 1NJIT 1UVMA 3BV8A 3PG9A 4J5OA 2HK2A 2MKYA 5CAAA 3AOAA 2W9CB 4YUDA 3VTIA 1GMVA 4C0HA 2YWFA 4IO1A 2I2YA 2ZVIA 2GS8A 4JI5F 2HQFA 1JLEB 4F7VA 4ED3A 1RYSA 1FA0A 4F0HA 2J76E 3Q89A 3PEJA 1KQKA 1HNZJ 4N8NA 1HWKA 2PA8D 4NASA 3MPYA 2VPXB 4L74A 5HQ8A 4DSFA 5B0DA 1C2PA 3U7JA 1FWPA 3PYEA 1KVIA 3M8YA 3UFCX 1R8AA 2ZWOA 3SFUA 1SXLA 4ECZA 2OFGX 5CQGA 3QT8A 4DX8H 4H4OB 5K5MA 1YSJA 4QIWD 3K5OA 4F0MA 3EJMA 1HW8A 5D0RA 4WFBQ 1JLBA 1T03B 1HHTP 1U6BA 3TZWA 2XS7A 2AP6A 2I5JB 2JLEA 2KDOA 4MMOA 3RAQA 1SJFA 1IKXA 4RW9A 2Y1IA 2M52A 5D3GB 4RBTA 2D69A 5IWAJ 4DV7J 3ZO7A 1R0BG 2FC8A 2JHEA 3UN3A 5J1EA 1C0TB 2QLFB 2PT0A 2R7QA 4GO7X 3S8SA 2HHUA 2HRUA 2X51A 2RF2B 1VQ5S 4GVBB 1R27B 5EDWA 3H4DA 3I55S 1VQ4S 5F3ZA 1FJGJ 4ZCIA 3CW2C 1W2BR 2DHSA 1KFDA 4ZJLA 2UU9J 1B0TA 1S6OA 4OX9J 2Y3YA 4HTIA 5LMNJ 2UUBJ 2P9CA 4FF1A 1HQUB 2NXUA 5BYQA 1U26A 3M1VA 1RCOB 1K73T 2CQGA 5DG7A 1F2HA 1V3SA 2KVQE 2OPPA 3ILLA 4WP3A 2HFZA 4ZVOB 5HQLA 1VC0A 1URNA 5EN1A 2P6TA 4ID8A 1TK0A 3W9HA 2MLZA 2YKOA 1X8DA 1RB0A 2W2NP 3T5LA 1JB0C 4TN2A 3VVUA 4XTTA 1XK8A 4NZ0A 2ZJQQ 4CT8A 1FKOB 1SBRA 2VG7B 2JEGA 1ZZNA 3VALA 3RB4A 4PXCA 3MTJA 1Q5VA 2ZBPA 2DJWA 1OQ6A 2X3GA 3R6GB 1D8YA 1IBKF 2BQRA 4QCLA 4CLSA 3RZAA 4A8FA 1XWLA 2A1BA 2KU7A 1NSQA 1PO6A 2XO7A 1OWXA 4K5SA 4WIIA 4PYDA 1U02A 3WZ0A 4NCAA 5J2NB 3ENAA 3H42A 2FZCB 1S9EA 4KH1B 1S6PA 2CZ4A 2NREA 4J90A 3TARA 3NGKA 1GMWD 1T9VA 1MU2B 3QO9A 4MYTA 1ZTTA 3K5NA 2CZ9A 3BGUA 3P45B 3ISZA 4ZVEA 2A6MA 2I8EA 2XSFA 3DFEA 3HULA 4CP5A 2VA2A 1WC6A 3MAQA 2ZH7A 2G4BA 3OTEA 1BWVA 1O8BA 1RZMA 1VRTA 4DJBA 4DL3A 4X66J
chains in the Genus database with same CATH topology
4Q8FA 2HG4A 2MZQA 1XEZA 3BQ1A 2GCFA 1EETA 4GMKA 2E44A 3UR3C 2LECA 2LA4A 3KWMA 2QZ8A 2EW9A 4CH0S 2E1AA 2LDYA 1Q82T 4UY8T 4LUBA 4C8KA 1DAXA 4A8MP 2V9KA 1TVRB 1UFWA 4WYLA 3VAFA 2DO0A 3W2VB 1T02A 3D5MA 3ZZTA 1CQMA 5E2QA 1HWIA 4AL6A 3PKMA 4MK8A 1T95A 2FHJD 2JLFA 5KFGA 5HI7A 2WW8A 4RBVA 4OL8A 4C97A 3SV4A 1QJHA 5B08A 1V3RA 1N5TA 4HEA9 3HHNB 2HHHF 2MHNA 3W3SA 2RUGA 3GIJA 2J9EA 3EUNA 5BYRA 3K57A 1IKWA 1TFWA 1BD6A 3TAMB 3D2WA 2JJ4D 1IKYA 5G0RB 3M8QB 2FHMA 3CCLS 5T14A 4UOCA 3KJVA 2V4JA 2RE1A 1LWCB 2FC9A 1FHTA 2AJ0A 5MLCV 4WFNQ 5HMXA 2WAQD 4K4YA 1UKUA 2KFNA 2CIMA 1HFEL 2DD8S 4B3RF 2XCPA 2HW3A 2ZNZA 2R7SA 2GIQA 1FKPB 4DEZA 1J5OA 5GAEI 3GIIA 3POTB 2YNGB 3MECB 4IQXA 2P9GA 2YKQA 1TAQA 1C0UA 3HJFA 3HX9A 5AXMA 2F7VA 2G1DA 3NWGA 4QR1A 4NLQA 1IBMF 4PG5A 3KK1B 3E51A 4KB7A 4JI3F 3NCQA 4C3LA 5KFJA 1R7IA 2XG8A 3C6UA 2OTLS 3S6EA 2FUG9 3TANA 4C0OC 1JNZB 2W7PA 1DZ5A 4F4XA 1YTYA 3E3XA 3LO3A 3P96A 1NJXA 3IGNA 3J7A1 2IM2A 4A8YA 4G3IA 4R8UA 1U25A 1KHVA 2PI4A 4ICLA 3K5LA 1OSDA 5IQQA 2X1FA 5IWAF 4DV7F 1DLOA 3R1LA 4Q2MA 2BANA 1L3KA 2ROPA 3PRDA 4ECTA 1KLMA 3PJXA 1HBOA 5H9FJ 1VBZA 3QAUA 3SSRA 1VI7A 2C3OA 1K0TA 1TV6B 4X4PA 4IFYB 2EK6A 5KFYA 4AQYF 5C25A 4UUWA 1L3UA 3LWLA 2CYYA 2NLWA 4F4YA 2DRBA 5GADU 1WG5A 1X4HA 4NL5A 2Z2LA 4FZVA 1HBMA 5K14B 1MWZA 3D0HE 4X65F 3C6TB 3FEXB 3OTDA 2FJXA 4NOHA 4PWDB 4BS2A 3AAWB 3VQSA 4IRDA 3NP5A 4H4MB 1UJ6A 3MMAA 4KE5A 5KFOA 1U1MA 2IJNA 2VONA 4I1TA 4AYBD 3BSNA 3MD1A 1TFYA 1R43A 1GT8A 4C98A 3HLUA 4N47A 2ZOFA 4P7TA 1N33F 3R5DA 1BQMB 3DDKA 2EFNA 3FNNA 3K8WA 3MM8A 1TKTA 2DR7A 3HFKA 3IR7B 4OQJA 4NZ6A 2DGVA 3FGVA 4NLOA 3UD3P 4C8ZA 2YX4A 3W2WB 2QFJA 2BDPA 1C4AA 2MPUA 2FHOB 3Q22A 4I2PB 4RW4B 4RNMA 3CXCR 3GV8B 3DOKB 3TI0A 2DGQA 2KJVA 1SUQB 3VCDA 4BC9A 1N5SA 2GA7A 1PSDA 3M8PA 4QPTA 1FEHA 1QSYA 3U1NA 3OUYA 4QWDA 1U09A 2M0GB 3D1HA 3FJ2A 3LAKA 4FP9A 4PG4A 2XULA 2V0NA 3TOQA 4XPCA 4NLTA 4A8KA 1XN9A 2C42A 5KFBA 1SKWA 2ILYA 4C9DA 3DLGA 3RB3A 1HBNB 3HVTB 2R7RA 1HNWF 3Q0AA 4H4KA 5D8HB 1D9DA 2RDJA 4Q0BB 4OV1A 3AJ1A 5C24A 5L1LA 4KC5A 4PUOA 2GGPA 1FDDA 1S99A 2DNGA 3AY0A 1P9QC 2BV3A 3THPA 3MM9A 4B9NA 4RNFA 4C4WA 2IVFB 3QJPA 3QLHB 4YR3A 2BABA 1TUVA 2MKSA 2NSBA 3M2RA 4ED6A 2EVZA 4X4UA 1CLFA 3IRXB 1E6VA 3UE2A 3BGRA 2QYCA 4OI4A 5J2PA 1S6UA 2OSQA 2VUGA 2JVOA 2HNDA 2LEPA 4NLVA 4EFAC 2W7AA 2E7WA 4ID5B 5CYQA 1K1SA 1S97A 4CH1A 1X4FA 2E29A 3NNAA 5M2UA 3N6MA 1TL3B 4ES2A 2XWYA 1D3WA 5E33A 3GV5B 1T3NA 5FIIA 2XS2A 4RBUA 3N0VA 4UW2A 2BR0A 4F8RA 3ZZOA 4RNNA 5KG0A 1S1UB 1X9WA 3K0JA 5E3CA 5LMUF 2Y1RI 4ELUA 2R8IA 3Q24A 1H7XA 4QU7A 3N6NA 4G1PA 4OLOA 4BHQA 4DL0C 3MMCA 3N01A 5AE3A 2OPQB 3I4PA 4PR6A 5T7LB 4LIRA 1W25A 4ZP7A 1LKZA 2MKCA 2RJZA 4QIEA 4X84A 1WEZA 2DB1A 1P6TA 1TKXB 2BXJA 3DXBA 1QVFR 4K4SA 2OFHX 3T1AA 2HWHA 2LXUA 3N79A 2CQ1A 5A8RB 2R8HA 4K4WA 4DFMA 2UVVA 5F9NA 1VC6A 2E1CA 2PA3A 2ZH3A 2C2DA 4O4GA 1VS3A 5E7OB 1HNVA 1B0VA 4OHWA 2FLPA 2LQJA 1TP7A 1LW2A 3K58A 5KT7A 2BYCA 1NKBA 1RA6A 2YWGA 2FJDB 4KT0C 3DM2B 4F2RA 3ZZRA 4BBYA 3Q8QB 1G1XA 1FF2A 1X0PA 2MDAA 4ED8A 2IAJB 4CTAB 4IG0A 3OFGA 3I5AA 3V6DA 4JV5F 5SUHA 4U6PA 1H38A 3LP0B 5BJRA 1RTDB 2YX7A 3QWPA 3CF5Q 2CPEA 2HNZB 2WHOA 2FJWA 1JLAB 2RQMA 1OSCA 3N5FA 2CG4A 2R2SA 2B7CB 2M7SA 2YH1A 4JYAF 3OVBA 3M32B 2IBKA 3UNGC 3NNHA 2W8LA 4IR9A 2DGWA 4URSA 5THWA 4IRKA 1QY7A 3MURP 2WSEC 2DNHA 3P3DA 4ZP9A 3CULA 1BQNB 5FLXY 1TL4A 2PI5A 1K9MT 1U2RA 5HMWA 2KKHA 1FRJA 3TX8A 4A8OA 2GHPA 3NBPB 4ZP6A 5EX3A 5KFNA 3OLBA 3KMSA 2KFYA 2XI3A 5L1KA 1S1XA 1YG0A 2XHWA 3PHEA 4NYPA 2XGPA 1YI2S 1URRA 1Q7YT 1NB7A 3QGIA 1M5OC 3RR7A 2AX0A 4EBDA 4F50A 3HHDA 3OR1B 4F4ZA 4Q43A 1HMVA 3DRSA 3TRGA 5C42B 5I3PA 2IA6A 3BDPA 4FVMA 4YQWA 2VG5A 4IFVB 4P2SA 3QZ8A 1RTIB 4XIUA 1AFJA 2K1RB 3EGWB 5GVQA 3DU5A 2H9ZA 2MKJA 4FS1A 2VBYA 5KFEA 2ZZNA 3AA8A 4NX9A 2LVWA 5DG8A 2PN6A 2MJNA 3E01B 4R0EA 4AXJA 3VAKA 2JC0A 4WYWA 1FJEB 2V8DA 3UW1A 3IWLA 3I82A 4RLEA 2VV5A 2XGQA 4O44A 3EZUA 1HR0F 2N3OA 2XSJB 1N6QB 3FFIA 1VQOS 3HHLD 4EBCA 2DNNA 3O5TB 4I7FB 4CO5A 4Z37A 3PW0A 4B02A 3BGLA 3M2UA 4DN9A 4C8MA 1FDAA 1N0VC 4QWEA 1SJ1A 3H5YA 5L9NA 4NMLA 4C3MA 2XLJA 4ELTA 2UUAF 3GR1A 1U6ZA 2IBOA 4NLSA 4KFBA 2ZOGA 3K7RA 2D9OA 4OHXA 3MR3A 1Q86T 1Q7LB 1HBUB 3IFEA 3LH2S 1JLCB 2WTFA 2O5DA 2FIUA 4EO8A 5AE2A 2ZM6F 1KQGB 2J9DE 1FTRA 3CD5A 4IOBA 4WZQA 3CEDA 1JLEA 2ADCA 1UFLA 1Y5IB 2K8GA 2B4UA 5K8PA 3DLJA 5L39A 3I9ZA 2VB6A 2E7XA 2HAIA 2I0XA 5KFMA 4KTQA 1NU4A 2DNYA 1ZAWA 3GG0A 1T03A 1N56A 1JLBB 3BB5A 3OVAA 2I5JA 1KEKA 3KK2A 2VBZA 4DL7A 4X4VA 4RW9B 4LQ9A 1PGZA 2WBRA 4TLQA 4UUXA 1XMOF 2L3MA 5J1EB 2VOPA 2MQLA 3FRZA 2RF2A 3IR6B 3C2PA 5K8MA 1N54B 2M2BA 5F8IA 4Y2AA 4ZCKA 4G1QA 1K8AT 5KFQA 1HQUA 1Q53A 1S0NA 3M1VB 3TAPA 2GJIA 1WG4A 3OTOF 1YWXA 3MMBB 5JUMA 4OMFG 2DR9A 3I6PA 4DN0A 1TQLA 2R8JA 4X4NA 1UVKA 4DPOA 3MR6A 3MM7A 2M4MA 1N8RT 3M2VA 4WU3A 4A8XA 5A2QY 4K4TA 4K4VA 2VA3A 1VC5A 2F4VF 3MZIA 3TUZC 4K5RA 5KG3A 3LANA 2R7VA 2VFTA 3DOLA 4WFXA 2ALZA 2YTCA 5LT5A 4NCGA 3HF5A 1S9EB 4MKBA 1D1UA 3OPKA 2DVIA 3CTRA 1MU2A 3QO9B 2DISA 4NRTA 4DR4F 1P1TA 2HVHA 2KZZA 1Z2LA 1KR4A 4FBUA 1JLQB 4ILLA 2DR5A 1D0EA 2AJQA 1WTFA 3KG0A 4PXBA 1F5AA 4OHYA 3GFXA 2U2FA 4DR1F 1AFIA 1QE1A 4OI0A 4WCEQ 4I0WA 1YHQS 2ZE2B 4ZOSA 1UEVA 4NA3A 1DQ8A 1TVRA 5GMKa 1N32F 4KJIA 4HVZA 1HHSA 1PC4A 2HLTA 2E5LF 2M9KA 4H54A 1XMBA 5KAKA 4QWBA 2JH3A 5I3QA 3KLIB 2VQEF 2ZJPQ 1SQEA 2FHKA 1DTQB 5CHCB 1NO8A 2KYXA 3BREA 2C3UA 2CPDA 2X1AA 3CJKA 1SIWB 3ISNC 2AGOA 4TQRA 6FDRA 3O44A 2HHTA 1VQNS 1GQEA 4MIBA 1U45A 3NAIA 1WNEA 3GFHA 4IG3B 4UQGA 3TAMA 2IYGA 3KLHA 1YJNS 1T05B 3QAEA 1S1TB 1M5KC 4H4KC 1HNXF 3KJVB 2E5IA 2KN4A 3L7OA 4ZA1A 2V4JB 3I5CA 1LWCA 3ZZYA 5E0OA 1VK8A 1FRHA 4B9SA 2B4VA 2HGLA 2IHR1 5LJ5Y 2B0GA 4F67A 2XMWA 2JSXA 2F1FA 5IZHA 2HRYA 2N4DA 1S9GA 1JLGB 2GMJA 5KG4A 4KPYA 3POTA 2CQ0A 3MECA 4RW8A 2BJDA 1C0UB 4NLUA 2GQQA 2BACA 1FRIA 1MROA 3HVAA 4TYAA 2DNOA 3KK1A 2W9BA 4C8LA 2P5VA 1YJWS 4EUVA 3VR1A 1F5CA 4M8LA 3MEEB 5J2MB 4HT5A 4QYZJ 4CO1A 3CPWR 1RGVA 1C4CA 2WOMA 5IT0A 1KD1T 2CQHA 2HFNA 3GR0A 1WEXA 2MB0B 4DSIA 3FQKA 1SH3A 1FJ7A 1KOOA 4R8UB 2PMZD 5CD4H 5U47A 1S0OA 2CQ4A 1N36F 4OX7A 2DGSA 4DFPA 3I5BA 2AYEA 2BANB 3SEOA 3PV8A 1XERA 5KFZA 1KLMB 2E5HA 3JSRA 4C3KA 5LSLA 3I32A 5L1IA 4NLGA 1UEUA 2YY3A 4X2BA 2I38A 1TV6A 4ZS6A 4IFYA 3U1MA 5C25B 3I87A 2K3KA 2WB4A 1JLFA 4DSEA 3X1LB 3D54A 5E3PA 1HBMB 2IM0A 4F3MA 3AJ2A 2UXCF 1TL5A 5K14A 1VQ9S 4ALZA 5LSOA 4L72B 3T6BA 3CCRS 4DG1B 4H4MA 2LQ9A 4ES1A 2HYIB 3F44A 1FXDA 2EI5A 1YJTA 4U67Q 1NHVA 2O66A 1BWEA 3SCIE 4QIGA 2BA9A 4IDKB 1LWFA 3CD0A 2RMLA 2E5JA 4FXDA 3SDEB 3MM8B 3HHLB 4OZLA 4YHHF 3DU6A 4N76A 5I4MA 3W2WA 3HM9A 4HHJA 4ECVA 2KHCA 3RAMA 3KG4A 4I67A 2F8HA 1RT5A 2L9DA 3MAHA 7FDRA 2ZBIA 1R0AA 4ZKAA 1U47A 1JX4A 4I2PA 4RW4A 2KTQA 3T9ZA 1F2GA 4WTYA 2M3DA 1IJFB 2NR0A 1AROP 2ZH6A 1SUQA 1NZAA 3TP2A 3J7ZT 4TQSA 2L41A 3SCKE 3EXYA 3M6VA 3QIPA 2EPIA 3HKZD 4ZCLA 1U49A 3DLEB 2RNEA 1S1VB 5EWEA 3EPIA 2LYVA 4ED7A 3PW7A 3F41A 3BDEA 2WONA 4ETZA 4ETXA 2XLIA 4DV2F 2O67A 3ZZPA 1BGXT 4F26A 3DLGB 2F8EX 3KHGA 1HBNA 3RRKA 3LP1B 5J1NA 4Q0BA 3B82A 4YP3A 3RB6A 5C24B 4DLEA 2PEHA 3PO4A 4PKDB 1RT1B 2JOQA 2GGPB 5L9XA 3GE9A 3HHLC 3H5UA 2ASJA 2D9PA 2QSFA 3MM9B 1XR5A 1FDNA 3QLHA 4HL9A 5CXTA 3M2RB 3DYAB 3CCUS 4ZPVR 3OXLA 3IRXA 4MKAA 3PR5B 3LPYA 1WACA 1E6VB 4A8WA 1L3TA 3BGRB 5H1SV 2UXDF 4IH7A 1MNEA 3G6YA 4N5SA 3I96A 2VASA 5B0BA 3VAJA 2KXNB 3T6JA 5F8NA 1U2FA 2NSCA 5CYQB 2KHDA 4ZPTR 2JWNA 4K4XA 3M6XA 5KG5A 1Y00A 5HLFA 4DV6F 2VD3A 1PILA 2HLUA 4HDHA 2OH2A 4HH1A 4Y2CA 2RRAA 3DLKA 1VK3A 2HHSA 1S1UA 1X4EA 4KHMA 3RB0A 2KG1A 1IQTA 1LQ9A 5F41A 2F9JA 3KKFA 4EYIB 3V2UC 2MZ1A 2B9WA 2CJ9A 3VF0B 4ZVHA 2F9DA 5IT4A 4K4UA 3IS9B 2DIUA 2MYFA 2IRUA 4R5PA 2UZAA 1HNZF 2G9OA 4DR3F 2LU1A 4PRFA 1LFWA 1TAUA 2I1RA 3C46A 5AE1A 1CSJA 2KXFA 5GAEU 4B17A 3G4SS 4IOAQ 5GAGI 1TKXA 3B78A 2UUCF 3FVYA 3DDNA 2CQBA 4O23A 3O8WA 5A8RA 1R89A 4AUKA 2B9XA 3EPGA 2J8AA 5B0EA 2CDQA 2VFRA 3T1YF 4O4GB 1HD1A 2CPFA 4O3OA 1SL1A 5A6WA 4LIWA 4MFBA 4BWJA 1LW2B 5F9LA 2FPHX 2DPIA 3EZ5A 1UVIA 3FZBA 1ZM3A 3UDLA 4BC7A 1ULRA 2ZOMA 3QZ7A 3F56A 2AWZA 2DCUB 1HYSB 1H98A