4DUYO

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
87
structure length
87
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 30
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4duyO00
4LFCO 4DV3O 4JI2O 4OPHA 2ZKOA 2DOSA 1A32A 3SDLA 4LF5O 1XMOO 1IBLO 2AGAA 4JI1O 4DR3O 1X59A 4DR1O 4GKJO 4JV5O 4JI3O 4DR6O 4AQYO 2VQFO 1N33O 1G1XB 2UXBO 1J5EO 1AB3A 1XNRO 4X62O 2VQEO 2FKXA 4DUYO 1FKAO 4X64O 1HNWO 4KHPO 2HHHO 2JRIA 2UXDO 4NXNO 4JI5O 5A2QN 4X65O 4JI7O 4DR2O 1HR0O 4LF6O 4NXMO 3R66A 4DUZO 1HNZO 4DV2O 2UUCO 4LF8O 1XNQO 1IBMO 4K0KO 3J7AU 4YY3O 1YZBA 2UXCO 1DK1A 1KUQA 2UU9O 4LF9O 5BXZA 1R1BA 2UUBO 1D2DA 4GKKO 3T1YO 5IWAO 4JI6O 4LF4O 5FLXN 1F7YA 4B3RO 2Z0AA 3O65A 1R6TA 1N34O 2UUAO 4JI8O 1NS1A 1N32O 3J81N 4JYAO 1IBKO 5H5NA 5LMNO 4DV4O 1XEQA 5BY1A 2LW7A 1I94O 4B3TO 3M8AA 4YHHO 4DV6O 4OX9O 2E5LO 5BR8O 4DV7O 3OTOO 3JAMN 5LL6Y 4OPAA 4DV5O 4B3MO 4JI0O 4DR7O 2ZM6O 5LMUO 5IT9N 4A5UB 1N36O 3J80N 4LF7O 4JI4O 4LFBO 4DR5O 3T1HO 2DJVA 4B3SO 1AILA 4DR4O 1FYJA 4DV1O 4X66O 3RT3C 2N74A 1FJGO 4LFAO 1XMQO 3F5TA 1HNXO 4DV0O 2F4VO
chains in the Genus database with same CATH superfamily
1FFXB 1SQVH 2P7TC 2ZKOA 5GW7A 1VQ4V 1IX9A 3X2QB 2O57A 3BY6A 2CK3G 3ZRWA 4B3TB 1AR5A 2H94A 2Q73A 3CSXA 2UXBO 4BWAA 4J7ZA 3M99B 2A06H 3S3WA 4CH5A 2LO1A 3H1IH 3VBBA 5JJEB 5B1OA 3CCLV 3JD4A 4WFBV 2W6JG 3PJSK 4KHPO 1SESA 1SZTA 2LJ2A 3G67A 1HW7A 2E75B 1IXBA 4MVRA 2ZCEA 1FXHA 4X65O 1YJNV 2ZD9A 2ZNJA 1Z5VA 2WLHA 1H2KA 2UUCO 1HNZB 1WA8A 2HG5C 3JD2A 4DK1A 4LF9O 5B1NA 4R6ZA 4B7KA 1D2DA 1JPXA 3DXRA 1M57B 1M9NA 2UUBB 5A9GA 4GZRB 4AQYB 4FFBA 1SQPH 1K92A 4IIJA 5DN6G 4MVOA 4KL1A 2QSAA 1WLEA 4DK0A 3WB0A 1ZX3A 3OUFA 3I5DA 3OTOO 3L71H 1EBOA 3L72H 5J9PC 1MG1A 4X64B 5FPRA 1GN6A 3FFQA 2JGDB 2HR3A 4X62B 2HKOA 1TVKA 1TGOA 4QPKA 4DUZB 3WG7B 3OGIB 3CJHA 2HJDA 4UCRA 4YJ3B 4J42A 4FLYA 1QLEC 2ETNA 3MD0A 1Q3EA 2CTWA 1FJGO 2ZINA 1WPBA 2XUMA 1JVMA 1FS0G 2D2CB 3CEIA 4WFEA 5EIBD 1RM1C 3VQXA 4JI1B 2DYRC 3K04A 1PKXA 3OD4A 1M1KW 4NTYA 2C2AA 1X59A 3RYCB 1US6A 3E22A 3SPJA 4H33A 4UB8Z 4ZKIA 1R3KC 1ZL8A 1WNSA 1KKDA 1S5JA 2P5OA 1EN5A 4DUYO 1Y74A 3SYCA 1IVSA 2Q8VA 3FB8C 3JALA 1HNWO 1SQGA 4DV1B 2Q6AA 1JFFA 2E74B 1OCCC 1JR9A 2JK5C 3LDDA 5A2QN 3B77A 2PY5A 4LF8B 4FFBB 3CYOA 4I7ZB 1I08A 4MTXA 4NTWA 3CMAV 4MVQA 5J2TB 5IE9A 3APQA 2UU9O 5JCOC 1G6UA 4BW5A 4EEQA 4QGPA 3KZIZ 4MTOA 1K5SA 2GBOA 2MW2B 2QKCA 3DTUB 3JD3A 1R6TA 1XMOB 3J81N 4RQEA 5IJ0B 5KAIZ 2A79B 1BSMA 2YS8A 4DR1B 2Q0AA 1H38A 4JYAB 5DM6V 4DV7O 4JTDB 2QM8A 3ZRSA 2VQFB 4ZHQA 1Q81W 1DGSA 1GRJA 2YXHA 3CB2A 5E1AC 4FIPC 4A5UB 4NXNB 1NVPD 4DR7B 2FL4A 4LF6B 1GN3A 3CP1A 3BA8A 1AILA 2YICA 1JJOA 4YIOA 3T2MA 3FB6C 4QE7A 4FPPA 1VQ6V 2OT5A 1AR1B 3ABKC 1NTZH 2ATKC 2BCCH 1FFXA 4NKGB 4Z2WA 4GX2A 1OCRB 3FAVA 1QVFU 1BL8A 5B1BB 5TISZ 4LFCB 2LGQA 5LA6A 3TGUH 2V1DA 4GLXA 3K08A 1BZKA 4GKJO 4LF4B 4JI3O 4ZI7B 4DR6B 1GN2A 2EINC 1XL4A 3ABTA 3CCJV 1EFRG 2Q9LA 1MZFA 4KP4A 2HFEC 4KXRA 1KBHA 2OCCC 1MABG 3KCXA 2Y4UA 2WAMA 1GK9A 1QCEA 2PTMA 3CC7V 1N0NA 3D36C 4QIWF 3RBZA 4DUZO 1DTOA 4JI7B 4MS2A 4X9QA 4ABMA 4FZ0A 1Y66A 3J7AU 4HZ3A 4I4TB 2IJHA 1NJIW 4CH3A 1EN6A 1PV0A 4ICGA 2WLIB 3GWOA 1AI6A 1JOYA 3JATA 1N32B 1LR1A 1K4CC 2E3CA 1NR7A 2KG7B 4I55A 4JI8O 4E4EA 2A9HA 1B6QA 4UCTA 1TVKB 1JQ0A 1N33B 4B3MO 2JGUA 2YSUB 1PM9A 3K9AA 1AR4A 3F5WC 3HKCB 4B3SB 5LGTA 3J80N 1ZTEA 1U97A 4KFMA 3S3XA 3ABKB 2UUCB 1PP9H 4GX0A 2ZIOA 3ABMB 5LGNA 2K1EA 1IZ3A 2QGNA 3H01A 2WLJA 1V55B 4ZOLA 4WFHA 4PA7A 2DOSA 1CPYA 2EIJC 3H1LH 5LP6A 5CB4A 4P9OA 1XOUA 1MMMA 1VQKV 3QG5A 1QR8A 2ODMA 5H6QA 1NR1A 3K0GA 2YIAA 2YI9A 4MTFA 4WFFA 1DLBA 1OCZB 3LSUA 2KB1A 2RN9A 1NTMH 5KHHA 3G6BA 1ZUQA 2OIEA 4YHHB 1M57C 4R7CA 2CE4A 3IC9A 2Q0OC 2DWDC 3OE7G 2Q7GA 4NXNO 1H2LA 3HKDA 4WBNB 2QEXV 4LF6O 2ZXWC 3EFFK 2UXDB 3LNMB 5LP6C 3ZIAG 3B2EE 3T4DA 3LUTB 3AG4B 3BRCA 2EZOA 4Z1MG 3K57A 1OCZC 3SJAC 3AG3B 2P90A 4O4JB 1M5IA 4AI8A 3Q4HB 2CDYA 2IW5A 4WBNA 3ETDA 4X1IA 3HKDB 4EB6B 4JI6O 4LF4O 1Y76A 4B3RO 5LXTB 1N34O 3CC4V 1Q8IA 1KKCA 4HNAB 1I94O 2Q4PA 4NVPA 1L1FA 4OPAA 3TXSA 1J5EB 2AHZA 4YIPA 5ITZA 4AILC 4WF9V 1RSOA 4PELA 1H2GA 3P30A 3U10A 5LP6B 3ZS8C 1KECA 2EIMB 2WSSG 1GKFA 2F66C 4U3FH 4UVCA 2P06A 1PL4A 2W0XA 1SQFA 4H37A 4Q6GA 2DYSC 1CXZB 5CA1A 1Q82W 3JATB 1MNGA 3JARA 1XL6A 3CD6V 4LCUC 4OPHA 2WLLA 1KD1W 4JI1O 1VQ5V 3RW0A 2XNDG 2LFRA 2ZR2A 2M7WA 2NR5A 3A8TA 3HKBB 3N2KA 4I50B 2VQFO 2Q5ZA 4I9QA 3MDSA 3CCRV 4D6TH 3I55V 1P7BA 2VQEO 4FVMA 1E79G 1K97A 4JZ2A 4PA3A 4J80A 4PI0A 3F7VC 5LBQA 4ZBMA 4XDLA 4MTGA 4LF8O 3SR2C 4NTXA 4JTCB 1SC5B 3LDCA 1R3JC 3KCYA 2UUBO 1TUBB 1M93A 3FD9A 3OUSA 4XBFA 3RYFB 4JTAB 3OFNG 1ROPA 2P22C 4EFEA 5B3SC 3SPHA 2DW4A 2B1IA 1VQ8V 4GKKB 1TAEA 2UUAO 3B8MA 1XEQA 3ZX6A 2EJ7A 1WP8A 1P7GA 1AJPA 1M56C 2LGWA 1S77D 1B06A 1BQ0A 4DV4B 3AG4C 4DRXB 3BA9A 2PI5A 5KA5A 3AG7A 4DR5B 1WP7A 3E35A 4YJ2B 1R6NA 2P6JA 2QWNB 4GYCB 2DYSB 4BR6A 1XQ8A 4CC5A 3QNEA 2OCHA 5JJNB 1FJGB 2DQ0A 1VQ7V 2WLMA 1F4NA 2BE3A 3OMIB 4L87A 2Y0PA 3ZMVA 3P3NA 2ADPA 1YI2V 1N4CA 1YSCA 1I7FA 1Y6XA 4BIUA 1MA1A 1IBLB 1A32A 1S5HC 2VWJA 1IBLO 2AGAA 5JH7B 1AI5A 2BSKA 3BFRA 1SQBH 5K1PA 2CGOA 4X1YA 2R9RB 3G71V 4RUFA 5HFMA 3F7YC 2JJ1G 3ZEDA 3N27A 3ABMC 1K7DA 2G38A 4LH7A 2ZE8A 4H0LB 1V55C 1VF7A 2NLJC 4LH6A 4YXWG 1QQCA 2EZPA 4UVBA 4BAYA 4K8XA 3ZHVA 3A0BZ 2JS3A 3TCUA 4I0XA 3OR6C 1XNQB 2PUSA 5C8YB 3BAAA 3TXQA 2BTOA 2XT9A 4KUMA 2M6YA 5CN0A 3UO3A 3VQYA 4TOIA 5IY5C 2YUAA 3E2EA 2QR4A 4G27B 1WB8A 2WPDG 1NI8A 1IBKO 1G4YB 3CJHB 5BMVB 3L70H 4FLXA 2GTAA 5LL6Y 2FB5A 4RUEA 1QNMA 1N8RW 2R70A 1GMGA 4X88A 1SKVA 1ZLZA 1VIBA 4CBCA 3CRAA 4JI4O 1YDXA 1VEWA 4K8ZA 2A3QA 2EBOA 1Y67A 4MT8A 3DXRB 2CTQA 2JIZG 2YIBA 2ZT9B 1GN4A 2EIMC 3N2GA 4F6RA 1HNXO 3UT5B 3G6EV 3JARB 3B09A 1BHAA 4MVZA 4WFGA 4JI3B 1QHTA 5GTHZ 1K8AW 1KU9A 2JGDA 5BR8B 3QVNA 2XAHA 3FX7A 3AG2C 4LC1A 3CCEV 1RSOB 3BCCH 5FPOA 5J2UB 4DV5B 3K79A 1AB3A 5IYCO 2DYRB 1KMIZ 3QO7A 1JJ2U 2GUZB 3EHBB 4HNAA 2FKXA 3CXHF 3MHSC 3UKMA 1GM9A 2HJFC 4N23A 4FLZA 4TQFA 3VOUA 4RQFA 5EIBC 1NTKH 3CX5F 3T1HB 2E76B 4OXSA 4PD4F 5CA3A 4XDKA 1E1QG 3Q4HA 1K73W 2QA4V 1BHBA 3D36A 4GX1A 4U3JB 2BTQB 2D3OW 3KKYA 5LGUA 4B3RB 3WG7C 4MW8A 5EZYA 3T1YO 5IWAO 5CMUA 2OIGA 1VQOV 3T1YB 2RMKB 4NYKA 5LMNO 3ML0A 3DC6A 4B7EA 2PI4A 2YEVB 4DV6O 4IHJA 2Y69B 3TETA 3GVMA 1OCOB 2ZM6O 3OM3B 3QO8A 5JWPA 1HR0B 2F43G 1HDJA 1XDCA 1X4TA 5KUKA 4XDJA 2JS5A 1TUBA 2Y4TA 4JI5B 2YIBD 1S76D 1L0LH 2H3OA 4PDRA 1BS3A 4UCVA 2XTAA 4DXWA 3AEIA 4U7NA 5KHKA 1BT8A 4HAMA 4DV0B 1BE3H 1FXKC 3BPZA 5LYJB 3AG2B 3T1CA 4CZZA 5DECA 3JALB 4UCSA 2LW1A 1XNRB 3W7TA 3SYQA 3SJQC 3GWKC 3EXAA 4H44B 4D7TA 1KQSU 4PDVA 4UB6Z 3IFXA 1S72V 3JASA 4CS3A 1T5EA 5EYPA 4O4HB 3HR0A 5EK0A 1UJWB 3MHHC 4P30A 4F6EA 5L3FA 2Q7EA 3SJCC 4FM2A 3FB7C 4NXMO 3OTFA 4UCUA 4F4LA 5LHGA 5L3EA 2Q69A 1SETA 3UM7A 1Q7YW 1IBMO 2UXCO 3ABUA 4TV9B 2HVKC 5H6RA 3JD0A 2MK3A 2OCCB 4PJ0Z 1GH6A 1Q86W 2YC0A 3K3WA 3BHPA 1YTFD 2OTLV 4O4HA 4JYAO 4TQDA 3UCSC 1WB7A 1K4DC 3ZBHA 5IY5B 1E1RG 2CGNA 3OMNB 2E5LO 1NH2D 4JI0O 5IT9N 4HBNA 3JAWB 1Y76B 3L73H 1XUQA 4BIOA 3B40A 4ZI7A 5LOVB 3K9SA 5LYJA 2ZR3A 1FD9A 4P9PA 3EVKA 3FAVB 1S5LZ 3JAKA 5EZYB 1MZEA 1XMQO 2QKAA 3CMEV 3STZC 3F5TA 1O9GA 4JI2B 2CTPA 4O2BA 4LFCO 2L6LA 4DV3O 1URFA 4JGSA 5KAFZ 1K9MW 1RM1B 4DR3O 2P4KA 3LNNA 1N0JA 1RFYA 1PNMA 2F23A 2ZE6A 4TT3G 3OTOB 1EN4A 5IDJA 1I94B 3ZMUA 3HB3B 3I56V 1W2BU 4IYIA 2JJ2G 2PYJA 3WU2Z 4JI7O 4LFBB 2F93B 4TWKA 3NR7A 1W0KG 4PA6A 1RP3B 4JF3A 4ZOLB 3ZRXA 2AHYA 5KMGA 1L0NH 1YZBA 4LNUB 1KP2A 3L9DA 5JJJB 3RFRA 4F6RB 5IJ9A 1PNLA 1LUVA 4TV8B 2IH1C 1F4MA 3DGEA 3JAWA 4WCEV 4TUYA 4CC6A 1N32O 3HKCA 2AZ0A 3VQVA 2LW7A 1MOFA 3P3PA 4JI8B 1RPOA 3E86A 3M8AA 3CCQV 1EM1A 1Q90D 5EBLC 1IXMA 5HFLA 1R6KA 5KHJA 1K3EA 3E22B 2N05A 2XAGA 2WA4A 2X6AA 2WA3A 2EULA 2XAFA 5KX5A 4X1KA 5L3GA 3QTCA 4DV1O 3RYCA 4I55B 4HYOA 2OWOA 4IT5A 1XBLA 3N2GB 4JZGA 2WLLB 4J7KA 3WFVA 1W0JG 5GTIZ 3ZRVA 5IWAB 4I4TA 3SDLA 1XMOO 5KX5B 5LMNB 4DR1O 4YJ3A 2QM7A 2A0LA 1SQQH 4RAIA 5EC2C 3NXSA 2IBZH 2KKWA 2Y69C 4JAAA 5ITZB 4TSFG 2EX3A 4X62O 1COWG 1V54C 4KHPB 3T4ZA 3W7SA 1OCCB 4O2AA 4Z1VA 3K5LA 2QWOB 2ZXWB 3K58A 1K33A 3ZMSA 1S3JA 3E8GA 2YDEA 4DR2O 4R50A 4DV2B 4DW0A 1I0HA 4TUYB 3FB5C 3AG1C 2BSKB 4DW1A 4DR4B 1XNQO 5CA0B 3K5NA 3ZMTA 1MSDA 4O4JA 2OTJV 1XMQB 1LNQA 1ZAUA 1OCRC 4PV1B 3GB7C 1I5XA 4I5SA 1L8DA 1QLNA 3LSQA 4PA4A 4JV5B 5L3BA 1P84F 1THZA 1D5NA 3G80A 4QPJA 5IYZB 3SPCA 3ETGA 4J41A 5AG2A 5GONB 2VWKA 3C90A 4B3SO 1QVGU 1N36B 3OEHG 4FLTA 1OCOC 3W7XA 1VP7A 1IBMB 1JCHA 4JAVA 2BTQA 4PDMA 2UXCB 4U3JA 3K06A 2P4VA 1TUEB 3E8FA 5CBHA 4LWSA 5FL7G 5FNVB 2F4VO 3K0DA 1V9PA 1J95A 2XASA 4C7UA 3FYIB 4L8JA 4J9ZB 3ICXA 2EIKB 2EILC 3A0RA 2QM4A 4O2AB 2YIDA 4DV7B 1JA8A 1G1XB 3ETEA 1VMGA 5EBMC 1NZ6A 5KLVH 1XNRO 3WB1A 2Y0IA 3JYCA 1ZL8B 4CH4A 2CTRA 1BCCH 3U11A 1YF2A 2UXDO 4QJFB 3PN1A 1YXBA 3RYFA 2ZDIA 3R66A 3ZHUA 4J7JA 4X65B 1FFTB 1PNKA 5D5PA 4JPRA 2WLIA 1DK1A 3LDEA 5DEDA 3E89A 1FXKB 3CS5A 4AHCA 1O9HA 4X20B 2RCVA 1YCIA 3A0HZ 1FPOA 2Z0AA 1PD3A 4QNHB 1F51A 5EYPB 1VQ9V 4B3TO 1N34B 1OV9A 1YVWA 1IURA 4DR7O 1NBMG 1XHZA 4UV9A 5LMUO 2YI8A 1EZVH 1AI7A 4DR5O 2V7QG 4UVAA 2IM9A 3D8CA 5IJ9B 4FLVA 3ASOC 1Z5WA 2GHYA 5C8YA 2F1MA 4LNUA 2N74A 4EB6A 4TV8A 2NN4A 2X6BA 2PYLA 2W6IG 4QE9A 2VS0A 5B1AC 1SS3A 3CRCA 1K34A 1WA8B 2WWWA 4GKJB 3RYIB 2HVJC 3RYHB 1NKDA 3CXCU 1NH2B 5B66Z 4FLWA 4W4LA 1N33O 1KP3A 3RN4A 4O4IB 1J5EO 1Q6HA 5B1BC 1KC8W 1FAFA 3RGBA 5CBGA 1AJNA 3FYEB 4FM0A 4ZIBA 2CH7B 4ZHQB 2X6CA 1M4UA 5B3SB 1FKAO 3ZRWB 2DN9A 3E8HA 3H9VA 1CEZA 2KQXA 1OHHG 2B5UA 2BOBC 1SRYA 4O4LB 1SZXA 5C93A 1QLEB 4LFAB 1HNXB 3H1HH 3CHXA 3LSSA 2DMXA 1HP8A 3OW2U 1H2SB 3HKEB 2IJIA 4O4LA 3U0ZA 4GKKO 1SA0A 3WB2A 2GDSA 2CH7A 5H5NA 3C3TA 1PPJH 5LOVA 3DC5A 4JI0B 3K59A 3SPGA 4YHHO 1VF6A 5LHHA 1H2MA 5JQGA 3C3SA 4G2KA 1Q6IA 5F2VO 3ZJZA 2EILB 4DR2B 3T1HO 2IU0A 4X66B 3RYIA 3B8NA 1OZ0A 3SYOA 4DR4O 4TV9A 3RT3C 3ZN0A 1XREA 2XHBA 1B04A 4DO2A 4FLUA 1GTOA 3O9OA 4MVSA 3AK3A 4JYCA 4EFBA 3E8BA 3JCUZ 3UT5A 4JI6B 2ZDIC 3AG3C 2AXTZ 2FYUH 3MAQA 4LF5O 2ZNIA 2FTKA 4B08A 1CP9A 2PZSA 4JV5O 3P32A 4E2LA 5JCOA 4MSWC 2UUAB 4GX5A 1P49A 2YXYA 3AK1A 2UXXA 2UXBB 5BMVA 2E5LB 1ZSPA 3HKBA 1RPRA 2L35A 2RQ6A 4PDLA 1W59A 2JRIA 3OAAG 5B1AB 4IIJB 2IH3C 2JDIG 4X20A 4JI5O 1BMFG 1FXKA 2HEPA 4Q20A 5LA6B 1JMKC 4K0KO 4YY3O 1KUQA 3L74H 2QKSA 1BGYH 1VQNV 3RWRD 4YY3B 3CPWU 3RVYA 4DR3B 2X7RB 4N21A 5KHIA 4DV3B 3JD1A 3IC7A 3O65A 5KUMA 4X8AA 3L75H 1AI4A 1QU7A 3CC2V 1UFIA 5L3CA 2QDOA 5LHIA 4GT1A 4J9YB 1Q43A 1WPXA 4IHJB 3W7WA 3JAMN 4LBEC 1H2NA 4LF7B 3CRQA 3M7MX 4J11A 1B3QA 1VQPV 2NNUA 2QE7G 5LXTA 1Y4MA 4LF7O 4LFBO 4CS4A 2DJVA 1SA0B 2LFSA 4G28B 3CCMV 5IJ0A 4X1YB 3APOA 2B1GA 5JVDA 3SYAA 5JH7A 3TJTA 1XHXA 4FFKA 2F4VB 4CS2A 4LFAO 3K5OA 4DV0O 3CCSV 4O2BB 4NR1A 1AP5A 2Q7HA 3W7UA 1F23A 5J2TA 2UU9B 4PI2A 4JYBA 4CH6A 3JAKB 5H9CA 2XAQA 3HPLC 5GONA 2ARHA 2A7WA 3CRRA 4IL6Z 2LQTA 2EIKC 1IDSA 2GUZA 4YJ2A 2R9AA 3B4SA 2UXNA 4BIZA 2QWQB 3AG1B 3CRMA 3QF7A 4PHZA 4DRXA 2VRZA 4P2ZA 1YJ9V 1UPGA 2HHHO 2JEXA 5BZBA 5KA6A 2DE0X 2OYQA 3BEHA 2IU3A 3ZMZA 3IGAC 1XI1A 1HNZO 2B9ZA 1M90W 3OMAB 3AK2A 2HLDG 1YHQV 1AROP 1VQLV 2ITDC 4IGGA 5BXZA 1R1BA 1NT2B 1I5YA 4LF5B 3ZN1A 1SF9A 2RJZA 1WJZA 2Z3YA 5K1XA 1YJWV 1YEWA 5FLXN 3ZHSA 1F7YA 3OR7C 3H1JH 3BABA 4JYYA 3SYPA 5BY1A 2EINB 1YTFB 3FKSG 2QJ1A 5BR8O 2PGGA 3TK1A 2R72A 3K5MA 4DV5O 1K5QA 3SGIA 3BVOA 2KG7A 1N36O 2JVDA 4GCZA 3DSQA 2ITCC 4UUJC 2QWRB 1FYJA 4IYHA 1GM7A 1KB9F 2YXLA 1G8MA 3R65A 3X2QC 1ENVA 2Q68A 5KHGA 2JEUA 2QTSA 4LF9B 1P4RA 2BOCC 4X1KB 1VF5B 5CA1B 4UXNA 5KMGB 1PL0A 1GM8A 3THOA 4OX9B 5JQGB 1H8EG 3JSLA 2ILMA 4B3MB 3KG2A 2X0LA 3UO2A 5B5EZ 1NQTA 3ASOB 1U96A 4W4KA 4JI4B 5CBFA 2FMLA 1NVPB 4X64O 1AVMA 2PF4E 4D7SA 1FXVA 4X1IB 3HKEA 1HR0O 3G4SV 4DYLA 3IJ4A 2F95B 2N04A 4UV8A 5FNVA 4LWSB 4NB5A 1ZWIC 1QR9A 1TA8A 4FZ1A 2V4DA 4MVMA 4RO2A 5JVDB 1YIJV 2GV9A 2EIJB 4R8CA 3A2FA 1BQZA 2HP8A 4RWUA 4UCOA 4JASA 4GUNA 5IYZA 3ZHTA 4DV4O 1H8HG 2CUGA 2CAZC 4FJCC 4J10A 4FK5C 1R73A 1OJHA 3ABLB 2LP7A 2GTSA 1S0VA 3JCZA 4O4IA 2R9IA 5J2UA 5EC1C 1GAXA 4MVUA 5CB4B 1HNWB 5D5QA 5EBWC 3E83A 4U7OA 3STLC 4X66O 2EJRA 1NU1H 1V54B 3UQ8A 3RYHA 4NXMB 1AJQA 3D3IA 3VQWA 5CA0A 4K3AA 3SPIA 4PA9A 5E79Z 4JI2O 3D3QA 2ZE5A 1JFFB 4LR3A 2WLKA 3ASNC 1Y74B 1Q5OA 4DV6B 4EKWA 4DR6O 4AQYO 4FMTA 1M56B 4X89A 1ORQC 3OEEG 2XOKG 4LP8A 2DQ3A 1R3IC 3CE2A 2WLNA 1R3LC 3CCUV 4MW3A 1VQMV 1SERA 3CCVV 1D5AA 3N2KB 3ABLC 2AZ2A 2P67A 5LMUB 4I50A 2Z5UA 4OGQB 3OT7A 3QO5A 2RNBA 3H1KH 3ZCCA 1MSWD 4DV2O 2AW9A 1AP6A 2RDCA 3K03A 4JAUA 2IJJA 3RVZA 3ETQA 4I0XB 4K0KB 1SQXH 1JX9A 5H2FZ 5IYDO 2Q67A 2ZE7A 2ZQMA 2Y48A 1KYOF 4FM1A 1IBKB 2IJKA 3CWBH 3ZHRA 1NS1A 2KSDA 2GSMB 3ASNB 2W0FC 2K9PA 3JASB 2VQEB 1XILA 2H8PC 4H13B 4OX9O 3IAYA 2ZM6B 1LUWA 4BW9A 4DUYB 2ADQB 1QBZA 2HHHB 2XAJA 1YITV 4WFAV 3SJBC 4K35A 2YEVA 1Q6UA 3JSNA 1VF6C 2QWPB 3OGCC 4I9WA 2ZIMA 1WAZA 4ASUG 2DWEC 2QTOA 1DF5A 1HWYA 3ZHQA 4UFZA 5L3DA 1DF4A 1GO3F 1VARA 1Z2GA 5IYBO 1WN7A 1EZJA
chains in the Genus database with same CATH topology
4LFCO 4DV3O 4JI2O 4OPHA 2ZKOA 2DOSA 1A32A 3SDLA 4LF5O 1XMOO 1IBLO 2AGAA 4JI1O 4DR3O 1X59A 4DR1O 4GKJO 4JV5O 4JI3O 4DR6O 4AQYO 2VQFO 1N33O 1G1XB 2UXBO 1J5EO 1AB3A 1XNRO 4X62O 2VQEO 2FKXA 4DUYO 1FKAO 4X64O 1HNWO 4KHPO 2HHHO 2JRIA 2UXDO 4NXNO 4JI5O 5A2QN 4X65O 4JI7O 4DR2O 1HR0O 4LF6O 4NXMO 3R66A 4DUZO 1HNZO 4DV2O 2UUCO 4LF8O 1XNQO 1IBMO 4K0KO 3J7AU 4YY3O 1YZBA 2UXCO 1DK1A 1KUQA 2UU9O 4LF9O 5BXZA 1R1BA 2UUBO 1D2DA 4GKKO 3T1YO 5IWAO 4JI6O 4LF4O 5FLXN 1F7YA 4B3RO 2Z0AA 3O65A 1R6TA 1N34O 2UUAO 4JI8O 1NS1A 1N32O 3J81N 4JYAO 1IBKO 5H5NA 5LMNO 4DV4O 1XEQA 5BY1A 2LW7A 1I94O 4B3TO 3M8AA 4YHHO 4DV6O 4OX9O 2E5LO 5BR8O 4DV7O 3OTOO 3JAMN 5LL6Y 4OPAA 4DV5O 4B3MO 4JI0O 4DR7O 2ZM6O 5LMUO 5IT9N 4A5UB 1N36O 3J80N 4LF7O 4JI4O 4LFBO 4DR5O 3T1HO 2DJVA 4B3SO 1AILA 4DR4O 1FYJA 4DV1O 4X66O 3RT3C 2N74A 1FJGO 4LFAO 1XMQO 3F5TA 1HNXO 4DV0O 2F4VO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFC O;  4DV3 O;  4JI2 O;  4OPH A;  2ZKO A;  2DOS A;  1A32 A;  3SDL A;  4LF5 O;  1XMO O;  1IBL O;  2AGA A;  4JI1 O;  4DR3 O;  1X59 A;  4DR1 O;  4GKJ O;  4JV5 O;  4JI3 O;  4DR6 O;  4AQY O;  2VQF O;  1N33 O;  1G1X B;  2UXB O;  1J5E O;  1AB3 A;  1XNR O;  4X62 O;  2VQE O;  2FKX A;  4DUY O;  1FKA O;  4X64 O;  1HNW O;  4KHP O;  2HHH O;  2JRI A;  2UXD O;  4NXN O;  4JI5 O;  5A2Q N;  4X65 O;  4JI7 O;  4DR2 O;  1HR0 O;  4LF6 O;  4NXM O;  3R66 A;  4DUZ O;  1HNZ O;  4DV2 O;  2UUC O;  4LF8 O;  1XNQ O;  1IBM O;  4K0K O;  3J7A U;  4YY3 O;  1YZB A;  2UXC O;  1DK1 A;  1KUQ A;  2UU9 O;  4LF9 O;  5BXZ A;  1R1B A;  2UUB O;  1D2D A;  4GKK O;  3T1Y O;  5IWA O;  4JI6 O;  4LF4 O;  5FLX N;  1F7Y A;  4B3R O;  2Z0A A;  3O65 A;  1R6T A;  1N34 O;  2UUA O;  4JI8 O;  1NS1 A;  1N32 O;  3J81 N;  4JYA O;  1IBK O;  5H5N A;  5LMN O;  4DV4 O;  1XEQ A;  5BY1 A;  2LW7 A;  1I94 O;  4B3T O;  3M8A A;  4YHH O;  4DV6 O;  4OX9 O;  2E5L O;  5BR8 O;  4DV7 O;  3OTO O;  3JAM N;  5LL6 Y;  4OPA A;  4DV5 O;  4B3M O;  4JI0 O;  4DR7 O;  2ZM6 O;  5LMU O;  5IT9 N;  4A5U B;  1N36 O;  3J80 N;  4LF7 O;  4JI4 O;  4LFB O;  4DR5 O;  3T1H O;  2DJV A;  4B3S O;  1AIL A;  4DR4 O;  1FYJ A;  4DV1 O;  4X66 O;  3RT3 C;  2N74 A;  1FJG O;  4LFA O;  1XMQ O;  3F5T A;  1HNX O;  4DV0 O;  2F4V O; 
#chains in the Genus database with same CATH topology
 1FFX B;  1SQV H;  2P7T C;  2ZKO A;  5GW7 A;  1VQ4 V;  1IX9 A;  3X2Q B;  2O57 A;  3BY6 A;  2CK3 G;  3ZRW A;  4B3T B;  1AR5 A;  2H94 A;  2Q73 A;  3CSX A;  2UXB O;  4BWA A;  4J7Z A;  3M99 B;  2A06 H;  3S3W A;  4CH5 A;  2LO1 A;  3H1I H;  3VBB A;  5JJE B;  5B1O A;  3CCL V;  3JD4 A;  4WFB V;  2W6J G;  3PJS K;  4KHP O;  1SES A;  1SZT A;  2LJ2 A;  3G67 A;  1HW7 A;  2E75 B;  1IXB A;  4MVR A;  2ZCE A;  1FXH A;  4X65 O;  1YJN V;  2ZD9 A;  2ZNJ A;  1Z5V A;  2WLH A;  1H2K A;  2UUC O;  1HNZ B;  1WA8 A;  2HG5 C;  3JD2 A;  4DK1 A;  4LF9 O;  5B1N A;  4R6Z A;  4B7K A;  1D2D A;  1JPX A;  3DXR A;  1M57 B;  1M9N A;  2UUB B;  5A9G A;  4GZR B;  4AQY B;  4FFB A;  1SQP H;  1K92 A;  4IIJ A;  5DN6 G;  4MVO A;  4KL1 A;  2QSA A;  1WLE A;  4DK0 A;  3WB0 A;  1ZX3 A;  3OUF A;  3I5D A;  3OTO O;  3L71 H;  1EBO A;  3L72 H;  5J9P C;  1MG1 A;  4X64 B;  5FPR A;  1GN6 A;  3FFQ A;  2JGD B;  2HR3 A;  4X62 B;  2HKO A;  1TVK A;  1TGO A;  4QPK A;  4DUZ B;  3WG7 B;  3OGI B;  3CJH A;  2HJD A;  4UCR A;  4YJ3 B;  4J42 A;  4FLY A;  1QLE C;  2ETN A;  3MD0 A;  1Q3E A;  2CTW A;  1FJG O;  2ZIN A;  1WPB A;  2XUM A;  1JVM A;  1FS0 G;  2D2C B;  3CEI A;  4WFE A;  5EIB D;  1RM1 C;  3VQX A;  4JI1 B;  2DYR C;  3K04 A;  1PKX A;  3OD4 A;  1M1K W;  4NTY A;  2C2A A;  1X59 A;  3RYC B;  1US6 A;  3E22 A;  3SPJ A;  4H33 A;  4UB8 Z;  4ZKI A;  1R3K C;  1ZL8 A;  1WNS A;  1KKD A;  1S5J A;  2P5O A;  1EN5 A;  4DUY O;  1Y74 A;  3SYC A;  1IVS A;  2Q8V A;  3FB8 C;  3JAL A;  1HNW O;  1SQG A;  4DV1 B;  2Q6A A;  1JFF A;  2E74 B;  1OCC C;  1JR9 A;  2JK5 C;  3LDD A;  5A2Q N;  3B77 A;  2PY5 A;  4LF8 B;  4FFB B;  3CYO A;  4I7Z B;  1I08 A;  4MTX A;  4NTW A;  3CMA V;  4MVQ A;  5J2T B;  5IE9 A;  3APQ A;  2UU9 O;  5JCO C;  1G6U A;  4BW5 A;  4EEQ A;  4QGP A;  3KZI Z;  4MTO A;  1K5S A;  2GBO A;  2MW2 B;  2QKC A;  3DTU B;  3JD3 A;  1R6T A;  1XMO B;  3J81 N;  4RQE A;  5IJ0 B;  5KAI Z;  2A79 B;  1BSM A;  2YS8 A;  4DR1 B;  2Q0A A;  1H38 A;  4JYA B;  5DM6 V;  4DV7 O;  4JTD B;  2QM8 A;  3ZRS A;  2VQF B;  4ZHQ A;  1Q81 W;  1DGS A;  1GRJ A;  2YXH A;  3CB2 A;  5E1A C;  4FIP C;  4A5U B;  4NXN B;  1NVP D;  4DR7 B;  2FL4 A;  4LF6 B;  1GN3 A;  3CP1 A;  3BA8 A;  1AIL A;  2YIC A;  1JJO A;  4YIO A;  3T2M A;  3FB6 C;  4QE7 A;  4FPP A;  1VQ6 V;  2OT5 A;  1AR1 B;  3ABK C;  1NTZ H;  2ATK C;  2BCC H;  1FFX A;  4NKG B;  4Z2W A;  4GX2 A;  1OCR B;  3FAV A;  1QVF U;  1BL8 A;  5B1B B;  5TIS Z;  4LFC B;  2LGQ A;  5LA6 A;  3TGU H;  2V1D A;  4GLX A;  3K08 A;  1BZK A;  4GKJ O;  4LF4 B;  4JI3 O;  4ZI7 B;  4DR6 B;  1GN2 A;  2EIN C;  1XL4 A;  3ABT A;  3CCJ V;  1EFR G;  2Q9L A;  1MZF A;  4KP4 A;  2HFE C;  4KXR A;  1KBH A;  2OCC C;  1MAB G;  3KCX A;  2Y4U A;  2WAM A;  1GK9 A;  1QCE A;  2PTM A;  3CC7 V;  1N0N A;  3D36 C;  4QIW F;  3RBZ A;  4DUZ O;  1DTO A;  4JI7 B;  4MS2 A;  4X9Q A;  4ABM A;  4FZ0 A;  1Y66 A;  3J7A U;  4HZ3 A;  4I4T B;  2IJH A;  1NJI W;  4CH3 A;  1EN6 A;  1PV0 A;  4ICG A;  2WLI B;  3GWO A;  1AI6 A;  1JOY A;  3JAT A;  1N32 B;  1LR1 A;  1K4C C;  2E3C A;  1NR7 A;  2KG7 B;  4I55 A;  4JI8 O;  4E4E A;  2A9H A;  1B6Q A;  4UCT A;  1TVK B;  1JQ0 A;  1N33 B;  4B3M O;  2JGU A;  2YSU B;  1PM9 A;  3K9A A;  1AR4 A;  3F5W C;  3HKC B;  4B3S B;  5LGT A;  3J80 N;  1ZTE A;  1U97 A;  4KFM A;  3S3X A;  3ABK B;  2UUC B;  1PP9 H;  4GX0 A;  2ZIO A;  3ABM B;  5LGN A;  2K1E A;  1IZ3 A;  2QGN A;  3H01 A;  2WLJ A;  1V55 B;  4ZOL A;  4WFH A;  4PA7 A;  2DOS A;  1CPY A;  2EIJ C;  3H1L H;  5LP6 A;  5CB4 A;  4P9O A;  1XOU A;  1MMM A;  1VQK V;  3QG5 A;  1QR8 A;  2ODM A;  5H6Q A;  1NR1 A;  3K0G A;  2YIA A;  2YI9 A;  4MTF A;  4WFF A;  1DLB A;  1OCZ B;  3LSU A;  2KB1 A;  2RN9 A;  1NTM H;  5KHH A;  3G6B A;  1ZUQ A;  2OIE A;  4YHH B;  1M57 C;  4R7C A;  2CE4 A;  3IC9 A;  2Q0O C;  2DWD C;  3OE7 G;  2Q7G A;  4NXN O;  1H2L A;  3HKD A;  4WBN B;  2QEX V;  4LF6 O;  2ZXW C;  3EFF K;  2UXD B;  3LNM B;  5LP6 C;  3ZIA G;  3B2E E;  3T4D A;  3LUT B;  3AG4 B;  3BRC A;  2EZO A;  4Z1M G;  3K57 A;  1OCZ C;  3SJA C;  3AG3 B;  2P90 A;  4O4J B;  1M5I A;  4AI8 A;  3Q4H B;  2CDY A;  2IW5 A;  4WBN A;  3ETD A;  4X1I A;  3HKD B;  4EB6 B;  4JI6 O;  4LF4 O;  1Y76 A;  4B3R O;  5LXT B;  1N34 O;  3CC4 V;  1Q8I A;  1KKC A;  4HNA B;  1I94 O;  2Q4P A;  4NVP A;  1L1F A;  4OPA A;  3TXS A;  1J5E B;  2AHZ A;  4YIP A;  5ITZ A;  4AIL C;  4WF9 V;  1RSO A;  4PEL A;  1H2G A;  3P30 A;  3U10 A;  5LP6 B;  3ZS8 C;  1KEC A;  2EIM B;  2WSS G;  1GKF A;  2F66 C;  4U3F H;  4UVC A;  2P06 A;  1PL4 A;  2W0X A;  1SQF A;  4H37 A;  4Q6G A;  2DYS C;  1CXZ B;  5CA1 A;  1Q82 W;  3JAT B;  1MNG A;  3JAR A;  1XL6 A;  3CD6 V;  4LCU C;  4OPH A;  2WLL A;  1KD1 W;  4JI1 O;  1VQ5 V;  3RW0 A;  2XND G;  2LFR A;  2ZR2 A;  2M7W A;  2NR5 A;  3A8T A;  3HKB B;  3N2K A;  4I50 B;  2VQF O;  2Q5Z A;  4I9Q A;  3MDS A;  3CCR V;  4D6T H;  3I55 V;  1P7B A;  2VQE O;  4FVM A;  1E79 G;  1K97 A;  4JZ2 A;  4PA3 A;  4J80 A;  4PI0 A;  3F7V C;  5LBQ A;  4ZBM A;  4XDL A;  4MTG A;  4LF8 O;  3SR2 C;  4NTX A;  4JTC B;  1SC5 B;  3LDC A;  1R3J C;  3KCY A;  2UUB O;  1TUB B;  1M93 A;  3FD9 A;  3OUS A;  4XBF A;  3RYF B;  4JTA B;  3OFN G;  1ROP A;  2P22 C;  4EFE A;  5B3S C;  3SPH A;  2DW4 A;  2B1I A;  1VQ8 V;  4GKK B;  1TAE A;  2UUA O;  3B8M A;  1XEQ A;  3ZX6 A;  2EJ7 A;  1WP8 A;  1P7G A;  1AJP A;  1M56 C;  2LGW A;  1S77 D;  1B06 A;  1BQ0 A;  4DV4 B;  3AG4 C;  4DRX B;  3BA9 A;  2PI5 A;  5KA5 A;  3AG7 A;  4DR5 B;  1WP7 A;  3E35 A;  4YJ2 B;  1R6N A;  2P6J A;  2QWN B;  4GYC B;  2DYS B;  4BR6 A;  1XQ8 A;  4CC5 A;  3QNE A;  2OCH A;  5JJN B;  1FJG B;  2DQ0 A;  1VQ7 V;  2WLM A;  1F4N A;  2BE3 A;  3OMI B;  4L87 A;  2Y0P A;  3ZMV A;  3P3N A;  2ADP A;  1YI2 V;  1N4C A;  1YSC A;  1I7F A;  1Y6X A;  4BIU A;  1MA1 A;  1IBL B;  1A32 A;  1S5H C;  2VWJ A;  1IBL O;  2AGA A;  5JH7 B;  1AI5 A;  2BSK A;  3BFR A;  1SQB H;  5K1P A;  2CGO A;  4X1Y A;  2R9R B;  3G71 V;  4RUF A;  5HFM A;  3F7Y C;  2JJ1 G;  3ZED A;  3N27 A;  3ABM C;  1K7D A;  2G38 A;  4LH7 A;  2ZE8 A;  4H0L B;  1V55 C;  1VF7 A;  2NLJ C;  4LH6 A;  4YXW G;  1QQC A;  2EZP A;  4UVB A;  4BAY A;  4K8X A;  3ZHV A;  3A0B Z;  2JS3 A;  3TCU A;  4I0X A;  3OR6 C;  1XNQ B;  2PUS A;  5C8Y B;  3BAA A;  3TXQ A;  2BTO A;  2XT9 A;  4KUM A;  2M6Y A;  5CN0 A;  3UO3 A;  3VQY A;  4TOI A;  5IY5 C;  2YUA A;  3E2E A;  2QR4 A;  4G27 B;  1WB8 A;  2WPD G;  1NI8 A;  1IBK O;  1G4Y B;  3CJH B;  5BMV B;  3L70 H;  4FLX A;  2GTA A;  5LL6 Y;  2FB5 A;  4RUE A;  1QNM A;  1N8R W;  2R70 A;  1GMG A;  4X88 A;  1SKV A;  1ZLZ A;  1VIB A;  4CBC A;  3CRA A;  4JI4 O;  1YDX A;  1VEW A;  4K8Z A;  2A3Q A;  2EBO A;  1Y67 A;  4MT8 A;  3DXR B;  2CTQ A;  2JIZ G;  2YIB A;  2ZT9 B;  1GN4 A;  2EIM C;  3N2G A;  4F6R A;  1HNX O;  3UT5 B;  3G6E V;  3JAR B;  3B09 A;  1BHA A;  4MVZ A;  4WFG A;  4JI3 B;  1QHT A;  5GTH Z;  1K8A W;  1KU9 A;  2JGD A;  5BR8 B;  3QVN A;  2XAH A;  3FX7 A;  3AG2 C;  4LC1 A;  3CCE V;  1RSO B;  3BCC H;  5FPO A;  5J2U B;  4DV5 B;  3K79 A;  1AB3 A;  5IYC O;  2DYR B;  1KMI Z;  3QO7 A;  1JJ2 U;  2GUZ B;  3EHB B;  4HNA A;  2FKX A;  3CXH F;  3MHS C;  3UKM A;  1GM9 A;  2HJF C;  4N23 A;  4FLZ A;  4TQF A;  3VOU A;  4RQF A;  5EIB C;  1NTK H;  3CX5 F;  3T1H B;  2E76 B;  4OXS A;  4PD4 F;  5CA3 A;  4XDK A;  1E1Q G;  3Q4H A;  1K73 W;  2QA4 V;  1BHB A;  3D36 A;  4GX1 A;  4U3J B;  2BTQ B;  2D3O W;  3KKY A;  5LGU A;  4B3R B;  3WG7 C;  4MW8 A;  5EZY A;  3T1Y O;  5IWA O;  5CMU A;  2OIG A;  1VQO V;  3T1Y B;  2RMK B;  4NYK A;  5LMN O;  3ML0 A;  3DC6 A;  4B7E A;  2PI4 A;  2YEV B;  4DV6 O;  4IHJ A;  2Y69 B;  3TET A;  3GVM A;  1OCO B;  2ZM6 O;  3OM3 B;  3QO8 A;  5JWP A;  1HR0 B;  2F43 G;  1HDJ A;  1XDC A;  1X4T A;  5KUK A;  4XDJ A;  2JS5 A;  1TUB A;  2Y4T A;  4JI5 B;  2YIB D;  1S76 D;  1L0L H;  2H3O A;  4PDR A;  1BS3 A;  4UCV A;  2XTA A;  4DXW A;  3AEI A;  4U7N A;  5KHK A;  1BT8 A;  4HAM A;  4DV0 B;  1BE3 H;  1FXK C;  3BPZ A;  5LYJ B;  3AG2 B;  3T1C A;  4CZZ A;  5DEC A;  3JAL B;  4UCS A;  2LW1 A;  1XNR B;  3W7T A;  3SYQ A;  3SJQ C;  3GWK C;  3EXA A;  4H44 B;  4D7T A;  1KQS U;  4PDV A;  4UB6 Z;  3IFX A;  1S72 V;  3JAS A;  4CS3 A;  1T5E A;  5EYP A;  4O4H B;  3HR0 A;  5EK0 A;  1UJW B;  3MHH C;  4P30 A;  4F6E A;  5L3F A;  2Q7E A;  3SJC C;  4FM2 A;  3FB7 C;  4NXM O;  3OTF A;  4UCU A;  4F4L A;  5LHG A;  5L3E A;  2Q69 A;  1SET A;  3UM7 A;  1Q7Y W;  1IBM O;  2UXC O;  3ABU A;  4TV9 B;  2HVK C;  5H6R A;  3JD0 A;  2MK3 A;  2OCC B;  4PJ0 Z;  1GH6 A;  1Q86 W;  2YC0 A;  3K3W A;  3BHP A;  1YTF D;  2OTL V;  4O4H A;  4JYA O;  4TQD A;  3UCS C;  1WB7 A;  1K4D C;  3ZBH A;  5IY5 B;  1E1R G;  2CGN A;  3OMN B;  2E5L O;  1NH2 D;  4JI0 O;  5IT9 N;  4HBN A;  3JAW B;  1Y76 B;  3L73 H;  1XUQ A;  4BIO A;  3B40 A;  4ZI7 A;  5LOV B;  3K9S A;  5LYJ A;  2ZR3 A;  1FD9 A;  4P9P A;  3EVK A;  3FAV B;  1S5L Z;  3JAK A;  5EZY B;  1MZE A;  1XMQ O;  2QKA A;  3CME V;  3STZ C;  3F5T A;  1O9G A;  4JI2 B;  2CTP A;  4O2B A;  4LFC O;  2L6L A;  4DV3 O;  1URF A;  4JGS A;  5KAF Z;  1K9M W;  1RM1 B;  4DR3 O;  2P4K A;  3LNN A;  1N0J A;  1RFY A;  1PNM A;  2F23 A;  2ZE6 A;  4TT3 G;  3OTO B;  1EN4 A;  5IDJ A;  1I94 B;  3ZMU A;  3HB3 B;  3I56 V;  1W2B U;  4IYI A;  2JJ2 G;  2PYJ A;  3WU2 Z;  4JI7 O;  4LFB B;  2F93 B;  4TWK A;  3NR7 A;  1W0K G;  4PA6 A;  1RP3 B;  4JF3 A;  4ZOL B;  3ZRX A;  2AHY A;  5KMG A;  1L0N H;  1YZB A;  4LNU B;  1KP2 A;  3L9D A;  5JJJ B;  3RFR A;  4F6R B;  5IJ9 A;  1PNL A;  1LUV A;  4TV8 B;  2IH1 C;  1F4M A;  3DGE A;  3JAW A;  4WCE V;  4TUY A;  4CC6 A;  1N32 O;  3HKC A;  2AZ0 A;  3VQV A;  2LW7 A;  1MOF A;  3P3P A;  4JI8 B;  1RPO A;  3E86 A;  3M8A A;  3CCQ V;  1EM1 A;  1Q90 D;  5EBL C;  1IXM A;  5HFL A;  1R6K A;  5KHJ A;  1K3E A;  3E22 B;  2N05 A;  2XAG A;  2WA4 A;  2X6A A;  2WA3 A;  2EUL A;  2XAF A;  5KX5 A;  4X1K A;  5L3G A;  3QTC A;  4DV1 O;  3RYC A;  4I55 B;  4HYO A;  2OWO A;  4IT5 A;  1XBL A;  3N2G B;  4JZG A;  2WLL B;  4J7K A;  3WFV A;  1W0J G;  5GTI Z;  3ZRV A;  5IWA B;  4I4T A;  3SDL A;  1XMO O;  5KX5 B;  5LMN B;  4DR1 O;  4YJ3 A;  2QM7 A;  2A0L A;  1SQQ H;  4RAI A;  5EC2 C;  3NXS A;  2IBZ H;  2KKW A;  2Y69 C;  4JAA A;  5ITZ B;  4TSF G;  2EX3 A;  4X62 O;  1COW G;  1V54 C;  4KHP B;  3T4Z A;  3W7S A;  1OCC B;  4O2A A;  4Z1V A;  3K5L A;  2QWO B;  2ZXW B;  3K58 A;  1K33 A;  3ZMS A;  1S3J A;  3E8G A;  2YDE A;  4DR2 O;  4R50 A;  4DV2 B;  4DW0 A;  1I0H A;  4TUY B;  3FB5 C;  3AG1 C;  2BSK B;  4DW1 A;  4DR4 B;  1XNQ O;  5CA0 B;  3K5N A;  3ZMT A;  1MSD A;  4O4J A;  2OTJ V;  1XMQ B;  1LNQ A;  1ZAU A;  1OCR C;  4PV1 B;  3GB7 C;  1I5X A;  4I5S A;  1L8D A;  1QLN A;  3LSQ A;  4PA4 A;  4JV5 B;  5L3B A;  1P84 F;  1THZ A;  1D5N A;  3G80 A;  4QPJ A;  5IYZ B;  3SPC A;  3ETG A;  4J41 A;  5AG2 A;  5GON B;  2VWK A;  3C90 A;  4B3S O;  1QVG U;  1N36 B;  3OEH G;  4FLT A;  1OCO C;  3W7X A;  1VP7 A;  1IBM B;  1JCH A;  4JAV A;  2BTQ A;  4PDM A;  2UXC B;  4U3J A;  3K06 A;  2P4V A;  1TUE B;  3E8F A;  5CBH A;  4LWS A;  5FL7 G;  5FNV B;  2F4V O;  3K0D A;  1V9P A;  1J95 A;  2XAS A;  4C7U A;  3FYI B;  4L8J A;  4J9Z B;  3ICX A;  2EIK B;  2EIL C;  3A0R A;  2QM4 A;  4O2A B;  2YID A;  4DV7 B;  1JA8 A;  1G1X B;  3ETE A;  1VMG A;  5EBM C;  1NZ6 A;  5KLV H;  1XNR O;  3WB1 A;  2Y0I A;  3JYC A;  1ZL8 B;  4CH4 A;  2CTR A;  1BCC H;  3U11 A;  1YF2 A;  2UXD O;  4QJF B;  3PN1 A;  1YXB A;  3RYF A;  2ZDI A;  3R66 A;  3ZHU A;  4J7J A;  4X65 B;  1FFT B;  1PNK A;  5D5P A;  4JPR A;  2WLI A;  1DK1 A;  3LDE A;  5DED A;  3E89 A;  1FXK B;  3CS5 A;  4AHC A;  1O9H A;  4X20 B;  2RCV A;  1YCI A;  3A0H Z;  1FPO A;  2Z0A A;  1PD3 A;  4QNH B;  1F51 A;  5EYP B;  1VQ9 V;  4B3T O;  1N34 B;  1OV9 A;  1YVW A;  1IUR A;  4DR7 O;  1NBM G;  1XHZ A;  4UV9 A;  5LMU O;  2YI8 A;  1EZV H;  1AI7 A;  4DR5 O;  2V7Q G;  4UVA A;  2IM9 A;  3D8C A;  5IJ9 B;  4FLV A;  3ASO C;  1Z5W A;  2GHY A;  5C8Y A;  2F1M A;  4LNU A;  2N74 A;  4EB6 A;  4TV8 A;  2NN4 A;  2X6B A;  2PYL A;  2W6I G;  4QE9 A;  2VS0 A;  5B1A C;  1SS3 A;  3CRC A;  1K34 A;  1WA8 B;  2WWW A;  4GKJ B;  3RYI B;  2HVJ C;  3RYH B;  1NKD A;  3CXC U;  1NH2 B;  5B66 Z;  4FLW A;  4W4L A;  1N33 O;  1KP3 A;  3RN4 A;  4O4I B;  1J5E O;  1Q6H A;  5B1B C;  1KC8 W;  1FAF A;  3RGB A;  5CBG A;  1AJN A;  3FYE B;  4FM0 A;  4ZIB A;  2CH7 B;  4ZHQ B;  2X6C A;  1M4U A;  5B3S B;  1FKA O;  3ZRW B;  2DN9 A;  3E8H A;  3H9V A;  1CEZ A;  2KQX A;  1OHH G;  2B5U A;  2BOB C;  1SRY A;  4O4L B;  1SZX A;  5C93 A;  1QLE B;  4LFA B;  1HNX B;  3H1H H;  3CHX A;  3LSS A;  2DMX A;  1HP8 A;  3OW2 U;  1H2S B;  3HKE B;  2IJI A;  4O4L A;  3U0Z A;  4GKK O;  1SA0 A;  3WB2 A;  2GDS A;  2CH7 A;  5H5N A;  3C3T A;  1PPJ H;  5LOV A;  3DC5 A;  4JI0 B;  3K59 A;  3SPG A;  4YHH O;  1VF6 A;  5LHH A;  1H2M A;  5JQG A;  3C3S A;  4G2K A;  1Q6I A;  5F2V O;  3ZJZ A;  2EIL B;  4DR2 B;  3T1H O;  2IU0 A;  4X66 B;  3RYI A;  3B8N A;  1OZ0 A;  3SYO A;  4DR4 O;  4TV9 A;  3RT3 C;  3ZN0 A;  1XRE A;  2XHB A;  1B04 A;  4DO2 A;  4FLU A;  1GTO A;  3O9O A;  4MVS A;  3AK3 A;  4JYC A;  4EFB A;  3E8B A;  3JCU Z;  3UT5 A;  4JI6 B;  2ZDI C;  3AG3 C;  2AXT Z;  2FYU H;  3MAQ A;  4LF5 O;  2ZNI A;  2FTK A;  4B08 A;  1CP9 A;  2PZS A;  4JV5 O;  3P32 A;  4E2L A;  5JCO A;  4MSW C;  2UUA B;  4GX5 A;  1P49 A;  2YXY A;  3AK1 A;  2UXX A;  2UXB B;  5BMV A;  2E5L B;  1ZSP A;  3HKB A;  1RPR A;  2L35 A;  2RQ6 A;  4PDL A;  1W59 A;  2JRI A;  3OAA G;  5B1A B;  4IIJ B;  2IH3 C;  2JDI G;  4X20 A;  4JI5 O;  1BMF G;  1FXK A;  2HEP A;  4Q20 A;  5LA6 B;  1JMK C;  4K0K O;  4YY3 O;  1KUQ A;  3L74 H;  2QKS A;  1BGY H;  1VQN V;  3RWR D;  4YY3 B;  3CPW U;  3RVY A;  4DR3 B;  2X7R B;  4N21 A;  5KHI A;  4DV3 B;  3JD1 A;  3IC7 A;  3O65 A;  5KUM A;  4X8A A;  3L75 H;  1AI4 A;  1QU7 A;  3CC2 V;  1UFI A;  5L3C A;  2QDO A;  5LHI A;  4GT1 A;  4J9Y B;  1Q43 A;  1WPX A;  4IHJ B;  3W7W A;  3JAM N;  4LBE C;  1H2N A;  4LF7 B;  3CRQ A;  3M7M X;  4J11 A;  1B3Q A;  1VQP V;  2NNU A;  2QE7 G;  5LXT A;  1Y4M A;  4LF7 O;  4LFB O;  4CS4 A;  2DJV A;  1SA0 B;  2LFS A;  4G28 B;  3CCM V;  5IJ0 A;  4X1Y B;  3APO A;  2B1G A;  5JVD A;  3SYA A;  5JH7 A;  3TJT A;  1XHX A;  4FFK A;  2F4V B;  4CS2 A;  4LFA O;  3K5O A;  4DV0 O;  3CCS V;  4O2B B;  4NR1 A;  1AP5 A;  2Q7H A;  3W7U A;  1F23 A;  5J2T A;  2UU9 B;  4PI2 A;  4JYB A;  4CH6 A;  3JAK B;  5H9C A;  2XAQ A;  3HPL C;  5GON A;  2ARH A;  2A7W A;  3CRR A;  4IL6 Z;  2LQT A;  2EIK C;  1IDS A;  2GUZ A;  4YJ2 A;  2R9A A;  3B4S A;  2UXN A;  4BIZ A;  2QWQ B;  3AG1 B;  3CRM A;  3QF7 A;  4PHZ A;  4DRX A;  2VRZ A;  4P2Z A;  1YJ9 V;  1UPG A;  2HHH O;  2JEX A;  5BZB A;  5KA6 A;  2DE0 X;  2OYQ A;  3BEH A;  2IU3 A;  3ZMZ A;  3IGA C;  1XI1 A;  1HNZ O;  2B9Z A;  1M90 W;  3OMA B;  3AK2 A;  2HLD G;  1YHQ V;  1ARO P;  1VQL V;  2ITD C;  4IGG A;  5BXZ A;  1R1B A;  1NT2 B;  1I5Y A;  4LF5 B;  3ZN1 A;  1SF9 A;  2RJZ A;  1WJZ A;  2Z3Y A;  5K1X A;  1YJW V;  1YEW A;  5FLX N;  3ZHS A;  1F7Y A;  3OR7 C;  3H1J H;  3BAB A;  4JYY A;  3SYP A;  5BY1 A;  2EIN B;  1YTF B;  3FKS G;  2QJ1 A;  5BR8 O;  2PGG A;  3TK1 A;  2R72 A;  3K5M A;  4DV5 O;  1K5Q A;  3SGI A;  3BVO A;  2KG7 A;  1N36 O;  2JVD A;  4GCZ A;  3DSQ A;  2ITC C;  4UUJ C;  2QWR B;  1FYJ A;  4IYH A;  1GM7 A;  1KB9 F;  2YXL A;  1G8M A;  3R65 A;  3X2Q C;  1ENV A;  2Q68 A;  5KHG A;  2JEU A;  2QTS A;  4LF9 B;  1P4R A;  2BOC C;  4X1K B;  1VF5 B;  5CA1 B;  4UXN A;  5KMG B;  1PL0 A;  1GM8 A;  3THO A;  4OX9 B;  5JQG B;  1H8E G;  3JSL A;  2ILM A;  4B3M B;  3KG2 A;  2X0L A;  3UO2 A;  5B5E Z;  1NQT A;  3ASO B;  1U96 A;  4W4K A;  4JI4 B;  5CBF A;  2FML A;  1NVP B;  4X64 O;  1AVM A;  2PF4 E;  4D7S A;  1FXV A;  4X1I B;  3HKE A;  1HR0 O;  3G4S V;  4DYL A;  3IJ4 A;  2F95 B;  2N04 A;  4UV8 A;  5FNV A;  4LWS B;  4NB5 A;  1ZWI C;  1QR9 A;  1TA8 A;  4FZ1 A;  2V4D A;  4MVM A;  4RO2 A;  5JVD B;  1YIJ V;  2GV9 A;  2EIJ B;  4R8C A;  3A2F A;  1BQZ A;  2HP8 A;  4RWU A;  4UCO A;  4JAS A;  4GUN A;  5IYZ A;  3ZHT A;  4DV4 O;  1H8H G;  2CUG A;  2CAZ C;  4FJC C;  4J10 A;  4FK5 C;  1R73 A;  1OJH A;  3ABL B;  2LP7 A;  2GTS A;  1S0V A;  3JCZ A;  4O4I A;  2R9I A;  5J2U A;  5EC1 C;  1GAX A;  4MVU A;  5CB4 B;  1HNW B;  5D5Q A;  5EBW C;  3E83 A;  4U7O A;  3STL C;  4X66 O;  2EJR A;  1NU1 H;  1V54 B;  3UQ8 A;  3RYH A;  4NXM B;  1AJQ A;  3D3I A;  3VQW A;  5CA0 A;  4K3A A;  3SPI A;  4PA9 A;  5E79 Z;  4JI2 O;  3D3Q A;  2ZE5 A;  1JFF B;  4LR3 A;  2WLK A;  3ASN C;  1Y74 B;  1Q5O A;  4DV6 B;  4EKW A;  4DR6 O;  4AQY O;  4FMT A;  1M56 B;  4X89 A;  1ORQ C;  3OEE G;  2XOK G;  4LP8 A;  2DQ3 A;  1R3I C;  3CE2 A;  2WLN A;  1R3L C;  3CCU V;  4MW3 A;  1VQM V;  1SER A;  3CCV V;  1D5A A;  3N2K B;  3ABL C;  2AZ2 A;  2P67 A;  5LMU B;  4I50 A;  2Z5U A;  4OGQ B;  3OT7 A;  3QO5 A;  2RNB A;  3H1K H;  3ZCC A;  1MSW D;  4DV2 O;  2AW9 A;  1AP6 A;  2RDC A;  3K03 A;  4JAU A;  2IJJ A;  3RVZ A;  3ETQ A;  4I0X B;  4K0K B;  1SQX H;  1JX9 A;  5H2F Z;  5IYD O;  2Q67 A;  2ZE7 A;  2ZQM A;  2Y48 A;  1KYO F;  4FM1 A;  1IBK B;  2IJK A;  3CWB H;  3ZHR A;  1NS1 A;  2KSD A;  2GSM B;  3ASN B;  2W0F C;  2K9P A;  3JAS B;  2VQE B;  1XIL A;  2H8P C;  4H13 B;  4OX9 O;  3IAY A;  2ZM6 B;  1LUW A;  4BW9 A;  4DUY B;  2ADQ B;  1QBZ A;  2HHH B;  2XAJ A;  1YIT V;  4WFA V;  3SJB C;  4K35 A;  2YEV A;  1Q6U A;  3JSN A;  1VF6 C;  2QWP B;  3OGC C;  4I9W A;  2ZIM A;  1WAZ A;  4ASU G;  2DWE C;  2QTO A;  1DF5 A;  1HWY A;  3ZHQ A;  4UFZ A;  5L3D A;  1DF4 A;  1GO3 F;  1VAR A;  1Z2G A;  5IYB O;  1WN7 A;  1EZJ A; 
#chains in the Genus database with same CATH homology
 4LFC O;  4DV3 O;  4JI2 O;  4OPH A;  2ZKO A;  2DOS A;  1A32 A;  3SDL A;  4LF5 O;  1XMO O;  1IBL O;  2AGA A;  4JI1 O;  4DR3 O;  1X59 A;  4DR1 O;  4GKJ O;  4JV5 O;  4JI3 O;  4DR6 O;  4AQY O;  2VQF O;  1N33 O;  1G1X B;  2UXB O;  1J5E O;  1AB3 A;  1XNR O;  4X62 O;  2VQE O;  2FKX A;  4DUY O;  1FKA O;  4X64 O;  1HNW O;  4KHP O;  2HHH O;  2JRI A;  2UXD O;  4NXN O;  4JI5 O;  5A2Q N;  4X65 O;  4JI7 O;  4DR2 O;  1HR0 O;  4LF6 O;  4NXM O;  3R66 A;  4DUZ O;  1HNZ O;  4DV2 O;  2UUC O;  4LF8 O;  1XNQ O;  1IBM O;  4K0K O;  3J7A U;  4YY3 O;  1YZB A;  2UXC O;  1DK1 A;  1KUQ A;  2UU9 O;  4LF9 O;  5BXZ A;  1R1B A;  2UUB O;  1D2D A;  4GKK O;  3T1Y O;  5IWA O;  4JI6 O;  4LF4 O;  5FLX N;  1F7Y A;  4B3R O;  2Z0A A;  3O65 A;  1R6T A;  1N34 O;  2UUA O;  4JI8 O;  1NS1 A;  1N32 O;  3J81 N;  4JYA O;  1IBK O;  5H5N A;  5LMN O;  4DV4 O;  1XEQ A;  5BY1 A;  2LW7 A;  1I94 O;  4B3T O;  3M8A A;  4YHH O;  4DV6 O;  4OX9 O;  2E5L O;  5BR8 O;  4DV7 O;  3OTO O;  3JAM N;  5LL6 Y;  4OPA A;  4DV5 O;  4B3M O;  4JI0 O;  4DR7 O;  2ZM6 O;  5LMU O;  5IT9 N;  4A5U B;  1N36 O;  3J80 N;  4LF7 O;  4JI4 O;  4LFB O;  4DR5 O;  3T1H O;  2DJV A;  4B3S O;  1AIL A;  4DR4 O;  1FYJ A;  4DV1 O;  4X66 O;  3RT3 C;  2N74 A;  1FJG O;  4LFA O;  1XMQ O;  3F5T A;  1HNX O;  4DV0 O;  2F4V O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...