4DUYI

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 26
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4duyI00
3J7AG 2V2QA 2BV3A 2DEIA 3WU6A 4B3RI 4GKJI 4UTGA 1KTVA 1N34E 2BM1A 1HNZE 3WU3A 4X62I 1KVKA 3H4LA 4KHPI 2UUCI 2X7IA 2HFUA 4X64I 1MG7A 4DPWA 4B3RE 4PU9A 4USMA 2UUBE 1BKNA 3B8HA 3ZZ0A 4X62E 1EA6A 4MYUA 4KHPE 1IBKI 2UUCE 4AQYE 4JI2I 3T1HI 4DV6I 2BM0A 3F0NA 4DV3E 1EI1A 4DUZI 4GKKI 1N32E 1HR0I 4WUBA 4JI2E 4LF8I 4YHHE 4PRXA 3T1HE 4DV6E 4JI5E 3QT8A 1ZM2A 4DUZE 4GKKE 2Q2EB 4DR3I 2ZM6I 2HKJA 2VF3A 2HK2A 1H73A 1MX0A 4Z7CA 5FLXC 4DPUA 4LF8E 4DV4I 2UXCI 4JI0I 1A6FA 1XNQE 3V2UC 3GONA 1N36I 1DARA 1XMQI 3LTOA 1Z5CA 4JI4I 4DV1I 4DR3E 2ZM6E 4LF6I 3LPSA 4NXMI 4JI0E 4HYMA 4XTJA 5IT9C 3J81Q 2UU9I 1XMQE 3PYEA 2UUAE 1QZRA 1N34I 4JI4E 4LF4I 1D6TA 4DR5I 2GS8A 3J80C 1Z0VA 4B3TE 4DV7I 4LF6E 4JI1E 4OX9I 4NXME 3PYGA 1OJ4A 3B82A 4DR6I 2UU9E 4PRVA 4X66I 2V2ZA 5LL6R 1FKAE 2UUBI 4LF4E 3ZKBA 5LMNE 4DR5E 1S16A 2UXBE 1Z0BA 4DV7E 4B3SI 4OX9E 4AQYI 4KQVA 4LFBI 1B62A 1Z5BA 1I94I 4DR6E 1PIEA 4DR1I 4EMDA 4X66E 3Q1QA 5LMUI 4DV3I 4NXNI 4DPXA 1FJGE 2E5LI 2A2CA 1J5EE 4B3SE 4HXZA 2R42A 2E1RA 1NZ0A 1HNXE 5IWAI 4LFBE 4FW9A 1N32I 1XMOI 3JAMQ 1ELOA 4YHHI 3J7AM 1I94E 3CWVA 4JI8I 4DR1E 4JI5I 3PYDA 5LMUE 4NXNE 1FWLA 4DR4I 2VQEI 2E5LE 3OTOI 2EFGA 5IWAE 1H7SA 2OI2A 1XMOE 4JI7E 1XNQI 4JI8E 4HY1A 4LFCI 4ED4A 4DR7I 4JG4A 2AJ4A 1ZXMA 4DR4E 2VQEE 3ZZTA 2A2DA 4R1FA 2ZITA 4YY3I 3OTOE 2VQFI 4HACB 1ZM3A 4LFCE 1Z0CA 4DR7E 2UUAI 4K0KI 4B3TI 5A2QC 4YY3E 4JI1I 2VQFE 1MU5A 4DPTA 3HULA 2V8PA 4X65I 1VISA 2F4VE 1Z0WA 2HFSA 4K0KE 5LMNI 2UXBI 3T1YE 2ZBKB 1H72C 1FNMA 4JYAE 3D4JA 5FLXQ 1K47A 4MYTA 5BR8I 4USKA 4FWDA 4X65E 4ZVIA 4DUYE 4P7AA 4P52A 2V34A 2WW4A 1FJGI 4FWHA 1J5EI 4HACA 1HNXI 5BR8E 4DV0E 2LJPA 4LF7I 1N0VC 2HHHE 1NHJA 5IT9Q 4LF9I 1N0UA 1KIJA 1RREA 3B78A 1WUUA 2CZ9A 1NHIA 4B3MI 4Z7YA 4JV5I 3J80Q 3QT7A 4DR2E 1KKHA 1IBLI 4JI7I 4WUDA 2HK3A 4LF7E 1H7UA 1Z59A 4LF9E 4M1KA 4JI6I 1HNWI 4GKJE 2UXDI 4B3ME 4JV5E 3WU5A 2J7KA 1FI4A 4LF5I 1Z0EA 3WU4A 3M6AA 1ZXNA 1IBLE 4X64E 4RPFA 1ZM4A 4DV2I 4JI6E 1HNWE 1FWKA 2UXDE 3K17A 4LF5E 2X36A 1IBKE 1NHHA 1N33I 3QT5A 3K1JA 4DPYA 5L3JA 4WUCA 1IBMI 4DV2E 4I3HA 3J81C 2F4VI 3PYFA 4DV5I 4FN5A 3LNUA 4UT4A 4JI3I 3T1YI 1B63A 2HKEA 2V2VA 4JYAI 1Z5AA 1N33E 2DEJA 1XNRI 1HR0E 1XHKA 3ZZUA 3ZKDA 1U2RA 1IBME 3V5RA 4DUYI 2R3VA 1Z0TA 4DXLA 1PVGA 4DV5E 4JI3E 5GMDA 2XEXA 1S4EA 1RR9A 3ZM7A 1XNRE 4DV0I 4DV4E 2UXCE 5GMEA 4LFAI 2HHHI 1N36E 4DU8A 4FWGA 4DV1E 1PKPA 1H74A 1HNZI 3QT6A 1UEKA 5A2QQ 4URLA 4DR2I 2NPFA 1Z0GA 1ZM9A 4DU7A 3JAMC 4LFAE
chains in the Genus database with same CATH superfamily
3J7AG 4IFDE 1R6LA 2V2QA 2BV3A 1Y4UA 2JT2A 2DEIA 3WU6A 4B3RI 4GKJI 4UTGA 1KTVA 3PRYA 4FW5A 1N34E 2BM1A 1HNZE 3WU3A 4X62I 2IOPA 5JEAC 1KVKA 2PO2A 3H4LA 4KHPI 2UUCI 5DRRA 2X7IA 2HFUA 4X64I 1MG7A 2WNRA 5FWKA 4FW6A 4DPWA 2Z5EA 4FW3A 4B3RE 2O1TA 4PU9A 4USMA 2UUBE 1BKNA 3B8HA 4AM3A 3ZZ0A 4X62E 1EA6A 4MYUA 4KHPE 1IBKI 2UUCE 4AQYE 5K36F 4JI2I 3T1HI 4DV6I 2BM0A 3F0NA 4DV3E 3P06A 1EI1A 3UHMA 4DUZI 4GKKI 4IZJD 3M7NG 5K36E 2JEAB 1N32E 1HR0I 2PO1A 1UDQA 4OO1A 5K36D 4WUBA 4JI2E 4LF8I 4YHHE 1XXEA 3L7ZB 4MQYA 4PRXA 4IZJB 3T1HE 3CDIA 3M85D 4DV6E 2C38A 3U1YA 4JI5E 3QT8A 1ZM2A 4FW4A 4U3DA 2IESA 2PNMA 3KRNA 4DUZE 4GKKE 2Q2EB 2CVEA 4U3BA 5K36B 4DR3I 2ZM6I 2HKJA 4MU3A 2GQ0A 2VF3A 2HK2A 1H73A 1MX0A 4LCHA 2PO2B 2Z5CB 4Z7CA 5FLXC 3M85G 4NBQA 3H1CA 4IFDA 4MU4A 4DPUA 4LF8E 4DV4I 2UXCI 4OZEA 4JI0I 1A6FA 4BA1A 4LCGA 1XNQE 2IOQA 3GONA 3V2UC 1N36I 1DARA 1XMQI 3LTOA 1USVA 1YH8A 1OYPA 1Z5CA 4JI4I 4DV1I 3HKMA 4DR3E 2ZM6E 1OYRA 4LF6I 3P3CA 2IERA 2AE8A 3LPSA 4NXMI 4JI0E 3PS2A 3GCMA 4HYMA 4XTJA 5IT9C 2J65A 3J81Q 2UU9I 1XMQE 3PYEA 4MDTA 3L7ZA 2UUAE 1QZRA 1N34I 4OO1D 2F1DA 4JI4E 4LF4I 1D6TA 4DR5I 2GS8A 5DRQA 3J80C 1Z0VA 4B3TE 2C37B 4DV7I 4LF6E 4JI1E 4OX9I 4NXME 1Y4SA 1E3HA 2Z5BA 3PYGA 2PO1B 4OO1B 1OJ4A 3P3EA 4IZJA 4QNJA 3B82A 4DR6I 2UU9E 4OKGA 4PRVA 2C38B 4X66I 2V2ZA 5LL6R 1FKAE 4IFDD 5K36A 2UUBI 4LF4E 3ZKBA 3GMEA 5LMNE 4DR5E 1S16A 2UXBE 1Z0BA 2Z5CA 4DV7E 4B3SI 4OX9E 4J3DA 4QNKA 4AQYI 4KQVA 4LFBI 1B62A 1Z5BA 4IFDB 4BA1B 1I94I 5C0XF 1PIEA 4DR6E 4DR1I 4EMDA 4X66E 1UDSA 3Q1QA 5LMUI 4DV3I 4NXNI 4DPXA 1FJGE 2E5LI 2A2CA 1J5EE 4B3SE 4LFAE 4HXZA 2NN6F 2R42A 2E1RA 1NZ0A 5IWAI 1HNXE 4LFBE 4FW9A 5C0XE 1N32I 3DD6A 1XMOI 3JAMQ 1ELOA 2O3ZA 4YHHI 3J7AM 4OO1C 1I94E 3CWVA 4JI8I 5C0XD 4DR1E 4JI5I 3PYDA 5LMUE 1YHCA 4LCFA 4NXNE 1FWLA 2NN6E 4DR4I 2PO0B 2VQEI 2C37A 2E5LE 5C0XB 4GQUA 3GLLA 3OTOI 2EFGA 5IWAE 1H7SA 2OI2A 1XMOE 4JI7E 2Z5BB 4BA2B 4IFDC 1XNQI 4JI8E 4HY1A 4IZKB 4LFCI 4ED4A 4DR7I 4JG4A 2AJ4A 1ZXMA 4DR4E 2VQEE 3ZZTA 2A2DA 2GO3A 2CGEA 2ZITA 4R1FA 4YY3I 3OTOE 2VQFI 3HJCA 1USUA 4HACB 5JEAF 1ZM3A 2BA0D 3K85A 1HK7A 4LFCE 1Z0CA 2CG9A 4LOMA 4DR7E 2WP8B 2UUAI 4K0KI 5EKWA 4B3TI 5JEAE 5A2QC 4YY3E 4JI1I 4MU0A 2VQFE 1MU5A 3Q6NA 3B4TA 4DPTA 1UDOA 3HULA 2V8PA 4X65I 1E3PA 1VISA 1R6MA 2F4VE 1Y6ZA 1Z0WA 2HFSA 4K0KE 5JEAB 2PO0A 5LMNI 2C39B 4LPFA 5DNXA 3T1YE 2UXBI 5K36C 2ZBKB 1H72C 1FNMA 4JYAE 5C0XA 3D4JA 5FLXQ 1K47A 4MYTA 3CDJA 5BR8I 2VESA 4BA2A 4USKA 4FWDA 4X65E 4IZKA 5EL9A 4ZVIA 4DUYE 2NN6A 4P7AA 4P52A 2V34A 2WW4A 4AIDA 1FJGI 4FWHA 1J5EI 4HACA 1HNXI 5BR8E 4DV0E 2BR2A 2LJPA 4LF7I 1N0VC 2HHHE 1NHJA 5IT9Q 2O1UA 4LF9I 1N0UA 1KIJA 1RREA 2BA1D 3PS1A 2WP8A 3B78A 3U1KA 1WUUA 2CZ9A 1NHIA 4B3MI 4Z7YA 4JV5I 3J80Q 2PNZB 3QT7A 4DR2E 1KKHA 3P3GA 2BA1G 1IBLI 4JI7I 4WUDA 2HK3A 4LF7E 1H7UA 1Z59A 4LF9E 4M1KA 4N3OA 4JI6I 1HNWI 5DNLA 4GKJE 2O1WA 5JEAA 2UXDI 2C39A 4B3ME 4JV5E 2JEBB 3WU5A 2J7KA 1FI4A 4LF5I 2PNLA 1Z0EA 3WU4A 2NN6D 3M6AA 4ISAA 3M7ND 1ZXNA 1IBLE 1OYSA 4X64E 4RPFA 1ZM4A 1UDNA 4DV2I 5DROA 4JI6E 1HNWE 4FW7A 1FWKA 2GO4A 3PS3A 2NN6B 2UXDE 2O1VA 3K17A 4LF5E 2X36A 1IBKE 1NHHA 1N33I 2JE6B 3QT5A 3K1JA 4DPYA 5L3JA 2BR2B 4WUCA 1P42A 1IBMI 4DV2E 4IS9A 4I3HA 3J81C 2F4VI 3PYFA 4DV5I 4FN5A 3LNUA 4UT4A 2PNZA 4JI3I 3T1YI 1B63A 2HKEA 2V2VA 4MU1A 4JYAI 1Z5AA 1N33E 1VI7A 2DEJA 2BA0G 1XNRI 1HR0E 1XHKA 4AIMA 5C0XC 3ZZUA 5JEAD 3ZKDA 1U2RA 1IBME 3Q6MA 3V5RA 4DUYI 2WNRB 2R3VA 1Z0TA 4DXLA 1PVGA 4DV5E 1Y60A 4OO1F 2NN6C 2JEBA 4JI3E 5GMDA 2XEXA 1S4EA 1RR9A 1RHYA 3ZM7A 1XNRE 4DV0I 4DV4E 2UXCE 5GMEA 4LFAI 2HHHI 4OO1E 3P76A 1N36E 4DU8A 4FWGA 5ELWA 4IFDF 4DV1E 3NZKA 1PKPA 1H74A 1HNZI 3QT6A 1UEKA 1Y5YA 5A2QQ 2JEAA 2JE6A 4URLA 4DR2I 2NPFA 1Z0GA 1ZM9A 4DU7A 3JAMC 5DRPA
chains in the Genus database with same CATH topology
3J7AG 2V2QA 2BV3A 1Y4UA 2DEIA 3WU6A 4B3RI 4GKJI 4UTGA 1KTVA 3PRYA 1N34E 2BM1A 1HNZE 3WU3A 4X62I 2IOPA 1KVKA 3H4LA 4KHPI 2UUCI 2X7IA 2HFUA 4X64I 1MG7A 5FWKA 4DPWA 2Z5EA 4B3RE 2O1TA 4PU9A 4USMA 2UUBE 1BKNA 3B8HA 3ZZ0A 4X62E 1EA6A 4MYUA 4KHPE 1IBKI 2UUCE 4AQYE 4JI2I 3T1HI 4DV6I 2BM0A 3F0NA 4DV3E 3P06A 1EI1A 4DUZI 4GKKI 4IZJD 1N32E 1HR0I 4WUBA 4JI2E 4LF8I 4YHHE 4PRXA 4IZJB 3T1HE 4DV6E 4JI5E 3QT8A 1ZM2A 2PNMA 4DUZE 4GKKE 2Q2EB 4DR3I 2ZM6I 2HKJA 2GQ0A 2VF3A 2HK2A 1H73A 1MX0A 2Z5CB 4Z7CA 5FLXC 4DPUA 4LF8E 4DV4I 2UXCI 4JI0I 1A6FA 1XNQE 2IOQA 3GONA 3V2UC 1N36I 1DARA 1XMQI 3LTOA 1USVA 1Z5CA 4JI4I 4DV1I 4DR3E 2ZM6E 4LF6I 3LPSA 4NXMI 4JI0E 4HYMA 4XTJA 5IT9C 3J81Q 2UU9I 1XMQE 3PYEA 2UUAE 1QZRA 1N34I 4JI4E 4LF4I 1D6TA 4DR5I 2GS8A 3J80C 1Z0VA 4B3TE 4DV7I 4LF6E 4JI1E 4OX9I 4NXME 1Y4SA 2Z5BA 3PYGA 1OJ4A 4IZJA 3B82A 4DR6I 2UU9E 4PRVA 4X66I 2V2ZA 5LL6R 1FKAE 2UUBI 4LF4E 3ZKBA 5LMNE 4DR5E 1S16A 2UXBE 1Z0BA 2Z5CA 4DV7E 4B3SI 4OX9E 4AQYI 4KQVA 4LFBI 1B62A 1Z5BA 1I94I 4DR6E 1PIEA 4DR1I 4EMDA 4X66E 3Q1QA 5LMUI 4DV3I 4NXNI 4DPXA 1FJGE 2E5LI 2A2CA 1J5EE 4B3SE 4HXZA 2R42A 2E1RA 1NZ0A 5IWAI 1HNXE 4LFBE 4FW9A 1N32I 1XMOI 3JAMQ 1ELOA 4YHHI 3J7AM 1I94E 3CWVA 4JI8I 4DR1E 4JI5I 3PYDA 5LMUE 4NXNE 1FWLA 4DR4I 2VQEI 2E5LE 3OTOI 2EFGA 5IWAE 1H7SA 2OI2A 1XMOE 4JI7E 2Z5BB 1XNQI 4JI8E 4HY1A 4IZKB 4LFCI 4ED4A 4DR7I 4JG4A 2AJ4A 1ZXMA 4DR4E 2VQEE 3ZZTA 2A2DA 2CGEA 2ZITA 4R1FA 4YY3I 3OTOE 2VQFI 3HJCA 1USUA 4HACB 1ZM3A 3K85A 1HK7A 4LFCE 1Z0CA 2CG9A 4DR7E 2UUAI 4K0KI 4B3TI 5A2QC 4YY3E 4JI1I 2VQFE 1MU5A 3Q6NA 4DPTA 3HULA 2V8PA 4X65I 1VISA 2F4VE 1Y6ZA 1Z0WA 2HFSA 4K0KE 5LMNI 2UXBI 3T1YE 2ZBKB 1H72C 1FNMA 4JYAE 3D4JA 5FLXQ 1K47A 4MYTA 5BR8I 4USKA 4FWDA 4X65E 4IZKA 4ZVIA 4DUYE 4P7AA 4P52A 2V34A 2WW4A 1FJGI 4FWHA 1J5EI 4HACA 1HNXI 5BR8E 4DV0E 2LJPA 4LF7I 1N0VC 2HHHE 1NHJA 5IT9Q 2O1UA 4LF9I 1N0UA 1KIJA 1RREA 3B78A 1WUUA 2CZ9A 1NHIA 4B3MI 4Z7YA 4JV5I 3J80Q 3QT7A 4DR2E 1KKHA 1IBLI 4JI7I 4WUDA 2HK3A 4LF7E 1H7UA 1Z59A 4LF9E 4M1KA 4N3OA 4JI6I 1HNWI 4GKJE 2O1WA 2UXDI 4B3ME 4JV5E 3WU5A 2J7KA 1FI4A 4LF5I 2PNLA 1Z0EA 3WU4A 3M6AA 1ZXNA 1IBLE 4X64E 4RPFA 1ZM4A 4DV2I 4JI6E 1HNWE 1FWKA 2UXDE 2O1VA 3K17A 4LF5E 2X36A 1IBKE 1NHHA 1N33I 3QT5A 3K1JA 4DPYA 5L3JA 4WUCA 1IBMI 4DV2E 4I3HA 3J81C 2F4VI 3PYFA 4DV5I 4FN5A 3LNUA 4UT4A 4JI3I 3T1YI 1B63A 2HKEA 2V2VA 4JYAI 1Z5AA 1N33E 2DEJA 1XNRI 1HR0E 1XHKA 3ZZUA 3ZKDA 1U2RA 1IBME 3Q6MA 3V5RA 4DUYI 2R3VA 1Z0TA 4DXLA 1PVGA 4DV5E 4JI3E 5GMDA 2XEXA 1S4EA 1RR9A 3ZM7A 1XNRE 4DV0I 4DV4E 2UXCE 5GMEA 4LFAI 2HHHI 1N36E 4DU8A 4FWGA 4DV1E 1PKPA 1H74A 1HNZI 3QT6A 1UEKA 5A2QQ 4URLA 4DR2I 2NPFA 1Z0GA 1ZM9A 4DU7A 3JAMC 4LFAE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7A G;  2V2Q A;  2BV3 A;  2DEI A;  3WU6 A;  4B3R I;  4GKJ I;  4UTG A;  1KTV A;  1N34 E;  2BM1 A;  1HNZ E;  3WU3 A;  4X62 I;  1KVK A;  3H4L A;  4KHP I;  2UUC I;  2X7I A;  2HFU A;  4X64 I;  1MG7 A;  4DPW A;  4B3R E;  4PU9 A;  4USM A;  2UUB E;  1BKN A;  3B8H A;  3ZZ0 A;  4X62 E;  1EA6 A;  4MYU A;  4KHP E;  1IBK I;  2UUC E;  4AQY E;  4JI2 I;  3T1H I;  4DV6 I;  2BM0 A;  3F0N A;  4DV3 E;  1EI1 A;  4DUZ I;  4GKK I;  1N32 E;  1HR0 I;  4WUB A;  4JI2 E;  4LF8 I;  4YHH E;  4PRX A;  3T1H E;  4DV6 E;  4JI5 E;  3QT8 A;  1ZM2 A;  4DUZ E;  4GKK E;  2Q2E B;  4DR3 I;  2ZM6 I;  2HKJ A;  2VF3 A;  2HK2 A;  1H73 A;  1MX0 A;  4Z7C A;  5FLX C;  4DPU A;  4LF8 E;  4DV4 I;  2UXC I;  4JI0 I;  1A6F A;  1XNQ E;  3V2U C;  3GON A;  1N36 I;  1DAR A;  1XMQ I;  3LTO A;  1Z5C A;  4JI4 I;  4DV1 I;  4DR3 E;  2ZM6 E;  4LF6 I;  3LPS A;  4NXM I;  4JI0 E;  4HYM A;  4XTJ A;  5IT9 C;  3J81 Q;  2UU9 I;  1XMQ E;  3PYE A;  2UUA E;  1QZR A;  1N34 I;  4JI4 E;  4LF4 I;  1D6T A;  4DR5 I;  2GS8 A;  3J80 C;  1Z0V A;  4B3T E;  4DV7 I;  4LF6 E;  4JI1 E;  4OX9 I;  4NXM E;  3PYG A;  1OJ4 A;  3B82 A;  4DR6 I;  2UU9 E;  4PRV A;  4X66 I;  2V2Z A;  5LL6 R;  1FKA E;  2UUB I;  4LF4 E;  3ZKB A;  5LMN E;  4DR5 E;  1S16 A;  2UXB E;  1Z0B A;  4DV7 E;  4B3S I;  4OX9 E;  4AQY I;  4KQV A;  4LFB I;  1B62 A;  1Z5B A;  1I94 I;  4DR6 E;  1PIE A;  4DR1 I;  4EMD A;  4X66 E;  3Q1Q A;  5LMU I;  4DV3 I;  4NXN I;  4DPX A;  1FJG E;  2E5L I;  2A2C A;  1J5E E;  4B3S E;  4HXZ A;  2R42 A;  2E1R A;  1NZ0 A;  1HNX E;  5IWA I;  4LFB E;  4FW9 A;  1N32 I;  1XMO I;  3JAM Q;  1ELO A;  4YHH I;  3J7A M;  1I94 E;  3CWV A;  4JI8 I;  4DR1 E;  4JI5 I;  3PYD A;  5LMU E;  4NXN E;  1FWL A;  4DR4 I;  2VQE I;  2E5L E;  3OTO I;  2EFG A;  5IWA E;  1H7S A;  2OI2 A;  1XMO E;  4JI7 E;  1XNQ I;  4JI8 E;  4HY1 A;  4LFC I;  4ED4 A;  4DR7 I;  4JG4 A;  2AJ4 A;  1ZXM A;  4DR4 E;  2VQE E;  3ZZT A;  2A2D A;  4R1F A;  2ZIT A;  4YY3 I;  3OTO E;  2VQF I;  4HAC B;  1ZM3 A;  4LFC E;  1Z0C A;  4DR7 E;  2UUA I;  4K0K I;  4B3T I;  5A2Q C;  4YY3 E;  4JI1 I;  2VQF E;  1MU5 A;  4DPT A;  3HUL A;  2V8P A;  4X65 I;  1VIS A;  2F4V E;  1Z0W A;  2HFS A;  4K0K E;  5LMN I;  2UXB I;  3T1Y E;  2ZBK B;  1H72 C;  1FNM A;  4JYA E;  3D4J A;  5FLX Q;  1K47 A;  4MYT A;  5BR8 I;  4USK A;  4FWD A;  4X65 E;  4ZVI A;  4DUY E;  4P7A A;  4P52 A;  2V34 A;  2WW4 A;  1FJG I;  4FWH A;  1J5E I;  4HAC A;  1HNX I;  5BR8 E;  4DV0 E;  2LJP A;  4LF7 I;  1N0V C;  2HHH E;  1NHJ A;  5IT9 Q;  4LF9 I;  1N0U A;  1KIJ A;  1RRE A;  3B78 A;  1WUU A;  2CZ9 A;  1NHI A;  4B3M I;  4Z7Y A;  4JV5 I;  3J80 Q;  3QT7 A;  4DR2 E;  1KKH A;  1IBL I;  4JI7 I;  4WUD A;  2HK3 A;  4LF7 E;  1H7U A;  1Z59 A;  4LF9 E;  4M1K A;  4JI6 I;  1HNW I;  4GKJ E;  2UXD I;  4B3M E;  4JV5 E;  3WU5 A;  2J7K A;  1FI4 A;  4LF5 I;  1Z0E A;  3WU4 A;  3M6A A;  1ZXN A;  1IBL E;  4X64 E;  4RPF A;  1ZM4 A;  4DV2 I;  4JI6 E;  1HNW E;  1FWK A;  2UXD E;  3K17 A;  4LF5 E;  2X36 A;  1IBK E;  1NHH A;  1N33 I;  3QT5 A;  3K1J A;  4DPY A;  5L3J A;  4WUC A;  1IBM I;  4DV2 E;  4I3H A;  3J81 C;  2F4V I;  3PYF A;  4DV5 I;  4FN5 A;  3LNU A;  4UT4 A;  4JI3 I;  3T1Y I;  1B63 A;  2HKE A;  2V2V A;  4JYA I;  1Z5A A;  1N33 E;  2DEJ A;  1XNR I;  1HR0 E;  1XHK A;  3ZZU A;  3ZKD A;  1U2R A;  1IBM E;  3V5R A;  4DUY I;  2R3V A;  1Z0T A;  4DXL A;  1PVG A;  4DV5 E;  4JI3 E;  5GMD A;  2XEX A;  1S4E A;  1RR9 A;  3ZM7 A;  1XNR E;  4DV0 I;  4DV4 E;  2UXC E;  5GME A;  4LFA I;  2HHH I;  1N36 E;  4DU8 A;  4FWG A;  4DV1 E;  1PKP A;  1H74 A;  1HNZ I;  3QT6 A;  1UEK A;  5A2Q Q;  4URL A;  4DR2 I;  2NPF A;  1Z0G A;  1ZM9 A;  4DU7 A;  3JAM C;  4LFA E; 
#chains in the Genus database with same CATH topology
 3J7A G;  4IFD E;  1R6L A;  2V2Q A;  2BV3 A;  1Y4U A;  2JT2 A;  2DEI A;  3WU6 A;  4B3R I;  4GKJ I;  4UTG A;  1KTV A;  3PRY A;  4FW5 A;  1N34 E;  2BM1 A;  1HNZ E;  3WU3 A;  4X62 I;  2IOP A;  5JEA C;  1KVK A;  2PO2 A;  3H4L A;  4KHP I;  2UUC I;  5DRR A;  2X7I A;  2HFU A;  4X64 I;  1MG7 A;  2WNR A;  5FWK A;  4FW6 A;  4DPW A;  2Z5E A;  4FW3 A;  4B3R E;  2O1T A;  4PU9 A;  4USM A;  2UUB E;  1BKN A;  3B8H A;  4AM3 A;  3ZZ0 A;  4X62 E;  1EA6 A;  4MYU A;  4KHP E;  1IBK I;  2UUC E;  4AQY E;  5K36 F;  4JI2 I;  3T1H I;  4DV6 I;  2BM0 A;  3F0N A;  4DV3 E;  3P06 A;  1EI1 A;  3UHM A;  4DUZ I;  4GKK I;  4IZJ D;  3M7N G;  5K36 E;  2JEA B;  1N32 E;  1HR0 I;  2PO1 A;  1UDQ A;  4OO1 A;  5K36 D;  4WUB A;  4JI2 E;  4LF8 I;  4YHH E;  1XXE A;  3L7Z B;  4MQY A;  4PRX A;  4IZJ B;  3T1H E;  3CDI A;  3M85 D;  4DV6 E;  2C38 A;  3U1Y A;  4JI5 E;  3QT8 A;  1ZM2 A;  4FW4 A;  4U3D A;  2IES A;  2PNM A;  3KRN A;  4DUZ E;  4GKK E;  2Q2E B;  2CVE A;  4U3B A;  5K36 B;  4DR3 I;  2ZM6 I;  2HKJ A;  4MU3 A;  2GQ0 A;  2VF3 A;  2HK2 A;  1H73 A;  1MX0 A;  4LCH A;  2PO2 B;  2Z5C B;  4Z7C A;  5FLX C;  3M85 G;  4NBQ A;  3H1C A;  4IFD A;  4MU4 A;  4DPU A;  4LF8 E;  4DV4 I;  2UXC I;  4OZE A;  4JI0 I;  1A6F A;  4BA1 A;  4LCG A;  1XNQ E;  2IOQ A;  3GON A;  3V2U C;  1N36 I;  1DAR A;  1XMQ I;  3LTO A;  1USV A;  1YH8 A;  1OYP A;  1Z5C A;  4JI4 I;  4DV1 I;  3HKM A;  4DR3 E;  2ZM6 E;  1OYR A;  4LF6 I;  3P3C A;  2IER A;  2AE8 A;  3LPS A;  4NXM I;  4JI0 E;  3PS2 A;  3GCM A;  4HYM A;  4XTJ A;  5IT9 C;  2J65 A;  3J81 Q;  2UU9 I;  1XMQ E;  3PYE A;  4MDT A;  3L7Z A;  2UUA E;  1QZR A;  1N34 I;  4OO1 D;  2F1D A;  4JI4 E;  4LF4 I;  1D6T A;  4DR5 I;  2GS8 A;  5DRQ A;  3J80 C;  1Z0V A;  4B3T E;  2C37 B;  4DV7 I;  4LF6 E;  4JI1 E;  4OX9 I;  4NXM E;  1Y4S A;  1E3H A;  2Z5B A;  3PYG A;  2PO1 B;  4OO1 B;  1OJ4 A;  3P3E A;  4IZJ A;  4QNJ A;  3B82 A;  4DR6 I;  2UU9 E;  4OKG A;  4PRV A;  2C38 B;  4X66 I;  2V2Z A;  5LL6 R;  1FKA E;  4IFD D;  5K36 A;  2UUB I;  4LF4 E;  3ZKB A;  3GME A;  5LMN E;  4DR5 E;  1S16 A;  2UXB E;  1Z0B A;  2Z5C A;  4DV7 E;  4B3S I;  4OX9 E;  4J3D A;  4QNK A;  4AQY I;  4KQV A;  4LFB I;  1B62 A;  1Z5B A;  4IFD B;  4BA1 B;  1I94 I;  5C0X F;  1PIE A;  4DR6 E;  4DR1 I;  4EMD A;  4X66 E;  1UDS A;  3Q1Q A;  5LMU I;  4DV3 I;  4NXN I;  4DPX A;  1FJG E;  2E5L I;  2A2C A;  1J5E E;  4B3S E;  4LFA E;  4HXZ A;  2NN6 F;  2R42 A;  2E1R A;  1NZ0 A;  5IWA I;  1HNX E;  4LFB E;  4FW9 A;  5C0X E;  1N32 I;  3DD6 A;  1XMO I;  3JAM Q;  1ELO A;  2O3Z A;  4YHH I;  3J7A M;  4OO1 C;  1I94 E;  3CWV A;  4JI8 I;  5C0X D;  4DR1 E;  4JI5 I;  3PYD A;  5LMU E;  1YHC A;  4LCF A;  4NXN E;  1FWL A;  2NN6 E;  4DR4 I;  2PO0 B;  2VQE I;  2C37 A;  2E5L E;  5C0X B;  4GQU A;  3GLL A;  3OTO I;  2EFG A;  5IWA E;  1H7S A;  2OI2 A;  1XMO E;  4JI7 E;  2Z5B B;  4BA2 B;  4IFD C;  1XNQ I;  4JI8 E;  4HY1 A;  4IZK B;  4LFC I;  4ED4 A;  4DR7 I;  4JG4 A;  2AJ4 A;  1ZXM A;  4DR4 E;  2VQE E;  3ZZT A;  2A2D A;  2GO3 A;  2CGE A;  2ZIT A;  4R1F A;  4YY3 I;  3OTO E;  2VQF I;  3HJC A;  1USU A;  4HAC B;  5JEA F;  1ZM3 A;  2BA0 D;  3K85 A;  1HK7 A;  4LFC E;  1Z0C A;  2CG9 A;  4LOM A;  4DR7 E;  2WP8 B;  2UUA I;  4K0K I;  5EKW A;  4B3T I;  5JEA E;  5A2Q C;  4YY3 E;  4JI1 I;  4MU0 A;  2VQF E;  1MU5 A;  3Q6N A;  3B4T A;  4DPT A;  1UDO A;  3HUL A;  2V8P A;  4X65 I;  1E3P A;  1VIS A;  1R6M A;  2F4V E;  1Y6Z A;  1Z0W A;  2HFS A;  4K0K E;  5JEA B;  2PO0 A;  5LMN I;  2C39 B;  4LPF A;  5DNX A;  3T1Y E;  2UXB I;  5K36 C;  2ZBK B;  1H72 C;  1FNM A;  4JYA E;  5C0X A;  3D4J A;  5FLX Q;  1K47 A;  4MYT A;  3CDJ A;  5BR8 I;  2VES A;  4BA2 A;  4USK A;  4FWD A;  4X65 E;  4IZK A;  5EL9 A;  4ZVI A;  4DUY E;  2NN6 A;  4P7A A;  4P52 A;  2V34 A;  2WW4 A;  4AID A;  1FJG I;  4FWH A;  1J5E I;  4HAC A;  1HNX I;  5BR8 E;  4DV0 E;  2BR2 A;  2LJP A;  4LF7 I;  1N0V C;  2HHH E;  1NHJ A;  5IT9 Q;  2O1U A;  4LF9 I;  1N0U A;  1KIJ A;  1RRE A;  2BA1 D;  3PS1 A;  2WP8 A;  3B78 A;  3U1K A;  1WUU A;  2CZ9 A;  1NHI A;  4B3M I;  4Z7Y A;  4JV5 I;  3J80 Q;  2PNZ B;  3QT7 A;  4DR2 E;  1KKH A;  3P3G A;  2BA1 G;  1IBL I;  4JI7 I;  4WUD A;  2HK3 A;  4LF7 E;  1H7U A;  1Z59 A;  4LF9 E;  4M1K A;  4N3O A;  4JI6 I;  1HNW I;  5DNL A;  4GKJ E;  2O1W A;  5JEA A;  2UXD I;  2C39 A;  4B3M E;  4JV5 E;  2JEB B;  3WU5 A;  2J7K A;  1FI4 A;  4LF5 I;  2PNL A;  1Z0E A;  3WU4 A;  2NN6 D;  3M6A A;  4ISA A;  3M7N D;  1ZXN A;  1IBL E;  1OYS A;  4X64 E;  4RPF A;  1ZM4 A;  1UDN A;  4DV2 I;  5DRO A;  4JI6 E;  1HNW E;  4FW7 A;  1FWK A;  2GO4 A;  3PS3 A;  2NN6 B;  2UXD E;  2O1V A;  3K17 A;  4LF5 E;  2X36 A;  1IBK E;  1NHH A;  1N33 I;  2JE6 B;  3QT5 A;  3K1J A;  4DPY A;  5L3J A;  2BR2 B;  4WUC A;  1P42 A;  1IBM I;  4DV2 E;  4IS9 A;  4I3H A;  3J81 C;  2F4V I;  3PYF A;  4DV5 I;  4FN5 A;  3LNU A;  4UT4 A;  2PNZ A;  4JI3 I;  3T1Y I;  1B63 A;  2HKE A;  2V2V A;  4MU1 A;  4JYA I;  1Z5A A;  1N33 E;  1VI7 A;  2DEJ A;  2BA0 G;  1XNR I;  1HR0 E;  1XHK A;  4AIM A;  5C0X C;  3ZZU A;  5JEA D;  3ZKD A;  1U2R A;  1IBM E;  3Q6M A;  3V5R A;  4DUY I;  2WNR B;  2R3V A;  1Z0T A;  4DXL A;  1PVG A;  4DV5 E;  1Y60 A;  4OO1 F;  2NN6 C;  2JEB A;  4JI3 E;  5GMD A;  2XEX A;  1S4E A;  1RR9 A;  1RHY A;  3ZM7 A;  1XNR E;  4DV0 I;  4DV4 E;  2UXC E;  5GME A;  4LFA I;  2HHH I;  4OO1 E;  3P76 A;  1N36 E;  4DU8 A;  4FWG A;  5ELW A;  4IFD F;  4DV1 E;  3NZK A;  1PKP A;  1H74 A;  1HNZ I;  3QT6 A;  1UEK A;  1Y5Y A;  5A2Q Q;  2JEA A;  2JE6 A;  4URL A;  4DR2 I;  2NPF A;  1Z0G A;  1ZM9 A;  4DU7 A;  3JAM C;  5DRP A; 
#chains in the Genus database with same CATH homology
 3J7A G;  2V2Q A;  2BV3 A;  1Y4U A;  2DEI A;  3WU6 A;  4B3R I;  4GKJ I;  4UTG A;  1KTV A;  3PRY A;  1N34 E;  2BM1 A;  1HNZ E;  3WU3 A;  4X62 I;  2IOP A;  1KVK A;  3H4L A;  4KHP I;  2UUC I;  2X7I A;  2HFU A;  4X64 I;  1MG7 A;  5FWK A;  4DPW A;  2Z5E A;  4B3R E;  2O1T A;  4PU9 A;  4USM A;  2UUB E;  1BKN A;  3B8H A;  3ZZ0 A;  4X62 E;  1EA6 A;  4MYU A;  4KHP E;  1IBK I;  2UUC E;  4AQY E;  4JI2 I;  3T1H I;  4DV6 I;  2BM0 A;  3F0N A;  4DV3 E;  3P06 A;  1EI1 A;  4DUZ I;  4GKK I;  4IZJ D;  1N32 E;  1HR0 I;  4WUB A;  4JI2 E;  4LF8 I;  4YHH E;  4PRX A;  4IZJ B;  3T1H E;  4DV6 E;  4JI5 E;  3QT8 A;  1ZM2 A;  2PNM A;  4DUZ E;  4GKK E;  2Q2E B;  4DR3 I;  2ZM6 I;  2HKJ A;  2GQ0 A;  2VF3 A;  2HK2 A;  1H73 A;  1MX0 A;  2Z5C B;  4Z7C A;  5FLX C;  4DPU A;  4LF8 E;  4DV4 I;  2UXC I;  4JI0 I;  1A6F A;  1XNQ E;  2IOQ A;  3GON A;  3V2U C;  1N36 I;  1DAR A;  1XMQ I;  3LTO A;  1USV A;  1Z5C A;  4JI4 I;  4DV1 I;  4DR3 E;  2ZM6 E;  4LF6 I;  3LPS A;  4NXM I;  4JI0 E;  4HYM A;  4XTJ A;  5IT9 C;  3J81 Q;  2UU9 I;  1XMQ E;  3PYE A;  2UUA E;  1QZR A;  1N34 I;  4JI4 E;  4LF4 I;  1D6T A;  4DR5 I;  2GS8 A;  3J80 C;  1Z0V A;  4B3T E;  4DV7 I;  4LF6 E;  4JI1 E;  4OX9 I;  4NXM E;  1Y4S A;  2Z5B A;  3PYG A;  1OJ4 A;  4IZJ A;  3B82 A;  4DR6 I;  2UU9 E;  4PRV A;  4X66 I;  2V2Z A;  5LL6 R;  1FKA E;  2UUB I;  4LF4 E;  3ZKB A;  5LMN E;  4DR5 E;  1S16 A;  2UXB E;  1Z0B A;  2Z5C A;  4DV7 E;  4B3S I;  4OX9 E;  4AQY I;  4KQV A;  4LFB I;  1B62 A;  1Z5B A;  1I94 I;  4DR6 E;  1PIE A;  4DR1 I;  4EMD A;  4X66 E;  3Q1Q A;  5LMU I;  4DV3 I;  4NXN I;  4DPX A;  1FJG E;  2E5L I;  2A2C A;  1J5E E;  4B3S E;  4HXZ A;  2R42 A;  2E1R A;  1NZ0 A;  5IWA I;  1HNX E;  4LFB E;  4FW9 A;  1N32 I;  1XMO I;  3JAM Q;  1ELO A;  4YHH I;  3J7A M;  1I94 E;  3CWV A;  4JI8 I;  4DR1 E;  4JI5 I;  3PYD A;  5LMU E;  4NXN E;  1FWL A;  4DR4 I;  2VQE I;  2E5L E;  3OTO I;  2EFG A;  5IWA E;  1H7S A;  2OI2 A;  1XMO E;  4JI7 E;  2Z5B B;  1XNQ I;  4JI8 E;  4HY1 A;  4IZK B;  4LFC I;  4ED4 A;  4DR7 I;  4JG4 A;  2AJ4 A;  1ZXM A;  4DR4 E;  2VQE E;  3ZZT A;  2A2D A;  2CGE A;  2ZIT A;  4R1F A;  4YY3 I;  3OTO E;  2VQF I;  3HJC A;  1USU A;  4HAC B;  1ZM3 A;  3K85 A;  1HK7 A;  4LFC E;  1Z0C A;  2CG9 A;  4DR7 E;  2UUA I;  4K0K I;  4B3T I;  5A2Q C;  4YY3 E;  4JI1 I;  2VQF E;  1MU5 A;  3Q6N A;  4DPT A;  3HUL A;  2V8P A;  4X65 I;  1VIS A;  2F4V E;  1Y6Z A;  1Z0W A;  2HFS A;  4K0K E;  5LMN I;  2UXB I;  3T1Y E;  2ZBK B;  1H72 C;  1FNM A;  4JYA E;  3D4J A;  5FLX Q;  1K47 A;  4MYT A;  5BR8 I;  4USK A;  4FWD A;  4X65 E;  4IZK A;  4ZVI A;  4DUY E;  4P7A A;  4P52 A;  2V34 A;  2WW4 A;  1FJG I;  4FWH A;  1J5E I;  4HAC A;  1HNX I;  5BR8 E;  4DV0 E;  2LJP A;  4LF7 I;  1N0V C;  2HHH E;  1NHJ A;  5IT9 Q;  2O1U A;  4LF9 I;  1N0U A;  1KIJ A;  1RRE A;  3B78 A;  1WUU A;  2CZ9 A;  1NHI A;  4B3M I;  4Z7Y A;  4JV5 I;  3J80 Q;  3QT7 A;  4DR2 E;  1KKH A;  1IBL I;  4JI7 I;  4WUD A;  2HK3 A;  4LF7 E;  1H7U A;  1Z59 A;  4LF9 E;  4M1K A;  4N3O A;  4JI6 I;  1HNW I;  4GKJ E;  2O1W A;  2UXD I;  4B3M E;  4JV5 E;  3WU5 A;  2J7K A;  1FI4 A;  4LF5 I;  2PNL A;  1Z0E A;  3WU4 A;  3M6A A;  1ZXN A;  1IBL E;  4X64 E;  4RPF A;  1ZM4 A;  4DV2 I;  4JI6 E;  1HNW E;  1FWK A;  2UXD E;  2O1V A;  3K17 A;  4LF5 E;  2X36 A;  1IBK E;  1NHH A;  1N33 I;  3QT5 A;  3K1J A;  4DPY A;  5L3J A;  4WUC A;  1IBM I;  4DV2 E;  4I3H A;  3J81 C;  2F4V I;  3PYF A;  4DV5 I;  4FN5 A;  3LNU A;  4UT4 A;  4JI3 I;  3T1Y I;  1B63 A;  2HKE A;  2V2V A;  4JYA I;  1Z5A A;  1N33 E;  2DEJ A;  1XNR I;  1HR0 E;  1XHK A;  3ZZU A;  3ZKD A;  1U2R A;  1IBM E;  3Q6M A;  3V5R A;  4DUY I;  2R3V A;  1Z0T A;  4DXL A;  1PVG A;  4DV5 E;  4JI3 E;  5GMD A;  2XEX A;  1S4E A;  1RR9 A;  3ZM7 A;  1XNR E;  4DV0 I;  4DV4 E;  2UXC E;  5GME A;  4LFA I;  2HHH I;  1N36 E;  4DU8 A;  4FWG A;  4DV1 E;  1PKP A;  1H74 A;  1HNZ I;  3QT6 A;  1UEK A;  5A2Q Q;  4URL A;  4DR2 I;  2NPF A;  1Z0G A;  1ZM9 A;  4DU7 A;  3JAM C;  4LFA E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...