4DUYI

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome
publication title A structural basis for streptomycin resistance
rcsb
total genus 26
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4duyI00
4I3HA 4PU9A 1FKAE 4DXLA 4NXNI 3T1YI 4LFBE 3PYGA 1U2RA 4LF5I 1HR0I 4KHPI 3PYDA 4JI6E 1Z5BA 4USKA 2UUAE 2DEIA 1Z5CA 1ZM9A 2X36A 2R3VA 5FLXQ 1N0UA 5GMDA 2VF3A 5LMNE 4DPUA 4K0KI 4DV6E 2V2QA 1J5EI 4HY1A 2UUCI 1N33E 3QT5A 4DU8A 3J80C 2VQFE 3H4LA 4PRVA 3T1HI 1IBME 1IBMI 4MYTA 1FI4A 4LFCE 1N32I 4DV3E 2EFGA 3LNUA 1N36I 5L3JA 1K47A 1Z0CA 2GS8A 1Z0TA 4DV6I 3K1JA 1HNZI 2UXDE 1KIJA 4DR3E 3ZZTA 4AQYI 4DR3I 4LFBI 3B82A 4X66I 2HFUA 4X66E 1XHKA 1MU5A 4B3RI 4HACB 2ZM6I 2F4VI 1Z5AA 5A2QC 4X65I 1ZM2A 4HXZA 1FWLA 1A6FA 4JI5I 3K17A 4M1KA 4JV5I 2HK2A 1FJGE 1J5EE 4P52A 1IBKI 1PKPA 4JI3I 1FWKA 4X62I 4X64I 1KVKA 1ZXNA 1XNQE 4WUDA 4NXNE 2V2ZA 2Q2EB 4JI2I 2AJ4A 4MYUA 5LMNI 2HKJA 1N0VC 4JYAE 3B78A 4DR7I 1N36E 2E1RA 4JG4A 2HKEA 2V8PA 1BKNA 4YHHI 4DUZI 2X7IA 3ZM7A 4JI5E 2J7KA 5A2QQ 4DUYI 4DV7I 1XMOI 1H7UA 2ZITA 4EMDA 2UUCE 4DR5I 1MX0A 4GKKE 1B63A 4JI7E 4LF9E 1HNZE 1N34I 4Z7YA 4B3SE 3T1HE 3WU4A 5IT9C 3J80Q 2UUAI 1HNXE 3WU3A 5LMUE 1N32E 3GONA 5BR8I 2DEJA 4NXME 2UXCI 4DPWA 1Z0BA 4LF8I 4DV2E 1XNQI 4DPTA 4AQYE 4P7AA 2UXDI 1FNMA 4JI8I 4DR2I 1OJ4A 4DPYA 3ZZUA 1H74A 1S16A 2NPFA 4ED4A 4YY3E 3WU6A 4JI0I 3OTOE 3ZKDA 3LPSA 4UTGA 3J81C 4JI4E 3J7AM 4JI2E 4DV0E 4HYMA 1ZXMA 1B62A 2R42A 4B3TE 3WU5A 1PVGA 1D6TA 4DV5I 2HHHE 2ZM6E 2F4VE 2HK3A 4DR6I 2BM0A 5BR8E 4DPXA 4DR4E 4DV3I 3OTOI 2HFSA 2CZ9A 4OX9I 4FW9A 3QT7A 1ELOA 4DV1E 4FWHA 4DV4I 3HULA 1HR0E 1HNWI 4Z7CA 3JAMQ 4DV2I 4YHHE 1S4EA 4ZVIA 1NHJA 1RREA 4UT4A 2VQEE 4JI1E 4DV7E 2HHHI 1WUUA 1XNRE 1NZ0A 2UXBI 3F0NA 2UXBE 4LF8E 1KKHA 1EI1A 4LF7I 1Z0GA 2BM1A 4YY3I 4FWGA 4OX9E 4X65E 2UUBI 5LL6R 4JI3E 4URLA 1IBLE 2BV3A 4DR1E 4DV0I 4JI4I 4LFAI 2UXCE 1Z0VA 4FWDA 1PIEA 1XMQE 2UU9I 4GKKI 4JI7I 4RPFA 4DV1I 4WUCA 2V34A 4XTJA 5LMUI 2E5LE 3CWVA 1I94E 4PRXA 2XEXA 4DR1I 1Z59A 2VQEI 3Q1QA 4B3MI 4R1FA 4DV5E 4DV4E 3J7AG 4JYAI 1XMOE 3ZZ0A 2A2CA 5IWAI 1XNRI 3ZKBA 4DUZE 1I94I 2VQFI 4X62E 4X64E 1RR9A 3QT6A 1XMQI 2V2VA 1ZM3A 4FN5A 4JI1I 4LF4E 4USMA 1IBLI 2LJPA 4DR7E 4LFAE 3V5RA 4DR5E 1QZRA 1EA6A 4DR6E 1IBKE 2WW4A 4LF7E 3PYFA 2ZBKB 4JI6I 4DUYE 4LF6E 1UEKA 4WUBA 1KTVA 2E5LI 3T1YE 5IWAE 1Z0WA 1ZM4A 4LF9I 3V2UC 4DR4I 1N33I 2UU9E 3B8HA 4KHPE 4B3ME 5GMEA 2OI2A 1H73A 1VISA 4B3SI 5FLXC 1MG7A 1FJGI 1HNXI 3D4JA 4JI0E 3M6AA 4K0KE 3QT8A 1HNWE 3J81Q 1DARA 1H7SA 4GKJE 4KQVA 4JI8E 3LTOA 4B3TI 1H72C 4B3RE 1NHIA 3JAMC 2UUBE 4NXMI 4LF4I 3PYEA 4LF6I 1N34E 4DR2E 4GKJI 4JV5E 4LF5E 2A2DA 4LFCI 1NHHA 4HACA 4DU7A 5IT9Q 1Z0EA
chains in the Genus database with same CATH superfamily
2BA1G 1Y60A 3P76A 4I3HA 4PU9A 2O1VA 2NN6E 2C39B 1UDSA 3PRYA 1FKAE 4DXLA 2PNZA 4NXNI 1UDQA 3T1YI 4FW3A 4LFBE 5K36D 3PYGA 5EKWA 1U2RA 4LF5I 1HR0I 4QNKA 4BA1A 2PO2A 4QNJA 4KHPI 3PS3A 3PYDA 4FW5A 4JI6E 1Z5BA 4USKA 2UUAE 2DEIA 4IZJA 1Z5CA 1ZM9A 1USUA 2X36A 2R3VA 5FLXQ 1N0UA 5GMDA 2VF3A 5LMNE 4DPUA 4K0KI 5DRRA 5K36B 2C37A 4DV6E 2PO2B 2V2QA 1J5EI 4HY1A 2UUCI 1N33E 2BR2A 3QT5A 4DU8A 1R6LA 3J80C 2VQFE 3H4LA 4PRVA 3T1HI 1IBME 4BA2B 4MU0A 1IBMI 4MYTA 1FI4A 4FW6A 2JE6A 4LFCE 2BA1D 1N32I 4OO1C 4OZEA 4DV3E 2EFGA 3LNUA 1N36I 4GQUA 4IZKA 5L3JA 1K47A 1Z0CA 2GS8A 2NN6C 1Z0TA 4DV6I 3K1JA 2NN6F 3UHMA 1HNZI 2UXDE 1KIJA 4DR3E 3ZZTA 4AQYI 1XXEA 4DR3I 4LFBI 3B82A 4X66I 3GMEA 2C38A 2HFUA 4X66E 1Y4SA 4IZKB 1XHKA 1MU5A 2C38B 4B3RI 4HACB 2ZM6I 2F4VI 2PO0B 4MU1A 1Z5AA 2CVEA 2CG9A 2IERA 5A2QC 4X65I 1ZM2A 4HXZA 4AIDA 1FWLA 2O1TA 1A6FA 4JI5I 4FW4A 2Z5EA 3K17A 5C0XE 4M1KA 3M85D 1Y5YA 4JV5I 2HK2A 3GCMA 1FJGE 1YH8A 1J5EE 5K36A 4OO1B 4P52A 1IBKI 1PKPA 4JI3I 4IFDA 1VI7A 2BR2B 1FWKA 4X62I 4X64I 1KVKA 1ZXNA 1Y6ZA 1XNQE 4WUDA 4NXNE 2V2ZA 2Q2EB 4JI2I 2AJ4A 4MYUA 3DD6A 5LMNI 2HKJA 1N0VC 4JYAE 3B78A 4DR7I 1N36E 2E1RA 4JG4A 2HKEA 2V8PA 2GO3A 1BKNA 2BA0D 2PNZB 4YHHI 3U1KA 4DUZI 2X7IA 3ZM7A 4MQYA 4JI5E 1RHYA 2J7KA 2NN6A 3P3CA 3GLLA 5A2QQ 4DUYI 5DNLA 5FWKA 4DV7I 2WNRA 1XMOI 4IZJD 1H7UA 2ZITA 3L7ZA 4EMDA 2UUCE 4FW7A 2C39A 4DR5I 1MX0A 4GKKE 1B63A 4JI7E 4LF9E 4LCGA 3HJCA 1HNZE 1N34I 4Z7YA 4B3SE 3T1HE 3WU4A 2WP8B 5IT9C 3J80Q 2UUAI 2GQ0A 1HNXE 5JEAC 3WU3A 5LMUE 1N32E 2IESA 3GONA 2JE6B 5BR8I 2DEJA 4NXME 4BA2A 2UXCI 4AM3A 4DPWA 1Z0BA 4LF8I 4DV2E 1XNQI 4DPTA 4AQYE 4P7AA 2UXDI 1FNMA 4JI8I 4DR2I 1OJ4A 2PO1A 4DPYA 2JEAB 2PNLA 3ZZUA 1H74A 1S16A 4MU4A 2NPFA 4ED4A 4YY3E 2Z5CB 3WU6A 5JEAD 2JEBB 3CDJA 4IZJB 4JI0I 4IFDE 3OTOE 4NBQA 3ZKDA 3LPSA 4UTGA 3J81C 2AE8A 4JI4E 3J7AM 4JI2E 4DV0E 4HYMA 3Q6MA 1ZXMA 1B62A 1USVA 2R42A 4B3TE 3WU5A 1PVGA 1D6TA 4DV5I 3P3GA 2NN6B 2HHHE 2ZM6E 2F4VE 5JEAB 3M85G 2HK3A 4DR6I 2BM0A 5BR8E 4DPXA 4DR4E 4DV3I 5C0XD 3OTOI 2HFSA 2CZ9A 4OX9I 4IFDD 4FW9A 3QT7A 2JEAA 1ELOA 4DV1E 4FWHA 4DV4I 3HULA 1HR0E 1HNWI 4U3BA 2JT2A 4Z7CA 3JAMQ 2Z5BB 4DV2I 5C0XB 4YHHE 1S4EA 4ZVIA 1NHJA 1RREA 4UT4A 4MU3A 2VQEE 3U1YA 3M7NG 3PS2A 2NN6D 4JI1E 4IFDC 5DRPA 4DV7E 2PNMA 5DROA 2Z5BA 2HHHI 4J3DA 1WUUA 4IFDF 1XNRE 1NZ0A 1P42A 2UXBI 3F0NA 3B4TA 2UXBE 4LF8E 1KKHA 2WP8A 1EI1A 1Z0GA 4LF7I 5C0XF 2BM1A 4YY3I 4FWGA 1UDOA 4OX9E 1Y4UA 4X65E 2UUBI 5LL6R 4JI3E 4URLA 1IBLE 2BV3A 4DR1E 5JEAA 4DV0I 4JI4I 4LFAI 2UXCE 4LCHA 1Z0VA 4FWDA 4OO1E 1PIEA 1XMQE 2UU9I 4OKGA 4GKKI 4JI7I 4RPFA 4OO1F 1E3PA 1HK7A 4DV1I 4WUCA 2V34A 4XTJA 5LMUI 5K36E 4OO1D 1UDNA 2E5LE 3CWVA 1I94E 4PRXA 5K36F 2XEXA 4DR1I 1Z59A 2C37B 2PO1B 2VQEI 3Q1QA 4B3MI 4R1FA 5EL9A 4N3OA 4DV5E 4DV4E 3J7AG 4JYAI 1XMOE 2JEBA 3ZZ0A 2A2CA 5IWAI 1XNRI 3HKMA 2VESA 3ZKBA 1OYRA 4DUZE 1I94I 4MDTA 2VQFI 2O3ZA 4X62E 4X64E 3NZKA 1RR9A 2F1DA 4ISAA 3QT6A 1XMQI 2V2VA 5C0XA 1ZM3A 4FN5A 4LCFA 4JI1I 3PS1A 4LF4E 1YHCA 4USMA 1IBLI 2BA0G 2LJPA 4DR7E 4AIMA 4LFAE 3V5RA 4DR5E 1QZRA 1EA6A 4DR6E 1IBKE 2WW4A 4LF7E 3PYFA 2ZBKB 3K85A 4JI6I 4DUYE 4LF6E 1E3HA 3L7ZB 3CDIA 1UEKA 4IS9A 4WUBA 1KTVA 2E5LI 5ELWA 3T1YE 5IWAE 1Z0WA 1ZM4A 4LF9I 2IOPA 3P3EA 3V2UC 4DR4I 1N33I 2UU9E 3B8HA 3M7ND 4B3ME 5DNXA 4KHPE 1R6MA 5GMEA 2OI2A 1H73A 1VISA 4B3SI 5FLXC 1MG7A 1FJGI 1HNXI 3D4JA 4JI0E 2IOQA 3M6AA 4LOMA 2Z5CA 5C0XC 3Q6NA 4U3DA 2CGEA 4K0KE 4OO1A 3QT8A 1OYSA 1HNWE 4BA1B 3P06A 5JEAE 2O1WA 3J81Q 1DARA 1H7SA 2J65A 4GKJE 4KQVA 4JI8E 4IFDB 3LTOA 5JEAF 4B3TI 2GO4A 1H72C 3H1CA 4B3RE 5DRQA 1NHIA 3JAMC 4LPFA 2O1UA 2UUBE 2PO0A 4NXMI 4LF4I 3PYEA 4LF6I 3KRNA 1N34E 4DR2E 4GKJI 4JV5E 4LF5E 5K36C 2A2DA 4LFCI 1NHHA 4HACA 4DU7A 5IT9Q 2WNRB 1OYPA 1Z0EA
chains in the Genus database with same CATH topology
4I3HA 4PU9A 2O1VA 3PRYA 1FKAE 4DXLA 4NXNI 3T1YI 4LFBE 3PYGA 1U2RA 4LF5I 1HR0I 4KHPI 3PYDA 4JI6E 1Z5BA 4USKA 2UUAE 2DEIA 4IZJA 1Z5CA 1ZM9A 1USUA 2X36A 2R3VA 5FLXQ 1N0UA 5GMDA 2VF3A 5LMNE 4DPUA 4K0KI 4DV6E 2V2QA 1J5EI 4HY1A 2UUCI 1N33E 3QT5A 4DU8A 3J80C 2VQFE 3H4LA 4PRVA 3T1HI 1IBME 1IBMI 4MYTA 1FI4A 4LFCE 1N32I 4DV3E 2EFGA 3LNUA 1N36I 4IZKA 5L3JA 1K47A 1Z0CA 2GS8A 1Z0TA 4DV6I 3K1JA 1HNZI 2UXDE 1KIJA 4DR3E 3ZZTA 4AQYI 4DR3I 4LFBI 3B82A 4X66I 4X66E 2HFUA 1Y4SA 4IZKB 1XHKA 1MU5A 4B3RI 4HACB 2ZM6I 2F4VI 1Z5AA 2CG9A 5A2QC 4X65I 1ZM2A 4HXZA 1FWLA 2O1TA 1A6FA 4JI5I 2Z5EA 3K17A 4M1KA 4JV5I 2HK2A 1FJGE 1J5EE 4P52A 1IBKI 1PKPA 4JI3I 1FWKA 4X62I 4X64I 1KVKA 1ZXNA 1Y6ZA 1XNQE 4WUDA 4NXNE 2V2ZA 2Q2EB 4JI2I 2AJ4A 4MYUA 5LMNI 2HKJA 1N0VC 4JYAE 3B78A 4DR7I 1N36E 2E1RA 4JG4A 2HKEA 2V8PA 1BKNA 4YHHI 4DUZI 2X7IA 3ZM7A 4JI5E 2J7KA 5A2QQ 4DUYI 5FWKA 4DV7I 1XMOI 4IZJD 1H7UA 2ZITA 4EMDA 2UUCE 4DR5I 1MX0A 4GKKE 1B63A 4JI7E 4LF9E 3HJCA 1HNZE 1N34I 4Z7YA 4B3SE 3T1HE 3WU4A 5IT9C 3J80Q 2UUAI 2GQ0A 1HNXE 3WU3A 5LMUE 1N32E 3GONA 5BR8I 2DEJA 4NXME 2UXCI 4DPWA 1Z0BA 4LF8I 4DV2E 1XNQI 4DPTA 4AQYE 4P7AA 2UXDI 1FNMA 4JI8I 4DR2I 1OJ4A 4DPYA 2PNLA 3ZZUA 1H74A 1S16A 2NPFA 4ED4A 4YY3E 2Z5CB 3WU6A 4IZJB 4JI0I 3OTOE 3ZKDA 3LPSA 4UTGA 3J81C 4JI4E 3J7AM 4JI2E 4DV0E 4HYMA 3Q6MA 1ZXMA 1B62A 1USVA 2R42A 4B3TE 3WU5A 1PVGA 1D6TA 4DV5I 2HHHE 2ZM6E 2F4VE 2HK3A 4DR6I 2BM0A 5BR8E 4DPXA 4DR4E 4DV3I 3OTOI 2HFSA 2CZ9A 4OX9I 4FW9A 3QT7A 1ELOA 4DV1E 4FWHA 4DV4I 3HULA 1HR0E 1HNWI 4Z7CA 3JAMQ 2Z5BB 4DV2I 4YHHE 1S4EA 4ZVIA 1NHJA 1RREA 4UT4A 2VQEE 4JI1E 4DV7E 2PNMA 2Z5BA 2HHHI 1WUUA 1XNRE 1NZ0A 2UXBI 3F0NA 2UXBE 4LF8E 1KKHA 1EI1A 1Z0GA 4LF7I 2BM1A 4YY3I 4FWGA 4OX9E 1Y4UA 4X65E 2UUBI 5LL6R 4JI3E 4URLA 1IBLE 2BV3A 4DR1E 4DV0I 4JI4I 4LFAI 2UXCE 1Z0VA 4FWDA 1PIEA 1XMQE 2UU9I 4GKKI 4JI7I 4RPFA 1HK7A 4DV1I 4WUCA 2V34A 4XTJA 5LMUI 2E5LE 3CWVA 1I94E 4PRXA 2XEXA 4DR1I 1Z59A 2VQEI 3Q1QA 4B3MI 4R1FA 4N3OA 4DV5E 4DV4E 3J7AG 4JYAI 1XMOE 3ZZ0A 2A2CA 5IWAI 1XNRI 3ZKBA 4DUZE 1I94I 2VQFI 4X62E 4X64E 1RR9A 3QT6A 1XMQI 2V2VA 1ZM3A 4FN5A 4JI1I 4LF4E 4USMA 1IBLI 2LJPA 4DR7E 4LFAE 3V5RA 4DR5E 1QZRA 1EA6A 4DR6E 1IBKE 2WW4A 4LF7E 3PYFA 2ZBKB 3K85A 4JI6I 4DUYE 4LF6E 1UEKA 4WUBA 1KTVA 2E5LI 3T1YE 5IWAE 1Z0WA 1ZM4A 4LF9I 2IOPA 3V2UC 4DR4I 1N33I 2UU9E 3B8HA 4KHPE 4B3ME 5GMEA 2OI2A 1H73A 1VISA 4B3SI 5FLXC 1MG7A 1FJGI 1HNXI 3D4JA 4JI0E 2IOQA 3M6AA 2Z5CA 3Q6NA 2CGEA 4K0KE 3QT8A 1HNWE 3P06A 2O1WA 3J81Q 1DARA 1H7SA 4GKJE 4KQVA 4JI8E 3LTOA 4B3TI 1H72C 4B3RE 1NHIA 3JAMC 2O1UA 2UUBE 4NXMI 4LF4I 3PYEA 4LF6I 1N34E 4DR2E 4GKJI 4JV5E 4LF5E 2A2DA 4LFCI 1NHHA 4HACA 4DU7A 5IT9Q 1Z0EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I3H A;  4PU9 A;  1FKA E;  4DXL A;  4NXN I;  3T1Y I;  4LFB E;  3PYG A;  1U2R A;  4LF5 I;  1HR0 I;  4KHP I;  3PYD A;  4JI6 E;  1Z5B A;  4USK A;  2UUA E;  2DEI A;  1Z5C A;  1ZM9 A;  2X36 A;  2R3V A;  5FLX Q;  1N0U A;  5GMD A;  2VF3 A;  5LMN E;  4DPU A;  4K0K I;  4DV6 E;  2V2Q A;  1J5E I;  4HY1 A;  2UUC I;  1N33 E;  3QT5 A;  4DU8 A;  3J80 C;  2VQF E;  3H4L A;  4PRV A;  3T1H I;  1IBM E;  1IBM I;  4MYT A;  1FI4 A;  4LFC E;  1N32 I;  4DV3 E;  2EFG A;  3LNU A;  1N36 I;  5L3J A;  1K47 A;  1Z0C A;  2GS8 A;  1Z0T A;  4DV6 I;  3K1J A;  1HNZ I;  2UXD E;  1KIJ A;  4DR3 E;  3ZZT A;  4AQY I;  4DR3 I;  4LFB I;  3B82 A;  4X66 I;  2HFU A;  4X66 E;  1XHK A;  1MU5 A;  4B3R I;  4HAC B;  2ZM6 I;  2F4V I;  1Z5A A;  5A2Q C;  4X65 I;  1ZM2 A;  4HXZ A;  1FWL A;  1A6F A;  4JI5 I;  3K17 A;  4M1K A;  4JV5 I;  2HK2 A;  1FJG E;  1J5E E;  4P52 A;  1IBK I;  1PKP A;  4JI3 I;  1FWK A;  4X62 I;  4X64 I;  1KVK A;  1ZXN A;  1XNQ E;  4WUD A;  4NXN E;  2V2Z A;  2Q2E B;  4JI2 I;  2AJ4 A;  4MYU A;  5LMN I;  2HKJ A;  1N0V C;  4JYA E;  3B78 A;  4DR7 I;  1N36 E;  2E1R A;  4JG4 A;  2HKE A;  2V8P A;  1BKN A;  4YHH I;  4DUZ I;  2X7I A;  3ZM7 A;  4JI5 E;  2J7K A;  5A2Q Q;  4DUY I;  4DV7 I;  1XMO I;  1H7U A;  2ZIT A;  4EMD A;  2UUC E;  4DR5 I;  1MX0 A;  4GKK E;  1B63 A;  4JI7 E;  4LF9 E;  1HNZ E;  1N34 I;  4Z7Y A;  4B3S E;  3T1H E;  3WU4 A;  5IT9 C;  3J80 Q;  2UUA I;  1HNX E;  3WU3 A;  5LMU E;  1N32 E;  3GON A;  5BR8 I;  2DEJ A;  4NXM E;  2UXC I;  4DPW A;  1Z0B A;  4LF8 I;  4DV2 E;  1XNQ I;  4DPT A;  4AQY E;  4P7A A;  2UXD I;  1FNM A;  4JI8 I;  4DR2 I;  1OJ4 A;  4DPY A;  3ZZU A;  1H74 A;  1S16 A;  2NPF A;  4ED4 A;  4YY3 E;  3WU6 A;  4JI0 I;  3OTO E;  3ZKD A;  3LPS A;  4UTG A;  3J81 C;  4JI4 E;  3J7A M;  4JI2 E;  4DV0 E;  4HYM A;  1ZXM A;  1B62 A;  2R42 A;  4B3T E;  3WU5 A;  1PVG A;  1D6T A;  4DV5 I;  2HHH E;  2ZM6 E;  2F4V E;  2HK3 A;  4DR6 I;  2BM0 A;  5BR8 E;  4DPX A;  4DR4 E;  4DV3 I;  3OTO I;  2HFS A;  2CZ9 A;  4OX9 I;  4FW9 A;  3QT7 A;  1ELO A;  4DV1 E;  4FWH A;  4DV4 I;  3HUL A;  1HR0 E;  1HNW I;  4Z7C A;  3JAM Q;  4DV2 I;  4YHH E;  1S4E A;  4ZVI A;  1NHJ A;  1RRE A;  4UT4 A;  2VQE E;  4JI1 E;  4DV7 E;  2HHH I;  1WUU A;  1XNR E;  1NZ0 A;  2UXB I;  3F0N A;  2UXB E;  4LF8 E;  1KKH A;  1EI1 A;  4LF7 I;  1Z0G A;  2BM1 A;  4YY3 I;  4FWG A;  4OX9 E;  4X65 E;  2UUB I;  5LL6 R;  4JI3 E;  4URL A;  1IBL E;  2BV3 A;  4DR1 E;  4DV0 I;  4JI4 I;  4LFA I;  2UXC E;  1Z0V A;  4FWD A;  1PIE A;  1XMQ E;  2UU9 I;  4GKK I;  4JI7 I;  4RPF A;  4DV1 I;  4WUC A;  2V34 A;  4XTJ A;  5LMU I;  2E5L E;  3CWV A;  1I94 E;  4PRX A;  2XEX A;  4DR1 I;  1Z59 A;  2VQE I;  3Q1Q A;  4B3M I;  4R1F A;  4DV5 E;  4DV4 E;  3J7A G;  4JYA I;  1XMO E;  3ZZ0 A;  2A2C A;  5IWA I;  1XNR I;  3ZKB A;  4DUZ E;  1I94 I;  2VQF I;  4X62 E;  4X64 E;  1RR9 A;  3QT6 A;  1XMQ I;  2V2V A;  1ZM3 A;  4FN5 A;  4JI1 I;  4LF4 E;  4USM A;  1IBL I;  2LJP A;  4DR7 E;  4LFA E;  3V5R A;  4DR5 E;  1QZR A;  1EA6 A;  4DR6 E;  1IBK E;  2WW4 A;  4LF7 E;  3PYF A;  2ZBK B;  4JI6 I;  4DUY E;  4LF6 E;  1UEK A;  4WUB A;  1KTV A;  2E5L I;  3T1Y E;  5IWA E;  1Z0W A;  1ZM4 A;  4LF9 I;  3V2U C;  4DR4 I;  1N33 I;  2UU9 E;  3B8H A;  4KHP E;  4B3M E;  5GME A;  2OI2 A;  1H73 A;  1VIS A;  4B3S I;  5FLX C;  1MG7 A;  1FJG I;  1HNX I;  3D4J A;  4JI0 E;  3M6A A;  4K0K E;  3QT8 A;  1HNW E;  3J81 Q;  1DAR A;  1H7S A;  4GKJ E;  4KQV A;  4JI8 E;  3LTO A;  4B3T I;  1H72 C;  4B3R E;  1NHI A;  3JAM C;  2UUB E;  4NXM I;  4LF4 I;  3PYE A;  4LF6 I;  1N34 E;  4DR2 E;  4GKJ I;  4JV5 E;  4LF5 E;  2A2D A;  4LFC I;  1NHH A;  4HAC A;  4DU7 A;  5IT9 Q;  1Z0E A; 
#chains in the Genus database with same CATH topology
 2BA1 G;  1Y60 A;  3P76 A;  4I3H A;  4PU9 A;  2O1V A;  2NN6 E;  2C39 B;  1UDS A;  3PRY A;  1FKA E;  4DXL A;  2PNZ A;  4NXN I;  1UDQ A;  3T1Y I;  4FW3 A;  4LFB E;  5K36 D;  3PYG A;  5EKW A;  1U2R A;  4LF5 I;  1HR0 I;  4QNK A;  4BA1 A;  2PO2 A;  4QNJ A;  4KHP I;  3PS3 A;  3PYD A;  4FW5 A;  4JI6 E;  1Z5B A;  4USK A;  2UUA E;  2DEI A;  4IZJ A;  1Z5C A;  1ZM9 A;  1USU A;  2X36 A;  2R3V A;  5FLX Q;  1N0U A;  5GMD A;  2VF3 A;  5LMN E;  4DPU A;  4K0K I;  5DRR A;  5K36 B;  2C37 A;  4DV6 E;  2PO2 B;  2V2Q A;  1J5E I;  4HY1 A;  2UUC I;  1N33 E;  2BR2 A;  3QT5 A;  4DU8 A;  1R6L A;  3J80 C;  2VQF E;  3H4L A;  4PRV A;  3T1H I;  1IBM E;  4BA2 B;  4MU0 A;  1IBM I;  4MYT A;  1FI4 A;  4FW6 A;  2JE6 A;  4LFC E;  2BA1 D;  1N32 I;  4OO1 C;  4OZE A;  4DV3 E;  2EFG A;  3LNU A;  1N36 I;  4GQU A;  4IZK A;  5L3J A;  1K47 A;  1Z0C A;  2GS8 A;  2NN6 C;  1Z0T A;  4DV6 I;  3K1J A;  2NN6 F;  3UHM A;  1HNZ I;  2UXD E;  1KIJ A;  4DR3 E;  3ZZT A;  4AQY I;  1XXE A;  4DR3 I;  4LFB I;  3B82 A;  4X66 I;  3GME A;  2C38 A;  2HFU A;  4X66 E;  1Y4S A;  4IZK B;  1XHK A;  1MU5 A;  2C38 B;  4B3R I;  4HAC B;  2ZM6 I;  2F4V I;  2PO0 B;  4MU1 A;  1Z5A A;  2CVE A;  2CG9 A;  2IER A;  5A2Q C;  4X65 I;  1ZM2 A;  4HXZ A;  4AID A;  1FWL A;  2O1T A;  1A6F A;  4JI5 I;  4FW4 A;  2Z5E A;  3K17 A;  5C0X E;  4M1K A;  3M85 D;  1Y5Y A;  4JV5 I;  2HK2 A;  3GCM A;  1FJG E;  1YH8 A;  1J5E E;  5K36 A;  4OO1 B;  4P52 A;  1IBK I;  1PKP A;  4JI3 I;  4IFD A;  1VI7 A;  2BR2 B;  1FWK A;  4X62 I;  4X64 I;  1KVK A;  1ZXN A;  1Y6Z A;  1XNQ E;  4WUD A;  4NXN E;  2V2Z A;  2Q2E B;  4JI2 I;  2AJ4 A;  4MYU A;  3DD6 A;  5LMN I;  2HKJ A;  1N0V C;  4JYA E;  3B78 A;  4DR7 I;  1N36 E;  2E1R A;  4JG4 A;  2HKE A;  2V8P A;  2GO3 A;  1BKN A;  2BA0 D;  2PNZ B;  4YHH I;  3U1K A;  4DUZ I;  2X7I A;  3ZM7 A;  4MQY A;  4JI5 E;  1RHY A;  2J7K A;  2NN6 A;  3P3C A;  3GLL A;  5A2Q Q;  4DUY I;  5DNL A;  5FWK A;  4DV7 I;  2WNR A;  1XMO I;  4IZJ D;  1H7U A;  2ZIT A;  3L7Z A;  4EMD A;  2UUC E;  4FW7 A;  2C39 A;  4DR5 I;  1MX0 A;  4GKK E;  1B63 A;  4JI7 E;  4LF9 E;  4LCG A;  3HJC A;  1HNZ E;  1N34 I;  4Z7Y A;  4B3S E;  3T1H E;  3WU4 A;  2WP8 B;  5IT9 C;  3J80 Q;  2UUA I;  2GQ0 A;  1HNX E;  5JEA C;  3WU3 A;  5LMU E;  1N32 E;  2IES A;  3GON A;  2JE6 B;  5BR8 I;  2DEJ A;  4NXM E;  4BA2 A;  2UXC I;  4AM3 A;  4DPW A;  1Z0B A;  4LF8 I;  4DV2 E;  1XNQ I;  4DPT A;  4AQY E;  4P7A A;  2UXD I;  1FNM A;  4JI8 I;  4DR2 I;  1OJ4 A;  2PO1 A;  4DPY A;  2JEA B;  2PNL A;  3ZZU A;  1H74 A;  1S16 A;  4MU4 A;  2NPF A;  4ED4 A;  4YY3 E;  2Z5C B;  3WU6 A;  5JEA D;  2JEB B;  3CDJ A;  4IZJ B;  4JI0 I;  4IFD E;  3OTO E;  4NBQ A;  3ZKD A;  3LPS A;  4UTG A;  3J81 C;  2AE8 A;  4JI4 E;  3J7A M;  4JI2 E;  4DV0 E;  4HYM A;  3Q6M A;  1ZXM A;  1B62 A;  1USV A;  2R42 A;  4B3T E;  3WU5 A;  1PVG A;  1D6T A;  4DV5 I;  3P3G A;  2NN6 B;  2HHH E;  2ZM6 E;  2F4V E;  5JEA B;  3M85 G;  2HK3 A;  4DR6 I;  2BM0 A;  5BR8 E;  4DPX A;  4DR4 E;  4DV3 I;  5C0X D;  3OTO I;  2HFS A;  2CZ9 A;  4OX9 I;  4IFD D;  4FW9 A;  3QT7 A;  2JEA A;  1ELO A;  4DV1 E;  4FWH A;  4DV4 I;  3HUL A;  1HR0 E;  1HNW I;  4U3B A;  2JT2 A;  4Z7C A;  3JAM Q;  2Z5B B;  4DV2 I;  5C0X B;  4YHH E;  1S4E A;  4ZVI A;  1NHJ A;  1RRE A;  4UT4 A;  4MU3 A;  2VQE E;  3U1Y A;  3M7N G;  3PS2 A;  2NN6 D;  4JI1 E;  4IFD C;  5DRP A;  4DV7 E;  2PNM A;  5DRO A;  2Z5B A;  2HHH I;  4J3D A;  1WUU A;  4IFD F;  1XNR E;  1NZ0 A;  1P42 A;  2UXB I;  3F0N A;  3B4T A;  2UXB E;  4LF8 E;  1KKH A;  2WP8 A;  1EI1 A;  1Z0G A;  4LF7 I;  5C0X F;  2BM1 A;  4YY3 I;  4FWG A;  1UDO A;  4OX9 E;  1Y4U A;  4X65 E;  2UUB I;  5LL6 R;  4JI3 E;  4URL A;  1IBL E;  2BV3 A;  4DR1 E;  5JEA A;  4DV0 I;  4JI4 I;  4LFA I;  2UXC E;  4LCH A;  1Z0V A;  4FWD A;  4OO1 E;  1PIE A;  1XMQ E;  2UU9 I;  4OKG A;  4GKK I;  4JI7 I;  4RPF A;  4OO1 F;  1E3P A;  1HK7 A;  4DV1 I;  4WUC A;  2V34 A;  4XTJ A;  5LMU I;  5K36 E;  4OO1 D;  1UDN A;  2E5L E;  3CWV A;  1I94 E;  4PRX A;  5K36 F;  2XEX A;  4DR1 I;  1Z59 A;  2C37 B;  2PO1 B;  2VQE I;  3Q1Q A;  4B3M I;  4R1F A;  5EL9 A;  4N3O A;  4DV5 E;  4DV4 E;  3J7A G;  4JYA I;  1XMO E;  2JEB A;  3ZZ0 A;  2A2C A;  5IWA I;  1XNR I;  3HKM A;  2VES A;  3ZKB A;  1OYR A;  4DUZ E;  1I94 I;  4MDT A;  2VQF I;  2O3Z A;  4X62 E;  4X64 E;  3NZK A;  1RR9 A;  2F1D A;  4ISA A;  3QT6 A;  1XMQ I;  2V2V A;  5C0X A;  1ZM3 A;  4FN5 A;  4LCF A;  4JI1 I;  3PS1 A;  4LF4 E;  1YHC A;  4USM A;  1IBL I;  2BA0 G;  2LJP A;  4DR7 E;  4AIM A;  4LFA E;  3V5R A;  4DR5 E;  1QZR A;  1EA6 A;  4DR6 E;  1IBK E;  2WW4 A;  4LF7 E;  3PYF A;  2ZBK B;  3K85 A;  4JI6 I;  4DUY E;  4LF6 E;  1E3H A;  3L7Z B;  3CDI A;  1UEK A;  4IS9 A;  4WUB A;  1KTV A;  2E5L I;  5ELW A;  3T1Y E;  5IWA E;  1Z0W A;  1ZM4 A;  4LF9 I;  2IOP A;  3P3E A;  3V2U C;  4DR4 I;  1N33 I;  2UU9 E;  3B8H A;  3M7N D;  4B3M E;  5DNX A;  4KHP E;  1R6M A;  5GME A;  2OI2 A;  1H73 A;  1VIS A;  4B3S I;  5FLX C;  1MG7 A;  1FJG I;  1HNX I;  3D4J A;  4JI0 E;  2IOQ A;  3M6A A;  4LOM A;  2Z5C A;  5C0X C;  3Q6N A;  4U3D A;  2CGE A;  4K0K E;  4OO1 A;  3QT8 A;  1OYS A;  1HNW E;  4BA1 B;  3P06 A;  5JEA E;  2O1W A;  3J81 Q;  1DAR A;  1H7S A;  2J65 A;  4GKJ E;  4KQV A;  4JI8 E;  4IFD B;  3LTO A;  5JEA F;  4B3T I;  2GO4 A;  1H72 C;  3H1C A;  4B3R E;  5DRQ A;  1NHI A;  3JAM C;  4LPF A;  2O1U A;  2UUB E;  2PO0 A;  4NXM I;  4LF4 I;  3PYE A;  4LF6 I;  3KRN A;  1N34 E;  4DR2 E;  4GKJ I;  4JV5 E;  4LF5 E;  5K36 C;  2A2D A;  4LFC I;  1NHH A;  4HAC A;  4DU7 A;  5IT9 Q;  2WNR B;  1OYP A;  1Z0E A; 
#chains in the Genus database with same CATH homology
 4I3H A;  4PU9 A;  2O1V A;  3PRY A;  1FKA E;  4DXL A;  4NXN I;  3T1Y I;  4LFB E;  3PYG A;  1U2R A;  4LF5 I;  1HR0 I;  4KHP I;  3PYD A;  4JI6 E;  1Z5B A;  4USK A;  2UUA E;  2DEI A;  4IZJ A;  1Z5C A;  1ZM9 A;  1USU A;  2X36 A;  2R3V A;  5FLX Q;  1N0U A;  5GMD A;  2VF3 A;  5LMN E;  4DPU A;  4K0K I;  4DV6 E;  2V2Q A;  1J5E I;  4HY1 A;  2UUC I;  1N33 E;  3QT5 A;  4DU8 A;  3J80 C;  2VQF E;  3H4L A;  4PRV A;  3T1H I;  1IBM E;  1IBM I;  4MYT A;  1FI4 A;  4LFC E;  1N32 I;  4DV3 E;  2EFG A;  3LNU A;  1N36 I;  4IZK A;  5L3J A;  1K47 A;  1Z0C A;  2GS8 A;  1Z0T A;  4DV6 I;  3K1J A;  1HNZ I;  2UXD E;  1KIJ A;  4DR3 E;  3ZZT A;  4AQY I;  4DR3 I;  4LFB I;  3B82 A;  4X66 I;  4X66 E;  2HFU A;  1Y4S A;  4IZK B;  1XHK A;  1MU5 A;  4B3R I;  4HAC B;  2ZM6 I;  2F4V I;  1Z5A A;  2CG9 A;  5A2Q C;  4X65 I;  1ZM2 A;  4HXZ A;  1FWL A;  2O1T A;  1A6F A;  4JI5 I;  2Z5E A;  3K17 A;  4M1K A;  4JV5 I;  2HK2 A;  1FJG E;  1J5E E;  4P52 A;  1IBK I;  1PKP A;  4JI3 I;  1FWK A;  4X62 I;  4X64 I;  1KVK A;  1ZXN A;  1Y6Z A;  1XNQ E;  4WUD A;  4NXN E;  2V2Z A;  2Q2E B;  4JI2 I;  2AJ4 A;  4MYU A;  5LMN I;  2HKJ A;  1N0V C;  4JYA E;  3B78 A;  4DR7 I;  1N36 E;  2E1R A;  4JG4 A;  2HKE A;  2V8P A;  1BKN A;  4YHH I;  4DUZ I;  2X7I A;  3ZM7 A;  4JI5 E;  2J7K A;  5A2Q Q;  4DUY I;  5FWK A;  4DV7 I;  1XMO I;  4IZJ D;  1H7U A;  2ZIT A;  4EMD A;  2UUC E;  4DR5 I;  1MX0 A;  4GKK E;  1B63 A;  4JI7 E;  4LF9 E;  3HJC A;  1HNZ E;  1N34 I;  4Z7Y A;  4B3S E;  3T1H E;  3WU4 A;  5IT9 C;  3J80 Q;  2UUA I;  2GQ0 A;  1HNX E;  3WU3 A;  5LMU E;  1N32 E;  3GON A;  5BR8 I;  2DEJ A;  4NXM E;  2UXC I;  4DPW A;  1Z0B A;  4LF8 I;  4DV2 E;  1XNQ I;  4DPT A;  4AQY E;  4P7A A;  2UXD I;  1FNM A;  4JI8 I;  4DR2 I;  1OJ4 A;  4DPY A;  2PNL A;  3ZZU A;  1H74 A;  1S16 A;  2NPF A;  4ED4 A;  4YY3 E;  2Z5C B;  3WU6 A;  4IZJ B;  4JI0 I;  3OTO E;  3ZKD A;  3LPS A;  4UTG A;  3J81 C;  4JI4 E;  3J7A M;  4JI2 E;  4DV0 E;  4HYM A;  3Q6M A;  1ZXM A;  1B62 A;  1USV A;  2R42 A;  4B3T E;  3WU5 A;  1PVG A;  1D6T A;  4DV5 I;  2HHH E;  2ZM6 E;  2F4V E;  2HK3 A;  4DR6 I;  2BM0 A;  5BR8 E;  4DPX A;  4DR4 E;  4DV3 I;  3OTO I;  2HFS A;  2CZ9 A;  4OX9 I;  4FW9 A;  3QT7 A;  1ELO A;  4DV1 E;  4FWH A;  4DV4 I;  3HUL A;  1HR0 E;  1HNW I;  4Z7C A;  3JAM Q;  2Z5B B;  4DV2 I;  4YHH E;  1S4E A;  4ZVI A;  1NHJ A;  1RRE A;  4UT4 A;  2VQE E;  4JI1 E;  4DV7 E;  2PNM A;  2Z5B A;  2HHH I;  1WUU A;  1XNR E;  1NZ0 A;  2UXB I;  3F0N A;  2UXB E;  4LF8 E;  1KKH A;  1EI1 A;  1Z0G A;  4LF7 I;  2BM1 A;  4YY3 I;  4FWG A;  4OX9 E;  1Y4U A;  4X65 E;  2UUB I;  5LL6 R;  4JI3 E;  4URL A;  1IBL E;  2BV3 A;  4DR1 E;  4DV0 I;  4JI4 I;  4LFA I;  2UXC E;  1Z0V A;  4FWD A;  1PIE A;  1XMQ E;  2UU9 I;  4GKK I;  4JI7 I;  4RPF A;  1HK7 A;  4DV1 I;  4WUC A;  2V34 A;  4XTJ A;  5LMU I;  2E5L E;  3CWV A;  1I94 E;  4PRX A;  2XEX A;  4DR1 I;  1Z59 A;  2VQE I;  3Q1Q A;  4B3M I;  4R1F A;  4N3O A;  4DV5 E;  4DV4 E;  3J7A G;  4JYA I;  1XMO E;  3ZZ0 A;  2A2C A;  5IWA I;  1XNR I;  3ZKB A;  4DUZ E;  1I94 I;  2VQF I;  4X62 E;  4X64 E;  1RR9 A;  3QT6 A;  1XMQ I;  2V2V A;  1ZM3 A;  4FN5 A;  4JI1 I;  4LF4 E;  4USM A;  1IBL I;  2LJP A;  4DR7 E;  4LFA E;  3V5R A;  4DR5 E;  1QZR A;  1EA6 A;  4DR6 E;  1IBK E;  2WW4 A;  4LF7 E;  3PYF A;  2ZBK B;  3K85 A;  4JI6 I;  4DUY E;  4LF6 E;  1UEK A;  4WUB A;  1KTV A;  2E5L I;  3T1Y E;  5IWA E;  1Z0W A;  1ZM4 A;  4LF9 I;  2IOP A;  3V2U C;  4DR4 I;  1N33 I;  2UU9 E;  3B8H A;  4KHP E;  4B3M E;  5GME A;  2OI2 A;  1H73 A;  1VIS A;  4B3S I;  5FLX C;  1MG7 A;  1FJG I;  1HNX I;  3D4J A;  4JI0 E;  2IOQ A;  3M6A A;  2Z5C A;  3Q6N A;  2CGE A;  4K0K E;  3QT8 A;  1HNW E;  3P06 A;  2O1W A;  3J81 Q;  1DAR A;  1H7S A;  4GKJ E;  4KQV A;  4JI8 E;  3LTO A;  4B3T I;  1H72 C;  4B3R E;  1NHI A;  3JAM C;  2O1U A;  2UUB E;  4NXM I;  4LF4 I;  3PYE A;  4LF6 I;  1N34 E;  4DR2 E;  4GKJ I;  4JV5 E;  4LF5 E;  2A2D A;  4LFC I;  1NHH A;  4HAC A;  4DU7 A;  5IT9 Q;  1Z0E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...