4DUYO

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
87
structure length
87
Chain Sequence
b'PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 30
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4duyO00
4X62O 1IBLO 1XMQO 4LF5O 3R66A 5BXZA 4YHHO 3J7AU 1R6TA 1N33O 4JI4O 2VQEO 4JI7O 1N34O 4DUYO 1G1XB 1XEQA 2JRIA 4DV3O 4DR1O 2Z0AA 4LF8O 2F4VO 1X59A 2ZM6O 4GKKO 4DR4O 5BY1A 4B3MO 1F7YA 4JI6O 4B3RO 2N74A 1I94O 3T1YO 4JI5O 2UXDO 1A32A 2DOSA 4DV5O 4DUZO 1N36O 4DV7O 4B3SO 4LF4O 2UU9O 4DV6O 4NXNO 4GKJO 3J81N 1AB3A 2UUBO 4DV2O 5IT9N 3SDLA 4JI2O 1HNZO 4NXMO 1IBMO 2DJVA 2UUCO 2HHHO 4X66O 4B3TO 4JI1O 3JAMN 4JI0O 4AQYO 1HNXO 3J80N 4LF7O 1XMOO 4DV1O 4OPAA 2AGAA 2LW7A 2ZKOA 5IWAO 1NS1A 5FLXN 1IBKO 3T1HO 4K0KO 4JYAO 2UXCO 1YZBA 2E5LO 5LL6Y 4X64O 4JV5O 4DV4O 4LF6O 2FKXA 1XNRO 3F5TA 1DK1A 4YY3O 3RT3C 5A2QN 2UUAO 1KUQA 4OPHA 4JI8O 1FJGO 1J5EO 1FYJA 1HNWO 2UXBO 4DR6O 1HR0O 1FKAO 3OTOO 1D2DA 1XNQO 1AILA 5LMNO 4LFBO 4DR3O 4OX9O 4JI3O 3M8AA 4LF9O 1R1BA 2VQFO 4KHPO 1N32O 3O65A 4DR2O 5LMUO 5H5NA 4DR5O 4X65O 4A5UB 4DV0O 4DR7O 5BR8O 4LFCO 4LFAO
chains in the Genus database with same CATH superfamily
5LP6C 1TA8A 1YJWV 4FFBB 2DQ3A 4D7SA 2XNDG 1S77D 1SC5B 3JARB 2OCCC 2Q7GA 3JD3A 4Z1VA 2R70A 4XDJA 1KD1W 4NXNB 1H2NA 1V9PA 3AG7A 1OCCC 3C90A 2EZPA 3JD2A 2QWNB 3N2GB 1VQLV 1Y76A 1N8RW 3K03A 3W7SA 2MW2B 4DUYB 5CA1B 2QKAA 3HPLC 1XQ8A 2QSAA 2L35A 5B1BC 1FFTB 4EEQA 1B06A 1KECA 1NVPB 2QM8A 2UUCO 5KHKA 4FM1A 5CMUA 2HHHO 5J2UB 2AZ2A 2NN4A 3T2MA 2PI5A 2ITDC 3HB3B 4JYAB 1BZKA 2A06H 1VP7A 4U3JB 2ZQMA 2YI9A 2JEUA 2LFRA 5K1PA 1WNSA 3QG5A 3I56V 1K7DA 2PTMA 5LHGA 2BOBC 3W7WA 4BR6A 1M1KW 3SPGA 4D6TH 1XMOB 1L8DA 5CA0A 5B1AB 3F5TA 3LSSA 1EFRG 2B1GA 3BAAA 2QM4A 1OCRC 4I0XB 5JCOA 2AW9A 2XAHA 4TT3G 3F7YC 4J41A 2GUZB 4K3AA 4IT5A 2KQXA 1SERA 3SPCA 2WAMA 1AILA 5L3FA 2EIMC 5IDJA 1BSMA 4MS2A 1M57C 5EBLC 3BABA 2YDEA 1IVSA 4LFCO 2KG7B 4X62O 3DGEA 2Q8VA 1AP6A 1XMQO 4I50A 5LXTA 4HNAA 1SZTA 2VQEO 2ZDIA 5IJ9A 1N32B 3CRQA 5KA5A 3LDCA 5IYDO 1GN2A 3RYFA 4LCUC 4LF8O 4MW3A 3B40A 2QJ1A 3OT7A 5HFLA 3H01A 5KX5B 4WBNB 3RVYA 2ZDIC 4MTFA 2F93B 1A32A 2P4KA 4NKGB 2FL4A 4KP4A 2EILB 1IXBA 2QGNA 3D3IA 2A9HA 1YVWA 4GKJO 2YXHA 1FS0G 1CPYA 1P4RA 4O4IB 5FPOA 3TXQA 1W2BU 3ZRSA 3STLC 4GX5A 3VQVA 2HJDA 1K34A 3RBZA 5CN0A 3JAMN 2F66C 2F43G 2WLIB 4J9ZB 3DTUB 4DV1O 2QWPB 3ZS8C 5J9PC 1UFIA 4LNUA 4YJ2A 4E4EA 1ZL8A 2UUCB 2HHHB 1IBKO 1GO3F 4P9PA 2UXCO 4QPJA 1F23A 3N2KB 4X1KB 5IY5B 1HW7A 4RQEA 4JI8B 1EN5A 2QKCA 4MTGA 1JOYA 3K79A 1VF7A 2ADPA 3LSUA 3K5NA 5KMGA 1NR1A 5EBWC 1THZA 1D2DA 3E2EA 3CCEV 2EINC 1K5SA 3LUTB 4LF9O 5CA3A 1M56B 3JAWA 3M99B 4ZHQB 4ZKIA 3SJBC 5L3GA 3LSQA 1M5IA 2OT5A 3RW0A 2YIBD 3QO8A 5D5PA 1G1XB 4QIWF 3F5WC 1MABG 1NZ6A 4LFCB 3AG3B 3CCUV 4DV3O 1XMQB 2LGWA 2P4VA 4FZ0A 2ITCC 1FXKA 4PJ0Z 3UT5B 1UJWB 3D8CA 3RYCB 2VQEB 4UCVA 3GB7C 4N23A 4U7OA 3AK1A 1OCOB 5IE9A 4LF8B 3ZEDA 3K0GA 2UXXA 2K1EA 4DK1A 2RMKB 3VQXA 1FXKC 3Q4HA 4K35A 4UUJC 4FM2A 1IZ3A 1Q90D 4Q6GA 1IBMO 2YICA 3JSLA 5KHGA 2OCCB 2BOCC 1VMGA 3E22B 4GKJB 4JV5B 1OCCB 1JQ0A 2CTQA 1NU1H 1XHZA 2P67A 1YJNV 4K8XA 1GMGA 4EB6B 3FB7C 4FJCC 3RYHB 3MHSC 4JYBA 3ZN1A 3CC4V 4DV1B 2Q9LA 2ZINA 4FK5C 3JARA 1K8AW 5B1BB 1IBKB 4YIPA 2UXCB 5L3CA 4LP8A 2PGGA 4GZRB 5F2VO 4PDMA 2CK3G 3N2GA 3H1KH 4DR6O 4MVUA 1BMFG 1Q6UA 2JVDA 3UQ8A 5LMNO 2QWRB 3K59A 3OUFA 5CA1A 1RSOB 2Q6AA 2OIGA 1MOFA 1DGSA 1R6NA 1PNLA 3ETQA 3BFRA 3PN1A 1VQPV 4X65O 1ZX3A 3FFQA 3J7AU 1PL0A 1EN4A 4YHHO 4W4KA 1N33O 1VF6A 2JJ1G 4LF9B 2F4VB 5CBFA 1Q6IA 4ICGA 2GV9A 2BTOA 2Q67A 5FPRA 3JAKB 2ETNA 4LWSB 5E79Z 2CE4A 4B7EA 2ZM6O 1WJZA 4U3JA 4J9YB 5J2TB 4QPKA 1VF6C 1KB9F 2V7QG 3VQYA 2HJFC 2CTPA 4JI5O 1Q3EA 4O4HB 2EIMB 1KKCA 2HEPA 4DV3B 4XDLA 1JR9A 2FMLA 1AB3A 3SR2C 4OXSA 4I0XA 3G67A 5H6QA 5LA6B 4NXMO 1URFA 3CRCA 1XBLA 4F6RA 4UVBA 1XILA 3HR0A 3CCMV 5LGTA 4EKWA 3HKDB 2P6JA 4DW1A 4JI0O 3ETGA 4WCEV 3QVNA 3FB6C 4TUYB 5B1AC 1BQZA 3H1JH 1IBMB 1US6A 2QWOB 3AEIA 4PD4F 3I5DA 2KG7A 3THOA 3R65A 1IX9A 3K0DA 4JASA 4WFFA 3E8FA 1GN3A 5EZYA 1SETA 2WWWA 3QNEA 3OEEG 1P49A 2E74B 4KFMA 1K4CC 2A7WA 2EJRA 2Q69A 3JD0A 4JGSA 2Q73A 1EBOA 2UXBO 3U11A 1Q7YW 2VS0A 2YSUB 5IJ0B 1F4MA 4LFAB 5KX5A 1B3QA 3E86A 2JS3A 4LFBO 4WBNA 1TAEA 1KU9A 2D2CB 3M8AA 1ZWIC 4WFHA 1Q86W 3B77A 3E8GA 1AI6A 4OGQB 4J11A 3OFNG 5CBHA 5LMNB 2XUMA 1VEWA 3EVKA 4O4IA 4NTXA 1AVMA 2IH1C 3EXAA 4TV9B 2F95B 1QLNA 1YTFB 2EILC 3OR7C 4YHHB 1VQ7V 1N33B 1RM1C 4DR4O 4B3MO 3B8MA 2H8PC 2PYJA 3N2KA 2D3OW 2B1IA 4X1KA 2EINB 2LFSA 3ZBHA 1EM1A 4IYIA 2ZM6B 1MZEA 1Q43A 2CDYA 5IT9N 1R3KC 3SJCC 4XBFA 2JIZG 5E1AC 4JI5B 4MT8A 1SZXA 3L74H 5GW7A 1I5YA 4TOIA 5B5EZ 4PI0A 1VQ5V 2LW7A 4NXMB 3ABLB 4IIJB 1M90W 1ENVA 2AXTZ 1JPXA 5TISZ 5KUKA 1VQ6V 4JYAO 4LH7A 4ZHQA 4TQDA 4JI0B 2DE0X 2FKXA 2QTSA 1Y74B 1FJGB 2X7RB 4G2KA 3UO3A 2OCHA 4X1IB 1BQ0A 2YIAA 3K08A 2UUAO 1NH2B 3WU2Z 1M56C 4LBEC 3VQWA 4H0LB 2BE3A 3UT5A 3OTOO 4UV8A 3RYCA 2GHYA 1XNQO 2WPDG 5JVDB 2DMXA 4DK0A 2H3OA 3EHBB 2O57A 4DR2O 4PHZA 2UXBB 1JA8A 1IBLO 3U10A 1EZJA 3P30A 3TETA 4LFBB 2L6LA 4DO2A 4FVMA 5B66Z 3QTCA 1YITV 2EBOA 1OCOC 3CCQV 3UO2A 4DR1O 3E22A 4TV8B 3W7XA 5B3SC 5EYPA 4X89A 2DYRB 3D36C 1YI2V 4B3RO 1AI4A 3K58A 1AR4A 3ZRWB 1IXMA 4UFZA 4EB6A 1NTKH 1AROP 3RYHA 3AK3A 2VRZA 2E76B 3JCZA 1L0LH 4O2AB 4DV6O 4DR4B 2AHZA 2UUBO 4YIOA 4B3MB 3BA8A 2HR3A 1M93A 1SKVA 1RPOA 2RCVA 4PV1B 2A3QA 2A0LA 2HP8A 2YIDA 1V55B 5C8YB 1K97A 5LOVB 2DYSC 4I7ZB 1RSOA 1S72V 5JJJB 1R3IC 3ETDA 4FLXA 4H44B 3VBBA 3K9SA 3FX7A 3SGIA 1WLEA 3LNNA 1K73W 1ZUQA 1SS3A 1BL8A 1YHQV 2QM7A 2IM9A 2QA4V 4P9OA 3CRRA 1QCEA 4JI8O 3JAKA 1FYJA 4LWSA 4F4LA 5L3DA 3OE7G 3RYIA 4DR7B 2G38A 5J2TA 4IL6Z 4ASUG 2UUAB 3CCRV 4O4HA 3O65A 1DLBA 2P5OA 5LMUO 5GONB 1TVKB 5CBGA 3A0HZ 1ROPA 2LO1A 4DW0A 3OTOB 4JYYA 2IW5A 5C93A 3HKBB 1XNQB 2WLKA 4Q20A 4DXWA 3IAYA 3H9VA 3ZRVA 1KBHA 4DR2B 3FB8C 4FLYA 3X2QB 1IBLB 1R3JC 3AG4C 2Q5ZA 3SYAA 4UVCA 3IJ4A 4GKKO 5LHHA 1I94O 4X88A 1QVGU 1P7GA 4DR1B 3ZMTA 3U0ZA 1EZVH 3CWBH 3MHHC 4DV2O 4AQYB 4HZ3A 4B3RB 2DJVA 3ABMC 4UCRA 1AJNA 3LDDA 3D3QA 2Y4TA 1NTZH 2PZSA 3CS5A 5IYZB 4B3TO 2VWJA 5IJ0A 4F6EA 1GTOA 3APQA 4DV6B 2Y69B 1JJ2U 4BIUA 2UUBB 3SPHA 3DC5A 1AR5A 3A8TA 1NQTA 4PA7A 1YZBA 3JCUZ 1RM1B 2V4DA 4JV5O 3KCXA 4DV4O 3TCUA 2AZ0A 5JJEB 1Y6XA 2PUSA 4PA6A 2XAFA 5A2QN 1PPJH 1M4UA 2XT9A 4TV9A 5A9GA 4X20A 3ZHRA 4ZBMA 1HWYA 2WLNA 2CTWA 4J10A 1H2SB 4UVAA 1ZAUA 2JGDB 3K9AA 3HKEB 4JZGA 3F7VC 4JI7B 1ORQC 1NBMG 2HKOA 2E75B 2JGUA 3CRAA 3PJSK 5KHHA 2LP7A 3MAQA 5DM6V 1WPXA 2ARHA 5H6RA 1S5JA 5LMUB 1AJQA 1UPGA 3IFXA 4FZ1A 1Q5OA 1XOUA 1YDXA 2F4VO 1I5XA 3VOUA 5IYCO 4IIJA 3ZHQA 4U3FH 3OGCC 2AHYA 2GSMB 3SYOA 1GM8A 3DXRB 1WAZA 3ABKB 4Z1MG 1N36O 1EN6A 4R6ZA 4RO2A 4GKKB 3SDLA 2WLHA 1YXBA 1AI7A 1I94B 5ITZB 3ABLC 2XHBA 4WFGA 4FLUA 2IU0A 3ZCCA 1O9GA 4DV2B 3OMAB 5JVDA 4UB6Z 4L8JA 3KKYA 5K1XA 3QO5A 1NS1A 5FLXN 4JAVA 5B3SB 2QTOA 1XL4A 5LL6Y 4B3TB 4X64O 3BEHA 2Z3YA 1HP8A 4TSFG 3C3TA 3ZX6A 1B04A 4ZOLB 3ETEA 3ABUA 3RT3C 4UCOA 5FNVB 5DECA 4LR3A 2B9ZA 3E83A 1QBZA 1NT2B 1XDCA 4DV4B 4I4TA 3JD4A 4TV8A 1YSCA 3OMIB 2ZNJA 1QNMA 4NR1A 2W6JG 4WFBV 5KA6A 4DR3O 2M7WA 4X8AA 4OX9O 1JMKC 3ZRWA 3CXCU 2M6YA 4FFBA 4R50A 2X0LA 4CH3A 3P3NA 4DR5O 2UXNA 2DYSB 4LFAO 3CRMA 4QJFB 4WF9V 4BAYA 4LF5O 2XTAA 3ASOB 4AI8A 1KYOF 2DYRC 5KUMA 4JYCA 2RN9A 2Q7EA 1FFXB 2IJIA 4WFEA 1JFFB 2JRIA 4DV5B 5LOVA 2R9RB 5BY1A 4R8CA 2OTJV 1Y76B 3H1LH 1KQSU 2IJJA 3T1YO 4O4LB 2ZIOA 2IU3A 1G4YB 1QLEB 3SJQC 4FMTA 3WB0A 3FYIB 3JASB 1VIBA 2VWKA 4DV7O 1G8MA 5J2UA 3APOA 3J81N 1SQPH 1V55C 2WA4A 3OR6C 5LBQA 4KL1A 5L3BA 3G80A 2H94A 1FXVA 2X6BA 2R9AA 2IJKA 2EZOA 2BCCH 1TUBB 1N36B 1H2MA 4DYLA 3RN4A 2WLLB 5DEDA 3H1IH 1K33A 2ZT9B 3AG4B 5IWAO 1XNRB 1V54C 5GONA 3CCVV 2NLJC 2ZCEA 3SPJA 1QVFU 4N21A 3HKBA 1WP8A 4X1YB 1YF2A 2GUZA 2N04A 1U96A 3ZJZA 1FAFA 3NXSA 1Z5WA 4CH6A 4X9QA 4OPHA 1FJGO 4X64B 3CC7V 1WN7A 2ZE7A 4AILC 1X4TA 3ABMB 4BW9A 5HFMA 4DRXB 3CMEV 4GCZA 2YC0A 5B1NA 5LGUA 2LJ2A 3O9OA 3T4ZA 1H2GA 2DW4A 3JYCA 3CCSV 4DV0O 2Z5UA 4MVZA 1OJHA 3CHXA 2A79B 3X2QC 3ZHUA 2IH3C 2ZR2A 1GH6A 1KKDA 3BRCA 3EFFK 4JI4O 4DR3B 4OX9B 3L71H 1S5HC 2GDSA 2QKSA 4J7ZA 2C2AA 3CCJV 4DR5B 5IYZA 1XHXA 4GUNA 2JK5C 5LXTB 4IHJB 3OD4A 4LF5B 5D5QA 3L72H 3CD6V 2P22C 2XAGA 2RDCA 4CS4A 4ZIBA 1AI5A 1SF9A 3WB2A 2DWDC 4FLVA 1W59A 1ZTEA 1PL4A 1RFYA 4CC6A 1H2KA 1SQGA 1Q82W 1WP7A 2Y69C 4UB8Z 4ZI7B 4GYCB 2ZXWB 1MMMA 2FYUH 3AK2A 2CH7B 1Y67A 3T1YB 1PP9H 2WLIA 1AR1B 4CH5A 1LR1A 4X66O 3KCYA 2ZIMA 4DV7B 2Q0OC 4MSWC 1GM9A 2JGDA 2AGAA 2ZE8A 2PI4A 5EC1C 5CB4B 3T1HO 2R9IA 3HKEA 2OIEA 4TQFA 2LQTA 3SYPA 4NB5A 3CEIA 5IWAB 3JALB 4L87A 2WA3A 3CX5F 4B7KA 5FL7G 3BY6A 2ZNIA 3CSXA 2MK3A 3KZIZ 1PM9A 2YXYA 4CZZA 1R1BA 4BWAA 5DN6G 1VQ9V 3TGUH 3DXRA 4DR7O 1B6QA 1Y4MA 5EIBD 1MSDA 2EIKC 3R66A 2E3CA 5ITZA 1N34O 1LNQA 4DV0B 1XREA 3GWKC 4MTXA 4WFAV 1VQMV 1N4CA 3BA9A 4I55B 3ABKC 4CBCA 2P7TC 4JI4B 2XAQA 1NVPD 3L73H 2ODMA 3AG2C 1YJ9V 1ZSPA 4FIPC 1H2LA 5EC2C 2JEXA 3D36A 3CPWU 1RP3B 4CH4A 3ZMUA 4GX2A 4ZOLA 4EFBA 5JQGB 1Q6HA 2WLJA 5FNVA 1F4NA 1MNGA 4PA3A 4JI1O 4YJ3B 4AQYO 3B2EE 2EULA 3CC2V 4R7CA 4P30A 3SYQA 1CXZB 2ZR3A 4X66B 1GN4A 4JTCB 3SJAC 1SQQH 1D5NA 2V1DA 4PDRA 4LF6O 2JS5A 2ZE6A 3FKSG 3RFRA 4NVPA 3BVOA 1COWG 3B4SA 3HKCB 4YY3O 4GLXA 4KUMA 1VQ4V 3T1HB 3ASNB 2P90A 1GK9A 1FFXA 1JFFA 3SYCA 3C3SA 1MSWD 3G4SV 1VQOV 2R72A 4K8ZA 1FKAO 1S5LZ 4JTAB 1GKFA 3JSNA 3A0RA 2DQ0A 3ASOC 2YIBA 1KP3A 4G27B 2RJZA 2YEVB 4O4LA 4PA4A 4KHPO 1R3LC 1SQFA 3MDSA 2DN9A 2QE7G 2WLMA 1O9HA 1L1FA 3JASA 3AG1B 1V54B 1S76D 4TWKA 2PY5A 4FM0A 4JI7O 2Y4UA 1OV9A 1QHTA 1Z5VA 1XEQA 3WFVA 3RVZA 1TUBA 1QLEC 2WLLA 3G6BA 1X59A 1MA1A 4CS2A 4LC1A 1N34B 4JI6O 4QE9A 3K57A 3W7TA 5IYBO 1FD9A 2UXDO 1OCZB 4D7TA 5LA6A 4O4JB 1XI1A 2RQ6A 3G6EV 4IYHA 2LW1A 1S0VA 4X1YA 4LF4O 1QR9A 3DC6A 4IGGA 2BSKB 3JATB 2UU9O 2QEXV 1G6UA 3HKDA 2Q4PA 1NR7A 3L70H 1PD3A 4TUYA 3MD0A 5H2FZ 1LUVA 1TGOA 2Q7HA 4F6RB 4DRXA 2HG5C 4OPAA 1QU7A 4I9QA 3STZC 2YI8A 4MW8A 2E5LO 1QR8A 4JI1B 3P32A 4BW5A 4Z2WA 2BTQB 5JCOC 1BCCH 2OWOA 5LYJB 1BT8A 3K5MA 4MVMA 1KUQA 5EZYB 3QO7A 3BPZA 1R6KA 1GN6A 4UCUA 4NTYA 3FYEB 4IHJA 4LF6B 1HNWO 4RUFA 1HR0O 3ZN0A 4YY3B 2LGQA 4NYKA 4JI3O 4HAMA 3OW2U 4YXWG 3LDEA 2KSDA 1ZLZA 2ZE5A 1I0HA 1BS3A 3K3WA 4ZI7A 4O2BB 3L75H 4GX1A 3OEHG 3S3WA 2CH7A 2ZD9A 4KHPB 2GTSA 1S3JA 3ZHSA 4JZ2A 5JH7B 1E1RG 1I08A 1WB8A 3G71V 1OHHG 2EIJB 2IJHA 3BHPA 2ZXWC 1F7YA 5CB4A 1AP5A 4RAIA 3E35A 2ATKC 1AJPA 3ZRXA 1GM7A 2HVJC 4DV5O 3B09A 4B3SO 4FLWA 3CJHB 1SA0B 2P06A 3JALA 5GTHZ 1F51A 3WG7B 1M9NA 3TJTA 2YXLA 1HNZO 4JI6B 3IC9A 2EIKB 1K3EA 3LNMB 2UXDB 3CCLV 1JX9A 4J7KA 4QGPA 4FLZA 5KHIA 4LF4B 2UU9B 3JD1A 2HFEC 2B5UA 1JJOA 1Y74A 1VF5B 4QE7A 1Y66A 2F1MA 1SQBH 3AG2B 4X1IA 1XNRO 1VQ8V 1IDSA 1WA8B 2E5LB 3E89A 3K04A 2WSSG 3OUSA 2Q68A 1NKDA 4FPPA 1PNMA 4I55A 5KLVH 5BZBA 2XAJA 1L0NH 4X62B 1VQNV 2IBZH 1R73A 3CMAV 1GRJA 1VARA 4PDLA 5BMVB 1HNWB 3UCSC 1HR0B 5JQGA 1DF5A 1WB7A 1R6TA 3S3XA 4JI3B 4PI2A 3FAVB 1Z2GA 3B8NA 4HBNA 2ILMA 4YJ3A 5LP6B 2W0FC 1QQCA 1I7FA 1JVMA 3ZIAG 4EFEA 5LGNA 3E8HA 3A0BZ 1FXHA 4QNHB 4CS3A 3NR7A 4XDKA 4O2AA 3CE2A 1K92A 5EYPB 2NNUA 3OGIB 1N0JA 4DUZO 3ZMVA 1JCHA 1KP2A 3HKCA 5KAIZ 4PELA 1K9MW 2JDIG 2QWQB 1BHBA 4JI2O 3H1HH 3CP1A 1PV0A 1BE3H 5C8YA 2EX3A 4H37A 4UV9A 4B3SB 1KC8W 4HYOA 3ICXA 1HNZB 2YEVA 3ZHTA 1PNKA 1FPOA 2KB1A 3ASNC 4K0KO 1N0NA 2OTLV 1LUWA 3N27A 1U97A 1D5AA 5JJNB 2KKWA 3L9DA 3CB2A 4JTDB 2EJ7A 5EIBC 3CYOA 4RUEA 4JAUA 3K5LA 3T4DA 4ABMA 2PYLA 1J5EO 4MTOA 3ML0A 3QF7A 2HLDG 2CUGA 4CC5A 3AG1C 2HVKC 1TVKA 2CAZC 4W4LA 1OCRB 1H38A 3RYIB 2VQFO 1MZFA 3RGBA 2FTKA 2W6IG 1BHAA 5JWPA 5BR8O 4O4JA 3KG2A 1YTFD 2BSKA 3JATA 5BXZA 5CA0B 2PF4E 2OYQA 1M57B 4J80A 3GVMA 3GWOA 4PDVA 1K5QA 5H9CA 1OCZC 2Z0AA 1J95A 1CP9A 4UCTA 4P2ZA 3OTFA 1YEWA 1XL6A 2BTQA 4JF3A 4LH6A 4GX0A 5B1OA 3OAAG 3FB5C 5LYJA 4I50B 1YCIA 3ZMZA 4HNAB 3CXHF 5IJ9B 3ZHVA 4I9WA 4UXNA 4DUZB 2CGNA 3TXSA 1HNXO 3J80N 4LF7O 3RYFB 2CTRA 3IGAC 4JI2B 1H8EG 1VQKV 1HDJA 2YS8A 1KMIZ 4C7UA 1Q8IA 1NH2D 1P84F 1GAXA 4B08A 3WB1A 4O2BA 1E79G 3DSQA 4RQFA 1DK1A 4DR6B 1SESA 4BIZA 2Y0IA 3M7MX 2Y48A 4K0KB 5JH7A 4G28B 3K5OA 4RWUA 1PKXA 3SPIA 1K4DC 3OMNB 2N05A 4MVQA 5EBMC 4X65B 1XUQA 2YUAA 5KAFZ 5EK0A 4X20B 3ZMSA 4LNUB 4YJ2B 1ZL8B 1Q81W 4U7NA 3W7UA 1J5EB 1RPRA 4NXNO 4A5UB 2GBOA 3I55V 4AHCA 3CJHA 1SA0A 4J42A 2K9PA 4UCSA 3UKMA 1SQVH 1OZ0A 2Q0AA 4KXRA 2EIJC 2VQFB 4DUYO 1NJIW 5BR8B 2Y0PA 1P7BA 3RWRD 5KMGB 2X6AA 2CGOA 3T1CA 4J7JA 5IY5C 3WG7C 1BGYH 2XASA 2GTAA 2N74A 2F23A 4JAAA 3JAWB 3BCCH 2DOSA 4FFKA 3P3PA 1NTMH 2JJ2G 3FD9A 2QR4A 2X6CA 5KHJA 1YIJV 1H8HG 1WA8A 4E2LA 3ABTA 2FB5A 5LHIA 1DTOA 1W0JG 1MG1A 1IURA 1CEZA 1FXKB 3TK1A 1XMOO 5GTIZ 2ZKOA 4FLTA 3UM7A 4PA9A 5BMVA 1SQXH 4MVRA 1HNXB 5L3EA 4MVOA 4BIOA 2XOKG 4LF7B 2ADQB 5AG2A 3E8BA 3AG3C 1E1QG 3Q4HB 4H13B 3FAVA 4GT1A 2QDOA 2DWEC 4NTWA 1NI8A 1TUEB 5LP6A 1SRYA 2RNBA 1WPBA 3K06A 1T5EA 2NR5A 4MVSA 1DF4A 2W0XA 3A2FA 4JPRA 3IC7A 3OM3B 4I4TB 4H33A 1N32O 5H5NA 4I5SA 1W0KG
chains in the Genus database with same CATH topology
4X62O 1IBLO 1XMQO 4LF5O 3R66A 5BXZA 4YHHO 3J7AU 1R6TA 1N33O 4JI4O 2VQEO 4JI7O 1N34O 4DUYO 1G1XB 1XEQA 2JRIA 4DV3O 4DR1O 2Z0AA 4LF8O 2F4VO 1X59A 2ZM6O 4GKKO 4DR4O 5BY1A 4B3MO 1F7YA 4JI6O 4B3RO 2N74A 1I94O 3T1YO 4JI5O 2UXDO 1A32A 2DOSA 4DV5O 4DUZO 1N36O 4DV7O 4B3SO 4LF4O 2UU9O 4DV6O 4NXNO 4GKJO 3J81N 1AB3A 2UUBO 4DV2O 5IT9N 3SDLA 4JI2O 1HNZO 4NXMO 1IBMO 2DJVA 2UUCO 2HHHO 4X66O 4B3TO 4JI1O 3JAMN 4JI0O 4AQYO 1HNXO 3J80N 4LF7O 1XMOO 4DV1O 4OPAA 2AGAA 2LW7A 2ZKOA 5IWAO 1NS1A 5FLXN 1IBKO 3T1HO 4K0KO 4JYAO 2UXCO 1YZBA 2E5LO 5LL6Y 4X64O 4JV5O 4DV4O 4LF6O 2FKXA 1XNRO 3F5TA 1DK1A 4YY3O 3RT3C 5A2QN 2UUAO 1KUQA 4OPHA 4JI8O 1FJGO 1J5EO 1FYJA 1HNWO 2UXBO 4DR6O 1HR0O 1FKAO 3OTOO 1D2DA 1XNQO 1AILA 5LMNO 4LFBO 4DR3O 4OX9O 4JI3O 3M8AA 4LF9O 1R1BA 2VQFO 4KHPO 1N32O 3O65A 4DR2O 5LMUO 5H5NA 4DR5O 4X65O 4A5UB 4DV0O 4DR7O 5BR8O 4LFCO 4LFAO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X62 O;  1IBL O;  1XMQ O;  4LF5 O;  3R66 A;  5BXZ A;  4YHH O;  3J7A U;  1R6T A;  1N33 O;  4JI4 O;  2VQE O;  4JI7 O;  1N34 O;  4DUY O;  1G1X B;  1XEQ A;  2JRI A;  4DV3 O;  4DR1 O;  2Z0A A;  4LF8 O;  2F4V O;  1X59 A;  2ZM6 O;  4GKK O;  4DR4 O;  5BY1 A;  4B3M O;  1F7Y A;  4JI6 O;  4B3R O;  2N74 A;  1I94 O;  3T1Y O;  4JI5 O;  2UXD O;  1A32 A;  2DOS A;  4DV5 O;  4DUZ O;  1N36 O;  4DV7 O;  4B3S O;  4LF4 O;  2UU9 O;  4DV6 O;  4NXN O;  4GKJ O;  3J81 N;  1AB3 A;  2UUB O;  4DV2 O;  5IT9 N;  3SDL A;  4JI2 O;  1HNZ O;  4NXM O;  1IBM O;  2DJV A;  2UUC O;  2HHH O;  4X66 O;  4B3T O;  4JI1 O;  3JAM N;  4JI0 O;  4AQY O;  1HNX O;  3J80 N;  4LF7 O;  1XMO O;  4DV1 O;  4OPA A;  2AGA A;  2LW7 A;  2ZKO A;  5IWA O;  1NS1 A;  5FLX N;  1IBK O;  3T1H O;  4K0K O;  4JYA O;  2UXC O;  1YZB A;  2E5L O;  5LL6 Y;  4X64 O;  4JV5 O;  4DV4 O;  4LF6 O;  2FKX A;  1XNR O;  3F5T A;  1DK1 A;  4YY3 O;  3RT3 C;  5A2Q N;  2UUA O;  1KUQ A;  4OPH A;  4JI8 O;  1FJG O;  1J5E O;  1FYJ A;  1HNW O;  2UXB O;  4DR6 O;  1HR0 O;  1FKA O;  3OTO O;  1D2D A;  1XNQ O;  1AIL A;  5LMN O;  4LFB O;  4DR3 O;  4OX9 O;  4JI3 O;  3M8A A;  4LF9 O;  1R1B A;  2VQF O;  4KHP O;  1N32 O;  3O65 A;  4DR2 O;  5LMU O;  5H5N A;  4DR5 O;  4X65 O;  4A5U B;  4DV0 O;  4DR7 O;  5BR8 O;  4LFC O;  4LFA O; 
#chains in the Genus database with same CATH topology
 5LP6 C;  1TA8 A;  1YJW V;  4FFB B;  2DQ3 A;  4D7S A;  2XND G;  1S77 D;  1SC5 B;  3JAR B;  2OCC C;  2Q7G A;  3JD3 A;  4Z1V A;  2R70 A;  4XDJ A;  1KD1 W;  4NXN B;  1H2N A;  1V9P A;  3AG7 A;  1OCC C;  3C90 A;  2EZP A;  3JD2 A;  2QWN B;  3N2G B;  1VQL V;  1Y76 A;  1N8R W;  3K03 A;  3W7S A;  2MW2 B;  4DUY B;  5CA1 B;  2QKA A;  3HPL C;  1XQ8 A;  2QSA A;  2L35 A;  5B1B C;  1FFT B;  4EEQ A;  1B06 A;  1KEC A;  1NVP B;  2QM8 A;  2UUC O;  5KHK A;  4FM1 A;  5CMU A;  2HHH O;  5J2U B;  2AZ2 A;  2NN4 A;  3T2M A;  2PI5 A;  2ITD C;  3HB3 B;  4JYA B;  1BZK A;  2A06 H;  1VP7 A;  4U3J B;  2ZQM A;  2YI9 A;  2JEU A;  2LFR A;  5K1P A;  1WNS A;  3QG5 A;  3I56 V;  1K7D A;  2PTM A;  5LHG A;  2BOB C;  3W7W A;  4BR6 A;  1M1K W;  3SPG A;  4D6T H;  1XMO B;  1L8D A;  5CA0 A;  5B1A B;  3F5T A;  3LSS A;  1EFR G;  2B1G A;  3BAA A;  2QM4 A;  1OCR C;  4I0X B;  5JCO A;  2AW9 A;  2XAH A;  4TT3 G;  3F7Y C;  4J41 A;  2GUZ B;  4K3A A;  4IT5 A;  2KQX A;  1SER A;  3SPC A;  2WAM A;  1AIL A;  5L3F A;  2EIM C;  5IDJ A;  1BSM A;  4MS2 A;  1M57 C;  5EBL C;  3BAB A;  2YDE A;  1IVS A;  4LFC O;  2KG7 B;  4X62 O;  3DGE A;  2Q8V A;  1AP6 A;  1XMQ O;  4I50 A;  5LXT A;  4HNA A;  1SZT A;  2VQE O;  2ZDI A;  5IJ9 A;  1N32 B;  3CRQ A;  5KA5 A;  3LDC A;  5IYD O;  1GN2 A;  3RYF A;  4LCU C;  4LF8 O;  4MW3 A;  3B40 A;  2QJ1 A;  3OT7 A;  5HFL A;  3H01 A;  5KX5 B;  4WBN B;  3RVY A;  2ZDI C;  4MTF A;  2F93 B;  1A32 A;  2P4K A;  4NKG B;  2FL4 A;  4KP4 A;  2EIL B;  1IXB A;  2QGN A;  3D3I A;  2A9H A;  1YVW A;  4GKJ O;  2YXH A;  1FS0 G;  1CPY A;  1P4R A;  4O4I B;  5FPO A;  3TXQ A;  1W2B U;  3ZRS A;  3STL C;  4GX5 A;  3VQV A;  2HJD A;  1K34 A;  3RBZ A;  5CN0 A;  3JAM N;  2F66 C;  2F43 G;  2WLI B;  4J9Z B;  3DTU B;  4DV1 O;  2QWP B;  3ZS8 C;  5J9P C;  1UFI A;  4LNU A;  4YJ2 A;  4E4E A;  1ZL8 A;  2UUC B;  2HHH B;  1IBK O;  1GO3 F;  4P9P A;  2UXC O;  4QPJ A;  1F23 A;  3N2K B;  4X1K B;  5IY5 B;  1HW7 A;  4RQE A;  4JI8 B;  1EN5 A;  2QKC A;  4MTG A;  1JOY A;  3K79 A;  1VF7 A;  2ADP A;  3LSU A;  3K5N A;  5KMG A;  1NR1 A;  5EBW C;  1THZ A;  1D2D A;  3E2E A;  3CCE V;  2EIN C;  1K5S A;  3LUT B;  4LF9 O;  5CA3 A;  1M56 B;  3JAW A;  3M99 B;  4ZHQ B;  4ZKI A;  3SJB C;  5L3G A;  3LSQ A;  1M5I A;  2OT5 A;  3RW0 A;  2YIB D;  3QO8 A;  5D5P A;  1G1X B;  4QIW F;  3F5W C;  1MAB G;  1NZ6 A;  4LFC B;  3AG3 B;  3CCU V;  4DV3 O;  1XMQ B;  2LGW A;  2P4V A;  4FZ0 A;  2ITC C;  1FXK A;  4PJ0 Z;  3UT5 B;  1UJW B;  3D8C A;  3RYC B;  2VQE B;  4UCV A;  3GB7 C;  4N23 A;  4U7O A;  3AK1 A;  1OCO B;  5IE9 A;  4LF8 B;  3ZED A;  3K0G A;  2UXX A;  2K1E A;  4DK1 A;  2RMK B;  3VQX A;  1FXK C;  3Q4H A;  4K35 A;  4UUJ C;  4FM2 A;  1IZ3 A;  1Q90 D;  4Q6G A;  1IBM O;  2YIC A;  3JSL A;  5KHG A;  2OCC B;  2BOC C;  1VMG A;  3E22 B;  4GKJ B;  4JV5 B;  1OCC B;  1JQ0 A;  2CTQ A;  1NU1 H;  1XHZ A;  2P67 A;  1YJN V;  4K8X A;  1GMG A;  4EB6 B;  3FB7 C;  4FJC C;  3RYH B;  3MHS C;  4JYB A;  3ZN1 A;  3CC4 V;  4DV1 B;  2Q9L A;  2ZIN A;  4FK5 C;  3JAR A;  1K8A W;  5B1B B;  1IBK B;  4YIP A;  2UXC B;  5L3C A;  4LP8 A;  2PGG A;  4GZR B;  5F2V O;  4PDM A;  2CK3 G;  3N2G A;  3H1K H;  4DR6 O;  4MVU A;  1BMF G;  1Q6U A;  2JVD A;  3UQ8 A;  5LMN O;  2QWR B;  3K59 A;  3OUF A;  5CA1 A;  1RSO B;  2Q6A A;  2OIG A;  1MOF A;  1DGS A;  1R6N A;  1PNL A;  3ETQ A;  3BFR A;  3PN1 A;  1VQP V;  4X65 O;  1ZX3 A;  3FFQ A;  3J7A U;  1PL0 A;  1EN4 A;  4YHH O;  4W4K A;  1N33 O;  1VF6 A;  2JJ1 G;  4LF9 B;  2F4V B;  5CBF A;  1Q6I A;  4ICG A;  2GV9 A;  2BTO A;  2Q67 A;  5FPR A;  3JAK B;  2ETN A;  4LWS B;  5E79 Z;  2CE4 A;  4B7E A;  2ZM6 O;  1WJZ A;  4U3J A;  4J9Y B;  5J2T B;  4QPK A;  1VF6 C;  1KB9 F;  2V7Q G;  3VQY A;  2HJF C;  2CTP A;  4JI5 O;  1Q3E A;  4O4H B;  2EIM B;  1KKC A;  2HEP A;  4DV3 B;  4XDL A;  1JR9 A;  2FML A;  1AB3 A;  3SR2 C;  4OXS A;  4I0X A;  3G67 A;  5H6Q A;  5LA6 B;  4NXM O;  1URF A;  3CRC A;  1XBL A;  4F6R A;  4UVB A;  1XIL A;  3HR0 A;  3CCM V;  5LGT A;  4EKW A;  3HKD B;  2P6J A;  4DW1 A;  4JI0 O;  3ETG A;  4WCE V;  3QVN A;  3FB6 C;  4TUY B;  5B1A C;  1BQZ A;  3H1J H;  1IBM B;  1US6 A;  2QWO B;  3AEI A;  4PD4 F;  3I5D A;  2KG7 A;  3THO A;  3R65 A;  1IX9 A;  3K0D A;  4JAS A;  4WFF A;  3E8F A;  1GN3 A;  5EZY A;  1SET A;  2WWW A;  3QNE A;  3OEE G;  1P49 A;  2E74 B;  4KFM A;  1K4C C;  2A7W A;  2EJR A;  2Q69 A;  3JD0 A;  4JGS A;  2Q73 A;  1EBO A;  2UXB O;  3U11 A;  1Q7Y W;  2VS0 A;  2YSU B;  5IJ0 B;  1F4M A;  4LFA B;  5KX5 A;  1B3Q A;  3E86 A;  2JS3 A;  4LFB O;  4WBN A;  1TAE A;  1KU9 A;  2D2C B;  3M8A A;  1ZWI C;  4WFH A;  1Q86 W;  3B77 A;  3E8G A;  1AI6 A;  4OGQ B;  4J11 A;  3OFN G;  5CBH A;  5LMN B;  2XUM A;  1VEW A;  3EVK A;  4O4I A;  4NTX A;  1AVM A;  2IH1 C;  3EXA A;  4TV9 B;  2F95 B;  1QLN A;  1YTF B;  2EIL C;  3OR7 C;  4YHH B;  1VQ7 V;  1N33 B;  1RM1 C;  4DR4 O;  4B3M O;  3B8M A;  2H8P C;  2PYJ A;  3N2K A;  2D3O W;  2B1I A;  4X1K A;  2EIN B;  2LFS A;  3ZBH A;  1EM1 A;  4IYI A;  2ZM6 B;  1MZE A;  1Q43 A;  2CDY A;  5IT9 N;  1R3K C;  3SJC C;  4XBF A;  2JIZ G;  5E1A C;  4JI5 B;  4MT8 A;  1SZX A;  3L74 H;  5GW7 A;  1I5Y A;  4TOI A;  5B5E Z;  4PI0 A;  1VQ5 V;  2LW7 A;  4NXM B;  3ABL B;  4IIJ B;  1M90 W;  1ENV A;  2AXT Z;  1JPX A;  5TIS Z;  5KUK A;  1VQ6 V;  4JYA O;  4LH7 A;  4ZHQ A;  4TQD A;  4JI0 B;  2DE0 X;  2FKX A;  2QTS A;  1Y74 B;  1FJG B;  2X7R B;  4G2K A;  3UO3 A;  2OCH A;  4X1I B;  1BQ0 A;  2YIA A;  3K08 A;  2UUA O;  1NH2 B;  3WU2 Z;  1M56 C;  4LBE C;  3VQW A;  4H0L B;  2BE3 A;  3UT5 A;  3OTO O;  4UV8 A;  3RYC A;  2GHY A;  1XNQ O;  2WPD G;  5JVD B;  2DMX A;  4DK0 A;  2H3O A;  3EHB B;  2O57 A;  4DR2 O;  4PHZ A;  2UXB B;  1JA8 A;  1IBL O;  3U10 A;  1EZJ A;  3P30 A;  3TET A;  4LFB B;  2L6L A;  4DO2 A;  4FVM A;  5B66 Z;  3QTC A;  1YIT V;  2EBO A;  1OCO C;  3CCQ V;  3UO2 A;  4DR1 O;  3E22 A;  4TV8 B;  3W7X A;  5B3S C;  5EYP A;  4X89 A;  2DYR B;  3D36 C;  1YI2 V;  4B3R O;  1AI4 A;  3K58 A;  1AR4 A;  3ZRW B;  1IXM A;  4UFZ A;  4EB6 A;  1NTK H;  1ARO P;  3RYH A;  3AK3 A;  2VRZ A;  2E76 B;  3JCZ A;  1L0L H;  4O2A B;  4DV6 O;  4DR4 B;  2AHZ A;  2UUB O;  4YIO A;  4B3M B;  3BA8 A;  2HR3 A;  1M93 A;  1SKV A;  1RPO A;  2RCV A;  4PV1 B;  2A3Q A;  2A0L A;  2HP8 A;  2YID A;  1V55 B;  5C8Y B;  1K97 A;  5LOV B;  2DYS C;  4I7Z B;  1RSO A;  1S72 V;  5JJJ B;  1R3I C;  3ETD A;  4FLX A;  4H44 B;  3VBB A;  3K9S A;  3FX7 A;  3SGI A;  1WLE A;  3LNN A;  1K73 W;  1ZUQ A;  1SS3 A;  1BL8 A;  1YHQ V;  2QM7 A;  2IM9 A;  2QA4 V;  4P9O A;  3CRR A;  1QCE A;  4JI8 O;  3JAK A;  1FYJ A;  4LWS A;  4F4L A;  5L3D A;  3OE7 G;  3RYI A;  4DR7 B;  2G38 A;  5J2T A;  4IL6 Z;  4ASU G;  2UUA B;  3CCR V;  4O4H A;  3O65 A;  1DLB A;  2P5O A;  5LMU O;  5GON B;  1TVK B;  5CBG A;  3A0H Z;  1ROP A;  2LO1 A;  4DW0 A;  3OTO B;  4JYY A;  2IW5 A;  5C93 A;  3HKB B;  1XNQ B;  2WLK A;  4Q20 A;  4DXW A;  3IAY A;  3H9V A;  3ZRV A;  1KBH A;  4DR2 B;  3FB8 C;  4FLY A;  3X2Q B;  1IBL B;  1R3J C;  3AG4 C;  2Q5Z A;  3SYA A;  4UVC A;  3IJ4 A;  4GKK O;  5LHH A;  1I94 O;  4X88 A;  1QVG U;  1P7G A;  4DR1 B;  3ZMT A;  3U0Z A;  1EZV H;  3CWB H;  3MHH C;  4DV2 O;  4AQY B;  4HZ3 A;  4B3R B;  2DJV A;  3ABM C;  4UCR A;  1AJN A;  3LDD A;  3D3Q A;  2Y4T A;  1NTZ H;  2PZS A;  3CS5 A;  5IYZ B;  4B3T O;  2VWJ A;  5IJ0 A;  4F6E A;  1GTO A;  3APQ A;  4DV6 B;  2Y69 B;  1JJ2 U;  4BIU A;  2UUB B;  3SPH A;  3DC5 A;  1AR5 A;  3A8T A;  1NQT A;  4PA7 A;  1YZB A;  3JCU Z;  1RM1 B;  2V4D A;  4JV5 O;  3KCX A;  4DV4 O;  3TCU A;  2AZ0 A;  5JJE B;  1Y6X A;  2PUS A;  4PA6 A;  2XAF A;  5A2Q N;  1PPJ H;  1M4U A;  2XT9 A;  4TV9 A;  5A9G A;  4X20 A;  3ZHR A;  4ZBM A;  1HWY A;  2WLN A;  2CTW A;  4J10 A;  1H2S B;  4UVA A;  1ZAU A;  2JGD B;  3K9A A;  3HKE B;  4JZG A;  3F7V C;  4JI7 B;  1ORQ C;  1NBM G;  2HKO A;  2E75 B;  2JGU A;  3CRA A;  3PJS K;  5KHH A;  2LP7 A;  3MAQ A;  5DM6 V;  1WPX A;  2ARH A;  5H6R A;  1S5J A;  5LMU B;  1AJQ A;  1UPG A;  3IFX A;  4FZ1 A;  1Q5O A;  1XOU A;  1YDX A;  2F4V O;  1I5X A;  3VOU A;  5IYC O;  4IIJ A;  3ZHQ A;  4U3F H;  3OGC C;  2AHY A;  2GSM B;  3SYO A;  1GM8 A;  3DXR B;  1WAZ A;  3ABK B;  4Z1M G;  1N36 O;  1EN6 A;  4R6Z A;  4RO2 A;  4GKK B;  3SDL A;  2WLH A;  1YXB A;  1AI7 A;  1I94 B;  5ITZ B;  3ABL C;  2XHB A;  4WFG A;  4FLU A;  2IU0 A;  3ZCC A;  1O9G A;  4DV2 B;  3OMA B;  5JVD A;  4UB6 Z;  4L8J A;  3KKY A;  5K1X A;  3QO5 A;  1NS1 A;  5FLX N;  4JAV A;  5B3S B;  2QTO A;  1XL4 A;  5LL6 Y;  4B3T B;  4X64 O;  3BEH A;  2Z3Y A;  1HP8 A;  4TSF G;  3C3T A;  3ZX6 A;  1B04 A;  4ZOL B;  3ETE A;  3ABU A;  3RT3 C;  4UCO A;  5FNV B;  5DEC A;  4LR3 A;  2B9Z A;  3E83 A;  1QBZ A;  1NT2 B;  1XDC A;  4DV4 B;  4I4T A;  3JD4 A;  4TV8 A;  1YSC A;  3OMI B;  2ZNJ A;  1QNM A;  4NR1 A;  2W6J G;  4WFB V;  5KA6 A;  4DR3 O;  2M7W A;  4X8A A;  4OX9 O;  1JMK C;  3ZRW A;  3CXC U;  2M6Y A;  4FFB A;  4R50 A;  2X0L A;  4CH3 A;  3P3N A;  4DR5 O;  2UXN A;  2DYS B;  4LFA O;  3CRM A;  4QJF B;  4WF9 V;  4BAY A;  4LF5 O;  2XTA A;  3ASO B;  4AI8 A;  1KYO F;  2DYR C;  5KUM A;  4JYC A;  2RN9 A;  2Q7E A;  1FFX B;  2IJI A;  4WFE A;  1JFF B;  2JRI A;  4DV5 B;  5LOV A;  2R9R B;  5BY1 A;  4R8C A;  2OTJ V;  1Y76 B;  3H1L H;  1KQS U;  2IJJ A;  3T1Y O;  4O4L B;  2ZIO A;  2IU3 A;  1G4Y B;  1QLE B;  3SJQ C;  4FMT A;  3WB0 A;  3FYI B;  3JAS B;  1VIB A;  2VWK A;  4DV7 O;  1G8M A;  5J2U A;  3APO A;  3J81 N;  1SQP H;  1V55 C;  2WA4 A;  3OR6 C;  5LBQ A;  4KL1 A;  5L3B A;  3G80 A;  2H94 A;  1FXV A;  2X6B A;  2R9A A;  2IJK A;  2EZO A;  2BCC H;  1TUB B;  1N36 B;  1H2M A;  4DYL A;  3RN4 A;  2WLL B;  5DED A;  3H1I H;  1K33 A;  2ZT9 B;  3AG4 B;  5IWA O;  1XNR B;  1V54 C;  5GON A;  3CCV V;  2NLJ C;  2ZCE A;  3SPJ A;  1QVF U;  4N21 A;  3HKB A;  1WP8 A;  4X1Y B;  1YF2 A;  2GUZ A;  2N04 A;  1U96 A;  3ZJZ A;  1FAF A;  3NXS A;  1Z5W A;  4CH6 A;  4X9Q A;  4OPH A;  1FJG O;  4X64 B;  3CC7 V;  1WN7 A;  2ZE7 A;  4AIL C;  1X4T A;  3ABM B;  4BW9 A;  5HFM A;  4DRX B;  3CME V;  4GCZ A;  2YC0 A;  5B1N A;  5LGU A;  2LJ2 A;  3O9O A;  3T4Z A;  1H2G A;  2DW4 A;  3JYC A;  3CCS V;  4DV0 O;  2Z5U A;  4MVZ A;  1OJH A;  3CHX A;  2A79 B;  3X2Q C;  3ZHU A;  2IH3 C;  2ZR2 A;  1GH6 A;  1KKD A;  3BRC A;  3EFF K;  4JI4 O;  4DR3 B;  4OX9 B;  3L71 H;  1S5H C;  2GDS A;  2QKS A;  4J7Z A;  2C2A A;  3CCJ V;  4DR5 B;  5IYZ A;  1XHX A;  4GUN A;  2JK5 C;  5LXT B;  4IHJ B;  3OD4 A;  4LF5 B;  5D5Q A;  3L72 H;  3CD6 V;  2P22 C;  2XAG A;  2RDC A;  4CS4 A;  4ZIB A;  1AI5 A;  1SF9 A;  3WB2 A;  2DWD C;  4FLV A;  1W59 A;  1ZTE A;  1PL4 A;  1RFY A;  4CC6 A;  1H2K A;  1SQG A;  1Q82 W;  1WP7 A;  2Y69 C;  4UB8 Z;  4ZI7 B;  4GYC B;  2ZXW B;  1MMM A;  2FYU H;  3AK2 A;  2CH7 B;  1Y67 A;  3T1Y B;  1PP9 H;  2WLI A;  1AR1 B;  4CH5 A;  1LR1 A;  4X66 O;  3KCY A;  2ZIM A;  4DV7 B;  2Q0O C;  4MSW C;  1GM9 A;  2JGD A;  2AGA A;  2ZE8 A;  2PI4 A;  5EC1 C;  5CB4 B;  3T1H O;  2R9I A;  3HKE A;  2OIE A;  4TQF A;  2LQT A;  3SYP A;  4NB5 A;  3CEI A;  5IWA B;  3JAL B;  4L87 A;  2WA3 A;  3CX5 F;  4B7K A;  5FL7 G;  3BY6 A;  2ZNI A;  3CSX A;  2MK3 A;  3KZI Z;  1PM9 A;  2YXY A;  4CZZ A;  1R1B A;  4BWA A;  5DN6 G;  1VQ9 V;  3TGU H;  3DXR A;  4DR7 O;  1B6Q A;  1Y4M A;  5EIB D;  1MSD A;  2EIK C;  3R66 A;  2E3C A;  5ITZ A;  1N34 O;  1LNQ A;  4DV0 B;  1XRE A;  3GWK C;  4MTX A;  4WFA V;  1VQM V;  1N4C A;  3BA9 A;  4I55 B;  3ABK C;  4CBC A;  2P7T C;  4JI4 B;  2XAQ A;  1NVP D;  3L73 H;  2ODM A;  3AG2 C;  1YJ9 V;  1ZSP A;  4FIP C;  1H2L A;  5EC2 C;  2JEX A;  3D36 A;  3CPW U;  1RP3 B;  4CH4 A;  3ZMU A;  4GX2 A;  4ZOL A;  4EFB A;  5JQG B;  1Q6H A;  2WLJ A;  5FNV A;  1F4N A;  1MNG A;  4PA3 A;  4JI1 O;  4YJ3 B;  4AQY O;  3B2E E;  2EUL A;  3CC2 V;  4R7C A;  4P30 A;  3SYQ A;  1CXZ B;  2ZR3 A;  4X66 B;  1GN4 A;  4JTC B;  3SJA C;  1SQQ H;  1D5N A;  2V1D A;  4PDR A;  4LF6 O;  2JS5 A;  2ZE6 A;  3FKS G;  3RFR A;  4NVP A;  3BVO A;  1COW G;  3B4S A;  3HKC B;  4YY3 O;  4GLX A;  4KUM A;  1VQ4 V;  3T1H B;  3ASN B;  2P90 A;  1GK9 A;  1FFX A;  1JFF A;  3SYC A;  3C3S A;  1MSW D;  3G4S V;  1VQO V;  2R72 A;  4K8Z A;  1FKA O;  1S5L Z;  4JTA B;  1GKF A;  3JSN A;  3A0R A;  2DQ0 A;  3ASO C;  2YIB A;  1KP3 A;  4G27 B;  2RJZ A;  2YEV B;  4O4L A;  4PA4 A;  4KHP O;  1R3L C;  1SQF A;  3MDS A;  2DN9 A;  2QE7 G;  2WLM A;  1O9H A;  1L1F A;  3JAS A;  3AG1 B;  1V54 B;  1S76 D;  4TWK A;  2PY5 A;  4FM0 A;  4JI7 O;  2Y4U A;  1OV9 A;  1QHT A;  1Z5V A;  1XEQ A;  3WFV A;  3RVZ A;  1TUB A;  1QLE C;  2WLL A;  3G6B A;  1X59 A;  1MA1 A;  4CS2 A;  4LC1 A;  1N34 B;  4JI6 O;  4QE9 A;  3K57 A;  3W7T A;  5IYB O;  1FD9 A;  2UXD O;  1OCZ B;  4D7T A;  5LA6 A;  4O4J B;  1XI1 A;  2RQ6 A;  3G6E V;  4IYH A;  2LW1 A;  1S0V A;  4X1Y A;  4LF4 O;  1QR9 A;  3DC6 A;  4IGG A;  2BSK B;  3JAT B;  2UU9 O;  2QEX V;  1G6U A;  3HKD A;  2Q4P A;  1NR7 A;  3L70 H;  1PD3 A;  4TUY A;  3MD0 A;  5H2F Z;  1LUV A;  1TGO A;  2Q7H A;  4F6R B;  4DRX A;  2HG5 C;  4OPA A;  1QU7 A;  4I9Q A;  3STZ C;  2YI8 A;  4MW8 A;  2E5L O;  1QR8 A;  4JI1 B;  3P32 A;  4BW5 A;  4Z2W A;  2BTQ B;  5JCO C;  1BCC H;  2OWO A;  5LYJ B;  1BT8 A;  3K5M A;  4MVM A;  1KUQ A;  5EZY B;  3QO7 A;  3BPZ A;  1R6K A;  1GN6 A;  4UCU A;  4NTY A;  3FYE B;  4IHJ A;  4LF6 B;  1HNW O;  4RUF A;  1HR0 O;  3ZN0 A;  4YY3 B;  2LGQ A;  4NYK A;  4JI3 O;  4HAM A;  3OW2 U;  4YXW G;  3LDE A;  2KSD A;  1ZLZ A;  2ZE5 A;  1I0H A;  1BS3 A;  3K3W A;  4ZI7 A;  4O2B B;  3L75 H;  4GX1 A;  3OEH G;  3S3W A;  2CH7 A;  2ZD9 A;  4KHP B;  2GTS A;  1S3J A;  3ZHS A;  4JZ2 A;  5JH7 B;  1E1R G;  1I08 A;  1WB8 A;  3G71 V;  1OHH G;  2EIJ B;  2IJH A;  3BHP A;  2ZXW C;  1F7Y A;  5CB4 A;  1AP5 A;  4RAI A;  3E35 A;  2ATK C;  1AJP A;  3ZRX A;  1GM7 A;  2HVJ C;  4DV5 O;  3B09 A;  4B3S O;  4FLW A;  3CJH B;  1SA0 B;  2P06 A;  3JAL A;  5GTH Z;  1F51 A;  3WG7 B;  1M9N A;  3TJT A;  2YXL A;  1HNZ O;  4JI6 B;  3IC9 A;  2EIK B;  1K3E A;  3LNM B;  2UXD B;  3CCL V;  1JX9 A;  4J7K A;  4QGP A;  4FLZ A;  5KHI A;  4LF4 B;  2UU9 B;  3JD1 A;  2HFE C;  2B5U A;  1JJO A;  1Y74 A;  1VF5 B;  4QE7 A;  1Y66 A;  2F1M A;  1SQB H;  3AG2 B;  4X1I A;  1XNR O;  1VQ8 V;  1IDS A;  1WA8 B;  2E5L B;  3E89 A;  3K04 A;  2WSS G;  3OUS A;  2Q68 A;  1NKD A;  4FPP A;  1PNM A;  4I55 A;  5KLV H;  5BZB A;  2XAJ A;  1L0N H;  4X62 B;  1VQN V;  2IBZ H;  1R73 A;  3CMA V;  1GRJ A;  1VAR A;  4PDL A;  5BMV B;  1HNW B;  3UCS C;  1HR0 B;  5JQG A;  1DF5 A;  1WB7 A;  1R6T A;  3S3X A;  4JI3 B;  4PI2 A;  3FAV B;  1Z2G A;  3B8N A;  4HBN A;  2ILM A;  4YJ3 A;  5LP6 B;  2W0F C;  1QQC A;  1I7F A;  1JVM A;  3ZIA G;  4EFE A;  5LGN A;  3E8H A;  3A0B Z;  1FXH A;  4QNH B;  4CS3 A;  3NR7 A;  4XDK A;  4O2A A;  3CE2 A;  1K92 A;  5EYP B;  2NNU A;  3OGI B;  1N0J A;  4DUZ O;  3ZMV A;  1JCH A;  1KP2 A;  3HKC A;  5KAI Z;  4PEL A;  1K9M W;  2JDI G;  2QWQ B;  1BHB A;  4JI2 O;  3H1H H;  3CP1 A;  1PV0 A;  1BE3 H;  5C8Y A;  2EX3 A;  4H37 A;  4UV9 A;  4B3S B;  1KC8 W;  4HYO A;  3ICX A;  1HNZ B;  2YEV A;  3ZHT A;  1PNK A;  1FPO A;  2KB1 A;  3ASN C;  4K0K O;  1N0N A;  2OTL V;  1LUW A;  3N27 A;  1U97 A;  1D5A A;  5JJN B;  2KKW A;  3L9D A;  3CB2 A;  4JTD B;  2EJ7 A;  5EIB C;  3CYO A;  4RUE A;  4JAU A;  3K5L A;  3T4D A;  4ABM A;  2PYL A;  1J5E O;  4MTO A;  3ML0 A;  3QF7 A;  2HLD G;  2CUG A;  4CC5 A;  3AG1 C;  2HVK C;  1TVK A;  2CAZ C;  4W4L A;  1OCR B;  1H38 A;  3RYI B;  2VQF O;  1MZF A;  3RGB A;  2FTK A;  2W6I G;  1BHA A;  5JWP A;  5BR8 O;  4O4J A;  3KG2 A;  1YTF D;  2BSK A;  3JAT A;  5BXZ A;  5CA0 B;  2PF4 E;  2OYQ A;  1M57 B;  4J80 A;  3GVM A;  3GWO A;  4PDV A;  1K5Q A;  5H9C A;  1OCZ C;  2Z0A A;  1J95 A;  1CP9 A;  4UCT A;  4P2Z A;  3OTF A;  1YEW A;  1XL6 A;  2BTQ A;  4JF3 A;  4LH6 A;  4GX0 A;  5B1O A;  3OAA G;  3FB5 C;  5LYJ A;  4I50 B;  1YCI A;  3ZMZ A;  4HNA B;  3CXH F;  5IJ9 B;  3ZHV A;  4I9W A;  4UXN A;  4DUZ B;  2CGN A;  3TXS A;  1HNX O;  3J80 N;  4LF7 O;  3RYF B;  2CTR A;  3IGA C;  4JI2 B;  1H8E G;  1VQK V;  1HDJ A;  2YS8 A;  1KMI Z;  4C7U A;  1Q8I A;  1NH2 D;  1P84 F;  1GAX A;  4B08 A;  3WB1 A;  4O2B A;  1E79 G;  3DSQ A;  4RQF A;  1DK1 A;  4DR6 B;  1SES A;  4BIZ A;  2Y0I A;  3M7M X;  2Y48 A;  4K0K B;  5JH7 A;  4G28 B;  3K5O A;  4RWU A;  1PKX A;  3SPI A;  1K4D C;  3OMN B;  2N05 A;  4MVQ A;  5EBM C;  4X65 B;  1XUQ A;  2YUA A;  5KAF Z;  5EK0 A;  4X20 B;  3ZMS A;  4LNU B;  4YJ2 B;  1ZL8 B;  1Q81 W;  4U7N A;  3W7U A;  1J5E B;  1RPR A;  4NXN O;  4A5U B;  2GBO A;  3I55 V;  4AHC A;  3CJH A;  1SA0 A;  4J42 A;  2K9P A;  4UCS A;  3UKM A;  1SQV H;  1OZ0 A;  2Q0A A;  4KXR A;  2EIJ C;  2VQF B;  4DUY O;  1NJI W;  5BR8 B;  2Y0P A;  1P7B A;  3RWR D;  5KMG B;  2X6A A;  2CGO A;  3T1C A;  4J7J A;  5IY5 C;  3WG7 C;  1BGY H;  2XAS A;  2GTA A;  2N74 A;  2F23 A;  4JAA A;  3JAW B;  3BCC H;  2DOS A;  4FFK A;  3P3P A;  1NTM H;  2JJ2 G;  3FD9 A;  2QR4 A;  2X6C A;  5KHJ A;  1YIJ V;  1H8H G;  1WA8 A;  4E2L A;  3ABT A;  2FB5 A;  5LHI A;  1DTO A;  1W0J G;  1MG1 A;  1IUR A;  1CEZ A;  1FXK B;  3TK1 A;  1XMO O;  5GTI Z;  2ZKO A;  4FLT A;  3UM7 A;  4PA9 A;  5BMV A;  1SQX H;  4MVR A;  1HNX B;  5L3E A;  4MVO A;  4BIO A;  2XOK G;  4LF7 B;  2ADQ B;  5AG2 A;  3E8B A;  3AG3 C;  1E1Q G;  3Q4H B;  4H13 B;  3FAV A;  4GT1 A;  2QDO A;  2DWE C;  4NTW A;  1NI8 A;  1TUE B;  5LP6 A;  1SRY A;  2RNB A;  1WPB A;  3K06 A;  1T5E A;  2NR5 A;  4MVS A;  1DF4 A;  2W0X A;  3A2F A;  4JPR A;  3IC7 A;  3OM3 B;  4I4T B;  4H33 A;  1N32 O;  5H5N A;  4I5S A;  1W0K G; 
#chains in the Genus database with same CATH homology
 4X62 O;  1IBL O;  1XMQ O;  4LF5 O;  3R66 A;  5BXZ A;  4YHH O;  3J7A U;  1R6T A;  1N33 O;  4JI4 O;  2VQE O;  4JI7 O;  1N34 O;  4DUY O;  1G1X B;  1XEQ A;  2JRI A;  4DV3 O;  4DR1 O;  2Z0A A;  4LF8 O;  2F4V O;  1X59 A;  2ZM6 O;  4GKK O;  4DR4 O;  5BY1 A;  4B3M O;  1F7Y A;  4JI6 O;  4B3R O;  2N74 A;  1I94 O;  3T1Y O;  4JI5 O;  2UXD O;  1A32 A;  2DOS A;  4DV5 O;  4DUZ O;  1N36 O;  4DV7 O;  4B3S O;  4LF4 O;  2UU9 O;  4DV6 O;  4NXN O;  4GKJ O;  3J81 N;  1AB3 A;  2UUB O;  4DV2 O;  5IT9 N;  3SDL A;  4JI2 O;  1HNZ O;  4NXM O;  1IBM O;  2DJV A;  2UUC O;  2HHH O;  4X66 O;  4B3T O;  4JI1 O;  3JAM N;  4JI0 O;  4AQY O;  1HNX O;  3J80 N;  4LF7 O;  1XMO O;  4DV1 O;  4OPA A;  2AGA A;  2LW7 A;  2ZKO A;  5IWA O;  1NS1 A;  5FLX N;  1IBK O;  3T1H O;  4K0K O;  4JYA O;  2UXC O;  1YZB A;  2E5L O;  5LL6 Y;  4X64 O;  4JV5 O;  4DV4 O;  4LF6 O;  2FKX A;  1XNR O;  3F5T A;  1DK1 A;  4YY3 O;  3RT3 C;  5A2Q N;  2UUA O;  1KUQ A;  4OPH A;  4JI8 O;  1FJG O;  1J5E O;  1FYJ A;  1HNW O;  2UXB O;  4DR6 O;  1HR0 O;  1FKA O;  3OTO O;  1D2D A;  1XNQ O;  1AIL A;  5LMN O;  4LFB O;  4DR3 O;  4OX9 O;  4JI3 O;  3M8A A;  4LF9 O;  1R1B A;  2VQF O;  4KHP O;  1N32 O;  3O65 A;  4DR2 O;  5LMU O;  5H5N A;  4DR5 O;  4X65 O;  4A5U B;  4DV0 O;  4DR7 O;  5BR8 O;  4LFC O;  4LFA O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...