4DUYO

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
87
structure length
87
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 30
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4duyO00
3F5TA 4OPHA 4LF9O 4GKKO 4JV5O 2UXCO 5LMNO 1DK1A 2DJVA 1FKAO 3JAMN 1J5EO 2JRIA 4YHHO 4DV0O 4LF5O 4DR5O 4DUZO 1IBMO 2E5LO 4DV3O 1I94O 4JI5O 2DOSA 4DR2O 1HNWO 5BR8O 4B3TO 3J80N 4LFBO 4LF4O 4B3SO 4YY3O 5FLXN 4K0KO 4LFAO 4DV5O 1R6TA 5LL6Y 2UUAO 4LF7O 1A32A 1X59A 3RT3C 1NS1A 4GKJO 5BY1A 4LFCO 2ZM6O 4DV1O 1XNQO 3J7AU 1N34O 4AQYO 4JI4O 4B3MO 3T1YO 1FYJA 1AB3A 5H5NA 4JI3O 4JI0O 1HNXO 1IBLO 1KUQA 2ZKOA 1FJGO 2AGAA 1XEQA 4A5UB 4JI8O 4DR6O 4B3RO 1HNZO 4JI2O 1YZBA 1F7YA 1N33O 4NXMO 5IWAO 2VQFO 3R66A 4DR3O 4OX9O 4X65O 4X66O 5BXZA 3M8AA 1G1XB 1AILA 4KHPO 4LF6O 1XMQO 4JI1O 3SDLA 3OTOO 4OPAA 2LW7A 1R1BA 1XMOO 1N32O 5IT9N 3J81N 4LF8O 2UUCO 1N36O 4JYAO 4DUYO 4JI6O 3O65A 2F4VO 5A2QN 4X64O 2HHHO 3T1HO 1XNRO 4NXNO 4DR7O 2FKXA 2Z0AA 4DV2O 2UUBO 2VQEO 1HR0O 2UU9O 4DR4O 5LMUO 4DR1O 4DV6O 2UXDO 1IBKO 2N74A 4JI7O 4DV7O 1D2DA 4DV4O 4X62O 2UXBO
chains in the Genus database with same CATH superfamily
3F5TA 5KAFZ 4JYAB 1YEWA 1SKVA 1AI6A 3APQA 2ZNIA 2IJIA 1I5XA 1KKCA 2EZOA 2JS3A 1IBMO 3D36A 4JI5O 1JVMA 2FL4A 4LF6B 1BMFG 4YY3O 2EIMC 3Q4HA 1LUWA 1XDCA 4NVPA 4UCSA 2CTWA 2UUAO 4LF7O 4FFBA 4DV7B 3ZMTA 3T4DA 4DV1O 1Y76A 4H0LB 5KHIA 1FXVA 1Q3EA 4YHHB 3VQVA 3W7WA 2LGWA 2ZINA 4JI3O 2YIAA 1VQMV 1VQKV 2PYJA 4FPPA 2OCHA 2R72A 3BEHA 5B3SB 1AP6A 1U97A 2GSMB 2VQFO 3RVZA 3ETQA 3ZS8C 3QO8A 1SQQH 5GTHZ 3SPGA 3A0BZ 1BT8A 2YI8A 1M56B 2ZR3A 2YIBA 5LP6C 3BY6A 4JI1O 3P32A 1NT2B 1QR8A 1IBLB 3OT7A 1O9GA 4JTCB 4LP8A 5EC2C 1Z5VA 1NVPB 4L87A 4PDMA 4X64O 3T1HO 1NTMH 4KXRA 3L74H 3HKBA 2Q5ZA 3CCUV 2JGUA 2P4KA 4K3AA 3CXHF 3ZJZA 1IXMA 1FXKA 1D5NA 1PNKA 2F1MA 3L75H 3DSQA 1YVWA 1KP2A 2YXHA 3H1KH 1V9PA 2EIKB 2BSKB 4ICGA 4WCEV 3G6EV 4LF8B 4FK5C 1SF9A 5CB4A 1YITV 1WP7A 4DV3O 3JD2A 4KHPB 3E8GA 2NLJC 2XUMA 2UUBB 1JCHA 1HR0B 4YJ3A 4U3JB 4JYYA 4WFEA 3WB0A 2HVJC 1KMIZ 1GK9A 3NXSA 5JH7A 3FFQA 1AR4A 4IGGA 1P7BA 4AQYO 1J5EB 4X1KB 3RWRD 4O4HA 2ZE7A 3FAVB 4JI8O 1L8DA 4B3TB 4PDLA 1X4TA 2VWKA 1AROP 1SQBH 4C7UA 3JSLA 2XAQA 3UT5B 4HZ3A 3DXRA 2JGDA 3UCSC 4WF9V 1KYOF 1NBMG 1BZKA 4PDVA 1TUBA 1H2LA 5D5QA 4RO2A 3M99B 4UCRA 1NVPD 4LF6O 4P30A 3ABLB 5KHHA 3RW0A 3ASNB 1M57C 3AK2A 3RYFA 4DR5B 1WNSA 3NR7A 3CCSV 2ZIMA 1EBOA 4WBNB 5IT9N 3J81N 3SYCA 2XT9A 3BAAA 1SQPH 2IJHA 2IU0A 4IYHA 2ZXWC 3FB5C 2LW1A 2BTQA 5IJ9B 4WFAV 2Z0AA 4X20A 1AI4A 5CA1B 4GX5A 2QE7G 4MVMA 1HP8A 4FM0A 1EN5A 1K97A 4G2KA 4GKKO 2CE4A 1KU9A 5AG2A 4KL1A 4JTAB 4RQFA 4JZGA 4F4LA 5J2TB 2GTAA 4DR7B 3ZRWB 3F5WC 5KUMA 1JJOA 4CH4A 1NJIW 3JARA 3AG2B 5FPOA 2VQEB 3G71V 4DV6B 2UXDB 1VQ9V 3KCYA 2EULA 2FB5A 4GKJO 4LF9B 1P7GA 3D36C 5BMVB 2ITDC 4XBFA 2M6YA 3AG3B 2P06A 3E22A 3E8FA 2FMLA 1Q6IA 3TK1A 2QM4A 1Y66A 3TXQA 1TUEB 3WG7B 4P2ZA 3A8TA 3KCXA 4PHZA 4RUFA 5IJ0A 4I5SA 4LFAB 2IJKA 1SRYA 1ZTEA 1WP8A 2PF4E 1AILA 5LXTB 1ZL8B 2XHBA 1XHXA 2AW9A 1YHQV 3K06A 4KHPO 4Z1VA 4JGSA 2XASA 1FXHA 5CB4B 1K5SA 4MVRA 4TV8A 1H2SB 1RPRA 1QCEA 1SESA 4HNAB 3OMIB 3STZC 1PD3A 1N36O 3ZN1A 1DF4A 1BQZA 4NXMB 5IWAB 4O2AB 3K03A 2VRZA 4NXNO 1FFXB 5JH7B 4I0XA 5BZBA 3AG4C 5GONB 4GT1A 2JVDA 1MABG 2WLLB 3CMAV 5KUKA 5LMUO 2YUAA 4CS2A 1MOFA 2EINB 4P9OA 4OPHA 2F95B 3JASA 2DYSC 4UCTA 4J11A 4L8JA 1HDJA 4DR5O 1VQLV 4O4JA 3L71H 2E5LO 1TUBB 4X1YB 3OGCC 2LJ2A 1RM1C 3WB2A 2GHYA 3B8NA 1B6QA 4LR3A 1MMMA 1R3LC 4X1IA 1A32A 3CJHA 4DXWA 2UXBB 3O9OA 2R9IA 4DW1A 1VQOV 4B3MO 4ZI7A 2VWJA 1EM1A 2EIJC 2QJ1A 5H5NA 3UQ8A 1SA0B 4MVQA 4JAVA 4A5UB 1HNZO 3CMEV 1YZBA 2KSDA 5KA5A 3CC2V 4AHCA 2HG5C 4H37A 3CC7V 1FS0G 4ZOLA 3T2MA 2ITCC 1ROPA 2ZM6B 4JI4B 5CBHA 2HEPA 3CRRA 3ICXA 1RFYA 1EN4A 2JEUA 4BR6A 1XMOO 2LP7A 3QF7A 2Z3YA 2Q68A 1GM8A 1SZTA 3APOA 4CS3A 1WB8A 4UUJC 5B1NA 4FVMA 5IY5C 1N33B 4UV8A 1V55B 1QLEB 1VIBA 1I7FA 5KMGB 3QO7A 1THZA 1VQ5V 4CH3A 2FKXA 4YJ2B 4TUYA 5JQGB 1AJQA 2EX3A 4AI8A 3OW2U 4DR1O 1NH2B 4FLYA 2Q0OC 5JJEB 3CC4V 3ETGA 1GKFA 2UUCB 2GTSA 2WLIA 3H1JH 3OFNG 3FX7A 3SYOA 2F4VB 3STLC 1M5IA 4D7TA 1JFFB 2HP8A 5HFMA 2IM9A 1K9MW 3OAAG 4K0KO 4TV8B 2JDIG 3CD6V 4LH6A 1W2BU 2RQ6A 3ZHSA 1BL8A 1IBKB 1K5QA 2HJFC 2QM8A 1MZFA 1SS3A 2KB1A 5B1BC 3RT3C 4OGQB 5DEDA 5DM6V 4R8CA 1XNQO 3X2QB 3ZMVA 5JWPA 4I9WA 1M93A 3JYCA 3RFRA 2EILB 4MVOA 1ZUQA 3AK1A 1JA8A 1HNXO 3TXSA 1R6NA 4DR2B 2Q6AA 3EHBB 4Q20A 1Q5OA 5ITZB 2P6JA 3CHXA 1Z5WA 3TETA 5LMNB 2F66C 4F6RB 3VQXA 1ZAUA 1KKDA 1J95A 1YDXA 2B1IA 1XMQO 3WU2Z 4O4JB 2LW7A 4JI0B 4J7KA 2Q7HA 3ABKB 4NTYA 2AXTZ 2XAHA 4I50A 1ZX3A 2E3CA 1NH2D 3C3SA 4BIZA 4D7SA 4FLXA 2OTJV 3LNMB 3RYIA 2H94A 2GBOA 1I08A 4FM1A 4U3JA 3SJAC 3OM3B 2OCCB 4JI7O 1LUVA 4X62O 1JMKC 2XNDG 4QPKA 3IGAC 2BOBC 3HKEB 4X1KA 1JQ0A 1JJ2U 1QR9A 4K35A 2A06H 4U3FH 3ZMZA 2QWPB 4DK0A 5TISZ 4KP4A 5L3CA 3FAVA 3A0RA 4X9QA 2FTKA 5KX5B 1AR1B 2V7QG 1OCCC 4AILC 2X6BA 3UT5A 4DK1A 4G27B 3SYAA 1S72V 1K7DA 2ZCEA 3UO2A 2CH7B 1B06A 1F51A 2OYQA 4H13B 3L73H 4JZ2A 1AP5A 1VARA 4BIUA 1N34O 2IJJA 1N0JA 2PZSA 3ZHTA 3K04A 2CGOA 2JIZG 4O4LB 4PA3A 1YI2V 4FLVA 4WBNA 1KUQA 3PN1A 1HNWB 2Y48A 4TUYB 2Y0PA 1K73W 5JJJB 2FYUH 3LSQA 5IJ9A 1QQCA 1KD1W 4X8AA 5CA1A 2WLIB 4ZHQA 2Q7GA 2ATKC 2GUZB 3N2GB 4HBNA 4R6ZA 3CRAA 3H01A 4U7OA 3WFVA 2H8PC 1SC5B 3OUSA 4JI6O 1XBLA 5A2QN 5J2TA 2HHHO 1DF5A 2W0XA 3ZRWA 4NTXA 2ETNA 3HKCB 3BABA 2XOKG 3FB8C 1UJWB 2BE3A 3CCVV 2P5OA 2ZT9B 2CTRA 3JCZA 1N32B 5JCOA 2WLNA 1R3JC 2PGGA 5BMVA 5LMNO 3FD9A 1VQ7V 2P22C 5EBMC 1SQFA 2M7WA 3W7SA 1XNRB 1KQSU 2OT5A 4G28B 1PP9H 1IX9A 4I4TA 4UFZA 3D3IA 4LFBO 4LF4O 3ZIAG 2Q4PA 5FLXN 1FPOA 4MS2A 3ZRXA 3B40A 5LXTA 1ZL8A 1R3KC 4JTDB 5BY1A 2A9HA 4F6EA 2UXCB 4MVZA 3E8BA 4GYCB 4I50B 2P4VA 3H1IH 1I0HA 5B3SC 4HNAA 3E83A 3RYIB 2D3OW 2Y4UA 5BR8B 4HAMA 1CEZA 3F7VC 1M56C 4O2AA 2PI4A 3R66A 3ZMSA 1FFXA 4TT3G 4DYLA 1US6A 3B09A 3JD3A 4J41A 2H3OA 3CRQA 1TAEA 2HFEC 1SZXA 4LFCB 1YXBA 5GONA 2IBZH 3K9SA 1WA8B 2WLLA 4UXNA 1S3JA 4LF5B 4DUZB 4PDRA 1I94B 1MNGA 4I7ZB 3ASOB 2HJDA 4XDKA 1FJGB 1Q90D 2ADPA 4HYOA 1YF2A 1M90W 4JYAO 3K5OA 3MD0A 2RCVA 1N8RW 1K4CC 4R7CA 4MW3A 2QM7A 1S0VA 2R70A 2PI5A 5JVDA 4X1YA 2EIKC 1M9NA 3ZX6A 4JYBA 5IE9A 3K3WA 3CRCA 3MAQA 2YEVA 3HKDB 4PV1B 3ZCCA 2OIGA 5LGNA 2CTQA 4FJCC 1XOUA 3SJBC 4DV7O 3G67A 4UB6Z 2E76B 4UVCA 2IH1C 4PI0A 4LH7A 3JAMN 4YHHO 4MSWC 4WFFA 1G6UA 3ZHQA 1SA0A 2ILMA 1GH6A 1COWG 4B08A 4BWAA 3FB7C 4O2BB 2ADQB 3JATA 2QWQB 3D3QA 2LQTA 4ZHQB 1YIJV 4ZKIA 2LGQA 2QTSA 3JD0A 3SPIA 1EN6A 3UO3A 4N23A 1Q86W 4PA4A 2K1EA 1K34A 2ZQMA 2KQXA 1S5LZ 3SPHA 5EIBD 2EJRA 5FNVB 4J10A 4UCUA 3HB3B 3BRCA 4DV0B 4FM2A 3BFRA 2RJZA 1IBLO 2AGAA 3OMAB 1S5JA 4J9YB 1VMGA 1F7YA 1S76D 3ETEA 3ABLC 5IYCO 4MTGA 3ASNC 5KMGA 2WA3A 4YJ2A 3OD4A 4IIJB 5JQGA 4RAIA 1YJWV 4TWKA 5LA6B 3JAWA 3T1YB 4EFBA 3AEIA 3EVKA 4J42A 2NNUA 2Q73A 4I4TB 2YC0A 2X7RB 3GB7C 4LF8O 2Y69B 4JI2B 1B3QA 4P9PA 4DR3B 4OX9B 4X66B 4D6TH 1JFFA 4X89A 3T4ZA 3QTCA 2C2AA 4PJ0Z 4ABMA 2UUBO 4UCVA 1HR0O 4GUNA 4J9ZB 1T5EA 1H8HG 1W0JG 2YS8A 1XL4A 1VP7A 5EZYA 3CCLV 1FKAO 3VOUA 1J5EO 4DUYB 2DYRB 2WSSG 2AHYA 1GN6A 4UB8Z 3AG2C 1XUQA 2QR4A 3CCJV 4LF5O 1BSMA 1RP3B 5DN6G 4DUZO 1ORQC 3CSXA 1I94O 4EB6B 3S3XA 2LFRA 5E79Z 4B3TO 3R65A 3J80N 3ABMB 5ITZA 4Z2WA 2GDSA 3JCUZ 1PPJH 3BPZA 3GVMA 4QIWF 2YDEA 3AG3C 2EJ7A 1VQ8V 1WLEA 3EFFK 1X59A 4F6RA 4DV4B 2F23A 5L3FA 4WFBV 1V54B 4JV5B 3CEIA 2QKCA 1I5YA 2WLMA 3J7AU 3WG7C 1F23A 2P90A 2A0LA 2Q8VA 2CUGA 1FXKC 3QG5A 3P30A 1R6KA 1ZSPA 3BHPA 2IH3C 4TQDA 5LHIA 5JVDB 1HW7A 3G4SV 1N0NA 4W4KA 3U11A 1OV9A 4B3SB 1OJHA 1SQXH 2YEVB 2W6IG 3ZN0A 5KA6A 4J7ZA 4DV5B 3UM7A 2A3QA 2WAMA 3K5MA 1AI5A 1QLNA 3IC9A 2X6AA 2QA4V 4CH6A 4PELA 5H6QA 4WFGA 1MSDA 5LOVB 1BQ0A 3U0ZA 3P3PA 1R3IC 4OPAA 2HKOA 4H33A 5LGUA 1R1BA 5IDJA 3K9AA 2ZE5A 1O9HA 4MTFA 4DR6B 3HKEA 3JATB 1JOYA 1AJNA 1RPOA 3CCEV 2Y0IA 4YIOA 3BA9A 5KX5A 1EFRG 4FLTA 2ZD9A 4DR7O 4IYIA 2HLDG 1MZEA 2EINC 1P4RA 1URFA 5K1XA 2CH7A 2QKAA 2VQEO 4JPRA 4DV6O 2UXDO 1VQPV 2DW4A 1D2DA 4LF9O 1K3EA 4B3RB 1R73A 4NB5A 1VQ6V 3H1HH 2JRIA 5KHKA 1VF5B 2PY5A 1KP3A 4O4LA 5K1PA 2YICA 4UVBA 5B1AB 4DV2B 2MW2B 3JAWB 1OCRB 4LFAO 2ODMA 2ZIOA 3F7YC 1GN3A 2YI9A 1P49A 2UU9B 4Z1MG 3K08A 3CRMA 3CCRV 3AG1B 3B4SA 1OCOB 4FZ0A 2QWRB 2JEXA 3DC5A 2GUZA 5CMUA 3N2GA 5IYBO 1UFIA 4YIPA 4K8ZA 3E89A 1IBMB 1QVGU 4JI5B 1XREA 4CBCA 2ZKOA 4ZIBA 1OCZB 2QWOB 3ZHRA 5IYDO 4GX0A 4YY3B 4NXMO 5IWAO 4JF3A 1PM9A 3E8HA 1G1XB 2E74B 4LF7B 2X0LA 2YXLA 3HKCA 3VBBA 5EZYB 4DV1B 4ZBMA 1MA1A 1E79G 3OE7G 2LFSA 2P7TC 5CBFA 2CK3G 3E86A 2WLJA 1GTOA 1V55C 3SYQA 5B5EZ 3PJSK 1QLEC 2ZR2A 4JI3B 2WWWA 2E75B 4JYCA 2AHZA 1Y74B 1VF6A 5LYJB 4PA9A 4LWSB 1WN7A 2DWEC 3GWKC 4MVSA 5FL7G 1Y67A 3L72H 5CA0B 1Y4MA 1IZ3A 4TV9A 2HVKC 2RNBA 2UXBO 3K58A 3JALB 1OCCB 4J80A 5J2UB 1NI8A 4X64B 1Q6UA 2ZNJA 1XI1A 1KB9F 4QGPA 1IURA 1CP9A 3KG2A 3B2EE 4DRXB 1TGOA 3ZEDA 2JJ2G 4JAAA 1NZ6A 2K9PA 3X2QC 2PTMA 3OTOB 1YJ9V 4TOIA 1F4NA 2EILC 4E4EA 3M7MX 1NS1A 3T1CA 2ZM6O 2EIMB 1CXZB 1WA8A 4JI4O 2YIDA 1QBZA 3LDDA 1B04A 2V1DA 1SQVH 4FIPC 3G6BA 1FFTB 5EYPB 4MT8A 3CX5F 4U7NA 4B3RO 1GO3F 2RDCA 3TCUA 3SGIA 1N33O 5EK0A 5CBGA 3L70H 1TVKB 3JD1A 5L3DA 3H1LH 4BW5A 2XAGA 3IAYA 2RN9A 2Q69A 1QNMA 3THOA 5E1AC 1W59A 3SPJA 3ABKC 3HKDA 1PKXA 4AQYB 1Q6HA 1AR5A 2UXXA 2ZDIA 2WA4A 3SDLA 4NTWA 3LNNA 5FPRA 1SETA 3MHHC 4JI8B 3JD4A 5LP6B 4LNUB 2UUCO 5JJNB 2F4VO 4EEQA 3TJTA 2OCCC 3CWBH 4O2BA 4RWUA 5B66Z 2YSUB 3ZHUA 1QU7A 5KHJA 4I9QA 4GCZA 1IBKO 2N74A 1NU1H 5IYZB 5L3EA 5C93A 5FNVA 3CP1A 3C90A 3ZHVA 3LDEA 5KLVH 2JS5A 4X65B 1LR1A 2PYLA 1NR7A 1L1FA 2DOSA 4DR2O 3IFXA 1LNQA 2X6CA 1GN2A 5H2FZ 1Z2GA 2JJ1G 1BS3A 2Z5UA 1PV0A 1IXBA 1KC8W 5LL6Y 4IIJA 4GKKB 5L3BA 5LA6A 1HWYA 4BW9A 1CPYA 1EZJA 1WAZA 2DQ0A 5EBWC 1PL0A 4N21A 5C8YB 2B9ZA 4CC6A 1XQ8A 3OEHG 4JI0O 4CZZA 1K33A 2F43G 1BHBA 3G80A 2WLKA 4MW8A 4MVUA 2XAFA 3JAKB 4TV9B 3CE2A 3RYHB 4E2LA 4IT5A 4BAYA 3LSSA 5H6RA 4GKJB 2LO1A 1RSOB 2R9AA 2OIEA 3OTOO 4RUEA 1GM7A 2KG7A 3SPCA 3OR7C 3C3TA 5DECA 1M57B 3RYCB 3K5NA 1K8AW 2A7WA 4EB6A 1Y6XA 1TA8A 4O4IA 3RBZA 2ZXWB 2DWDC 3WB1A 4QPJA 3CB2A 3S3WA 1VF6C 3OEEG 3QVNA 1N36B 3QNEA 1EZVH 3BA8A 1SERA 4NXNB 1HNWO 2JK5C 3I55V 1G4YB 2Q67A 3DC6A 4QE7A 5LMUB 1NQTA 3GWOA 4FFKA 1NTKH 5LHHA 4IHJB 2N04A 3OMNB 3W7UA 1L0LH 5A9GA 4PA7A 3ABUA 2WPDG 5LOVA 1GN4A 3K57A 4PA6A 5EIBC 3L9DA 4TQFA 2DE0X 2E5LB 3EXAA 3D8CA 3N2KA 4KUMA 3MDSA 1PNMA 2HR3A 3E35A 3CS5A 2N05A 4DR4B 1H8EG 3Q4HB 4X65O 4YXWG 4DO2A 4FFBB 3ASOC 5EC1C 5B1OA 1U96A 3ML0A 3LSUA 1Y76B 2CTPA 3MHSC 1JPXA 4B3MB 1OHHG 5CA3A 1YSCA 4XDJA 2QSAA 1N32O 1GMGA 1F4MA 1HNZB 4FZ1A 4FLUA 2P67A 4XDLA 1XNRO 2ZE8A 1QVFU 1XL6A 4UVAA 2ZDIC 3BCCH 1YTFB 2MK3A 3AG4B 1XMOB 1OZ0A 2UXCO 1DK1A 4FLZA 3ZMUA 1L0NH 3ZRSA 5CN0A 1MSWD 3KZIZ 1PL4A 2Q9LA 3CXCU 3CPWU 2DYSB 4UCOA 5BR8O 3HKBB 3ZRVA 1H38A 1S5HC 2XAJA 1FXKB 3IJ4A 4DR1B 2V4DA 2KG7B 2BCCH 3CYOA 1RM1B 1N4CA 3DGEA 2NR5A 4LFCO 4KFMA 2UXNA 5LGTA 2CGNA 2L35A 3E2EA 4PD4F 3P3NA 4QNHB 3JSNA 5LBQA 1GRJA 3OGIB 3OR6C 1NR1A 1ENVA 4O4IB 1FJGO 1XEQA 4QJFB 2DQ3A 5JCOC 3N27A 1Y74A 4GX2A 1GM9A 4LCUC 5LYJA 4K0KB 2EIJB 4LWSA 3RVYA 1H2KA 4YJ3B 1XNQB 3HPLC 5CA0A 1WPBA 1AJPA 2NN4A 2Y69C 5KHGA 1G8MA 4IL6Z 1K4DC 2DN9A 1VEWA 4O4HB 3JALA 1HNXB 2Y4TA 2YXYA 4R50A 4Q6GA 1YTFD 2B5UA 2CAZC 1PNLA 2YIBD 4QE9A 5J2UA 4MTXA 4EKWA 5H9CA 1SQGA 5J9PC 3DXRB 2JGDB 4DRXA 3W7XA 5HFLA 1WJZA 2QWNB 1VQNV 2VS0A 5F2VO 3FKSG 5IY5B 3I5DA 2EBOA 1E1RG 1XILA 2Q0AA 4I55A 3SJCC 1XMQB 1GAXA 1BCCH 3FB6C 1AI7A 2DYRC 3RYFB 4DR4O 1Q7YW 3CCMV 1H2MA 4PI2A 1FYJA 3N2KB 2ZE6A 2RMKB 4GZRB 2G38A 4GLXA 1KECA 3HR0A 2EZPA 3ABMC 4DV0O 5KAIZ 2AZ2A 4FLWA 5EYPA 1JR9A 2BTQB 3B8MA 2OWOA 1V54C 4X20B 4LBEC 1KBHA 2QKSA 1R6TA 2Q7EA 1TVKA 2WLHA 3FYIB 4JI7B 2KKWA 4X62B 2B1GA 2IU3A 1JX9A 3K79A 2QTOA 4LC1A 3T1YO 3TGUH 5B1BB 1AB3A 2QDOA 1YCIA 1MG1A 2QGNA 5LP6A 1WB7A 4LNUA 2L6LA 3QO5A 4JI2O 2CDYA 2XTAA 3JARB 1XHZA 3SR2C 2IW5A 1K92A 1P84F 4DR3O 1VQ4V 3B77A 2GV9A 3CCQV 4OX9O 1NTZH 2BTOA 4X66O 1FD9A 3OUFA 1D5AA 2OTLV 1N34B 3LDCA 3K59A 1H2GA 4CS4A 3E22B 4CC5A 4X88A 5IYZA 3SJQC 1E1QG 1ZLZA 4DUYO 3O65A 5IJ0B 1M1KW 4TSFG 2UUAB 3OTFA 3UKMA 1Q43A 1M4UA 1Q82W 1QHTA 3DTUB 1DLBA 2W0FC 1BHAA 4RQEA 3U10A 4NKGB 2ARHA 4DW0A 3ZBHA 4EFEA 1WPXA 1S77D 2F93B 4NR1A 5D5PA 4JASA 4UV9A 2BOCC 4DV4O 4JV5O 3FYEB 3LUTB 4B7EA 5EBLC 1AVMA 2DJVA 4J7JA 1DGSA 5B1AC 4JI6B 2VQFB 4JAUA 3I56V 3VQYA 1OCRC 5C8YA 2HHHB 4NYKA 4B7KA 1VF7A 1FAFA 4I0XB 3A2FA 3KKYA 2A79B 4B3SO 5GTIZ 1IDSA 4JI1B 5L3GA 3AG1C 4DV5O 1OCOC 3JAKA 5GW7A 3K0GA 3RYHA 4FMTA 3VQWA 3K5LA 1W0KG 3JASB 1RSOA 3RN4A 1BGYH 2R9RB 1OCZC 3ETDA 1ZWIC 3T1HB 4ASUG 1Q8IA 4OXSA 1DTOA 3RGBA 5LHGA 3ABTA 3AG7A 2BSKA 4DR6O 3A0HZ 4LFBB 4LF4B 3RYCA 4I55B 4CH5A 2PUSA 1H2NA 2D2CB 3K0DA 3BVOA 2W6JG 3M8AA 5BXZA 4X1IB 4WFHA 3CJHB 4K8XA 3SYPA 1Q81W 2QEXV 1BE3H 1YJNV 4H44B 4W4LA 1IVSA 3IC7A 3H9VA 3AK3A 4ZI7B 4DV3B 3W7TA 4GX1A 1NKDA 1UPGA 2O57A 2AZ0A 4ZOLB 4DV2O 4MTOA 4IHJA 4BIOA 2UU9O 2DMXA
chains in the Genus database with same CATH topology
3F5TA 4OPHA 4LF9O 4GKKO 4JV5O 2UXCO 5LMNO 1DK1A 2DJVA 1FKAO 3JAMN 1J5EO 2JRIA 4YHHO 4DV0O 4LF5O 4DR5O 4DUZO 1IBMO 2E5LO 4DV3O 1I94O 4JI5O 2DOSA 4DR2O 1HNWO 5BR8O 4B3TO 3J80N 4LFBO 4LF4O 4B3SO 4YY3O 5FLXN 4K0KO 4LFAO 4DV5O 1R6TA 5LL6Y 2UUAO 4LF7O 1A32A 1X59A 3RT3C 1NS1A 4GKJO 5BY1A 4LFCO 2ZM6O 4DV1O 1XNQO 3J7AU 1N34O 4AQYO 4JI4O 4B3MO 3T1YO 1FYJA 1AB3A 5H5NA 4JI3O 4JI0O 1HNXO 1IBLO 1KUQA 2ZKOA 1FJGO 2AGAA 1XEQA 4A5UB 4JI8O 4DR6O 4B3RO 1HNZO 4JI2O 1YZBA 1F7YA 1N33O 4NXMO 5IWAO 2VQFO 3R66A 4DR3O 4OX9O 4X65O 4X66O 5BXZA 3M8AA 1G1XB 1AILA 4KHPO 4LF6O 1XMQO 4JI1O 3SDLA 3OTOO 4OPAA 2LW7A 1R1BA 1XMOO 1N32O 5IT9N 3J81N 4LF8O 2UUCO 1N36O 4JYAO 4DUYO 4JI6O 3O65A 2F4VO 5A2QN 4X64O 2HHHO 3T1HO 1XNRO 4NXNO 4DR7O 2FKXA 2Z0AA 4DV2O 2UUBO 2VQEO 1HR0O 2UU9O 4DR4O 5LMUO 4DR1O 4DV6O 2UXDO 1IBKO 2N74A 4JI7O 4DV7O 1D2DA 4DV4O 4X62O 2UXBO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F5T A;  4OPH A;  4LF9 O;  4GKK O;  4JV5 O;  2UXC O;  5LMN O;  1DK1 A;  2DJV A;  1FKA O;  3JAM N;  1J5E O;  2JRI A;  4YHH O;  4DV0 O;  4LF5 O;  4DR5 O;  4DUZ O;  1IBM O;  2E5L O;  4DV3 O;  1I94 O;  4JI5 O;  2DOS A;  4DR2 O;  1HNW O;  5BR8 O;  4B3T O;  3J80 N;  4LFB O;  4LF4 O;  4B3S O;  4YY3 O;  5FLX N;  4K0K O;  4LFA O;  4DV5 O;  1R6T A;  5LL6 Y;  2UUA O;  4LF7 O;  1A32 A;  1X59 A;  3RT3 C;  1NS1 A;  4GKJ O;  5BY1 A;  4LFC O;  2ZM6 O;  4DV1 O;  1XNQ O;  3J7A U;  1N34 O;  4AQY O;  4JI4 O;  4B3M O;  3T1Y O;  1FYJ A;  1AB3 A;  5H5N A;  4JI3 O;  4JI0 O;  1HNX O;  1IBL O;  1KUQ A;  2ZKO A;  1FJG O;  2AGA A;  1XEQ A;  4A5U B;  4JI8 O;  4DR6 O;  4B3R O;  1HNZ O;  4JI2 O;  1YZB A;  1F7Y A;  1N33 O;  4NXM O;  5IWA O;  2VQF O;  3R66 A;  4DR3 O;  4OX9 O;  4X65 O;  4X66 O;  5BXZ A;  3M8A A;  1G1X B;  1AIL A;  4KHP O;  4LF6 O;  1XMQ O;  4JI1 O;  3SDL A;  3OTO O;  4OPA A;  2LW7 A;  1R1B A;  1XMO O;  1N32 O;  5IT9 N;  3J81 N;  4LF8 O;  2UUC O;  1N36 O;  4JYA O;  4DUY O;  4JI6 O;  3O65 A;  2F4V O;  5A2Q N;  4X64 O;  2HHH O;  3T1H O;  1XNR O;  4NXN O;  4DR7 O;  2FKX A;  2Z0A A;  4DV2 O;  2UUB O;  2VQE O;  1HR0 O;  2UU9 O;  4DR4 O;  5LMU O;  4DR1 O;  4DV6 O;  2UXD O;  1IBK O;  2N74 A;  4JI7 O;  4DV7 O;  1D2D A;  4DV4 O;  4X62 O;  2UXB O; 
#chains in the Genus database with same CATH topology
 3F5T A;  5KAF Z;  4JYA B;  1YEW A;  1SKV A;  1AI6 A;  3APQ A;  2ZNI A;  2IJI A;  1I5X A;  1KKC A;  2EZO A;  2JS3 A;  1IBM O;  3D36 A;  4JI5 O;  1JVM A;  2FL4 A;  4LF6 B;  1BMF G;  4YY3 O;  2EIM C;  3Q4H A;  1LUW A;  1XDC A;  4NVP A;  4UCS A;  2CTW A;  2UUA O;  4LF7 O;  4FFB A;  4DV7 B;  3ZMT A;  3T4D A;  4DV1 O;  1Y76 A;  4H0L B;  5KHI A;  1FXV A;  1Q3E A;  4YHH B;  3VQV A;  3W7W A;  2LGW A;  2ZIN A;  4JI3 O;  2YIA A;  1VQM V;  1VQK V;  2PYJ A;  4FPP A;  2OCH A;  2R72 A;  3BEH A;  5B3S B;  1AP6 A;  1U97 A;  2GSM B;  2VQF O;  3RVZ A;  3ETQ A;  3ZS8 C;  3QO8 A;  1SQQ H;  5GTH Z;  3SPG A;  3A0B Z;  1BT8 A;  2YI8 A;  1M56 B;  2ZR3 A;  2YIB A;  5LP6 C;  3BY6 A;  4JI1 O;  3P32 A;  1NT2 B;  1QR8 A;  1IBL B;  3OT7 A;  1O9G A;  4JTC B;  4LP8 A;  5EC2 C;  1Z5V A;  1NVP B;  4L87 A;  4PDM A;  4X64 O;  3T1H O;  1NTM H;  4KXR A;  3L74 H;  3HKB A;  2Q5Z A;  3CCU V;  2JGU A;  2P4K A;  4K3A A;  3CXH F;  3ZJZ A;  1IXM A;  1FXK A;  1D5N A;  1PNK A;  2F1M A;  3L75 H;  3DSQ A;  1YVW A;  1KP2 A;  2YXH A;  3H1K H;  1V9P A;  2EIK B;  2BSK B;  4ICG A;  4WCE V;  3G6E V;  4LF8 B;  4FK5 C;  1SF9 A;  5CB4 A;  1YIT V;  1WP7 A;  4DV3 O;  3JD2 A;  4KHP B;  3E8G A;  2NLJ C;  2XUM A;  2UUB B;  1JCH A;  1HR0 B;  4YJ3 A;  4U3J B;  4JYY A;  4WFE A;  3WB0 A;  2HVJ C;  1KMI Z;  1GK9 A;  3NXS A;  5JH7 A;  3FFQ A;  1AR4 A;  4IGG A;  1P7B A;  4AQY O;  1J5E B;  4X1K B;  3RWR D;  4O4H A;  2ZE7 A;  3FAV B;  4JI8 O;  1L8D A;  4B3T B;  4PDL A;  1X4T A;  2VWK A;  1ARO P;  1SQB H;  4C7U A;  3JSL A;  2XAQ A;  3UT5 B;  4HZ3 A;  3DXR A;  2JGD A;  3UCS C;  4WF9 V;  1KYO F;  1NBM G;  1BZK A;  4PDV A;  1TUB A;  1H2L A;  5D5Q A;  4RO2 A;  3M99 B;  4UCR A;  1NVP D;  4LF6 O;  4P30 A;  3ABL B;  5KHH A;  3RW0 A;  3ASN B;  1M57 C;  3AK2 A;  3RYF A;  4DR5 B;  1WNS A;  3NR7 A;  3CCS V;  2ZIM A;  1EBO A;  4WBN B;  5IT9 N;  3J81 N;  3SYC A;  2XT9 A;  3BAA A;  1SQP H;  2IJH A;  2IU0 A;  4IYH A;  2ZXW C;  3FB5 C;  2LW1 A;  2BTQ A;  5IJ9 B;  4WFA V;  2Z0A A;  4X20 A;  1AI4 A;  5CA1 B;  4GX5 A;  2QE7 G;  4MVM A;  1HP8 A;  4FM0 A;  1EN5 A;  1K97 A;  4G2K A;  4GKK O;  2CE4 A;  1KU9 A;  5AG2 A;  4KL1 A;  4JTA B;  4RQF A;  4JZG A;  4F4L A;  5J2T B;  2GTA A;  4DR7 B;  3ZRW B;  3F5W C;  5KUM A;  1JJO A;  4CH4 A;  1NJI W;  3JAR A;  3AG2 B;  5FPO A;  2VQE B;  3G71 V;  4DV6 B;  2UXD B;  1VQ9 V;  3KCY A;  2EUL A;  2FB5 A;  4GKJ O;  4LF9 B;  1P7G A;  3D36 C;  5BMV B;  2ITD C;  4XBF A;  2M6Y A;  3AG3 B;  2P06 A;  3E22 A;  3E8F A;  2FML A;  1Q6I A;  3TK1 A;  2QM4 A;  1Y66 A;  3TXQ A;  1TUE B;  3WG7 B;  4P2Z A;  3A8T A;  3KCX A;  4PHZ A;  4RUF A;  5IJ0 A;  4I5S A;  4LFA B;  2IJK A;  1SRY A;  1ZTE A;  1WP8 A;  2PF4 E;  1AIL A;  5LXT B;  1ZL8 B;  2XHB A;  1XHX A;  2AW9 A;  1YHQ V;  3K06 A;  4KHP O;  4Z1V A;  4JGS A;  2XAS A;  1FXH A;  5CB4 B;  1K5S A;  4MVR A;  4TV8 A;  1H2S B;  1RPR A;  1QCE A;  1SES A;  4HNA B;  3OMI B;  3STZ C;  1PD3 A;  1N36 O;  3ZN1 A;  1DF4 A;  1BQZ A;  4NXM B;  5IWA B;  4O2A B;  3K03 A;  2VRZ A;  4NXN O;  1FFX B;  5JH7 B;  4I0X A;  5BZB A;  3AG4 C;  5GON B;  4GT1 A;  2JVD A;  1MAB G;  2WLL B;  3CMA V;  5KUK A;  5LMU O;  2YUA A;  4CS2 A;  1MOF A;  2EIN B;  4P9O A;  4OPH A;  2F95 B;  3JAS A;  2DYS C;  4UCT A;  4J11 A;  4L8J A;  1HDJ A;  4DR5 O;  1VQL V;  4O4J A;  3L71 H;  2E5L O;  1TUB B;  4X1Y B;  3OGC C;  2LJ2 A;  1RM1 C;  3WB2 A;  2GHY A;  3B8N A;  1B6Q A;  4LR3 A;  1MMM A;  1R3L C;  4X1I A;  1A32 A;  3CJH A;  4DXW A;  2UXB B;  3O9O A;  2R9I A;  4DW1 A;  1VQO V;  4B3M O;  4ZI7 A;  2VWJ A;  1EM1 A;  2EIJ C;  2QJ1 A;  5H5N A;  3UQ8 A;  1SA0 B;  4MVQ A;  4JAV A;  4A5U B;  1HNZ O;  3CME V;  1YZB A;  2KSD A;  5KA5 A;  3CC2 V;  4AHC A;  2HG5 C;  4H37 A;  3CC7 V;  1FS0 G;  4ZOL A;  3T2M A;  2ITC C;  1ROP A;  2ZM6 B;  4JI4 B;  5CBH A;  2HEP A;  3CRR A;  3ICX A;  1RFY A;  1EN4 A;  2JEU A;  4BR6 A;  1XMO O;  2LP7 A;  3QF7 A;  2Z3Y A;  2Q68 A;  1GM8 A;  1SZT A;  3APO A;  4CS3 A;  1WB8 A;  4UUJ C;  5B1N A;  4FVM A;  5IY5 C;  1N33 B;  4UV8 A;  1V55 B;  1QLE B;  1VIB A;  1I7F A;  5KMG B;  3QO7 A;  1THZ A;  1VQ5 V;  4CH3 A;  2FKX A;  4YJ2 B;  4TUY A;  5JQG B;  1AJQ A;  2EX3 A;  4AI8 A;  3OW2 U;  4DR1 O;  1NH2 B;  4FLY A;  2Q0O C;  5JJE B;  3CC4 V;  3ETG A;  1GKF A;  2UUC B;  2GTS A;  2WLI A;  3H1J H;  3OFN G;  3FX7 A;  3SYO A;  2F4V B;  3STL C;  1M5I A;  4D7T A;  1JFF B;  2HP8 A;  5HFM A;  2IM9 A;  1K9M W;  3OAA G;  4K0K O;  4TV8 B;  2JDI G;  3CD6 V;  4LH6 A;  1W2B U;  2RQ6 A;  3ZHS A;  1BL8 A;  1IBK B;  1K5Q A;  2HJF C;  2QM8 A;  1MZF A;  1SS3 A;  2KB1 A;  5B1B C;  3RT3 C;  4OGQ B;  5DED A;  5DM6 V;  4R8C A;  1XNQ O;  3X2Q B;  3ZMV A;  5JWP A;  4I9W A;  1M93 A;  3JYC A;  3RFR A;  2EIL B;  4MVO A;  1ZUQ A;  3AK1 A;  1JA8 A;  1HNX O;  3TXS A;  1R6N A;  4DR2 B;  2Q6A A;  3EHB B;  4Q20 A;  1Q5O A;  5ITZ B;  2P6J A;  3CHX A;  1Z5W A;  3TET A;  5LMN B;  2F66 C;  4F6R B;  3VQX A;  1ZAU A;  1KKD A;  1J95 A;  1YDX A;  2B1I A;  1XMQ O;  3WU2 Z;  4O4J B;  2LW7 A;  4JI0 B;  4J7K A;  2Q7H A;  3ABK B;  4NTY A;  2AXT Z;  2XAH A;  4I50 A;  1ZX3 A;  2E3C A;  1NH2 D;  3C3S A;  4BIZ A;  4D7S A;  4FLX A;  2OTJ V;  3LNM B;  3RYI A;  2H94 A;  2GBO A;  1I08 A;  4FM1 A;  4U3J A;  3SJA C;  3OM3 B;  2OCC B;  4JI7 O;  1LUV A;  4X62 O;  1JMK C;  2XND G;  4QPK A;  3IGA C;  2BOB C;  3HKE B;  4X1K A;  1JQ0 A;  1JJ2 U;  1QR9 A;  4K35 A;  2A06 H;  4U3F H;  3ZMZ A;  2QWP B;  4DK0 A;  5TIS Z;  4KP4 A;  5L3C A;  3FAV A;  3A0R A;  4X9Q A;  2FTK A;  5KX5 B;  1AR1 B;  2V7Q G;  1OCC C;  4AIL C;  2X6B A;  3UT5 A;  4DK1 A;  4G27 B;  3SYA A;  1S72 V;  1K7D A;  2ZCE A;  3UO2 A;  2CH7 B;  1B06 A;  1F51 A;  2OYQ A;  4H13 B;  3L73 H;  4JZ2 A;  1AP5 A;  1VAR A;  4BIU A;  1N34 O;  2IJJ A;  1N0J A;  2PZS A;  3ZHT A;  3K04 A;  2CGO A;  2JIZ G;  4O4L B;  4PA3 A;  1YI2 V;  4FLV A;  4WBN A;  1KUQ A;  3PN1 A;  1HNW B;  2Y48 A;  4TUY B;  2Y0P A;  1K73 W;  5JJJ B;  2FYU H;  3LSQ A;  5IJ9 A;  1QQC A;  1KD1 W;  4X8A A;  5CA1 A;  2WLI B;  4ZHQ A;  2Q7G A;  2ATK C;  2GUZ B;  3N2G B;  4HBN A;  4R6Z A;  3CRA A;  3H01 A;  4U7O A;  3WFV A;  2H8P C;  1SC5 B;  3OUS A;  4JI6 O;  1XBL A;  5A2Q N;  5J2T A;  2HHH O;  1DF5 A;  2W0X A;  3ZRW A;  4NTX A;  2ETN A;  3HKC B;  3BAB A;  2XOK G;  3FB8 C;  1UJW B;  2BE3 A;  3CCV V;  2P5O A;  2ZT9 B;  2CTR A;  3JCZ A;  1N32 B;  5JCO A;  2WLN A;  1R3J C;  2PGG A;  5BMV A;  5LMN O;  3FD9 A;  1VQ7 V;  2P22 C;  5EBM C;  1SQF A;  2M7W A;  3W7S A;  1XNR B;  1KQS U;  2OT5 A;  4G28 B;  1PP9 H;  1IX9 A;  4I4T A;  4UFZ A;  3D3I A;  4LFB O;  4LF4 O;  3ZIA G;  2Q4P A;  5FLX N;  1FPO A;  4MS2 A;  3ZRX A;  3B40 A;  5LXT A;  1ZL8 A;  1R3K C;  4JTD B;  5BY1 A;  2A9H A;  4F6E A;  2UXC B;  4MVZ A;  3E8B A;  4GYC B;  4I50 B;  2P4V A;  3H1I H;  1I0H A;  5B3S C;  4HNA A;  3E83 A;  3RYI B;  2D3O W;  2Y4U A;  5BR8 B;  4HAM A;  1CEZ A;  3F7V C;  1M56 C;  4O2A A;  2PI4 A;  3R66 A;  3ZMS A;  1FFX A;  4TT3 G;  4DYL A;  1US6 A;  3B09 A;  3JD3 A;  4J41 A;  2H3O A;  3CRQ A;  1TAE A;  2HFE C;  1SZX A;  4LFC B;  1YXB A;  5GON A;  2IBZ H;  3K9S A;  1WA8 B;  2WLL A;  4UXN A;  1S3J A;  4LF5 B;  4DUZ B;  4PDR A;  1I94 B;  1MNG A;  4I7Z B;  3ASO B;  2HJD A;  4XDK A;  1FJG B;  1Q90 D;  2ADP A;  4HYO A;  1YF2 A;  1M90 W;  4JYA O;  3K5O A;  3MD0 A;  2RCV A;  1N8R W;  1K4C C;  4R7C A;  4MW3 A;  2QM7 A;  1S0V A;  2R70 A;  2PI5 A;  5JVD A;  4X1Y A;  2EIK C;  1M9N A;  3ZX6 A;  4JYB A;  5IE9 A;  3K3W A;  3CRC A;  3MAQ A;  2YEV A;  3HKD B;  4PV1 B;  3ZCC A;  2OIG A;  5LGN A;  2CTQ A;  4FJC C;  1XOU A;  3SJB C;  4DV7 O;  3G67 A;  4UB6 Z;  2E76 B;  4UVC A;  2IH1 C;  4PI0 A;  4LH7 A;  3JAM N;  4YHH O;  4MSW C;  4WFF A;  1G6U A;  3ZHQ A;  1SA0 A;  2ILM A;  1GH6 A;  1COW G;  4B08 A;  4BWA A;  3FB7 C;  4O2B B;  2ADQ B;  3JAT A;  2QWQ B;  3D3Q A;  2LQT A;  4ZHQ B;  1YIJ V;  4ZKI A;  2LGQ A;  2QTS A;  3JD0 A;  3SPI A;  1EN6 A;  3UO3 A;  4N23 A;  1Q86 W;  4PA4 A;  2K1E A;  1K34 A;  2ZQM A;  2KQX A;  1S5L Z;  3SPH A;  5EIB D;  2EJR A;  5FNV B;  4J10 A;  4UCU A;  3HB3 B;  3BRC A;  4DV0 B;  4FM2 A;  3BFR A;  2RJZ A;  1IBL O;  2AGA A;  3OMA B;  1S5J A;  4J9Y B;  1VMG A;  1F7Y A;  1S76 D;  3ETE A;  3ABL C;  5IYC O;  4MTG A;  3ASN C;  5KMG A;  2WA3 A;  4YJ2 A;  3OD4 A;  4IIJ B;  5JQG A;  4RAI A;  1YJW V;  4TWK A;  5LA6 B;  3JAW A;  3T1Y B;  4EFB A;  3AEI A;  3EVK A;  4J42 A;  2NNU A;  2Q73 A;  4I4T B;  2YC0 A;  2X7R B;  3GB7 C;  4LF8 O;  2Y69 B;  4JI2 B;  1B3Q A;  4P9P A;  4DR3 B;  4OX9 B;  4X66 B;  4D6T H;  1JFF A;  4X89 A;  3T4Z A;  3QTC A;  2C2A A;  4PJ0 Z;  4ABM A;  2UUB O;  4UCV A;  1HR0 O;  4GUN A;  4J9Z B;  1T5E A;  1H8H G;  1W0J G;  2YS8 A;  1XL4 A;  1VP7 A;  5EZY A;  3CCL V;  1FKA O;  3VOU A;  1J5E O;  4DUY B;  2DYR B;  2WSS G;  2AHY A;  1GN6 A;  4UB8 Z;  3AG2 C;  1XUQ A;  2QR4 A;  3CCJ V;  4LF5 O;  1BSM A;  1RP3 B;  5DN6 G;  4DUZ O;  1ORQ C;  3CSX A;  1I94 O;  4EB6 B;  3S3X A;  2LFR A;  5E79 Z;  4B3T O;  3R65 A;  3J80 N;  3ABM B;  5ITZ A;  4Z2W A;  2GDS A;  3JCU Z;  1PPJ H;  3BPZ A;  3GVM A;  4QIW F;  2YDE A;  3AG3 C;  2EJ7 A;  1VQ8 V;  1WLE A;  3EFF K;  1X59 A;  4F6R A;  4DV4 B;  2F23 A;  5L3F A;  4WFB V;  1V54 B;  4JV5 B;  3CEI A;  2QKC A;  1I5Y A;  2WLM A;  3J7A U;  3WG7 C;  1F23 A;  2P90 A;  2A0L A;  2Q8V A;  2CUG A;  1FXK C;  3QG5 A;  3P30 A;  1R6K A;  1ZSP A;  3BHP A;  2IH3 C;  4TQD A;  5LHI A;  5JVD B;  1HW7 A;  3G4S V;  1N0N A;  4W4K A;  3U11 A;  1OV9 A;  4B3S B;  1OJH A;  1SQX H;  2YEV B;  2W6I G;  3ZN0 A;  5KA6 A;  4J7Z A;  4DV5 B;  3UM7 A;  2A3Q A;  2WAM A;  3K5M A;  1AI5 A;  1QLN A;  3IC9 A;  2X6A A;  2QA4 V;  4CH6 A;  4PEL A;  5H6Q A;  4WFG A;  1MSD A;  5LOV B;  1BQ0 A;  3U0Z A;  3P3P A;  1R3I C;  4OPA A;  2HKO A;  4H33 A;  5LGU A;  1R1B A;  5IDJ A;  3K9A A;  2ZE5 A;  1O9H A;  4MTF A;  4DR6 B;  3HKE A;  3JAT B;  1JOY A;  1AJN A;  1RPO A;  3CCE V;  2Y0I A;  4YIO A;  3BA9 A;  5KX5 A;  1EFR G;  4FLT A;  2ZD9 A;  4DR7 O;  4IYI A;  2HLD G;  1MZE A;  2EIN C;  1P4R A;  1URF A;  5K1X A;  2CH7 A;  2QKA A;  2VQE O;  4JPR A;  4DV6 O;  2UXD O;  1VQP V;  2DW4 A;  1D2D A;  4LF9 O;  1K3E A;  4B3R B;  1R73 A;  4NB5 A;  1VQ6 V;  3H1H H;  2JRI A;  5KHK A;  1VF5 B;  2PY5 A;  1KP3 A;  4O4L A;  5K1P A;  2YIC A;  4UVB A;  5B1A B;  4DV2 B;  2MW2 B;  3JAW B;  1OCR B;  4LFA O;  2ODM A;  2ZIO A;  3F7Y C;  1GN3 A;  2YI9 A;  1P49 A;  2UU9 B;  4Z1M G;  3K08 A;  3CRM A;  3CCR V;  3AG1 B;  3B4S A;  1OCO B;  4FZ0 A;  2QWR B;  2JEX A;  3DC5 A;  2GUZ A;  5CMU A;  3N2G A;  5IYB O;  1UFI A;  4YIP A;  4K8Z A;  3E89 A;  1IBM B;  1QVG U;  4JI5 B;  1XRE A;  4CBC A;  2ZKO A;  4ZIB A;  1OCZ B;  2QWO B;  3ZHR A;  5IYD O;  4GX0 A;  4YY3 B;  4NXM O;  5IWA O;  4JF3 A;  1PM9 A;  3E8H A;  1G1X B;  2E74 B;  4LF7 B;  2X0L A;  2YXL A;  3HKC A;  3VBB A;  5EZY B;  4DV1 B;  4ZBM A;  1MA1 A;  1E79 G;  3OE7 G;  2LFS A;  2P7T C;  5CBF A;  2CK3 G;  3E86 A;  2WLJ A;  1GTO A;  1V55 C;  3SYQ A;  5B5E Z;  3PJS K;  1QLE C;  2ZR2 A;  4JI3 B;  2WWW A;  2E75 B;  4JYC A;  2AHZ A;  1Y74 B;  1VF6 A;  5LYJ B;  4PA9 A;  4LWS B;  1WN7 A;  2DWE C;  3GWK C;  4MVS A;  5FL7 G;  1Y67 A;  3L72 H;  5CA0 B;  1Y4M A;  1IZ3 A;  4TV9 A;  2HVK C;  2RNB A;  2UXB O;  3K58 A;  3JAL B;  1OCC B;  4J80 A;  5J2U B;  1NI8 A;  4X64 B;  1Q6U A;  2ZNJ A;  1XI1 A;  1KB9 F;  4QGP A;  1IUR A;  1CP9 A;  3KG2 A;  3B2E E;  4DRX B;  1TGO A;  3ZED A;  2JJ2 G;  4JAA A;  1NZ6 A;  2K9P A;  3X2Q C;  2PTM A;  3OTO B;  1YJ9 V;  4TOI A;  1F4N A;  2EIL C;  4E4E A;  3M7M X;  1NS1 A;  3T1C A;  2ZM6 O;  2EIM B;  1CXZ B;  1WA8 A;  4JI4 O;  2YID A;  1QBZ A;  3LDD A;  1B04 A;  2V1D A;  1SQV H;  4FIP C;  3G6B A;  1FFT B;  5EYP B;  4MT8 A;  3CX5 F;  4U7N A;  4B3R O;  1GO3 F;  2RDC A;  3TCU A;  3SGI A;  1N33 O;  5EK0 A;  5CBG A;  3L70 H;  1TVK B;  3JD1 A;  5L3D A;  3H1L H;  4BW5 A;  2XAG A;  3IAY A;  2RN9 A;  2Q69 A;  1QNM A;  3THO A;  5E1A C;  1W59 A;  3SPJ A;  3ABK C;  3HKD A;  1PKX A;  4AQY B;  1Q6H A;  1AR5 A;  2UXX A;  2ZDI A;  2WA4 A;  3SDL A;  4NTW A;  3LNN A;  5FPR A;  1SET A;  3MHH C;  4JI8 B;  3JD4 A;  5LP6 B;  4LNU B;  2UUC O;  5JJN B;  2F4V O;  4EEQ A;  3TJT A;  2OCC C;  3CWB H;  4O2B A;  4RWU A;  5B66 Z;  2YSU B;  3ZHU A;  1QU7 A;  5KHJ A;  4I9Q A;  4GCZ A;  1IBK O;  2N74 A;  1NU1 H;  5IYZ B;  5L3E A;  5C93 A;  5FNV A;  3CP1 A;  3C90 A;  3ZHV A;  3LDE A;  5KLV H;  2JS5 A;  4X65 B;  1LR1 A;  2PYL A;  1NR7 A;  1L1F A;  2DOS A;  4DR2 O;  3IFX A;  1LNQ A;  2X6C A;  1GN2 A;  5H2F Z;  1Z2G A;  2JJ1 G;  1BS3 A;  2Z5U A;  1PV0 A;  1IXB A;  1KC8 W;  5LL6 Y;  4IIJ A;  4GKK B;  5L3B A;  5LA6 A;  1HWY A;  4BW9 A;  1CPY A;  1EZJ A;  1WAZ A;  2DQ0 A;  5EBW C;  1PL0 A;  4N21 A;  5C8Y B;  2B9Z A;  4CC6 A;  1XQ8 A;  3OEH G;  4JI0 O;  4CZZ A;  1K33 A;  2F43 G;  1BHB A;  3G80 A;  2WLK A;  4MW8 A;  4MVU A;  2XAF A;  3JAK B;  4TV9 B;  3CE2 A;  3RYH B;  4E2L A;  4IT5 A;  4BAY A;  3LSS A;  5H6R A;  4GKJ B;  2LO1 A;  1RSO B;  2R9A A;  2OIE A;  3OTO O;  4RUE A;  1GM7 A;  2KG7 A;  3SPC A;  3OR7 C;  3C3T A;  5DEC A;  1M57 B;  3RYC B;  3K5N A;  1K8A W;  2A7W A;  4EB6 A;  1Y6X A;  1TA8 A;  4O4I A;  3RBZ A;  2ZXW B;  2DWD C;  3WB1 A;  4QPJ A;  3CB2 A;  3S3W A;  1VF6 C;  3OEE G;  3QVN A;  1N36 B;  3QNE A;  1EZV H;  3BA8 A;  1SER A;  4NXN B;  1HNW O;  2JK5 C;  3I55 V;  1G4Y B;  2Q67 A;  3DC6 A;  4QE7 A;  5LMU B;  1NQT A;  3GWO A;  4FFK A;  1NTK H;  5LHH A;  4IHJ B;  2N04 A;  3OMN B;  3W7U A;  1L0L H;  5A9G A;  4PA7 A;  3ABU A;  2WPD G;  5LOV A;  1GN4 A;  3K57 A;  4PA6 A;  5EIB C;  3L9D A;  4TQF A;  2DE0 X;  2E5L B;  3EXA A;  3D8C A;  3N2K A;  4KUM A;  3MDS A;  1PNM A;  2HR3 A;  3E35 A;  3CS5 A;  2N05 A;  4DR4 B;  1H8E G;  3Q4H B;  4X65 O;  4YXW G;  4DO2 A;  4FFB B;  3ASO C;  5EC1 C;  5B1O A;  1U96 A;  3ML0 A;  3LSU A;  1Y76 B;  2CTP A;  3MHS C;  1JPX A;  4B3M B;  1OHH G;  5CA3 A;  1YSC A;  4XDJ A;  2QSA A;  1N32 O;  1GMG A;  1F4M A;  1HNZ B;  4FZ1 A;  4FLU A;  2P67 A;  4XDL A;  1XNR O;  2ZE8 A;  1QVF U;  1XL6 A;  4UVA A;  2ZDI C;  3BCC H;  1YTF B;  2MK3 A;  3AG4 B;  1XMO B;  1OZ0 A;  2UXC O;  1DK1 A;  4FLZ A;  3ZMU A;  1L0N H;  3ZRS A;  5CN0 A;  1MSW D;  3KZI Z;  1PL4 A;  2Q9L A;  3CXC U;  3CPW U;  2DYS B;  4UCO A;  5BR8 O;  3HKB B;  3ZRV A;  1H38 A;  1S5H C;  2XAJ A;  1FXK B;  3IJ4 A;  4DR1 B;  2V4D A;  2KG7 B;  2BCC H;  3CYO A;  1RM1 B;  1N4C A;  3DGE A;  2NR5 A;  4LFC O;  4KFM A;  2UXN A;  5LGT A;  2CGN A;  2L35 A;  3E2E A;  4PD4 F;  3P3N A;  4QNH B;  3JSN A;  5LBQ A;  1GRJ A;  3OGI B;  3OR6 C;  1NR1 A;  1ENV A;  4O4I B;  1FJG O;  1XEQ A;  4QJF B;  2DQ3 A;  5JCO C;  3N27 A;  1Y74 A;  4GX2 A;  1GM9 A;  4LCU C;  5LYJ A;  4K0K B;  2EIJ B;  4LWS A;  3RVY A;  1H2K A;  4YJ3 B;  1XNQ B;  3HPL C;  5CA0 A;  1WPB A;  1AJP A;  2NN4 A;  2Y69 C;  5KHG A;  1G8M A;  4IL6 Z;  1K4D C;  2DN9 A;  1VEW A;  4O4H B;  3JAL A;  1HNX B;  2Y4T A;  2YXY A;  4R50 A;  4Q6G A;  1YTF D;  2B5U A;  2CAZ C;  1PNL A;  2YIB D;  4QE9 A;  5J2U A;  4MTX A;  4EKW A;  5H9C A;  1SQG A;  5J9P C;  3DXR B;  2JGD B;  4DRX A;  3W7X A;  5HFL A;  1WJZ A;  2QWN B;  1VQN V;  2VS0 A;  5F2V O;  3FKS G;  5IY5 B;  3I5D A;  2EBO A;  1E1R G;  1XIL A;  2Q0A A;  4I55 A;  3SJC C;  1XMQ B;  1GAX A;  1BCC H;  3FB6 C;  1AI7 A;  2DYR C;  3RYF B;  4DR4 O;  1Q7Y W;  3CCM V;  1H2M A;  4PI2 A;  1FYJ A;  3N2K B;  2ZE6 A;  2RMK B;  4GZR B;  2G38 A;  4GLX A;  1KEC A;  3HR0 A;  2EZP A;  3ABM C;  4DV0 O;  5KAI Z;  2AZ2 A;  4FLW A;  5EYP A;  1JR9 A;  2BTQ B;  3B8M A;  2OWO A;  1V54 C;  4X20 B;  4LBE C;  1KBH A;  2QKS A;  1R6T A;  2Q7E A;  1TVK A;  2WLH A;  3FYI B;  4JI7 B;  2KKW A;  4X62 B;  2B1G A;  2IU3 A;  1JX9 A;  3K79 A;  2QTO A;  4LC1 A;  3T1Y O;  3TGU H;  5B1B B;  1AB3 A;  2QDO A;  1YCI A;  1MG1 A;  2QGN A;  5LP6 A;  1WB7 A;  4LNU A;  2L6L A;  3QO5 A;  4JI2 O;  2CDY A;  2XTA A;  3JAR B;  1XHZ A;  3SR2 C;  2IW5 A;  1K92 A;  1P84 F;  4DR3 O;  1VQ4 V;  3B77 A;  2GV9 A;  3CCQ V;  4OX9 O;  1NTZ H;  2BTO A;  4X66 O;  1FD9 A;  3OUF A;  1D5A A;  2OTL V;  1N34 B;  3LDC A;  3K59 A;  1H2G A;  4CS4 A;  3E22 B;  4CC5 A;  4X88 A;  5IYZ A;  3SJQ C;  1E1Q G;  1ZLZ A;  4DUY O;  3O65 A;  5IJ0 B;  1M1K W;  4TSF G;  2UUA B;  3OTF A;  3UKM A;  1Q43 A;  1M4U A;  1Q82 W;  1QHT A;  3DTU B;  1DLB A;  2W0F C;  1BHA A;  4RQE A;  3U10 A;  4NKG B;  2ARH A;  4DW0 A;  3ZBH A;  4EFE A;  1WPX A;  1S77 D;  2F93 B;  4NR1 A;  5D5P A;  4JAS A;  4UV9 A;  2BOC C;  4DV4 O;  4JV5 O;  3FYE B;  3LUT B;  4B7E A;  5EBL C;  1AVM A;  2DJV A;  4J7J A;  1DGS A;  5B1A C;  4JI6 B;  2VQF B;  4JAU A;  3I56 V;  3VQY A;  1OCR C;  5C8Y A;  2HHH B;  4NYK A;  4B7K A;  1VF7 A;  1FAF A;  4I0X B;  3A2F A;  3KKY A;  2A79 B;  4B3S O;  5GTI Z;  1IDS A;  4JI1 B;  5L3G A;  3AG1 C;  4DV5 O;  1OCO C;  3JAK A;  5GW7 A;  3K0G A;  3RYH A;  4FMT A;  3VQW A;  3K5L A;  1W0K G;  3JAS B;  1RSO A;  3RN4 A;  1BGY H;  2R9R B;  1OCZ C;  3ETD A;  1ZWI C;  3T1H B;  4ASU G;  1Q8I A;  4OXS A;  1DTO A;  3RGB A;  5LHG A;  3ABT A;  3AG7 A;  2BSK A;  4DR6 O;  3A0H Z;  4LFB B;  4LF4 B;  3RYC A;  4I55 B;  4CH5 A;  2PUS A;  1H2N A;  2D2C B;  3K0D A;  3BVO A;  2W6J G;  3M8A A;  5BXZ A;  4X1I B;  4WFH A;  3CJH B;  4K8X A;  3SYP A;  1Q81 W;  2QEX V;  1BE3 H;  1YJN V;  4H44 B;  4W4L A;  1IVS A;  3IC7 A;  3H9V A;  3AK3 A;  4ZI7 B;  4DV3 B;  3W7T A;  4GX1 A;  1NKD A;  1UPG A;  2O57 A;  2AZ0 A;  4ZOL B;  4DV2 O;  4MTO A;  4IHJ A;  4BIO A;  2UU9 O;  2DMX A; 
#chains in the Genus database with same CATH homology
 3F5T A;  4OPH A;  4LF9 O;  4GKK O;  4JV5 O;  2UXC O;  5LMN O;  1DK1 A;  2DJV A;  1FKA O;  3JAM N;  1J5E O;  2JRI A;  4YHH O;  4DV0 O;  4LF5 O;  4DR5 O;  4DUZ O;  1IBM O;  2E5L O;  4DV3 O;  1I94 O;  4JI5 O;  2DOS A;  4DR2 O;  1HNW O;  5BR8 O;  4B3T O;  3J80 N;  4LFB O;  4LF4 O;  4B3S O;  4YY3 O;  5FLX N;  4K0K O;  4LFA O;  4DV5 O;  1R6T A;  5LL6 Y;  2UUA O;  4LF7 O;  1A32 A;  1X59 A;  3RT3 C;  1NS1 A;  4GKJ O;  5BY1 A;  4LFC O;  2ZM6 O;  4DV1 O;  1XNQ O;  3J7A U;  1N34 O;  4AQY O;  4JI4 O;  4B3M O;  3T1Y O;  1FYJ A;  1AB3 A;  5H5N A;  4JI3 O;  4JI0 O;  1HNX O;  1IBL O;  1KUQ A;  2ZKO A;  1FJG O;  2AGA A;  1XEQ A;  4A5U B;  4JI8 O;  4DR6 O;  4B3R O;  1HNZ O;  4JI2 O;  1YZB A;  1F7Y A;  1N33 O;  4NXM O;  5IWA O;  2VQF O;  3R66 A;  4DR3 O;  4OX9 O;  4X65 O;  4X66 O;  5BXZ A;  3M8A A;  1G1X B;  1AIL A;  4KHP O;  4LF6 O;  1XMQ O;  4JI1 O;  3SDL A;  3OTO O;  4OPA A;  2LW7 A;  1R1B A;  1XMO O;  1N32 O;  5IT9 N;  3J81 N;  4LF8 O;  2UUC O;  1N36 O;  4JYA O;  4DUY O;  4JI6 O;  3O65 A;  2F4V O;  5A2Q N;  4X64 O;  2HHH O;  3T1H O;  1XNR O;  4NXN O;  4DR7 O;  2FKX A;  2Z0A A;  4DV2 O;  2UUB O;  2VQE O;  1HR0 O;  2UU9 O;  4DR4 O;  5LMU O;  4DR1 O;  4DV6 O;  2UXD O;  1IBK O;  2N74 A;  4JI7 O;  4DV7 O;  1D2D A;  4DV4 O;  4X62 O;  2UXB O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...