4DUYI

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 26
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4duyI00
3F0NA 2DEIA 1FJGI 1J5EI 4JI6I 1NHJA 1XMQE 3JAMQ 3PYFA 1XNRE 4JI4I 2ZITA 1XNQE 4XTJA 4JV5E 3T1HI 3T1YI 4DUYI 4DPTA 2UXBE 4B3TI 2DEJA 1N0UA 1HNWE 2UXBI 1Z0VA 1ZM9A 3ZM7A 2OI2A 1FWKA 2VQFE 1K47A 4X66I 1PVGA 4JYAI 3ZZ0A 4LF4I 4X66E 4NXNI 4JI6E 4JYAE 5L3JA 1BKNA 3V5RA 4LF7E 1HNZE 1N36E 1N33I 4X65E 4DV6E 4AQYI 4P52A 4HYMA 1UEKA 1VISA 2LJPA 1HNXE 1ZXMA 1WUUA 4LFCI 1N0VC 4DR7I 2A2CA 4OX9I 3M6AA 2UUBE 4YHHE 4ZVIA 3QT5A 4DV0E 4YY3I 4P7AA 4B3RI 4PRXA 1MG7A 5LMUI 2E5LI 2R42A 1IBKE 4UT4A 4USMA 3Q1QA 4DU8A 1Z5AA 2A2DA 4RPFA 5BR8E 3J7AG 3J7AM 4DR5E 4FN5A 4DPYA 1J5EE 4DUZI 1I94I 1Z5CA 1XMOE 2UXDE 3LPSA 1NZ0A 4DR6E 2EFGA 3PYDA 2E5LE 2CZ9A 3JAMC 1KIJA 2XEXA 1B63A 1Z0WA 1Z0CA 3QT7A 1HNWI 4LF6I 3ZZUA 4DUZE 1I94E 1HNZI 5LMUE 3OTOI 1DARA 2BM0A 4B3MI 4B3ME 4X62E 4HY1A 1EI1A 4DV1E 1KKHA 2UU9I 4MYUA 4GKJI 3PYEA 1MX0A 1S16A 4LF9I 4ED4A 2UXDI 2UUCI 4M1KA 1S4EA 3D4JA 4PU9A 4JI5I 5LMNI 3GONA 4JI1I 3OTOE 2AJ4A 1IBLI 4B3SE 2ZM6E 4KHPI 1Z0EA 3B82A 4PRVA 4LF8E 3K1JA 4R1FA 4WUCA 1XMOI 4DPWA 5IWAE 3WU5A 5IWAI 4LFBE 4DR1E 2X36A 1N32E 2HFUA 4DR6I 4JI2I 1IBKI 3H4LA 4UTGA 2UU9E 2BM1A 1IBLE 2ZM6I 3HULA 4DUYE 4MYTA 2WW4A 4DR3E 2GS8A 2VF3A 4YHHI 2UUCE 2BV3A 3J81C 4X64I 1MU5A 1FJGE 4DV7E 2V2ZA 1Z0TA 3J80C 4B3SI 1NHHA 4FWDA 1FWLA 1ZXNA 4DV1I 1N36I 1N33E 4DV4I 4DXLA 5A2QQ 4K0KE 3K17A 4DV3E 4DV4E 1NHIA 2UUAE 4EMDA 4DR3I 3LTOA 1H7SA 4DV3I 2NPFA 1HNXI 4DV5I 2VQFI 5IT9Q 4LF5E 2F4VI 4LF6E 5A2QC 2F4VE 1FNMA 2E1RA 1A6FA 4JI2E 1RR9A 4WUBA 1HR0I 1ZM4A 2Q2EB 4KHPE 4FW9A 4JI1E 4DU7A 1ZM2A 4KQVA 4JI7E 1XNQI 4JI3E 5GMEA 1PKPA 2HHHI 1H73A 4DV2E 4Z7CA 4LF9E 3WU6A 4DV2I 3J80Q 4DV5E 2HK2A 4DV7I 1N32I 1IBME 1KVKA 3QT8A 4LFBI 4DR2E 1XNRI 4JI4E 2HK3A 1H7UA 5GMDA 4DR2I 1HR0E 2X7IA 4JI8I 3WU3A 1OJ4A 4X65I 3LNUA 2VQEI 5LL6R 1FI4A 2HHHE 4X64E 1H74A 4NXME 2UXCI 4JI5E 3ZZTA 5LMNE 2HKJA 1XMQI 4DR1I 4DR7E 4LF4E 4OX9E 1IBMI 1ZM3A 3QT6A 4LF8I 2R3VA 1EA6A 4FWHA 5IT9C 1Z59A 4B3TE 4DPXA 4LFAE 4LF5I 1N34I 1PIEA 3V2UC 2ZBKB 4JG4A 2UUBI 4DR5I 2V2QA 2V8PA 1KTVA 1RREA 1FKAE 3B8HA 1ELOA 3ZKBA 1D6TA 2V2VA 1H72C 5FLXQ 4DV6I 4AQYE 4X62I 4GKKE 3J81Q 1QZRA 4JV5I 1Z5BA 1U2RA 2UUAI 3ZKDA 1Z0GA 4WUDA 4HXZA 4LFCE 4NXMI 2J7KA 4DPUA 4DR4E 5FLXC 1XHKA 2V34A 3CWVA 4JI8E 4DV0I 4NXNE 4YY3E 4FWGA 3PYGA 3T1HE 4B3RE 3T1YE 4LF7I 4K0KI 2HKEA 4JI7I 3B78A 4HACA 5BR8I 4JI3I 4LFAI 2HFSA 4GKKI 1N34E 1B62A 1Z0BA 4URLA 3WU4A 4Z7YA 2UXCE 2VQEE 4USKA 4JI0I 4I3HA 4GKJE 4JI0E 4HACB 4DR4I
chains in the Genus database with same CATH superfamily
3DD6A 3F0NA 3H1CA 2DEIA 1FJGI 1J5EI 3CDJA 4JI6I 4FW4A 1NHJA 1XMQE 4U3DA 3JAMQ 3PYFA 1XNRE 4JI4I 2ZITA 1XNQE 2NN6A 4XTJA 4JV5E 3T1HI 5JEAC 4BA2B 3T1YI 5K36D 4DUYI 4IZKB 2JE6A 4IZJB 3L7ZB 4DPTA 2UXBE 4B3TI 2DEJA 1N0UA 3M7ND 1HNWE 2UXBI 1Z0VA 1ZM9A 3ZM7A 3NZKA 2OI2A 2BA1D 1FWKA 5JEAE 2VQFE 2IERA 1K47A 2PO0A 4IS9A 4X66I 1PVGA 4JYAI 3ZZ0A 4LF4I 4X66E 4NXNI 4JI6E 2C39A 2BR2A 4JYAE 5L3JA 1BKNA 3V5RA 4LF7E 1HNZE 1E3PA 4OO1D 2BR2B 2JT2A 1N36E 1N33I 4X65E 2O1VA 4DV6E 4AQYI 4P52A 4HYMA 4BA1B 2Z5EA 2O1TA 1UEKA 1VISA 2LJPA 1HNXE 1ZXMA 3Q6NA 2C37A 1WUUA 3M7NG 4LFCI 1N0VC 2PO2B 4DR7I 2A2CA 5DRRA 3M85G 4OX9I 3M6AA 2UUBE 4YHHE 3L7ZA 4QNJA 4IZJA 5EKWA 4ZVIA 3QT5A 4NBQA 4DV0E 4YY3I 4P7AA 4B3RI 4PRXA 1MG7A 4OZEA 5LMUI 2E5LI 2R42A 1IBKE 4IZJD 4IFDA 4UT4A 2JEAA 2PNZB 4USMA 3Q1QA 4DU8A 1Z5AA 3CDIA 2A2DA 4RPFA 5BR8E 4LOMA 3J7AG 4IFDB 3J7AM 4DR5E 4IFDC 5C0XE 4LCGA 4FN5A 3PS3A 4DPYA 2BA0G 1J5EE 5C0XB 4DUZI 1I94I 1Z5CA 1XMOE 2UXDE 2NN6E 2GO3A 3LPSA 1NZ0A 4GQUA 4DR6E 2EFGA 4N3OA 3PYDA 2E5LE 1HK7A 2CZ9A 4U3BA 3JAMC 1KIJA 4IFDF 5DNLA 2XEXA 1B63A 1Z0WA 1Z0CA 3QT7A 1HNWI 3P3GA 1USVA 4LF6I 3U1KA 2AE8A 3ZZUA 4DUZE 1I94E 1HNZI 5LMUE 3OTOI 1DARA 2BM0A 2JEAB 1UDNA 4B3MI 2PNLA 2BA0D 4B3ME 3P3EA 4X62E 4HY1A 1EI1A 3UHMA 4DV1E 1KKHA 2UU9I 3P06A 4MYUA 3U1YA 4GKJI 3PYEA 1MX0A 1S16A 4LF9I 4ED4A 2UXDI 4LCHA 4AIMA 2UUCI 4M1KA 5DNXA 1S4EA 4IFDE 3D4JA 4PU9A 4JI5I 4ISAA 5LMNI 2WP8B 3GONA 4JI1I 2Z5CB 3OTOE 2GQ0A 1Y60A 3HKMA 2AJ4A 1IBLI 3P76A 4B3SE 2ZM6E 4KHPI 1Z0EA 3B82A 4PRVA 2PO0B 4LF8E 3K1JA 1E3HA 1Y5YA 4R1FA 3P3CA 4WUCA 2O1UA 1XMOI 4DPWA 5IWAE 3WU5A 4FW6A 5IWAI 4LFBE 4DR1E 4OO1B 3Q6MA 2X36A 1N32E 2HFUA 4FW3A 4DR6I 4JI2I 1IBKI 5K36F 4MU0A 3H4LA 4UTGA 1UDSA 2UU9E 4MU4A 2BM1A 1IBLE 2C38A 1Y6ZA 2ZM6I 3GMEA 3HULA 4DUYE 4MYTA 2PO2A 2WW4A 4DR3E 1OYRA 2C37B 2GS8A 2VF3A 4MU3A 2CG9A 4YHHI 2JEBB 2UUCE 2BV3A 3J81C 4BA1A 4J3DA 1XXEA 4QNKA 4X64I 3B4TA 4FW5A 1MU5A 1FJGE 4DV7E 2V2ZA 2VESA 1Z0TA 3J80C 4B3SI 1NHHA 4FWDA 4MQYA 1FWLA 1ZXNA 4DV1I 5K36E 1N36I 1N33E 2WNRA 4DV4I 4DXLA 3GCMA 5A2QQ 4K0KE 3K17A 4DV3E 4DV4E 1NHIA 1P42A 1UDOA 4EMDA 2UUAE 1OYSA 4DR3I 3LTOA 1H7SA 4DV3I 2NPFA 2C39B 3PS1A 1HNXI 4DV5I 2VQFI 5IT9Q 4LF5E 2F4VI 4LF6E 5A2QC 2F4VE 1FNMA 2E1RA 4MU1A 1A6FA 4JI2E 1RR9A 5ELWA 4WUBA 1HR0I 1ZM4A 5DRQA 2Q2EB 4KHPE 4FW9A 4JI1E 4DU7A 1ZM2A 4KQVA 4JI7E 2JE6B 1XNQI 4JI3E 5GMEA 3GLLA 1PKPA 2NN6B 5JEAA 2HHHI 1UDQA 1H73A 4LCFA 5C0XC 2NN6C 4DV2E 2IESA 4Z7CA 4FW7A 4LF9E 4MDTA 3WU6A 4DV2I 3J80Q 4DV5E 2O1WA 2HK2A 4DV7I 1Y4SA 1N32I 1IBME 1KVKA 3QT8A 4LFBI 4DR2E 1XNRI 4JI4E 1R6MA 2HK3A 1H7UA 5GMDA 4DR2I 2BA1G 1HR0E 4OO1C 2X7IA 4JI8I 3WU3A 1OJ4A 4X65I 1YH8A 3LNUA 2VQEI 2PNMA 2Z5BA 5FWKA 5LL6R 1FI4A 2HHHE 4X64E 1H74A 5EL9A 4NXME 2UXCI 4JI5E 4OO1F 3ZZTA 5LMNE 5C0XD 2HKJA 2PNZA 1XMQI 4DR1I 4DR7E 4LF4E 4OX9E 5K36A 1IBMI 3K85A 2CGEA 1ZM3A 3QT6A 5JEAD 2WP8A 5DROA 4LF8I 4IZKA 2R3VA 1EA6A 4BA2A 4FWHA 5IT9C 3PRYA 1Z59A 4B3TE 4DPXA 4AM3A 2O3ZA 2NN6F 4LFAE 4LF5I 1N34I 1PIEA 3V2UC 5JEAF 2ZBKB 4JG4A 5JEAB 2UUBI 4IFDD 4DR5I 2V2QA 1VI7A 1USUA 2V8PA 1KTVA 1RREA 1FKAE 3B8HA 3KRNA 1ELOA 2IOQA 2JEBA 3ZKBA 5K36C 1D6TA 2F1DA 2V2VA 1H72C 5FLXQ 5K36B 2CVEA 1OYPA 4DV6I 4AQYE 4OO1E 4X62I 4GKKE 3J81Q 3PS2A 1QZRA 2C38B 4JV5I 1RHYA 1Z5BA 5DRPA 4AIDA 1U2RA 2UUAI 3ZKDA 1Z0GA 4WUDA 2Z5BB 4HXZA 4LFCE 4NXMI 2J7KA 5C0XF 4DPUA 4DR4E 2GO4A 5FLXC 1XHKA 4OO1A 1R6LA 4LPFA 2WNRB 2V34A 1Y4UA 3CWVA 4JI8E 4DV0I 4NXNE 4YY3E 4FWGA 3PYGA 3T1HE 4B3RE 3T1YE 4LF7I 4K0KI 2HKEA 2J65A 4JI7I 3B78A 2IOPA 4HACA 5BR8I 4JI3I 4OKGA 4LFAI 2HFSA 4GKKI 1YHCA 1N34E 5C0XA 1B62A 3HJCA 1Z0BA 4URLA 2PO1B 3WU4A 4Z7YA 2UXCE 2VQEE 2Z5CA 2PO1A 4USKA 4JI0I 4I3HA 4GKJE 2NN6D 4JI0E 4HACB 3M85D 4DR4I
chains in the Genus database with same CATH topology
3F0NA 2DEIA 1FJGI 1J5EI 4JI6I 1NHJA 1XMQE 3JAMQ 3PYFA 1XNRE 4JI4I 2ZITA 1XNQE 4XTJA 4JV5E 3T1HI 3T1YI 4DUYI 4IZKB 4IZJB 4DPTA 2UXBE 4B3TI 2DEJA 1N0UA 1HNWE 2UXBI 1Z0VA 1ZM9A 3ZM7A 2OI2A 1FWKA 2VQFE 1K47A 4X66I 1PVGA 4JYAI 3ZZ0A 4LF4I 4X66E 4NXNI 4JI6E 4JYAE 5L3JA 1BKNA 3V5RA 4LF7E 1HNZE 1N36E 1N33I 4X65E 2O1VA 4DV6E 4AQYI 4P52A 4HYMA 2Z5EA 2O1TA 1UEKA 1VISA 2LJPA 1HNXE 1ZXMA 3Q6NA 1WUUA 4LFCI 1N0VC 4DR7I 2A2CA 4OX9I 3M6AA 2UUBE 4YHHE 4IZJA 4ZVIA 3QT5A 4DV0E 4YY3I 4P7AA 4B3RI 4PRXA 1MG7A 5LMUI 2E5LI 2R42A 1IBKE 4IZJD 4UT4A 4USMA 3Q1QA 4DU8A 1Z5AA 2A2DA 4RPFA 5BR8E 3J7AG 3J7AM 4DR5E 4FN5A 4DPYA 1J5EE 1I94I 4DUZI 1Z5CA 1XMOE 2UXDE 3LPSA 1NZ0A 4DR6E 2EFGA 4N3OA 3PYDA 2E5LE 1HK7A 2CZ9A 3JAMC 1KIJA 2XEXA 1B63A 1Z0WA 1Z0CA 3QT7A 1HNWI 1USVA 4LF6I 3ZZUA 4DUZE 1I94E 1HNZI 5LMUE 3OTOI 1DARA 2BM0A 4B3MI 2PNLA 4B3ME 4X62E 4HY1A 1EI1A 4DV1E 1KKHA 2UU9I 3P06A 4MYUA 4GKJI 3PYEA 1MX0A 1S16A 4LF9I 4ED4A 2UXDI 2UUCI 4M1KA 1S4EA 3D4JA 4PU9A 4JI5I 5LMNI 3GONA 4JI1I 2Z5CB 3OTOE 2GQ0A 2AJ4A 1IBLI 4B3SE 2ZM6E 4KHPI 1Z0EA 3B82A 4PRVA 4LF8E 3K1JA 4R1FA 4WUCA 2O1UA 1XMOI 4DPWA 5IWAE 3WU5A 5IWAI 4LFBE 4DR1E 3Q6MA 2X36A 1N32E 2HFUA 4DR6I 4JI2I 1IBKI 3H4LA 4UTGA 2UU9E 2BM1A 1IBLE 1Y6ZA 2ZM6I 3HULA 4DUYE 4MYTA 2WW4A 4DR3E 2GS8A 2VF3A 2CG9A 4YHHI 2UUCE 2BV3A 3J81C 4X64I 1MU5A 1FJGE 4DV7E 2V2ZA 1Z0TA 3J80C 4B3SI 1NHHA 4FWDA 1FWLA 1ZXNA 4DV1I 1N36I 1N33E 4DV4I 4DXLA 5A2QQ 4K0KE 3K17A 4DV3E 4DV4E 1NHIA 2UUAE 4EMDA 4DR3I 3LTOA 1H7SA 4DV3I 2NPFA 1HNXI 4DV5I 2VQFI 5IT9Q 4LF5E 2F4VI 4LF6E 5A2QC 2F4VE 1FNMA 2E1RA 1A6FA 4JI2E 1RR9A 4WUBA 1HR0I 1ZM4A 2Q2EB 4KHPE 4FW9A 4JI1E 4DU7A 1ZM2A 4KQVA 4JI7E 1XNQI 4JI3E 5GMEA 1PKPA 2HHHI 1H73A 4DV2E 4Z7CA 4LF9E 3WU6A 4DV2I 3J80Q 4DV5E 2O1WA 2HK2A 4DV7I 1Y4SA 1N32I 1IBME 1KVKA 3QT8A 4LFBI 4DR2E 1XNRI 4JI4E 2HK3A 1H7UA 5GMDA 4DR2I 1HR0E 2X7IA 4JI8I 3WU3A 1OJ4A 4X65I 3LNUA 2VQEI 2PNMA 2Z5BA 5FWKA 5LL6R 1FI4A 2HHHE 4X64E 1H74A 4NXME 2UXCI 4JI5E 3ZZTA 5LMNE 2HKJA 1XMQI 4DR1I 4DR7E 4LF4E 4OX9E 1IBMI 3K85A 2CGEA 1ZM3A 3QT6A 4LF8I 4IZKA 2R3VA 1EA6A 4FWHA 5IT9C 3PRYA 1Z59A 4B3TE 4DPXA 4LFAE 4LF5I 1N34I 1PIEA 3V2UC 2ZBKB 4JG4A 2UUBI 4DR5I 2V2QA 1USUA 2V8PA 1KTVA 1RREA 1FKAE 3B8HA 1ELOA 2IOQA 3ZKBA 1D6TA 2V2VA 1H72C 5FLXQ 4DV6I 4AQYE 4X62I 4GKKE 3J81Q 1QZRA 4JV5I 1Z5BA 1U2RA 2UUAI 3ZKDA 1Z0GA 4WUDA 2Z5BB 4HXZA 4LFCE 4NXMI 2J7KA 4DPUA 4DR4E 5FLXC 1XHKA 2V34A 1Y4UA 3CWVA 4JI8E 4DV0I 4NXNE 4YY3E 4FWGA 3PYGA 3T1HE 4B3RE 3T1YE 4LF7I 4K0KI 2HKEA 4JI7I 3B78A 2IOPA 4HACA 5BR8I 4JI3I 4LFAI 2HFSA 4GKKI 1N34E 1B62A 3HJCA 1Z0BA 4URLA 3WU4A 4Z7YA 2UXCE 2VQEE 2Z5CA 4USKA 4JI0I 4I3HA 4GKJE 4JI0E 4HACB 4DR4I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F0N A;  2DEI A;  1FJG I;  1J5E I;  4JI6 I;  1NHJ A;  1XMQ E;  3JAM Q;  3PYF A;  1XNR E;  4JI4 I;  2ZIT A;  1XNQ E;  4XTJ A;  4JV5 E;  3T1H I;  3T1Y I;  4DUY I;  4DPT A;  2UXB E;  4B3T I;  2DEJ A;  1N0U A;  1HNW E;  2UXB I;  1Z0V A;  1ZM9 A;  3ZM7 A;  2OI2 A;  1FWK A;  2VQF E;  1K47 A;  4X66 I;  1PVG A;  4JYA I;  3ZZ0 A;  4LF4 I;  4X66 E;  4NXN I;  4JI6 E;  4JYA E;  5L3J A;  1BKN A;  3V5R A;  4LF7 E;  1HNZ E;  1N36 E;  1N33 I;  4X65 E;  4DV6 E;  4AQY I;  4P52 A;  4HYM A;  1UEK A;  1VIS A;  2LJP A;  1HNX E;  1ZXM A;  1WUU A;  4LFC I;  1N0V C;  4DR7 I;  2A2C A;  4OX9 I;  3M6A A;  2UUB E;  4YHH E;  4ZVI A;  3QT5 A;  4DV0 E;  4YY3 I;  4P7A A;  4B3R I;  4PRX A;  1MG7 A;  5LMU I;  2E5L I;  2R42 A;  1IBK E;  4UT4 A;  4USM A;  3Q1Q A;  4DU8 A;  1Z5A A;  2A2D A;  4RPF A;  5BR8 E;  3J7A G;  3J7A M;  4DR5 E;  4FN5 A;  4DPY A;  1J5E E;  4DUZ I;  1I94 I;  1Z5C A;  1XMO E;  2UXD E;  3LPS A;  1NZ0 A;  4DR6 E;  2EFG A;  3PYD A;  2E5L E;  2CZ9 A;  3JAM C;  1KIJ A;  2XEX A;  1B63 A;  1Z0W A;  1Z0C A;  3QT7 A;  1HNW I;  4LF6 I;  3ZZU A;  4DUZ E;  1I94 E;  1HNZ I;  5LMU E;  3OTO I;  1DAR A;  2BM0 A;  4B3M I;  4B3M E;  4X62 E;  4HY1 A;  1EI1 A;  4DV1 E;  1KKH A;  2UU9 I;  4MYU A;  4GKJ I;  3PYE A;  1MX0 A;  1S16 A;  4LF9 I;  4ED4 A;  2UXD I;  2UUC I;  4M1K A;  1S4E A;  3D4J A;  4PU9 A;  4JI5 I;  5LMN I;  3GON A;  4JI1 I;  3OTO E;  2AJ4 A;  1IBL I;  4B3S E;  2ZM6 E;  4KHP I;  1Z0E A;  3B82 A;  4PRV A;  4LF8 E;  3K1J A;  4R1F A;  4WUC A;  1XMO I;  4DPW A;  5IWA E;  3WU5 A;  5IWA I;  4LFB E;  4DR1 E;  2X36 A;  1N32 E;  2HFU A;  4DR6 I;  4JI2 I;  1IBK I;  3H4L A;  4UTG A;  2UU9 E;  2BM1 A;  1IBL E;  2ZM6 I;  3HUL A;  4DUY E;  4MYT A;  2WW4 A;  4DR3 E;  2GS8 A;  2VF3 A;  4YHH I;  2UUC E;  2BV3 A;  3J81 C;  4X64 I;  1MU5 A;  1FJG E;  4DV7 E;  2V2Z A;  1Z0T A;  3J80 C;  4B3S I;  1NHH A;  4FWD A;  1FWL A;  1ZXN A;  4DV1 I;  1N36 I;  1N33 E;  4DV4 I;  4DXL A;  5A2Q Q;  4K0K E;  3K17 A;  4DV3 E;  4DV4 E;  1NHI A;  2UUA E;  4EMD A;  4DR3 I;  3LTO A;  1H7S A;  4DV3 I;  2NPF A;  1HNX I;  4DV5 I;  2VQF I;  5IT9 Q;  4LF5 E;  2F4V I;  4LF6 E;  5A2Q C;  2F4V E;  1FNM A;  2E1R A;  1A6F A;  4JI2 E;  1RR9 A;  4WUB A;  1HR0 I;  1ZM4 A;  2Q2E B;  4KHP E;  4FW9 A;  4JI1 E;  4DU7 A;  1ZM2 A;  4KQV A;  4JI7 E;  1XNQ I;  4JI3 E;  5GME A;  1PKP A;  2HHH I;  1H73 A;  4DV2 E;  4Z7C A;  4LF9 E;  3WU6 A;  4DV2 I;  3J80 Q;  4DV5 E;  2HK2 A;  4DV7 I;  1N32 I;  1IBM E;  1KVK A;  3QT8 A;  4LFB I;  4DR2 E;  1XNR I;  4JI4 E;  2HK3 A;  1H7U A;  5GMD A;  4DR2 I;  1HR0 E;  2X7I A;  4JI8 I;  3WU3 A;  1OJ4 A;  4X65 I;  3LNU A;  2VQE I;  5LL6 R;  1FI4 A;  2HHH E;  4X64 E;  1H74 A;  4NXM E;  2UXC I;  4JI5 E;  3ZZT A;  5LMN E;  2HKJ A;  1XMQ I;  4DR1 I;  4DR7 E;  4LF4 E;  4OX9 E;  1IBM I;  1ZM3 A;  3QT6 A;  4LF8 I;  2R3V A;  1EA6 A;  4FWH A;  5IT9 C;  1Z59 A;  4B3T E;  4DPX A;  4LFA E;  4LF5 I;  1N34 I;  1PIE A;  3V2U C;  2ZBK B;  4JG4 A;  2UUB I;  4DR5 I;  2V2Q A;  2V8P A;  1KTV A;  1RRE A;  1FKA E;  3B8H A;  1ELO A;  3ZKB A;  1D6T A;  2V2V A;  1H72 C;  5FLX Q;  4DV6 I;  4AQY E;  4X62 I;  4GKK E;  3J81 Q;  1QZR A;  4JV5 I;  1Z5B A;  1U2R A;  2UUA I;  3ZKD A;  1Z0G A;  4WUD A;  4HXZ A;  4LFC E;  4NXM I;  2J7K A;  4DPU A;  4DR4 E;  5FLX C;  1XHK A;  2V34 A;  3CWV A;  4JI8 E;  4DV0 I;  4NXN E;  4YY3 E;  4FWG A;  3PYG A;  3T1H E;  4B3R E;  3T1Y E;  4LF7 I;  4K0K I;  2HKE A;  4JI7 I;  3B78 A;  4HAC A;  5BR8 I;  4JI3 I;  4LFA I;  2HFS A;  4GKK I;  1N34 E;  1B62 A;  1Z0B A;  4URL A;  3WU4 A;  4Z7Y A;  2UXC E;  2VQE E;  4USK A;  4JI0 I;  4I3H A;  4GKJ E;  4JI0 E;  4HAC B;  4DR4 I; 
#chains in the Genus database with same CATH topology
 3DD6 A;  3F0N A;  3H1C A;  2DEI A;  1FJG I;  1J5E I;  3CDJ A;  4JI6 I;  4FW4 A;  1NHJ A;  1XMQ E;  4U3D A;  3JAM Q;  3PYF A;  1XNR E;  4JI4 I;  2ZIT A;  1XNQ E;  2NN6 A;  4XTJ A;  4JV5 E;  3T1H I;  5JEA C;  4BA2 B;  3T1Y I;  5K36 D;  4DUY I;  4IZK B;  2JE6 A;  4IZJ B;  3L7Z B;  4DPT A;  2UXB E;  4B3T I;  2DEJ A;  1N0U A;  3M7N D;  1HNW E;  2UXB I;  1Z0V A;  1ZM9 A;  3ZM7 A;  3NZK A;  2OI2 A;  2BA1 D;  1FWK A;  5JEA E;  2VQF E;  2IER A;  1K47 A;  2PO0 A;  4IS9 A;  4X66 I;  1PVG A;  4JYA I;  3ZZ0 A;  4LF4 I;  4X66 E;  4NXN I;  4JI6 E;  2C39 A;  2BR2 A;  4JYA E;  5L3J A;  1BKN A;  3V5R A;  4LF7 E;  1HNZ E;  1E3P A;  4OO1 D;  2BR2 B;  2JT2 A;  1N36 E;  1N33 I;  4X65 E;  2O1V A;  4DV6 E;  4AQY I;  4P52 A;  4HYM A;  4BA1 B;  2Z5E A;  2O1T A;  1UEK A;  1VIS A;  2LJP A;  1HNX E;  1ZXM A;  3Q6N A;  2C37 A;  1WUU A;  3M7N G;  4LFC I;  1N0V C;  2PO2 B;  4DR7 I;  2A2C A;  5DRR A;  3M85 G;  4OX9 I;  3M6A A;  2UUB E;  4YHH E;  3L7Z A;  4QNJ A;  4IZJ A;  5EKW A;  4ZVI A;  3QT5 A;  4NBQ A;  4DV0 E;  4YY3 I;  4P7A A;  4B3R I;  4PRX A;  1MG7 A;  4OZE A;  5LMU I;  2E5L I;  2R42 A;  1IBK E;  4IZJ D;  4IFD A;  4UT4 A;  2JEA A;  2PNZ B;  4USM A;  3Q1Q A;  4DU8 A;  1Z5A A;  3CDI A;  2A2D A;  4RPF A;  5BR8 E;  4LOM A;  3J7A G;  4IFD B;  3J7A M;  4DR5 E;  4IFD C;  5C0X E;  4LCG A;  4FN5 A;  3PS3 A;  4DPY A;  2BA0 G;  1J5E E;  5C0X B;  4DUZ I;  1I94 I;  1Z5C A;  1XMO E;  2UXD E;  2NN6 E;  2GO3 A;  3LPS A;  1NZ0 A;  4GQU A;  4DR6 E;  2EFG A;  4N3O A;  3PYD A;  2E5L E;  1HK7 A;  2CZ9 A;  4U3B A;  3JAM C;  1KIJ A;  4IFD F;  5DNL A;  2XEX A;  1B63 A;  1Z0W A;  1Z0C A;  3QT7 A;  1HNW I;  3P3G A;  1USV A;  4LF6 I;  3U1K A;  2AE8 A;  3ZZU A;  4DUZ E;  1I94 E;  1HNZ I;  5LMU E;  3OTO I;  1DAR A;  2BM0 A;  2JEA B;  1UDN A;  4B3M I;  2PNL A;  2BA0 D;  4B3M E;  3P3E A;  4X62 E;  4HY1 A;  1EI1 A;  3UHM A;  4DV1 E;  1KKH A;  2UU9 I;  3P06 A;  4MYU A;  3U1Y A;  4GKJ I;  3PYE A;  1MX0 A;  1S16 A;  4LF9 I;  4ED4 A;  2UXD I;  4LCH A;  4AIM A;  2UUC I;  4M1K A;  5DNX A;  1S4E A;  4IFD E;  3D4J A;  4PU9 A;  4JI5 I;  4ISA A;  5LMN I;  2WP8 B;  3GON A;  4JI1 I;  2Z5C B;  3OTO E;  2GQ0 A;  1Y60 A;  3HKM A;  2AJ4 A;  1IBL I;  3P76 A;  4B3S E;  2ZM6 E;  4KHP I;  1Z0E A;  3B82 A;  4PRV A;  2PO0 B;  4LF8 E;  3K1J A;  1E3H A;  1Y5Y A;  4R1F A;  3P3C A;  4WUC A;  2O1U A;  1XMO I;  4DPW A;  5IWA E;  3WU5 A;  4FW6 A;  5IWA I;  4LFB E;  4DR1 E;  4OO1 B;  3Q6M A;  2X36 A;  1N32 E;  2HFU A;  4FW3 A;  4DR6 I;  4JI2 I;  1IBK I;  5K36 F;  4MU0 A;  3H4L A;  4UTG A;  1UDS A;  2UU9 E;  4MU4 A;  2BM1 A;  1IBL E;  2C38 A;  1Y6Z A;  2ZM6 I;  3GME A;  3HUL A;  4DUY E;  4MYT A;  2PO2 A;  2WW4 A;  4DR3 E;  1OYR A;  2C37 B;  2GS8 A;  2VF3 A;  4MU3 A;  2CG9 A;  4YHH I;  2JEB B;  2UUC E;  2BV3 A;  3J81 C;  4BA1 A;  4J3D A;  1XXE A;  4QNK A;  4X64 I;  3B4T A;  4FW5 A;  1MU5 A;  1FJG E;  4DV7 E;  2V2Z A;  2VES A;  1Z0T A;  3J80 C;  4B3S I;  1NHH A;  4FWD A;  4MQY A;  1FWL A;  1ZXN A;  4DV1 I;  5K36 E;  1N36 I;  1N33 E;  2WNR A;  4DV4 I;  4DXL A;  3GCM A;  5A2Q Q;  4K0K E;  3K17 A;  4DV3 E;  4DV4 E;  1NHI A;  1P42 A;  1UDO A;  4EMD A;  2UUA E;  1OYS A;  4DR3 I;  3LTO A;  1H7S A;  4DV3 I;  2NPF A;  2C39 B;  3PS1 A;  1HNX I;  4DV5 I;  2VQF I;  5IT9 Q;  4LF5 E;  2F4V I;  4LF6 E;  5A2Q C;  2F4V E;  1FNM A;  2E1R A;  4MU1 A;  1A6F A;  4JI2 E;  1RR9 A;  5ELW A;  4WUB A;  1HR0 I;  1ZM4 A;  5DRQ A;  2Q2E B;  4KHP E;  4FW9 A;  4JI1 E;  4DU7 A;  1ZM2 A;  4KQV A;  4JI7 E;  2JE6 B;  1XNQ I;  4JI3 E;  5GME A;  3GLL A;  1PKP A;  2NN6 B;  5JEA A;  2HHH I;  1UDQ A;  1H73 A;  4LCF A;  5C0X C;  2NN6 C;  4DV2 E;  2IES A;  4Z7C A;  4FW7 A;  4LF9 E;  4MDT A;  3WU6 A;  4DV2 I;  3J80 Q;  4DV5 E;  2O1W A;  2HK2 A;  4DV7 I;  1Y4S A;  1N32 I;  1IBM E;  1KVK A;  3QT8 A;  4LFB I;  4DR2 E;  1XNR I;  4JI4 E;  1R6M A;  2HK3 A;  1H7U A;  5GMD A;  4DR2 I;  2BA1 G;  1HR0 E;  4OO1 C;  2X7I A;  4JI8 I;  3WU3 A;  1OJ4 A;  4X65 I;  1YH8 A;  3LNU A;  2VQE I;  2PNM A;  2Z5B A;  5FWK A;  5LL6 R;  1FI4 A;  2HHH E;  4X64 E;  1H74 A;  5EL9 A;  4NXM E;  2UXC I;  4JI5 E;  4OO1 F;  3ZZT A;  5LMN E;  5C0X D;  2HKJ A;  2PNZ A;  1XMQ I;  4DR1 I;  4DR7 E;  4LF4 E;  4OX9 E;  5K36 A;  1IBM I;  3K85 A;  2CGE A;  1ZM3 A;  3QT6 A;  5JEA D;  2WP8 A;  5DRO A;  4LF8 I;  4IZK A;  2R3V A;  1EA6 A;  4BA2 A;  4FWH A;  5IT9 C;  3PRY A;  1Z59 A;  4B3T E;  4DPX A;  4AM3 A;  2O3Z A;  2NN6 F;  4LFA E;  4LF5 I;  1N34 I;  1PIE A;  3V2U C;  5JEA F;  2ZBK B;  4JG4 A;  5JEA B;  2UUB I;  4IFD D;  4DR5 I;  2V2Q A;  1VI7 A;  1USU A;  2V8P A;  1KTV A;  1RRE A;  1FKA E;  3B8H A;  3KRN A;  1ELO A;  2IOQ A;  2JEB A;  3ZKB A;  5K36 C;  1D6T A;  2F1D A;  2V2V A;  1H72 C;  5FLX Q;  5K36 B;  2CVE A;  1OYP A;  4DV6 I;  4AQY E;  4OO1 E;  4X62 I;  4GKK E;  3J81 Q;  3PS2 A;  1QZR A;  2C38 B;  4JV5 I;  1RHY A;  1Z5B A;  5DRP A;  4AID A;  1U2R A;  2UUA I;  3ZKD A;  1Z0G A;  4WUD A;  2Z5B B;  4HXZ A;  4LFC E;  4NXM I;  2J7K A;  5C0X F;  4DPU A;  4DR4 E;  2GO4 A;  5FLX C;  1XHK A;  4OO1 A;  1R6L A;  4LPF A;  2WNR B;  2V34 A;  1Y4U A;  3CWV A;  4JI8 E;  4DV0 I;  4NXN E;  4YY3 E;  4FWG A;  3PYG A;  3T1H E;  4B3R E;  3T1Y E;  4LF7 I;  4K0K I;  2HKE A;  2J65 A;  4JI7 I;  3B78 A;  2IOP A;  4HAC A;  5BR8 I;  4JI3 I;  4OKG A;  4LFA I;  2HFS A;  4GKK I;  1YHC A;  1N34 E;  5C0X A;  1B62 A;  3HJC A;  1Z0B A;  4URL A;  2PO1 B;  3WU4 A;  4Z7Y A;  2UXC E;  2VQE E;  2Z5C A;  2PO1 A;  4USK A;  4JI0 I;  4I3H A;  4GKJ E;  2NN6 D;  4JI0 E;  4HAC B;  3M85 D;  4DR4 I; 
#chains in the Genus database with same CATH homology
 3F0N A;  2DEI A;  1FJG I;  1J5E I;  4JI6 I;  1NHJ A;  1XMQ E;  3JAM Q;  3PYF A;  1XNR E;  4JI4 I;  2ZIT A;  1XNQ E;  4XTJ A;  4JV5 E;  3T1H I;  3T1Y I;  4DUY I;  4IZK B;  4IZJ B;  4DPT A;  2UXB E;  4B3T I;  2DEJ A;  1N0U A;  1HNW E;  2UXB I;  1Z0V A;  1ZM9 A;  3ZM7 A;  2OI2 A;  1FWK A;  2VQF E;  1K47 A;  4X66 I;  1PVG A;  4JYA I;  3ZZ0 A;  4LF4 I;  4X66 E;  4NXN I;  4JI6 E;  4JYA E;  5L3J A;  1BKN A;  3V5R A;  4LF7 E;  1HNZ E;  1N36 E;  1N33 I;  4X65 E;  2O1V A;  4DV6 E;  4AQY I;  4P52 A;  4HYM A;  2Z5E A;  2O1T A;  1UEK A;  1VIS A;  2LJP A;  1HNX E;  1ZXM A;  3Q6N A;  1WUU A;  4LFC I;  1N0V C;  4DR7 I;  2A2C A;  4OX9 I;  3M6A A;  2UUB E;  4YHH E;  4IZJ A;  4ZVI A;  3QT5 A;  4DV0 E;  4YY3 I;  4P7A A;  4B3R I;  4PRX A;  1MG7 A;  5LMU I;  2E5L I;  2R42 A;  1IBK E;  4IZJ D;  4UT4 A;  4USM A;  3Q1Q A;  4DU8 A;  1Z5A A;  2A2D A;  4RPF A;  5BR8 E;  3J7A G;  3J7A M;  4DR5 E;  4FN5 A;  4DPY A;  1J5E E;  1I94 I;  4DUZ I;  1Z5C A;  1XMO E;  2UXD E;  3LPS A;  1NZ0 A;  4DR6 E;  2EFG A;  4N3O A;  3PYD A;  2E5L E;  1HK7 A;  2CZ9 A;  3JAM C;  1KIJ A;  2XEX A;  1B63 A;  1Z0W A;  1Z0C A;  3QT7 A;  1HNW I;  1USV A;  4LF6 I;  3ZZU A;  4DUZ E;  1I94 E;  1HNZ I;  5LMU E;  3OTO I;  1DAR A;  2BM0 A;  4B3M I;  2PNL A;  4B3M E;  4X62 E;  4HY1 A;  1EI1 A;  4DV1 E;  1KKH A;  2UU9 I;  3P06 A;  4MYU A;  4GKJ I;  3PYE A;  1MX0 A;  1S16 A;  4LF9 I;  4ED4 A;  2UXD I;  2UUC I;  4M1K A;  1S4E A;  3D4J A;  4PU9 A;  4JI5 I;  5LMN I;  3GON A;  4JI1 I;  2Z5C B;  3OTO E;  2GQ0 A;  2AJ4 A;  1IBL I;  4B3S E;  2ZM6 E;  4KHP I;  1Z0E A;  3B82 A;  4PRV A;  4LF8 E;  3K1J A;  4R1F A;  4WUC A;  2O1U A;  1XMO I;  4DPW A;  5IWA E;  3WU5 A;  5IWA I;  4LFB E;  4DR1 E;  3Q6M A;  2X36 A;  1N32 E;  2HFU A;  4DR6 I;  4JI2 I;  1IBK I;  3H4L A;  4UTG A;  2UU9 E;  2BM1 A;  1IBL E;  1Y6Z A;  2ZM6 I;  3HUL A;  4DUY E;  4MYT A;  2WW4 A;  4DR3 E;  2GS8 A;  2VF3 A;  2CG9 A;  4YHH I;  2UUC E;  2BV3 A;  3J81 C;  4X64 I;  1MU5 A;  1FJG E;  4DV7 E;  2V2Z A;  1Z0T A;  3J80 C;  4B3S I;  1NHH A;  4FWD A;  1FWL A;  1ZXN A;  4DV1 I;  1N36 I;  1N33 E;  4DV4 I;  4DXL A;  5A2Q Q;  4K0K E;  3K17 A;  4DV3 E;  4DV4 E;  1NHI A;  2UUA E;  4EMD A;  4DR3 I;  3LTO A;  1H7S A;  4DV3 I;  2NPF A;  1HNX I;  4DV5 I;  2VQF I;  5IT9 Q;  4LF5 E;  2F4V I;  4LF6 E;  5A2Q C;  2F4V E;  1FNM A;  2E1R A;  1A6F A;  4JI2 E;  1RR9 A;  4WUB A;  1HR0 I;  1ZM4 A;  2Q2E B;  4KHP E;  4FW9 A;  4JI1 E;  4DU7 A;  1ZM2 A;  4KQV A;  4JI7 E;  1XNQ I;  4JI3 E;  5GME A;  1PKP A;  2HHH I;  1H73 A;  4DV2 E;  4Z7C A;  4LF9 E;  3WU6 A;  4DV2 I;  3J80 Q;  4DV5 E;  2O1W A;  2HK2 A;  4DV7 I;  1Y4S A;  1N32 I;  1IBM E;  1KVK A;  3QT8 A;  4LFB I;  4DR2 E;  1XNR I;  4JI4 E;  2HK3 A;  1H7U A;  5GMD A;  4DR2 I;  1HR0 E;  2X7I A;  4JI8 I;  3WU3 A;  1OJ4 A;  4X65 I;  3LNU A;  2VQE I;  2PNM A;  2Z5B A;  5FWK A;  5LL6 R;  1FI4 A;  2HHH E;  4X64 E;  1H74 A;  4NXM E;  2UXC I;  4JI5 E;  3ZZT A;  5LMN E;  2HKJ A;  1XMQ I;  4DR1 I;  4DR7 E;  4LF4 E;  4OX9 E;  1IBM I;  3K85 A;  2CGE A;  1ZM3 A;  3QT6 A;  4LF8 I;  4IZK A;  2R3V A;  1EA6 A;  4FWH A;  5IT9 C;  3PRY A;  1Z59 A;  4B3T E;  4DPX A;  4LFA E;  4LF5 I;  1N34 I;  1PIE A;  3V2U C;  2ZBK B;  4JG4 A;  2UUB I;  4DR5 I;  2V2Q A;  1USU A;  2V8P A;  1KTV A;  1RRE A;  1FKA E;  3B8H A;  1ELO A;  2IOQ A;  3ZKB A;  1D6T A;  2V2V A;  1H72 C;  5FLX Q;  4DV6 I;  4AQY E;  4X62 I;  4GKK E;  3J81 Q;  1QZR A;  4JV5 I;  1Z5B A;  1U2R A;  2UUA I;  3ZKD A;  1Z0G A;  4WUD A;  2Z5B B;  4HXZ A;  4LFC E;  4NXM I;  2J7K A;  4DPU A;  4DR4 E;  5FLX C;  1XHK A;  2V34 A;  1Y4U A;  3CWV A;  4JI8 E;  4DV0 I;  4NXN E;  4YY3 E;  4FWG A;  3PYG A;  3T1H E;  4B3R E;  3T1Y E;  4LF7 I;  4K0K I;  2HKE A;  4JI7 I;  3B78 A;  2IOP A;  4HAC A;  5BR8 I;  4JI3 I;  4LFA I;  2HFS A;  4GKK I;  1N34 E;  1B62 A;  3HJC A;  1Z0B A;  4URL A;  3WU4 A;  4Z7Y A;  2UXC E;  2VQE E;  2Z5C A;  4USK A;  4JI0 I;  4I3H A;  4GKJ E;  4JI0 E;  4HAC B;  4DR4 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...