4DUYI

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 26
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4duyI00
1FWKA 4DV2E 4DUZI 1XNQI 4X64E 3J80C 4USMA 4HACB 1NHIA 4JI3I 3D4JA 2V2QA 4PRVA 4JI7I 5LMUI 2BV3A 1ZM9A 1PKPA 1I94I 1FI4A 4DPYA 2BM1A 1NZ0A 3PYDA 4B3ME 5L3JA 4DV2I 1XNQE 4KHPE 4URLA 4GKKE 1Z0WA 4Z7YA 3B78A 2V8PA 2A2DA 1Z5CA 3M6AA 2VQEI 3T1HI 4HACA 4M1KA 4FWGA 2V2ZA 3B82A 3K17A 1WUUA 2HHHE 4JI8E 4I3HA 2UXBE 2X36A 4UT4A 2HFSA 2GS8A 1H74A 4DR2I 1J5EE 4DR7I 1NHJA 2UUCE 2BM0A 2V2VA 1H73A 1N34I 1N33I 1Z0EA 4OX9I 1KVKA 4DXLA 4WUBA 2HKJA 1DARA 4P52A 1HR0I 4DU8A 4X65I 4WUCA 4P7AA 1IBKE 4X64I 3WU5A 2OI2A 1H72C 1IBME 2UU9E 1OJ4A 3PYGA 5IWAE 3J81C 2E1RA 1QZRA 4DV4I 3ZZ0A 2VQEE 3T1HE 4PU9A 5BR8E 2R42A 5IT9Q 4LF7E 1U2RA 4DV6E 4X65E 4JV5E 2E5LI 1S4EA 4JG4A 5A2QC 5FLXC 4HXZA 2UXCI 2VQFI 1H7SA 4GKKI 4NXNE 3V2UC 5IWAI 1RR9A 4LF6E 1N33E 4DV4E 5BR8I 3ZZTA 2LJPA 2A2CA 4LF7I 4JI8I 4FW9A 3T1YI 3GONA 4OX9E 1EA6A 3QT6A 2J7KA 4LFCE 2UXCE 1N0VC 1Z5BA 3F0NA 3WU3A 3LTOA 4AQYE 1N36I 4B3TE 4B3MI 1PIEA 3J81Q 3K1JA 1IBLE 4NXMI 3CWVA 1XMQI 4FN5A 4KHPI 4DR3I 2HKEA 4DR6E 1S16A 4GKJE 4DUYI 1FKAE 3H4LA 1VISA 4YHHE 4DV6I 3V5RA 1IBKI 1Z0CA 4DU7A 1IBLI 4NXME 2UU9I 1NHHA 1XMQE 4EMDA 2VQFE 2UUCI 5LMNI 1KIJA 4USKA 1FWLA 4B3SE 1MX0A 4HY1A 4LF9E 3T1YE 1Z0BA 4MYTA 1HNXE 4LFCI 4NXNI 4ZVIA 1ZM3A 4B3RI 4FWHA 4JI5I 4B3TI 4AQYI 1N36E 4JI0E 5GMDA 3LNUA 4X62I 1MG7A 4DR1E 1B63A 4LF5E 1MU5A 1ZXNA 4DV5I 2UUBI 2NPFA 4GKJI 1HNXI 1FNMA 2HK2A 2DEIA 1Z5AA 4YHHI 4ED4A 3WU6A 3J7AM 4JV5I 2E5LE 4JI0I 3J80Q 4X62E 5LL6R 1KKHA 4HYMA 1XHKA 3QT7A 4DR3E 2ZBKB 4LF6I 4LFBE 4LF4E 4B3SI 4YY3E 1XMOE 4LF8I 4DV3I 4DV0I 4LF9I 4DR5I 3QT5A 5LMNE 2ZITA 1H7UA 1ZXMA 4JI6I 4B3RE 4DV1I 4JI5E 4DPTA 4LFBI 2CZ9A 2F4VI 1EI1A 3HULA 2AJ4A 3QT8A 4DR6I 4JI3E 4RPFA 4DUYE 4K0KI 5GMEA 3WU4A 2HFUA 1XNRI 2EFGA 4JI4I 2ZM6E 1Z0GA 1D6TA 4DR1I 1PVGA 4LF5I 3OTOE 3B8HA 1K47A 4DV5E 2UXDE 1FJGI 1RREA 2HK3A 5IT9C 4DV7I 4JI2E 4JYAE 2UUAI 3JAMQ 1XNRE 1HNZI 4JI4E 4Z7CA 5FLXQ 4KQVA 4XTJA 3PYFA 2V34A 3OTOI 3ZKDA 4JI6E 1A6FA 4PRXA 2UXDI 4UTGA 1Z59A 2XEXA 4LF4I 4DV3E 1Z0VA 4MYUA 4DV0E 4DV7E 1ZM4A 1ZM2A 2UUAE 1HNWE 4WUDA 3ZZUA 4DPWA 4DR4E 4JI1I 2UUBE 1B62A 1HNZE 1I94E 2X7IA 2HHHI 4DV1E 4X66I 3JAMC 4LFAE 1N32I 2R3VA 2WW4A 1ELOA 4DPUA 1N0UA 1IBMI 4FWDA 4R1FA 4DR2E 1J5EI 2DEJA 2F4VE 1BKNA 1KTVA 5A2QQ 3ZKBA 1HNWI 4DR4I 4DUZE 4JI1E 3LPSA 1FJGE 4YY3I 1XMOI 2Q2EB 4LF8E 4K0KE 2UXBI 4JI2I 4JYAI 1UEKA 3Q1QA 1Z0TA 2VF3A 4X66E 3J7AG 3ZM7A 4DR5E 4JI7E 4LFAI 2ZM6I 1N32E 4DPXA 5LMUE 4DR7E 1HR0E 3PYEA 1N34E
chains in the Genus database with same CATH superfamily
1FWKA 4DV2E 4MQYA 4DUZI 1XNQI 4X64E 3J80C 4USMA 2C38A 4HACB 1NHIA 2JEBA 1USVA 2BA0G 2BA0D 2GQ0A 4JI3I 3D4JA 2V2QA 4PRVA 4JI7I 5LMUI 5JEAD 2BV3A 1PKPA 1ZM9A 4GQUA 4OO1E 1I94I 1FI4A 2Z5CB 4DPYA 2BM1A 2JEBB 3H1CA 1NZ0A 3PYDA 4B3ME 5L3JA 2JE6B 4OO1B 4DV2I 1XNQE 3PRYA 5JEAB 4URLA 4KHPE 4GKKE 2IERA 1Z0WA 4Z7YA 3B78A 2V8PA 2A2DA 1Z5CA 3M6AA 2VQEI 3T1HI 4HACA 4M1KA 4FWGA 2V2ZA 1YH8A 3B82A 2PNZA 1WUUA 3K17A 4N3OA 2PNZB 2HHHE 4JI8E 4I3HA 2UXBE 2X36A 4UT4A 2HFSA 2GS8A 1H74A 4DR2I 1J5EE 4DR7I 1NHJA 1UDOA 2UUCE 2BM0A 2V2VA 1H73A 2NN6D 2WNRB 1N34I 2C38B 1N33I 3U1KA 2IESA 2PO1B 4IFDA 1Z0EA 5EL9A 4OX9I 2C39B 1KVKA 2NN6B 4DXLA 2Z5EA 5K36D 5C0XF 4WUBA 2HKJA 1DARA 4P52A 1HR0I 4QNJA 2PO0A 4DU8A 4X65I 4WUCA 4P7AA 1IBKE 4LOMA 4X64I 4IFDC 3WU5A 2NN6A 1H72C 2OI2A 1IBME 2UU9E 4OKGA 1OJ4A 3PYGA 5IWAE 3J81C 2E1RA 3DD6A 3UHMA 1QZRA 3Q6NA 4DV4I 3ZZ0A 1E3HA 5K36C 2Z5BB 2VQEE 3T1HE 4PU9A 5BR8E 3GLLA 4FW3A 2R42A 5IT9Q 4LF7E 1U2RA 4DV6E 3L7ZA 4X65E 4JV5E 3GMEA 2C37B 2E5LI 1P42A 1S4EA 4JG4A 2C37A 5A2QC 5FLXC 4HXZA 2AE8A 2UXCI 2VQFI 1H7SA 4GKKI 4NXNE 3M7NG 3V2UC 5IWAI 2O1WA 5K36A 4AIMA 1RR9A 4LF6E 1N33E 4DV4E 1VI7A 4LCHA 5BR8I 3ZZTA 2LJPA 5FWKA 2A2CA 4LF7I 4JI8I 4FW9A 3T1YI 3GONA 4OX9E 5JEAF 1EA6A 4IZJA 3QT6A 4OO1F 3GCMA 2J7KA 1Y5YA 4LFCE 2UXCE 1Z5BA 1N0VC 3F0NA 3WU3A 2PO2B 3LTOA 4AQYE 1N36I 4B3TE 4B3MI 3PS1A 1PIEA 3J81Q 3K1JA 2J65A 1IBLE 4NXMI 3PS3A 3CWVA 1XMQI 1UDNA 4FN5A 4KHPI 3U1YA 4AM3A 4DR3I 4IZJD 2HKEA 2PO0B 4DR6E 5DRQA 1S16A 5DRRA 3M85G 4NBQA 4GKJE 4DUYI 1FKAE 3H4LA 1VISA 2Z5CA 4YHHE 4LCGA 4OO1C 4DV6I 3V5RA 4IS9A 2WP8B 1IBKI 1Z0CA 4DU7A 1IBLI 4NXME 2UU9I 1NHHA 1XMQE 4EMDA 2VQFE 1XXEA 2O3ZA 2UUCI 5LMNI 1KIJA 4USKA 1FWLA 5DRPA 2WP8A 2O1TA 4B3SE 4OO1A 1MX0A 5K36F 4HY1A 4LF9E 3T1YE 1Z0BA 5ELWA 4MYTA 2CVEA 1HNXE 4LFCI 4NXNI 2JEAB 1OYSA 4ZVIA 4J3DA 1ZM3A 4B3RI 4FWHA 4JI5I 4AQYI 1N36E 4B3TI 4JI0E 5GMDA 1OYRA 3LNUA 1USUA 4X62I 1MG7A 2F1DA 4DR1E 1B63A 2NN6C 4LF5E 2PO2A 3KRNA 3P76A 1Y4SA 1MU5A 1ZXNA 4DV5I 2UUBI 2NPFA 2VESA 4GKJI 1HNXI 1FNMA 2HK2A 2DEIA 1Z5AA 3L7ZB 4YHHI 4ED4A 3WU6A 3J7AM 4LPFA 4JV5I 4IFDB 2E5LE 2BR2B 3PS2A 4JI0I 2O1VA 3J80Q 2Z5BA 4X62E 5LL6R 1KKHA 4HYMA 1XHKA 3QT7A 4DR3E 5K36B 2ZBKB 4LF6I 3M85D 4IFDD 1UDSA 4LFBE 4MU0A 4BA2A 4LF4E 4B3SI 4YY3E 1XMOE 4LF8I 4IZKA 4DV3I 4OO1D 2WNRA 2IOQA 5JEAE 4DV0I 4OZEA 4LF9I 4DR5I 3QT5A 1Y60A 5LMNE 2ZITA 1H7UA 1ZXMA 4JI6I 3CDJA 4B3RE 4DV1I 4JI5E 4DPTA 4LFBI 2O1UA 4FW4A 2CZ9A 2JEAA 2F4VI 5DNXA 1EI1A 3HULA 2AJ4A 3QT8A 4LCFA 4DR6I 4JI3E 4RPFA 4DUYE 4BA1B 1Y4UA 4U3DA 2PNLA 4K0KI 5GMEA 5DROA 1R6LA 1HK7A 3WU4A 2IOPA 3HJCA 2HFUA 1XNRI 2EFGA 4JI4I 2ZM6E 2GO4A 1Z0GA 1D6TA 4FW7A 4DR1I 1PVGA 4LF5I 3OTOE 4ISAA 1Y6ZA 3B8HA 1K47A 4DV5E 2BR2A 2UXDE 1FJGI 1RREA 2JE6A 1UDQA 3P3GA 5C0XC 2HK3A 1R6MA 3B4TA 5IT9C 4DV7I 2PNMA 4JI2E 4JYAE 2UUAI 2BA1G 3JAMQ 3CDIA 1XNRE 2BA1D 1HNZI 1YHCA 4JI4E 4Z7CA 5FLXQ 4KQVA 4XTJA 3PYFA 4IZKB 2C39A 2V34A 3OTOI 4MU3A 3ZKDA 4JI6E 2CG9A 5EKWA 1A6FA 2CGEA 4PRXA 2UXDI 4UTGA 5C0XA 1Z59A 2NN6F 2XEXA 4LF4I 4IFDE 4FW5A 4DV3E 1Z0VA 3P3EA 4MYUA 4DV0E 4DV7E 1ZM2A 1ZM4A 2UUAE 1HNWE 3ZZUA 4WUDA 4DPWA 4DR4E 4JI1I 1OYPA 2UUBE 5K36E 1B62A 1HNZE 2GO3A 1I94E 2X7IA 2HHHI 5C0XD 4U3BA 2PO1A 4DV1E 4X66I 4QNKA 3JAMC 4LFAE 1N32I 2R3VA 2WW4A 1ELOA 4DPUA 1N0UA 2NN6E 1IBMI 4FWDA 4R1FA 4IFDF 3P3CA 4MU4A 4DR2E 1J5EI 2DEJA 4AIDA 3P06A 2F4VE 1BKNA 5C0XB 3M7ND 1KTVA 5A2QQ 4MDTA 3ZKBA 1HNWI 3Q6MA 5JEAC 4DR4I 4DUZE 4JI1E 3LPSA 1FJGE 4FW6A 5C0XE 3HKMA 4YY3I 1E3PA 1XMOI 2Q2EB 4LF8E 4K0KE 3K85A 2UXBI 4JI2I 4JYAI 1UEKA 4BA1A 3Q1QA 1Z0TA 2VF3A 4X66E 3J7AG 3ZM7A 4MU1A 2JT2A 4DR5E 4JI7E 4LFAI 3NZKA 4IZJB 5DNLA 2ZM6I 1N32E 4DPXA 5LMUE 1RHYA 4DR7E 1HR0E 4BA2B 3PYEA 5JEAA 1N34E
chains in the Genus database with same CATH topology
1FWKA 4DV2E 4DUZI 1XNQI 4X64E 3J80C 4USMA 4HACB 1NHIA 1USVA 2GQ0A 4JI3I 3D4JA 2V2QA 4PRVA 4JI7I 5LMUI 2BV3A 1ZM9A 1PKPA 1I94I 1FI4A 2Z5CB 4DPYA 2BM1A 1NZ0A 3PYDA 4B3ME 5L3JA 4DV2I 1XNQE 3PRYA 4KHPE 4URLA 4GKKE 1Z0WA 4Z7YA 3B78A 2V8PA 2A2DA 1Z5CA 3M6AA 2VQEI 3T1HI 4HACA 4M1KA 4FWGA 2V2ZA 3B82A 3K17A 1WUUA 4N3OA 2HHHE 4JI8E 4I3HA 2UXBE 2X36A 4UT4A 2HFSA 2GS8A 1H74A 4DR2I 1J5EE 4DR7I 1NHJA 2UUCE 2BM0A 2V2VA 1H73A 1N34I 1N33I 1Z0EA 4OX9I 1KVKA 4DXLA 2Z5EA 4WUBA 2HKJA 1DARA 4P52A 1HR0I 4DU8A 4X65I 4WUCA 4P7AA 1IBKE 4X64I 3WU5A 2OI2A 1H72C 1IBME 2UU9E 1OJ4A 3PYGA 5IWAE 3J81C 2E1RA 1QZRA 3Q6NA 4DV4I 3ZZ0A 2Z5BB 2VQEE 3T1HE 4PU9A 5BR8E 2R42A 5IT9Q 4LF7E 1U2RA 4DV6E 4X65E 4JV5E 2E5LI 1S4EA 4JG4A 5A2QC 5FLXC 4HXZA 2UXCI 2VQFI 1H7SA 4GKKI 4NXNE 3V2UC 5IWAI 2O1WA 1RR9A 4LF6E 1N33E 4DV4E 5BR8I 3ZZTA 2LJPA 5FWKA 2A2CA 4LF7I 4JI8I 4FW9A 3T1YI 3GONA 4OX9E 1EA6A 4IZJA 3QT6A 2J7KA 4LFCE 2UXCE 1N0VC 1Z5BA 3F0NA 3WU3A 3LTOA 4AQYE 1N36I 4B3TE 4B3MI 1PIEA 3J81Q 3K1JA 1IBLE 4NXMI 3CWVA 1XMQI 4FN5A 4KHPI 4DR3I 4IZJD 2HKEA 4DR6E 1S16A 4GKJE 4DUYI 1FKAE 3H4LA 1VISA 2Z5CA 4YHHE 4DV6I 3V5RA 1IBKI 1Z0CA 4DU7A 1IBLI 4NXME 2UU9I 1NHHA 1XMQE 4EMDA 2VQFE 2UUCI 5LMNI 1KIJA 4USKA 1FWLA 2O1TA 4B3SE 1MX0A 4HY1A 4LF9E 3T1YE 1Z0BA 4MYTA 1HNXE 4LFCI 4NXNI 4ZVIA 1ZM3A 4B3RI 4FWHA 4JI5I 4B3TI 4AQYI 1N36E 4JI0E 5GMDA 3LNUA 1USUA 4X62I 1MG7A 4DR1E 1B63A 4LF5E 1Y4SA 1MU5A 1ZXNA 4DV5I 2UUBI 2NPFA 4GKJI 1HNXI 1FNMA 2HK2A 2DEIA 1Z5AA 4YHHI 4ED4A 3WU6A 3J7AM 4JV5I 2E5LE 4JI0I 2O1VA 3J80Q 2Z5BA 4X62E 5LL6R 1KKHA 4HYMA 1XHKA 4DR3E 3QT7A 2ZBKB 4LF6I 4LFBE 4LF4E 4B3SI 4YY3E 1XMOE 4LF8I 4IZKA 4DV3I 2IOQA 4DV0I 4LF9I 4DR5I 3QT5A 5LMNE 2ZITA 1H7UA 1ZXMA 4JI6I 4B3RE 4DV1I 4JI5E 4DPTA 4LFBI 2O1UA 2CZ9A 2F4VI 1EI1A 3HULA 2AJ4A 3QT8A 4DR6I 4JI3E 4RPFA 4DUYE 1Y4UA 2PNLA 4K0KI 5GMEA 1HK7A 3WU4A 2IOPA 3HJCA 2HFUA 1XNRI 2EFGA 4JI4I 2ZM6E 1Z0GA 1D6TA 4DR1I 1PVGA 4LF5I 3OTOE 1Y6ZA 3B8HA 1K47A 4DV5E 2UXDE 1FJGI 1RREA 2HK3A 5IT9C 4DV7I 2PNMA 4JI2E 4JYAE 2UUAI 3JAMQ 1XNRE 1HNZI 4JI4E 4Z7CA 5FLXQ 4KQVA 4XTJA 3PYFA 4IZKB 2V34A 3OTOI 3ZKDA 4JI6E 2CG9A 1A6FA 2CGEA 4PRXA 2UXDI 4UTGA 1Z59A 2XEXA 4LF4I 4DV3E 1Z0VA 4MYUA 4DV0E 4DV7E 1ZM4A 1ZM2A 2UUAE 1HNWE 4WUDA 3ZZUA 4DPWA 4DR4E 4JI1I 2UUBE 1B62A 1HNZE 1I94E 2X7IA 2HHHI 4DV1E 4X66I 3JAMC 4LFAE 1N32I 2R3VA 2WW4A 1ELOA 4DPUA 1N0UA 1IBMI 4FWDA 4R1FA 4DR2E 1J5EI 2DEJA 3P06A 2F4VE 1BKNA 1KTVA 5A2QQ 3ZKBA 1HNWI 3Q6MA 4DR4I 4DUZE 4JI1E 3LPSA 1FJGE 4YY3I 1XMOI 2Q2EB 4LF8E 4K0KE 3K85A 2UXBI 4JI2I 4JYAI 1UEKA 3Q1QA 1Z0TA 2VF3A 4X66E 3J7AG 3ZM7A 4DR5E 4JI7E 4LFAI 2ZM6I 4IZJB 1N32E 4DPXA 5LMUE 4DR7E 1HR0E 3PYEA 1N34E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FWK A;  4DV2 E;  4DUZ I;  1XNQ I;  4X64 E;  3J80 C;  4USM A;  4HAC B;  1NHI A;  4JI3 I;  3D4J A;  2V2Q A;  4PRV A;  4JI7 I;  5LMU I;  2BV3 A;  1ZM9 A;  1PKP A;  1I94 I;  1FI4 A;  4DPY A;  2BM1 A;  1NZ0 A;  3PYD A;  4B3M E;  5L3J A;  4DV2 I;  1XNQ E;  4KHP E;  4URL A;  4GKK E;  1Z0W A;  4Z7Y A;  3B78 A;  2V8P A;  2A2D A;  1Z5C A;  3M6A A;  2VQE I;  3T1H I;  4HAC A;  4M1K A;  4FWG A;  2V2Z A;  3B82 A;  3K17 A;  1WUU A;  2HHH E;  4JI8 E;  4I3H A;  2UXB E;  2X36 A;  4UT4 A;  2HFS A;  2GS8 A;  1H74 A;  4DR2 I;  1J5E E;  4DR7 I;  1NHJ A;  2UUC E;  2BM0 A;  2V2V A;  1H73 A;  1N34 I;  1N33 I;  1Z0E A;  4OX9 I;  1KVK A;  4DXL A;  4WUB A;  2HKJ A;  1DAR A;  4P52 A;  1HR0 I;  4DU8 A;  4X65 I;  4WUC A;  4P7A A;  1IBK E;  4X64 I;  3WU5 A;  2OI2 A;  1H72 C;  1IBM E;  2UU9 E;  1OJ4 A;  3PYG A;  5IWA E;  3J81 C;  2E1R A;  1QZR A;  4DV4 I;  3ZZ0 A;  2VQE E;  3T1H E;  4PU9 A;  5BR8 E;  2R42 A;  5IT9 Q;  4LF7 E;  1U2R A;  4DV6 E;  4X65 E;  4JV5 E;  2E5L I;  1S4E A;  4JG4 A;  5A2Q C;  5FLX C;  4HXZ A;  2UXC I;  2VQF I;  1H7S A;  4GKK I;  4NXN E;  3V2U C;  5IWA I;  1RR9 A;  4LF6 E;  1N33 E;  4DV4 E;  5BR8 I;  3ZZT A;  2LJP A;  2A2C A;  4LF7 I;  4JI8 I;  4FW9 A;  3T1Y I;  3GON A;  4OX9 E;  1EA6 A;  3QT6 A;  2J7K A;  4LFC E;  2UXC E;  1N0V C;  1Z5B A;  3F0N A;  3WU3 A;  3LTO A;  4AQY E;  1N36 I;  4B3T E;  4B3M I;  1PIE A;  3J81 Q;  3K1J A;  1IBL E;  4NXM I;  3CWV A;  1XMQ I;  4FN5 A;  4KHP I;  4DR3 I;  2HKE A;  4DR6 E;  1S16 A;  4GKJ E;  4DUY I;  1FKA E;  3H4L A;  1VIS A;  4YHH E;  4DV6 I;  3V5R A;  1IBK I;  1Z0C A;  4DU7 A;  1IBL I;  4NXM E;  2UU9 I;  1NHH A;  1XMQ E;  4EMD A;  2VQF E;  2UUC I;  5LMN I;  1KIJ A;  4USK A;  1FWL A;  4B3S E;  1MX0 A;  4HY1 A;  4LF9 E;  3T1Y E;  1Z0B A;  4MYT A;  1HNX E;  4LFC I;  4NXN I;  4ZVI A;  1ZM3 A;  4B3R I;  4FWH A;  4JI5 I;  4B3T I;  4AQY I;  1N36 E;  4JI0 E;  5GMD A;  3LNU A;  4X62 I;  1MG7 A;  4DR1 E;  1B63 A;  4LF5 E;  1MU5 A;  1ZXN A;  4DV5 I;  2UUB I;  2NPF A;  4GKJ I;  1HNX I;  1FNM A;  2HK2 A;  2DEI A;  1Z5A A;  4YHH I;  4ED4 A;  3WU6 A;  3J7A M;  4JV5 I;  2E5L E;  4JI0 I;  3J80 Q;  4X62 E;  5LL6 R;  1KKH A;  4HYM A;  1XHK A;  3QT7 A;  4DR3 E;  2ZBK B;  4LF6 I;  4LFB E;  4LF4 E;  4B3S I;  4YY3 E;  1XMO E;  4LF8 I;  4DV3 I;  4DV0 I;  4LF9 I;  4DR5 I;  3QT5 A;  5LMN E;  2ZIT A;  1H7U A;  1ZXM A;  4JI6 I;  4B3R E;  4DV1 I;  4JI5 E;  4DPT A;  4LFB I;  2CZ9 A;  2F4V I;  1EI1 A;  3HUL A;  2AJ4 A;  3QT8 A;  4DR6 I;  4JI3 E;  4RPF A;  4DUY E;  4K0K I;  5GME A;  3WU4 A;  2HFU A;  1XNR I;  2EFG A;  4JI4 I;  2ZM6 E;  1Z0G A;  1D6T A;  4DR1 I;  1PVG A;  4LF5 I;  3OTO E;  3B8H A;  1K47 A;  4DV5 E;  2UXD E;  1FJG I;  1RRE A;  2HK3 A;  5IT9 C;  4DV7 I;  4JI2 E;  4JYA E;  2UUA I;  3JAM Q;  1XNR E;  1HNZ I;  4JI4 E;  4Z7C A;  5FLX Q;  4KQV A;  4XTJ A;  3PYF A;  2V34 A;  3OTO I;  3ZKD A;  4JI6 E;  1A6F A;  4PRX A;  2UXD I;  4UTG A;  1Z59 A;  2XEX A;  4LF4 I;  4DV3 E;  1Z0V A;  4MYU A;  4DV0 E;  4DV7 E;  1ZM4 A;  1ZM2 A;  2UUA E;  1HNW E;  4WUD A;  3ZZU A;  4DPW A;  4DR4 E;  4JI1 I;  2UUB E;  1B62 A;  1HNZ E;  1I94 E;  2X7I A;  2HHH I;  4DV1 E;  4X66 I;  3JAM C;  4LFA E;  1N32 I;  2R3V A;  2WW4 A;  1ELO A;  4DPU A;  1N0U A;  1IBM I;  4FWD A;  4R1F A;  4DR2 E;  1J5E I;  2DEJ A;  2F4V E;  1BKN A;  1KTV A;  5A2Q Q;  3ZKB A;  1HNW I;  4DR4 I;  4DUZ E;  4JI1 E;  3LPS A;  1FJG E;  4YY3 I;  1XMO I;  2Q2E B;  4LF8 E;  4K0K E;  2UXB I;  4JI2 I;  4JYA I;  1UEK A;  3Q1Q A;  1Z0T A;  2VF3 A;  4X66 E;  3J7A G;  3ZM7 A;  4DR5 E;  4JI7 E;  4LFA I;  2ZM6 I;  1N32 E;  4DPX A;  5LMU E;  4DR7 E;  1HR0 E;  3PYE A;  1N34 E; 
#chains in the Genus database with same CATH topology
 1FWK A;  4DV2 E;  4MQY A;  4DUZ I;  1XNQ I;  4X64 E;  3J80 C;  4USM A;  2C38 A;  4HAC B;  1NHI A;  2JEB A;  1USV A;  2BA0 G;  2BA0 D;  2GQ0 A;  4JI3 I;  3D4J A;  2V2Q A;  4PRV A;  4JI7 I;  5LMU I;  5JEA D;  2BV3 A;  1PKP A;  1ZM9 A;  4GQU A;  4OO1 E;  1I94 I;  1FI4 A;  2Z5C B;  4DPY A;  2BM1 A;  2JEB B;  3H1C A;  1NZ0 A;  3PYD A;  4B3M E;  5L3J A;  2JE6 B;  4OO1 B;  4DV2 I;  1XNQ E;  3PRY A;  5JEA B;  4URL A;  4KHP E;  4GKK E;  2IER A;  1Z0W A;  4Z7Y A;  3B78 A;  2V8P A;  2A2D A;  1Z5C A;  3M6A A;  2VQE I;  3T1H I;  4HAC A;  4M1K A;  4FWG A;  2V2Z A;  1YH8 A;  3B82 A;  2PNZ A;  1WUU A;  3K17 A;  4N3O A;  2PNZ B;  2HHH E;  4JI8 E;  4I3H A;  2UXB E;  2X36 A;  4UT4 A;  2HFS A;  2GS8 A;  1H74 A;  4DR2 I;  1J5E E;  4DR7 I;  1NHJ A;  1UDO A;  2UUC E;  2BM0 A;  2V2V A;  1H73 A;  2NN6 D;  2WNR B;  1N34 I;  2C38 B;  1N33 I;  3U1K A;  2IES A;  2PO1 B;  4IFD A;  1Z0E A;  5EL9 A;  4OX9 I;  2C39 B;  1KVK A;  2NN6 B;  4DXL A;  2Z5E A;  5K36 D;  5C0X F;  4WUB A;  2HKJ A;  1DAR A;  4P52 A;  1HR0 I;  4QNJ A;  2PO0 A;  4DU8 A;  4X65 I;  4WUC A;  4P7A A;  1IBK E;  4LOM A;  4X64 I;  4IFD C;  3WU5 A;  2NN6 A;  1H72 C;  2OI2 A;  1IBM E;  2UU9 E;  4OKG A;  1OJ4 A;  3PYG A;  5IWA E;  3J81 C;  2E1R A;  3DD6 A;  3UHM A;  1QZR A;  3Q6N A;  4DV4 I;  3ZZ0 A;  1E3H A;  5K36 C;  2Z5B B;  2VQE E;  3T1H E;  4PU9 A;  5BR8 E;  3GLL A;  4FW3 A;  2R42 A;  5IT9 Q;  4LF7 E;  1U2R A;  4DV6 E;  3L7Z A;  4X65 E;  4JV5 E;  3GME A;  2C37 B;  2E5L I;  1P42 A;  1S4E A;  4JG4 A;  2C37 A;  5A2Q C;  5FLX C;  4HXZ A;  2AE8 A;  2UXC I;  2VQF I;  1H7S A;  4GKK I;  4NXN E;  3M7N G;  3V2U C;  5IWA I;  2O1W A;  5K36 A;  4AIM A;  1RR9 A;  4LF6 E;  1N33 E;  4DV4 E;  1VI7 A;  4LCH A;  5BR8 I;  3ZZT A;  2LJP A;  5FWK A;  2A2C A;  4LF7 I;  4JI8 I;  4FW9 A;  3T1Y I;  3GON A;  4OX9 E;  5JEA F;  1EA6 A;  4IZJ A;  3QT6 A;  4OO1 F;  3GCM A;  2J7K A;  1Y5Y A;  4LFC E;  2UXC E;  1Z5B A;  1N0V C;  3F0N A;  3WU3 A;  2PO2 B;  3LTO A;  4AQY E;  1N36 I;  4B3T E;  4B3M I;  3PS1 A;  1PIE A;  3J81 Q;  3K1J A;  2J65 A;  1IBL E;  4NXM I;  3PS3 A;  3CWV A;  1XMQ I;  1UDN A;  4FN5 A;  4KHP I;  3U1Y A;  4AM3 A;  4DR3 I;  4IZJ D;  2HKE A;  2PO0 B;  4DR6 E;  5DRQ A;  1S16 A;  5DRR A;  3M85 G;  4NBQ A;  4GKJ E;  4DUY I;  1FKA E;  3H4L A;  1VIS A;  2Z5C A;  4YHH E;  4LCG A;  4OO1 C;  4DV6 I;  3V5R A;  4IS9 A;  2WP8 B;  1IBK I;  1Z0C A;  4DU7 A;  1IBL I;  4NXM E;  2UU9 I;  1NHH A;  1XMQ E;  4EMD A;  2VQF E;  1XXE A;  2O3Z A;  2UUC I;  5LMN I;  1KIJ A;  4USK A;  1FWL A;  5DRP A;  2WP8 A;  2O1T A;  4B3S E;  4OO1 A;  1MX0 A;  5K36 F;  4HY1 A;  4LF9 E;  3T1Y E;  1Z0B A;  5ELW A;  4MYT A;  2CVE A;  1HNX E;  4LFC I;  4NXN I;  2JEA B;  1OYS A;  4ZVI A;  4J3D A;  1ZM3 A;  4B3R I;  4FWH A;  4JI5 I;  4AQY I;  1N36 E;  4B3T I;  4JI0 E;  5GMD A;  1OYR A;  3LNU A;  1USU A;  4X62 I;  1MG7 A;  2F1D A;  4DR1 E;  1B63 A;  2NN6 C;  4LF5 E;  2PO2 A;  3KRN A;  3P76 A;  1Y4S A;  1MU5 A;  1ZXN A;  4DV5 I;  2UUB I;  2NPF A;  2VES A;  4GKJ I;  1HNX I;  1FNM A;  2HK2 A;  2DEI A;  1Z5A A;  3L7Z B;  4YHH I;  4ED4 A;  3WU6 A;  3J7A M;  4LPF A;  4JV5 I;  4IFD B;  2E5L E;  2BR2 B;  3PS2 A;  4JI0 I;  2O1V A;  3J80 Q;  2Z5B A;  4X62 E;  5LL6 R;  1KKH A;  4HYM A;  1XHK A;  3QT7 A;  4DR3 E;  5K36 B;  2ZBK B;  4LF6 I;  3M85 D;  4IFD D;  1UDS A;  4LFB E;  4MU0 A;  4BA2 A;  4LF4 E;  4B3S I;  4YY3 E;  1XMO E;  4LF8 I;  4IZK A;  4DV3 I;  4OO1 D;  2WNR A;  2IOQ A;  5JEA E;  4DV0 I;  4OZE A;  4LF9 I;  4DR5 I;  3QT5 A;  1Y60 A;  5LMN E;  2ZIT A;  1H7U A;  1ZXM A;  4JI6 I;  3CDJ A;  4B3R E;  4DV1 I;  4JI5 E;  4DPT A;  4LFB I;  2O1U A;  4FW4 A;  2CZ9 A;  2JEA A;  2F4V I;  5DNX A;  1EI1 A;  3HUL A;  2AJ4 A;  3QT8 A;  4LCF A;  4DR6 I;  4JI3 E;  4RPF A;  4DUY E;  4BA1 B;  1Y4U A;  4U3D A;  2PNL A;  4K0K I;  5GME A;  5DRO A;  1R6L A;  1HK7 A;  3WU4 A;  2IOP A;  3HJC A;  2HFU A;  1XNR I;  2EFG A;  4JI4 I;  2ZM6 E;  2GO4 A;  1Z0G A;  1D6T A;  4FW7 A;  4DR1 I;  1PVG A;  4LF5 I;  3OTO E;  4ISA A;  1Y6Z A;  3B8H A;  1K47 A;  4DV5 E;  2BR2 A;  2UXD E;  1FJG I;  1RRE A;  2JE6 A;  1UDQ A;  3P3G A;  5C0X C;  2HK3 A;  1R6M A;  3B4T A;  5IT9 C;  4DV7 I;  2PNM A;  4JI2 E;  4JYA E;  2UUA I;  2BA1 G;  3JAM Q;  3CDI A;  1XNR E;  2BA1 D;  1HNZ I;  1YHC A;  4JI4 E;  4Z7C A;  5FLX Q;  4KQV A;  4XTJ A;  3PYF A;  4IZK B;  2C39 A;  2V34 A;  3OTO I;  4MU3 A;  3ZKD A;  4JI6 E;  2CG9 A;  5EKW A;  1A6F A;  2CGE A;  4PRX A;  2UXD I;  4UTG A;  5C0X A;  1Z59 A;  2NN6 F;  2XEX A;  4LF4 I;  4IFD E;  4FW5 A;  4DV3 E;  1Z0V A;  3P3E A;  4MYU A;  4DV0 E;  4DV7 E;  1ZM2 A;  1ZM4 A;  2UUA E;  1HNW E;  3ZZU A;  4WUD A;  4DPW A;  4DR4 E;  4JI1 I;  1OYP A;  2UUB E;  5K36 E;  1B62 A;  1HNZ E;  2GO3 A;  1I94 E;  2X7I A;  2HHH I;  5C0X D;  4U3B A;  2PO1 A;  4DV1 E;  4X66 I;  4QNK A;  3JAM C;  4LFA E;  1N32 I;  2R3V A;  2WW4 A;  1ELO A;  4DPU A;  1N0U A;  2NN6 E;  1IBM I;  4FWD A;  4R1F A;  4IFD F;  3P3C A;  4MU4 A;  4DR2 E;  1J5E I;  2DEJ A;  4AID A;  3P06 A;  2F4V E;  1BKN A;  5C0X B;  3M7N D;  1KTV A;  5A2Q Q;  4MDT A;  3ZKB A;  1HNW I;  3Q6M A;  5JEA C;  4DR4 I;  4DUZ E;  4JI1 E;  3LPS A;  1FJG E;  4FW6 A;  5C0X E;  3HKM A;  4YY3 I;  1E3P A;  1XMO I;  2Q2E B;  4LF8 E;  4K0K E;  3K85 A;  2UXB I;  4JI2 I;  4JYA I;  1UEK A;  4BA1 A;  3Q1Q A;  1Z0T A;  2VF3 A;  4X66 E;  3J7A G;  3ZM7 A;  4MU1 A;  2JT2 A;  4DR5 E;  4JI7 E;  4LFA I;  3NZK A;  4IZJ B;  5DNL A;  2ZM6 I;  1N32 E;  4DPX A;  5LMU E;  1RHY A;  4DR7 E;  1HR0 E;  4BA2 B;  3PYE A;  5JEA A;  1N34 E; 
#chains in the Genus database with same CATH homology
 1FWK A;  4DV2 E;  4DUZ I;  1XNQ I;  4X64 E;  3J80 C;  4USM A;  4HAC B;  1NHI A;  1USV A;  2GQ0 A;  4JI3 I;  3D4J A;  2V2Q A;  4PRV A;  4JI7 I;  5LMU I;  2BV3 A;  1ZM9 A;  1PKP A;  1I94 I;  1FI4 A;  2Z5C B;  4DPY A;  2BM1 A;  1NZ0 A;  3PYD A;  4B3M E;  5L3J A;  4DV2 I;  1XNQ E;  3PRY A;  4KHP E;  4URL A;  4GKK E;  1Z0W A;  4Z7Y A;  3B78 A;  2V8P A;  2A2D A;  1Z5C A;  3M6A A;  2VQE I;  3T1H I;  4HAC A;  4M1K A;  4FWG A;  2V2Z A;  3B82 A;  3K17 A;  1WUU A;  4N3O A;  2HHH E;  4JI8 E;  4I3H A;  2UXB E;  2X36 A;  4UT4 A;  2HFS A;  2GS8 A;  1H74 A;  4DR2 I;  1J5E E;  4DR7 I;  1NHJ A;  2UUC E;  2BM0 A;  2V2V A;  1H73 A;  1N34 I;  1N33 I;  1Z0E A;  4OX9 I;  1KVK A;  4DXL A;  2Z5E A;  4WUB A;  2HKJ A;  1DAR A;  4P52 A;  1HR0 I;  4DU8 A;  4X65 I;  4WUC A;  4P7A A;  1IBK E;  4X64 I;  3WU5 A;  2OI2 A;  1H72 C;  1IBM E;  2UU9 E;  1OJ4 A;  3PYG A;  5IWA E;  3J81 C;  2E1R A;  1QZR A;  3Q6N A;  4DV4 I;  3ZZ0 A;  2Z5B B;  2VQE E;  3T1H E;  4PU9 A;  5BR8 E;  2R42 A;  5IT9 Q;  4LF7 E;  1U2R A;  4DV6 E;  4X65 E;  4JV5 E;  2E5L I;  1S4E A;  4JG4 A;  5A2Q C;  5FLX C;  4HXZ A;  2UXC I;  2VQF I;  1H7S A;  4GKK I;  4NXN E;  3V2U C;  5IWA I;  2O1W A;  1RR9 A;  4LF6 E;  1N33 E;  4DV4 E;  5BR8 I;  3ZZT A;  2LJP A;  5FWK A;  2A2C A;  4LF7 I;  4JI8 I;  4FW9 A;  3T1Y I;  3GON A;  4OX9 E;  1EA6 A;  4IZJ A;  3QT6 A;  2J7K A;  4LFC E;  2UXC E;  1N0V C;  1Z5B A;  3F0N A;  3WU3 A;  3LTO A;  4AQY E;  1N36 I;  4B3T E;  4B3M I;  1PIE A;  3J81 Q;  3K1J A;  1IBL E;  4NXM I;  3CWV A;  1XMQ I;  4FN5 A;  4KHP I;  4DR3 I;  4IZJ D;  2HKE A;  4DR6 E;  1S16 A;  4GKJ E;  4DUY I;  1FKA E;  3H4L A;  1VIS A;  2Z5C A;  4YHH E;  4DV6 I;  3V5R A;  1IBK I;  1Z0C A;  4DU7 A;  1IBL I;  4NXM E;  2UU9 I;  1NHH A;  1XMQ E;  4EMD A;  2VQF E;  2UUC I;  5LMN I;  1KIJ A;  4USK A;  1FWL A;  2O1T A;  4B3S E;  1MX0 A;  4HY1 A;  4LF9 E;  3T1Y E;  1Z0B A;  4MYT A;  1HNX E;  4LFC I;  4NXN I;  4ZVI A;  1ZM3 A;  4B3R I;  4FWH A;  4JI5 I;  4B3T I;  4AQY I;  1N36 E;  4JI0 E;  5GMD A;  3LNU A;  1USU A;  4X62 I;  1MG7 A;  4DR1 E;  1B63 A;  4LF5 E;  1Y4S A;  1MU5 A;  1ZXN A;  4DV5 I;  2UUB I;  2NPF A;  4GKJ I;  1HNX I;  1FNM A;  2HK2 A;  2DEI A;  1Z5A A;  4YHH I;  4ED4 A;  3WU6 A;  3J7A M;  4JV5 I;  2E5L E;  4JI0 I;  2O1V A;  3J80 Q;  2Z5B A;  4X62 E;  5LL6 R;  1KKH A;  4HYM A;  1XHK A;  4DR3 E;  3QT7 A;  2ZBK B;  4LF6 I;  4LFB E;  4LF4 E;  4B3S I;  4YY3 E;  1XMO E;  4LF8 I;  4IZK A;  4DV3 I;  2IOQ A;  4DV0 I;  4LF9 I;  4DR5 I;  3QT5 A;  5LMN E;  2ZIT A;  1H7U A;  1ZXM A;  4JI6 I;  4B3R E;  4DV1 I;  4JI5 E;  4DPT A;  4LFB I;  2O1U A;  2CZ9 A;  2F4V I;  1EI1 A;  3HUL A;  2AJ4 A;  3QT8 A;  4DR6 I;  4JI3 E;  4RPF A;  4DUY E;  1Y4U A;  2PNL A;  4K0K I;  5GME A;  1HK7 A;  3WU4 A;  2IOP A;  3HJC A;  2HFU A;  1XNR I;  2EFG A;  4JI4 I;  2ZM6 E;  1Z0G A;  1D6T A;  4DR1 I;  1PVG A;  4LF5 I;  3OTO E;  1Y6Z A;  3B8H A;  1K47 A;  4DV5 E;  2UXD E;  1FJG I;  1RRE A;  2HK3 A;  5IT9 C;  4DV7 I;  2PNM A;  4JI2 E;  4JYA E;  2UUA I;  3JAM Q;  1XNR E;  1HNZ I;  4JI4 E;  4Z7C A;  5FLX Q;  4KQV A;  4XTJ A;  3PYF A;  4IZK B;  2V34 A;  3OTO I;  3ZKD A;  4JI6 E;  2CG9 A;  1A6F A;  2CGE A;  4PRX A;  2UXD I;  4UTG A;  1Z59 A;  2XEX A;  4LF4 I;  4DV3 E;  1Z0V A;  4MYU A;  4DV0 E;  4DV7 E;  1ZM4 A;  1ZM2 A;  2UUA E;  1HNW E;  4WUD A;  3ZZU A;  4DPW A;  4DR4 E;  4JI1 I;  2UUB E;  1B62 A;  1HNZ E;  1I94 E;  2X7I A;  2HHH I;  4DV1 E;  4X66 I;  3JAM C;  4LFA E;  1N32 I;  2R3V A;  2WW4 A;  1ELO A;  4DPU A;  1N0U A;  1IBM I;  4FWD A;  4R1F A;  4DR2 E;  1J5E I;  2DEJ A;  3P06 A;  2F4V E;  1BKN A;  1KTV A;  5A2Q Q;  3ZKB A;  1HNW I;  3Q6M A;  4DR4 I;  4DUZ E;  4JI1 E;  3LPS A;  1FJG E;  4YY3 I;  1XMO I;  2Q2E B;  4LF8 E;  4K0K E;  3K85 A;  2UXB I;  4JI2 I;  4JYA I;  1UEK A;  3Q1Q A;  1Z0T A;  2VF3 A;  4X66 E;  3J7A G;  3ZM7 A;  4DR5 E;  4JI7 E;  4LFA I;  2ZM6 I;  4IZJ B;  1N32 E;  4DPX A;  5LMU E;  4DR7 E;  1HR0 E;  3PYE A;  1N34 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...