4DUYO

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
87
structure length
87
Chain Sequence
b'PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome
publication title A structural basis for streptomycin resistance
rcsb
total genus 30
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4duyO00
2UXDO 3JAMN 4LF9O 4X66O 2DOSA 4DV0O 4B3RO 4OPAA 2E5LO 4DR2O 4LF5O 4LFCO 4DV6O 3T1YO 4DV5O 5LMUO 4GKKO 1F7YA 2UU9O 5H5NA 2UXCO 3R66A 3OTOO 1N34O 4DV4O 3J80N 1G1XB 3RT3C 4NXMO 5IWAO 4NXNO 2ZKOA 4DR6O 4LFAO 4OX9O 1XNQO 4X64O 4KHPO 4DR7O 1R1BA 4LF8O 2FKXA 3F5TA 4LF6O 3SDLA 4LF7O 5IT9N 1A32A 2VQFO 4DUYO 2UUCO 4X65O 3J81N 3J7AU 1FJGO 1IBMO 4JI1O 4JI8O 2F4VO 5BR8O 4YHHO 1HNWO 1IBKO 1R6TA 3O65A 1NS1A 3M8AA 4DR1O 4DR3O 1HNZO 4AQYO 2HHHO 1XMQO 5FLXN 2DJVA 4DR5O 1XEQA 4JI4O 4X62O 4JI6O 2UUAO 2LW7A 4DUZO 4A5UB 2UUBO 4DR4O 4GKJO 4JI7O 1AB3A 4DV7O 1J5EO 4B3TO 4JI5O 5BXZA 4LF4O 1X59A 1FYJA 1I94O 4K0KO 1YZBA 1HNXO 2VQEO 1KUQA 2Z0AA 4DV3O 1HR0O 4B3SO 2JRIA 4B3MO 4OPHA 5LMNO 4JI2O 4DV2O 2N74A 1AILA 5BY1A 2ZM6O 1XNRO 4JV5O 1IBLO 4JI0O 2AGAA 1DK1A 4LFBO 1N33O 5A2QN 4JYAO 1XMOO 1N32O 4JI3O 4DV1O 1D2DA 5LL6Y 1N36O 3T1HO 2UXBO 4YY3O 1FKAO
chains in the Genus database with same CATH superfamily
3E35A 3KKYA 4X66O 2UUCB 3B8MA 2E5LO 1Q43A 3JASB 2IU3A 2DQ3A 1SS3A 5LP6B 1QLNA 1YCIA 1JOYA 2DWEC 1R3LC 5CA1A 4LFAO 4DV4B 1AJPA 3K79A 2P4VA 5DEDA 5EC1C 3QTCA 4DR7O 3ICXA 5LMNB 3CX5F 3VQXA 4JYCA 4IIJB 4NKGB 2OCCB 2EINC 4RAIA 4PJ0Z 1LUVA 2VQFO 4DV6B 1L0NH 2XNDG 4UVAA 4UUJC 4GKJB 2ILMA 4H37A 2UXNA 3PJSK 4GT1A 4BAYA 4K8ZA 1OCRB 2X6AA 2WLNA 1IBMB 3OAAG 1J95A 5FLXN 1HNWB 4ICGA 1WPBA 4JI4O 1Q90D 1GH6A 1U97A 3STZC 4BR6A 3P30A 2P7TC 5LBQA 4UCUA 1H2SB 4JAAA 4C7UA 2EIMB 4G28B 2JGDB 4MVRA 3U10A 3THOA 2V4DA 1GN3A 1TA8A 4OX9B 1F23A 4B3SO 5FNVA 4R50A 1XQ8A 1FS0G 2CTQA 4PI0A 1SETA 3CB2A 1N34B 5IJ0B 1DF5A 2DYSB 1NU1H 2WPDG 2ZE8A 2ZXWC 3ETGA 4ZHQB 3G6BA 3OE7G 3W7TA 3CC4V 4RWUA 4ZOLB 4NXMB 3QNEA 5B3SC 4G27B 4XBFA 2XTAA 1NH2D 4AHCA 3H9VA 4YJ3A 1JFFB 2JJ2G 1PNLA 2PYLA 3L75H 4OPAA 4LH6A 1Z2GA 4LNUA 1OZ0A 2UXCO 5JWPA 2PTMA 1G1XB 1GAXA 5LOVB 3R65A 2RN9A 3LSSA 1WA8B 2ZT9B 3B40A 2YS8A 1SQVH 5LGNA 4MS2A 1JMKC 3W7XA 2GSMB 4B08A 2WWWA 5LMUB 2FYUH 1IDSA 3JAKA 3OEHG 4J7JA 5LHGA 4B3RB 4U3JA 1IBMO 2UUBB 4RQEA 2EIKC 4JI0B 3G80A 1XNRB 1TUBA 2OCHA 4MVUA 3RN4A 5GONB 1HNZB 3BHPA 2E74B 1R3KC 5B1AB 3AK3A 1EBOA 1BT8A 4QE7A 1K4DC 5J2TB 4U3FH 1SQGA 1ZUQA 2VQFB 1E1RG 4IYIA 2W6JG 2ZNIA 4B3TO 4F6RB 3JSLA 1R3IC 3CJHA 1XREA 4K0KO 4NTWA 4E4EA 5LP6A 5EBMC 1FXKB 4B3MO 4JI2O 3BPZA 4F4LA 4HBNA 2QR4A 5FL7G 2E76B 2B1IA 2W0XA 2QGNA 1VQLV 1XMQB 3DXRA 4Z2WA 4TV9A 3SJQC 3OFNG 3APOA 3CRMA 2UXDB 1H8HG 2JJ1G 2BTQA 2F23A 4GX2A 5B1OA 1ORQC 1F4NA 1YTFD 1KKDA 2R9RB 3E8FA 1IBLB 2AHYA 3S3XA 1F7YA 1NZ6A 4DV2B 4LFBB 4GZRB 1H2KA 4CS2A 2N05A 4WFGA 3CRAA 3GB7C 4BWAA 3CMAV 4X88A 4J7ZA 1R1BA 1Q81W 4LF6O 2YXLA 3UKMA 1VQ5V 2Q7GA 4EEQA 1R3JC 4DV7B 3E8GA 1TVKB 3FB8C 1SC5B 4WF9V 4N23A 4GX5A 2Q69A 2A06H 4TUYA 1L0LH 1QCEA 4UV8A 1K97A 5L3BA 1AP6A 3JALA 4X1IA 3KG2A 4I5SA 2EIMC 3A0RA 3RWRD 4FMTA 1XEQA 3RYHB 3KCYA 4FFBA 4DV7O 3LSQA 1SESA 1Q6UA 5H6QA 5JCOC 3CYOA 2OIGA 4O4HA 2M7WA 3JAKB 4PELA 1VQ7V 3RVZA 4MVOA 4QE9A 1OCCB 4LH7A 3WFVA 4HZ3A 2RDCA 5B1AC 2RJZA 2QM7A 4I9QA 3G4SV 3HPLC 4DV2O 1WP8A 2BSKB 5KMGA 1IBLO 1SERA 3AG7A 4LFBO 3BVOA 4X65B 3OR7C 3VOUA 5CB4B 3MDSA 1MNGA 4ZI7A 3JAWA 2Z3YA 1M57C 3DSQA 1FKAO 3E22A 4ABMA 5JQGA 2IW5A 3GWKC 5LGTA 4LF6B 3OM3B 3JARA 1W0JG 4O2AA 4UV9A 3RYIB 3T1YO 1RFYA 1I5YA 1QR9A 4B3MB 3K5OA 4P2ZA 3N2KB 3UM7A 3I5DA 2CTRA 2XAJA 4LF8O 4LFAB 3LDDA 3OW2U 3FAVB 1Q8IA 3Q4HB 1Y76B 1W59A 4NR1A 4B3TB 2P4KA 1YITV 2MW2B 3TK1A 3ZMVA 3WB2A 2B1GA 4RQFA 1YHQV 2GUZA 4FZ1A 3HKCB 4J10A 4X66B 4YY3B 2ZDIA 4ZHQA 2BOBC 3GWOA 3ABKB 4KL1A 1QU7A 1XDCA 4DR1O 4DR3O 4X20B 1MZFA 4JV5B 5LHHA 2AW9A 1BL8A 1VQ4V 3ABLC 3N2GB 2WLIB 1M9NA 3CSXA 4CC6A 4DR4O 1GO3F 4JAUA 3K04A 1WLEA 5IJ0A 4PI2A 1JVMA 2HJFC 5GW7A 3FFQA 1I94O 5LOVA 3KCXA 4LWSB 2QWQB 2XAGA 4DV3O 3CPWU 4LWSA 3OUSA 3CRCA 4O4JA 4O4IA 2LJ2A 4YJ3B 1NTZH 1IX9A 5KAIZ 1VIBA 4JI0O 3ZHQA 3SR2C 1LNQA 4EB6B 1Y67A 2OTJV 2GUZB 2ZNJA 1P84F 1N4CA 1URFA 2VRZA 3ZS8C 1WB7A 1YXBA 5HFLA 3K9SA 2ITDC 4CBCA 4LF9O 1O9HA 3K5NA 5LA6B 5EIBD 5L3FA 5CMUA 1P4RA 3T1HB 1VQMV 5IY5B 2KKWA 2ZDIC 2GTAA 3FX7A 3OUFA 1Z5WA 3AG1B 2AXTZ 3OTOO 1EN4A 2EJ7A 4NXMO 5J9PC 3ASOB 1FXKC 2ZE7A 4ASUG 4DRXA 4IT5A 1Y4MA 5JVDB 5BMVA 3LDCA 1XHZA 3LSUA 4B3SB 1SF9A 3OEEG 2EULA 1F4MA 1NR1A 3CCEV 2Q68A 1GKFA 3B09A 3HKEB 1RM1C 3JASA 1NBMG 2QWOB 3VQYA 2R72A 1XHXA 1ZL8B 2QM4A 2WSSG 4QJFB 1V55C 2F4VO 5BR8O 5KHGA 4UXNA 4DR3B 5GTHZ 2BTQB 1FAFA 1UJWB 3L72H 1Y6XA 4FLXA 5CBFA 4FM0A 3SJBC 4JTCB 1I94B 5BXZA 4B7KA 5EC2C 1KC8W 1GMGA 1FYJA 2WLHA 4FFBB 1YTFB 3ASNB 4I7ZB 4L87A 2PF4E 3ZRWA 4GLXA 3CXCU 3ABKC 3ZX6A 4KUMA 3H1JH 3FAVA 1I0HA 4LF8B 4ZBMA 3CEIA 1PV0A 2ZR2A 4IHJB 1IVSA 1BQZA 1DK1A 3CXHF 1VQKV 3EVKA 3ABMB 2UXBB 2UXBO 4YY3O 4ZKIA 5LP6C 1XL6A 3CRRA 4GKKO 2UU9O 2ARHA 1GM9A 3D3IA 2NN4A 2LGWA 1VQNV 1PP9H 3SYOA 2EZOA 1TVKA 1FFTB 2B5UA 1EN5A 2DWDC 2QKCA 1XILA 1VF5B 3CCQV 5KX5A 1CEZA 1EZJA 1B06A 2FKXA 4F6EA 3CRQA 1SQBH 1XI1A 1H2NA 1A32A 2Q4PA 4X1IB 1JJOA 3L73H 4UCVA 4JI6B 3T2MA 3CCMV 4DR2B 4TWKA 3K08A 3ZN0A 3SYQA 2IM9A 3ZJZA 3FB5C 4O2BA 4JF3A 1Q7YW 4JTAB 1M57B 3I56V 2O57A 1PPJH 3O65A 5IJ9B 1SA0A 3RYCA 1NTKH 2GV9A 4PDRA 1TUBB 1MZEA 1NR7A 2K9PA 4FLZA 3RFRA 4ZIBA 3RYFB 1X59A 4X8AA 1YZBA 2EILC 2Q5ZA 2HG5C 4E2LA 1VP7A 4FLVA 3LUTB 2DYRC 1BQ0A 4GCZA 4JYYA 4TV8A 3QF7A 2WA4A 4CC5A 2IU0A 2LQTA 1VEWA 2KQXA 3HKBB 1AI7A 1VQ6V 2GHYA 2GDSA 3DC5A 3GVMA 2X6BA 2EINB 4I50B 3N2GA 1NVPD 3RGBA 2Y69B 4FM2A 1MABG 2JK5C 3QG5A 1MSWD 5KHKA 2DOSA 4DR2O 4LF5O 3OMNB 1ZSPA 1TGOA 4FZ0A 2YXHA 4DV3B 2QTOA 3ETQA 1GN4A 4KFMA 4NVPA 4Q20A 4I0XA 4H0LB 1H2LA 2IJIA 5CA0A 2ADPA 3A0HZ 4J41A 1T5EA 5L3DA 3DGEA 5L3GA 3L70H 3SYCA 1BMFG 3U0ZA 4QGPA 3RW0A 1THZA 2HEPA 3HKEA 1OCOB 4I4TB 4DW0A 3M8AA 1HNZO 3JSNA 4ZI7B 2WA3A 1NI8A 2F95B 1N0NA 1NT2B 3JATB 2YIBD 2LW7A 2UUBO 4ZOLA 3ASNC 4JI2B 1FJGB 2JGDA 1YF2A 2W0FC 4UB8Z 3SPCA 4WFFA 5TISZ 4I55A 2OWOA 3WB1A 1P7BA 4TSFG 1HR0O 1I08A 1S5LZ 3AG4C 3TCUA 4TT3G 2N74A 1WB8A 4GX0A 5LA6A 1RM1B 5KAFZ 2XAHA 3EFFK 4X1KB 2EILB 4K35A 3NXSA 2DYRB 1E79G 4JI3O 2EIKB 1K92A 1FPOA 2AZ0A 2QKSA 5EZYB 1K4CC 5LMUO 4PA9A 2EIJC 4J7KA 1K7DA 1YEWA 2EIJB 2Y69C 4O4LB 5KHJA 1K3EA 2ZKOA 2XHBA 4MW8A 2Q0OC 2YEVB 2DMXA 4MTFA 3BRCA 3BY6A 5KHHA 5IWAB 2WLIA 1WPXA 2QM8A 1L8DA 4LF7O 2YI8A 1AI4A 1MOFA 2NNUA 1Q86W 1G6UA 1KQSU 1VF7A 2HVJC 4IL6Z 4JI1O 1D5NA 2ZR3A 1BCCH 5LXTA 2HFEC 4GX1A 3K5MA 4UFZA 2Z5UA 5HFMA 2P5OA 1RPOA 4GKJO 1AVMA 2HLDG 2FB5A 4LF4O 4J42A 3CWBH 2KSDA 1ENVA 5B3SB 4HAMA 2Y4TA 4FLTA 3K57A 3IC7A 2ZD9A 5L3CA 2QWRB 4TOIA 1AJNA 5LMNO 4D6TH 5JH7B 2IBZH 1KU9A 1DGSA 4AI8A 2PYJA 4DR5B 4KP4A 3VQWA 2X0LA 5CA1B 3W7SA 3JAWB 4X89A 1Q6IA 1R6NA 1RPRA 1QNMA 1D2DA 3ZN1A 5IYCO 2E5LB 2V7QG 2UXDO 3FB7C 4LC1A 2BSKA 1MMMA 4UVCA 3E86A 2GBOA 4MVSA 4DV6O 3P3PA 3R66A 4HYOA 4UCTA 3HR0A 4WCEV 3J80N 1V54B 4H33A 4FLWA 1YDXA 2HVKC 1G4YB 3CMEV 4X64B 4X64O 2UU9B 1M56C 2YUAA 2RQ6A 2LFSA 2VWJA 4WBNA 3OT7A 3JD1A 2QEXV 2R70A 3TJTA 3IAYA 1U96A 1UFIA 5H9CA 3T1YB 4UCOA 3ETEA 2VWKA 1NKDA 1TUEB 4YIOA 1KB9F 2HP8A 1F51A 2EBOA 4IHJA 3SPIA 1DLBA 3T4DA 2OT5A 4YHHO 4MTOA 5KUKA 2RCVA 1UPGA 2JDIG 4AQYO 1R6KA 3FD9A 4DR5O 2CGOA 2ODMA 1IXBA 4JGSA 4X62O 2UUAO 3EXAA 4JI1B 5JJJB 4TUYB 3SPJA 4FPPA 4JI5O 2NLJC 4PD4F 1BGYH 4TQFA 1NVPB 1HW7A 4PDVA 3K3WA 4FIPC 3CCVV 1JX9A 2KG7B 3QO5A 1FXHA 1AJQA 1N8RW 2CE4A 1KP2A 1WN7A 2KB1A 3ZRXA 4D7SA 2PI4A 5IYBO 4DUZB 2UXCB 2EX3A 5CB4A 1ZX3A 1N32O 1XMOO 2DE0X 5IY5C 4DK0A 5E1AC 4MW3A 3BCCH 2CTPA 3M99B 3UT5B 4DV0O 1K5SA 3X2QC 1XOUA 3ZMSA 5H5NA 3BA8A 5B1NA 5DM6V 3RT3C 2PUSA 1YIJV 4DR6O 4OX9O 4U7NA 3ZMZA 1MG1A 3OGCC 1MA1A 3LDEA 4W4LA 4WFBV 3C3TA 2X6CA 2YEVA 3BA9A 3LNNA 1B6QA 3ABMC 4LF9B 2LGQA 4K3AA 2IH1C 2FL4A 1QVFU 4DUYO 1SQQH 4QNHB 1FJGO 5JJEB 5EK0A 1XL4A 4UCRA 1P7GA 4PA4A 3SGIA 5EIBC 1WNSA 3SJCC 3VBBA 4DW1A 3ABTA 4JI8B 5KHIA 2P6JA 1AI5A 1AR1B 1XMQO 2P22C 3ZRSA 3E8BA 1KKCA 2GTSA 5KA6A 2WLKA 2R9AA 3ZIAG 3CCLV 1KBHA 4DRXB 1YJWV 5EBWC 4P9PA 2Q7EA 3RBZA 1VMGA 5IYZA 4DXWA 1BHAA 1FXVA 4NXNB 4G2KA 3ZCCA 4FK5C 3IC9A 4DR1B 1YVWA 2ZIOA 1GTOA 2Y48A 2X7RB 1ZL8A 2YI9A 2Y0PA 4N21A 5FPOA 1N36O 1V55B 1S5HC 4I9WA 4R6ZA 5D5QA 4B3RO 4CS3A 1W0KG 2CK3G 5F2VO 1OCZC 1S0VA 1PL0A 2IJKA 3CD6V 1B04A 1OCOC 2IJJA 1XNQO 2PY5A 3CJHB 1S5JA 2DW4A 3H1KH 4X1YA 1Y76A 5K1PA 4MSWC 5B66Z 2W6IG 4X1YB 3SDLA 3NR7A 4PDMA 3ABLB 4OGQB 3JCUZ 2WLLB 1GK9A 5IYZB 3OR6C 3S3WA 4YIPA 1KP3A 2EZPA 3WG7B 3JYCA 4X65O 4DV0B 1QLEC 3HKDA 4PA7A 3K5LA 5E79Z 3E89A 4LCUC 1D5AA 4U3JB 3D36A 5JQGB 4YXWG 4O4JB 4O4IB 1N32B 3IJ4A 5L3EA 3OTFA 5IYDO 4WFAV 4FJCC 2E75B 4IIJA 2KG7A 3K0DA 4JTDB 3Q4HA 1AB3A 3K58A 3ABUA 4O4HB 3RYFA 3N2KA 3D3QA 4XDKA 4O4LA 1OCCC 4AILC 1MSDA 2DQ0A 2DYSC 2CH7A 5BZBA 5AG2A 5ITZA 4PA3A 3K06A 3BABA 4MVZA 3JARB 4O2AB 1SQXH 4I4TA 1YI2V 4X62B 3L71H 1AILA 2ZM6O 3APQA 4O2BB 4MTXA 5H2FZ 3ZEDA 4JPRA 3F5WC 1SQFA 4LBEC 4JYBA 3QVNA 1AP5A 3RVYA 4MT8A 2HJDA 3CHXA 1R73A 3I55V 3C90A 1W2BU 1H2MA 1HDJA 2F43G 3MAQA 4WBNB 1ZLZA 3MD0A 4RUEA 1Y74B 2B9ZA 1EFRG 2PGGA 2ZQMA 4FM1A 4J11A 1K5QA 4L8JA 4NXNO 2ETNA 1HR0B 1IXMA 1AR5A 1JCHA 3KZIZ 5EYPA 3HKBA 4DV5B 1EZVH 2XAQA 3ETDA 4BIOA 3UT5A 4MVQA 3E22B 3G6EV 1HNXB 3JALB 4K0KB 5CBGA 3H1LH 4EFBA 3HB3B 2N04A 2UUCO 4FLUA 3K03A 4J80A 4Q6GA 4JI8O 1PNKA 5J2UB 1V9PA 4RO2A 5CA0B 2CGNA 2HHHO 3ZHUA 1EM1A 1DTOA 1AROP 2A7WA 5BR8B 1LR1A 2A3QA 3CC7V 3JD4A 1FD9A 5IE9A 4X9QA 2FTKA 2Y0IA 4CS4A 1S3JA 4IYHA 2YIDA 2BE3A 3ZHTA 1RSOB 2Q6AA 2VQEB 1S76D 3P3NA 4I0XB 1GM7A 1X4TA 3CP1A 3L9DA 3RYIA 1ZAUA 3UCSC 2RNBA 5GONA 2Q9LA 5KUMA 3H1IH 2BTOA 3ZBHA 2F4VB 4JAVA 1O9GA 2ATKC 3CCJV 3CC2V 4LF5B 2ZINA 1WP7A 1VQOV 4JYAO 2QSAA 2VS0A 4WFEA 3A2FA 1QR8A 3B2EE 3C3SA 4KXRA 3T1HO 2HKOA 2Y4UA 2F66C 3JAMN 3A8TA 4D7TA 1XUQA 1K33A 2YXYA 4XDJA 4JYAB 1N34O 1N0JA 1JA8A 5IWAO 4TV9B 2FMLA 5LHIA 2Q67A 3H01A 4F6RA 2ZIMA 1IZ3A 2E3CA 3ZHSA 4GYCB 3F5TA 2H3OA 3D36C 4DYLA 1H2GA 3ZMUA 5ITZB 1YJNV 1PNMA 2XOKG 3BAAA 2P90A 4R8CA 1WAZA 4JI7B 4BIUA 1JPXA 4CH5A 3AG3C 2OYQA 1GRJA 1OHHG 5GTIZ 1XMOB 2QDOA 4GUNA 2QJ1A 3DXRB 1VQPV 2UUAB 4JI4B 4JI3B 3AG2B 3H1HH 5CN0A 5B5EZ 2JS3A 2D3OW 5FNVB 3WU2Z 2CH7B 2AZ2A 2XASA 1WJZA 4A5UB 4X1KA 2DN9A 2ZCEA 4IGGA 2P67A 2OCCC 1DF4A 3OMAB 2WLLA 2Q8VA 1HNXO 3CE2A 4CZZA 3UO2A 2VQEO 4DR4B 3TXQA 3W7UA 3MHHC 2K1EA 3ML0A 3OD4A 1TAEA 4FFKA 2JEXA 1YJ9V 3BEHA 1GN2A 1SZXA 4GKKB 4UCSA 4JV5O 3F7VC 1RP3B 2WLJA 1S77D 1QQCA 1US6A 2XT9A 3HKCA 4FLYA 3N27A 1JJ2U 3CCUV 2F93B 3OMIB 4U7OA 1M90W 5DECA 1V54C 3F7YC 3CCRV 3ZMTA 4UVBA 5K1XA 5B1BB 4DV5O 1OJHA 1AR4A 1M56B 1OV9A 1SZTA 5H6RA 3SYPA 2QE7G 4DV4O 2BCCH 2QKAA 4J9ZB 2IH3C 5KLVH 1VQ8V 5JH7A 4Z1VA 5LGUA 5LYJA 3W7WA 4PV1B 2OIEA 1KYOF 1K34A 2QTSA 4QIWF 3MHSC 4JZGA 2OTLV 5LXTB 1K73W 4J9YB 1K9MW 1KD1W 1IBKO 1R6TA 1YSCA 2HR3A 1HWYA 2EJRA 1M1KW 2CTWA 3ZHRA 3AG4B 2DJVA 3AG3B 3SJAC 3TXSA 1KECA 1JR9A 2BOCC 4JI7O 1ZTEA 2Q0AA 4QPJA 1WA8A 4LF4B 2IJHA 2P06A 4EFEA 2QWNB 3O9OA 5CA3A 4LF7B 3JATA 1SKVA 1IURA 5FPRA 2JRIA 5EZYA 1XBLA 2CDYA 1SRYA 2JIZG 2WAMA 4RUFA 1BZKA 2JVDA 4I55B 1XNQB 1I7FA 1KMIZ 1FFXB 4LFCB 4PHZA 1PD3A 3LNMB 3RYHA 1N33O 1I5XA 2YIBA 3STLC 1CP9A 5LL6Y 4LR3A 4YJ2A 3FYEB 1BSMA 2M6YA 4BW9A 3WG7C 5C8YB 1OCRC 4TQDA 4OXSA 3BFRA 4HNAB 2PI5A 2Q73A 4LP8A 3L74H 4MTGA 4KHPO 1QBZA 5EYPB 4DK1A 5KX5B 1ZWIC 2ZE5A 2JEUA 4TV8B 3EHBB 3G67A 3G71V 3QO8A 3SPHA 1BHBA 2YC0A 1JQ0A 4DV1B 2MK3A 3ZRVA 1M4UA 1QVGU 2LFRA 1J5EB 2HHHB 5IDJA 1NH2B 3T1CA 3PN1A 4H44B 4DO2A 5D5PA 1G8MA 4B7EA 1PM9A 4WFHA 3IGAC 3WB0A 1Z5VA 2WLMA 3AG1C 5IJ9A 3E2EA 1VARA 1Y66A 2H94A 4JZ2A 1PL4A 4BIZA 1PKXA 3ASOC 5LYJB 4PA6A 3QO7A 1J5EO 3TGUH 4DUYB 5DN6G 2V1DA 2YICA 1NJIW 2NR5A 2YDEA 4KHPB 1FXKA 2C2AA 3ZHVA 1Q3EA 3CS5A 4NB5A 5CBHA 2F1MA 3T4ZA 1RSOA 4OPHA 3AK2A 3B4SA 2JS5A 1Q82W 3M7MX 3DTUB 4FVMA 5BY1A 3VQVA 4NYKA 1XNRO 3OGIB 3SYAA 3JD0A 5A2QN 2A9HA 4I50A 4H13B 3UO3A 4DV1O 3AG2C 4K8XA 2ZXWB 2A79B 3JCZA 4Z1MG 1B3QA 1SQPH 2Q7HA 4R7CA 3K0GA 4JASA 3CCSV 1M5IA 1LUWA 2LO1A 5BMVB 4LFCO 2RMKB 1QHTA 2ZM6B 3HKDB 3K9AA 3IFXA 2PZSA 2YIAA 3AEIA 1NTMH 4CH6A 2XUMA 1BS3A 1VF6A 2CAZC 5KMGB 2ZE6A 2ADQB 1GN6A 3SPGA 4NTYA 1ROPA 3D8CA 3JD2A 4MVMA 2H8PC 4DR6B 1M93A 2G38A 1COWG 3TETA 1CPYA 1S72V 4NTXA 3K59A 5IT9N 3OTOB 3U11A 5A9GA 4YJ2B 5JJNB 1P49A 2R9IA 4EKWA 2XAFA 5JCOA 3UQ8A 3A0BZ 3J81N 1Y74A 3J7AU 1N33B 1K8AW 5C8YA 1FFXA 2QWPB 4LNUB 5J2TA 1HNWO 1JFFA 1GM8A 1NS1A 1CXZB 4PDLA 3B8NA 4XDLA 2A0LA 1SA0B 2JGUA 5EBLC 3P32A 3RYCB 4YHHB 5J2UA 5B1BC 3FKSG 5C93A 3AK1A 1OCZB 4JI6O 2CUGA 4EB6A 3JD3A 4DUZO 3E83A 2ITCC 4P9OA 1NQTA 4BW5A 4CH4A 1HP8A 1H8EG 2L35A 4HNAA 2AHZA 3FYIB 1KUQA 2Z0AA 5KA5A 1BE3H 4QPKA 3ZRWB 2QA4V 4JI5B 3E8HA 3X2QB 4AQYB 5JVDA 4DR7B 1VF6C 1Q5OA 3DC6A 3FB6C 1Q6HA 2L6LA 1IBKB 1EN6A 2LP7A 3B77A 1H38A 1AI6A 2AGAA 2UXXA 2YSUB 1E1QG 1L1FA 1QLEB 4W4KA 4CH3A 4P30A 1VQ9V 1N36B 4X20A 2LW1A 2D2CB 4UB6Z
chains in the Genus database with same CATH topology
2UXDO 3JAMN 4LF9O 4X66O 2DOSA 4DV0O 4B3RO 4OPAA 2E5LO 4DR2O 4LF5O 4LFCO 4DV6O 3T1YO 4DV5O 5LMUO 4GKKO 1F7YA 2UU9O 5H5NA 2UXCO 3R66A 3OTOO 1N34O 4DV4O 3J80N 1G1XB 3RT3C 4NXMO 5IWAO 4NXNO 2ZKOA 4DR6O 4LFAO 4OX9O 1XNQO 4X64O 4KHPO 4DR7O 1R1BA 4LF8O 2FKXA 3F5TA 4LF6O 3SDLA 4LF7O 5IT9N 1A32A 2VQFO 4DUYO 2UUCO 4X65O 3J81N 3J7AU 1FJGO 1IBMO 4JI1O 4JI8O 2F4VO 5BR8O 4YHHO 1HNWO 1IBKO 1R6TA 3O65A 1NS1A 3M8AA 4DR1O 4DR3O 1HNZO 4AQYO 2HHHO 1XMQO 5FLXN 2DJVA 4DR5O 1XEQA 4JI4O 4X62O 4JI6O 2UUAO 2LW7A 4DUZO 4A5UB 2UUBO 4DR4O 4GKJO 4JI7O 1AB3A 4DV7O 1J5EO 4B3TO 4JI5O 5BXZA 4LF4O 1X59A 1FYJA 1I94O 4K0KO 1YZBA 1HNXO 2VQEO 1KUQA 2Z0AA 4DV3O 1HR0O 4B3SO 2JRIA 4B3MO 4OPHA 5LMNO 4JI2O 4DV2O 2N74A 1AILA 5BY1A 2ZM6O 1XNRO 4JV5O 1IBLO 4JI0O 2AGAA 1DK1A 4LFBO 1N33O 5A2QN 4JYAO 1XMOO 1N32O 4JI3O 4DV1O 1D2DA 5LL6Y 1N36O 3T1HO 2UXBO 4YY3O 1FKAO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXD O;  3JAM N;  4LF9 O;  4X66 O;  2DOS A;  4DV0 O;  4B3R O;  4OPA A;  2E5L O;  4DR2 O;  4LF5 O;  4LFC O;  4DV6 O;  3T1Y O;  4DV5 O;  5LMU O;  4GKK O;  1F7Y A;  2UU9 O;  5H5N A;  2UXC O;  3R66 A;  3OTO O;  1N34 O;  4DV4 O;  3J80 N;  1G1X B;  3RT3 C;  4NXM O;  5IWA O;  4NXN O;  2ZKO A;  4DR6 O;  4LFA O;  4OX9 O;  1XNQ O;  4X64 O;  4KHP O;  4DR7 O;  1R1B A;  4LF8 O;  2FKX A;  3F5T A;  4LF6 O;  3SDL A;  4LF7 O;  5IT9 N;  1A32 A;  2VQF O;  4DUY O;  2UUC O;  4X65 O;  3J81 N;  3J7A U;  1FJG O;  1IBM O;  4JI1 O;  4JI8 O;  2F4V O;  5BR8 O;  4YHH O;  1HNW O;  1IBK O;  1R6T A;  3O65 A;  1NS1 A;  3M8A A;  4DR1 O;  4DR3 O;  1HNZ O;  4AQY O;  2HHH O;  1XMQ O;  5FLX N;  2DJV A;  4DR5 O;  1XEQ A;  4JI4 O;  4X62 O;  4JI6 O;  2UUA O;  2LW7 A;  4DUZ O;  4A5U B;  2UUB O;  4DR4 O;  4GKJ O;  4JI7 O;  1AB3 A;  4DV7 O;  1J5E O;  4B3T O;  4JI5 O;  5BXZ A;  4LF4 O;  1X59 A;  1FYJ A;  1I94 O;  4K0K O;  1YZB A;  1HNX O;  2VQE O;  1KUQ A;  2Z0A A;  4DV3 O;  1HR0 O;  4B3S O;  2JRI A;  4B3M O;  4OPH A;  5LMN O;  4JI2 O;  4DV2 O;  2N74 A;  1AIL A;  5BY1 A;  2ZM6 O;  1XNR O;  4JV5 O;  1IBL O;  4JI0 O;  2AGA A;  1DK1 A;  4LFB O;  1N33 O;  5A2Q N;  4JYA O;  1XMO O;  1N32 O;  4JI3 O;  4DV1 O;  1D2D A;  5LL6 Y;  1N36 O;  3T1H O;  2UXB O;  4YY3 O;  1FKA O; 
#chains in the Genus database with same CATH topology
 3E35 A;  3KKY A;  4X66 O;  2UUC B;  3B8M A;  2E5L O;  1Q43 A;  3JAS B;  2IU3 A;  2DQ3 A;  1SS3 A;  5LP6 B;  1QLN A;  1YCI A;  1JOY A;  2DWE C;  1R3L C;  5CA1 A;  4LFA O;  4DV4 B;  1AJP A;  3K79 A;  2P4V A;  5DED A;  5EC1 C;  3QTC A;  4DR7 O;  3ICX A;  5LMN B;  3CX5 F;  3VQX A;  4JYC A;  4IIJ B;  4NKG B;  2OCC B;  2EIN C;  4RAI A;  4PJ0 Z;  1LUV A;  2VQF O;  4DV6 B;  1L0N H;  2XND G;  4UVA A;  4UUJ C;  4GKJ B;  2ILM A;  4H37 A;  2UXN A;  3PJS K;  4GT1 A;  4BAY A;  4K8Z A;  1OCR B;  2X6A A;  2WLN A;  1IBM B;  3OAA G;  1J95 A;  5FLX N;  1HNW B;  4ICG A;  1WPB A;  4JI4 O;  1Q90 D;  1GH6 A;  1U97 A;  3STZ C;  4BR6 A;  3P30 A;  2P7T C;  5LBQ A;  4UCU A;  1H2S B;  4JAA A;  4C7U A;  2EIM B;  4G28 B;  2JGD B;  4MVR A;  3U10 A;  3THO A;  2V4D A;  1GN3 A;  1TA8 A;  4OX9 B;  1F23 A;  4B3S O;  5FNV A;  4R50 A;  1XQ8 A;  1FS0 G;  2CTQ A;  4PI0 A;  1SET A;  3CB2 A;  1N34 B;  5IJ0 B;  1DF5 A;  2DYS B;  1NU1 H;  2WPD G;  2ZE8 A;  2ZXW C;  3ETG A;  4ZHQ B;  3G6B A;  3OE7 G;  3W7T A;  3CC4 V;  4RWU A;  4ZOL B;  4NXM B;  3QNE A;  5B3S C;  4G27 B;  4XBF A;  2XTA A;  1NH2 D;  4AHC A;  3H9V A;  4YJ3 A;  1JFF B;  2JJ2 G;  1PNL A;  2PYL A;  3L75 H;  4OPA A;  4LH6 A;  1Z2G A;  4LNU A;  1OZ0 A;  2UXC O;  5JWP A;  2PTM A;  1G1X B;  1GAX A;  5LOV B;  3R65 A;  2RN9 A;  3LSS A;  1WA8 B;  2ZT9 B;  3B40 A;  2YS8 A;  1SQV H;  5LGN A;  4MS2 A;  1JMK C;  3W7X A;  2GSM B;  4B08 A;  2WWW A;  5LMU B;  2FYU H;  1IDS A;  3JAK A;  3OEH G;  4J7J A;  5LHG A;  4B3R B;  4U3J A;  1IBM O;  2UUB B;  4RQE A;  2EIK C;  4JI0 B;  3G80 A;  1XNR B;  1TUB A;  2OCH A;  4MVU A;  3RN4 A;  5GON B;  1HNZ B;  3BHP A;  2E74 B;  1R3K C;  5B1A B;  3AK3 A;  1EBO A;  1BT8 A;  4QE7 A;  1K4D C;  5J2T B;  4U3F H;  1SQG A;  1ZUQ A;  2VQF B;  1E1R G;  4IYI A;  2W6J G;  2ZNI A;  4B3T O;  4F6R B;  3JSL A;  1R3I C;  3CJH A;  1XRE A;  4K0K O;  4NTW A;  4E4E A;  5LP6 A;  5EBM C;  1FXK B;  4B3M O;  4JI2 O;  3BPZ A;  4F4L A;  4HBN A;  2QR4 A;  5FL7 G;  2E76 B;  2B1I A;  2W0X A;  2QGN A;  1VQL V;  1XMQ B;  3DXR A;  4Z2W A;  4TV9 A;  3SJQ C;  3OFN G;  3APO A;  3CRM A;  2UXD B;  1H8H G;  2JJ1 G;  2BTQ A;  2F23 A;  4GX2 A;  5B1O A;  1ORQ C;  1F4N A;  1YTF D;  1KKD A;  2R9R B;  3E8F A;  1IBL B;  2AHY A;  3S3X A;  1F7Y A;  1NZ6 A;  4DV2 B;  4LFB B;  4GZR B;  1H2K A;  4CS2 A;  2N05 A;  4WFG A;  3CRA A;  3GB7 C;  4BWA A;  3CMA V;  4X88 A;  4J7Z A;  1R1B A;  1Q81 W;  4LF6 O;  2YXL A;  3UKM A;  1VQ5 V;  2Q7G A;  4EEQ A;  1R3J C;  4DV7 B;  3E8G A;  1TVK B;  3FB8 C;  1SC5 B;  4WF9 V;  4N23 A;  4GX5 A;  2Q69 A;  2A06 H;  4TUY A;  1L0L H;  1QCE A;  4UV8 A;  1K97 A;  5L3B A;  1AP6 A;  3JAL A;  4X1I A;  3KG2 A;  4I5S A;  2EIM C;  3A0R A;  3RWR D;  4FMT A;  1XEQ A;  3RYH B;  3KCY A;  4FFB A;  4DV7 O;  3LSQ A;  1SES A;  1Q6U A;  5H6Q A;  5JCO C;  3CYO A;  2OIG A;  4O4H A;  2M7W A;  3JAK B;  4PEL A;  1VQ7 V;  3RVZ A;  4MVO A;  4QE9 A;  1OCC B;  4LH7 A;  3WFV A;  4HZ3 A;  2RDC A;  5B1A C;  2RJZ A;  2QM7 A;  4I9Q A;  3G4S V;  3HPL C;  4DV2 O;  1WP8 A;  2BSK B;  5KMG A;  1IBL O;  1SER A;  3AG7 A;  4LFB O;  3BVO A;  4X65 B;  3OR7 C;  3VOU A;  5CB4 B;  3MDS A;  1MNG A;  4ZI7 A;  3JAW A;  2Z3Y A;  1M57 C;  3DSQ A;  1FKA O;  3E22 A;  4ABM A;  5JQG A;  2IW5 A;  3GWK C;  5LGT A;  4LF6 B;  3OM3 B;  3JAR A;  1W0J G;  4O2A A;  4UV9 A;  3RYI B;  3T1Y O;  1RFY A;  1I5Y A;  1QR9 A;  4B3M B;  3K5O A;  4P2Z A;  3N2K B;  3UM7 A;  3I5D A;  2CTR A;  2XAJ A;  4LF8 O;  4LFA B;  3LDD A;  3OW2 U;  3FAV B;  1Q8I A;  3Q4H B;  1Y76 B;  1W59 A;  4NR1 A;  4B3T B;  2P4K A;  1YIT V;  2MW2 B;  3TK1 A;  3ZMV A;  3WB2 A;  2B1G A;  4RQF A;  1YHQ V;  2GUZ A;  4FZ1 A;  3HKC B;  4J10 A;  4X66 B;  4YY3 B;  2ZDI A;  4ZHQ A;  2BOB C;  3GWO A;  3ABK B;  4KL1 A;  1QU7 A;  1XDC A;  4DR1 O;  4DR3 O;  4X20 B;  1MZF A;  4JV5 B;  5LHH A;  2AW9 A;  1BL8 A;  1VQ4 V;  3ABL C;  3N2G B;  2WLI B;  1M9N A;  3CSX A;  4CC6 A;  4DR4 O;  1GO3 F;  4JAU A;  3K04 A;  1WLE A;  5IJ0 A;  4PI2 A;  1JVM A;  2HJF C;  5GW7 A;  3FFQ A;  1I94 O;  5LOV A;  3KCX A;  4LWS B;  2QWQ B;  2XAG A;  4DV3 O;  3CPW U;  4LWS A;  3OUS A;  3CRC A;  4O4J A;  4O4I A;  2LJ2 A;  4YJ3 B;  1NTZ H;  1IX9 A;  5KAI Z;  1VIB A;  4JI0 O;  3ZHQ A;  3SR2 C;  1LNQ A;  4EB6 B;  1Y67 A;  2OTJ V;  2GUZ B;  2ZNJ A;  1P84 F;  1N4C A;  1URF A;  2VRZ A;  3ZS8 C;  1WB7 A;  1YXB A;  5HFL A;  3K9S A;  2ITD C;  4CBC A;  4LF9 O;  1O9H A;  3K5N A;  5LA6 B;  5EIB D;  5L3F A;  5CMU A;  1P4R A;  3T1H B;  1VQM V;  5IY5 B;  2KKW A;  2ZDI C;  2GTA A;  3FX7 A;  3OUF A;  1Z5W A;  3AG1 B;  2AXT Z;  3OTO O;  1EN4 A;  2EJ7 A;  4NXM O;  5J9P C;  3ASO B;  1FXK C;  2ZE7 A;  4ASU G;  4DRX A;  4IT5 A;  1Y4M A;  5JVD B;  5BMV A;  3LDC A;  1XHZ A;  3LSU A;  4B3S B;  1SF9 A;  3OEE G;  2EUL A;  1F4M A;  1NR1 A;  3CCE V;  2Q68 A;  1GKF A;  3B09 A;  3HKE B;  1RM1 C;  3JAS A;  1NBM G;  2QWO B;  3VQY A;  2R72 A;  1XHX A;  1ZL8 B;  2QM4 A;  2WSS G;  4QJF B;  1V55 C;  2F4V O;  5BR8 O;  5KHG A;  4UXN A;  4DR3 B;  5GTH Z;  2BTQ B;  1FAF A;  1UJW B;  3L72 H;  1Y6X A;  4FLX A;  5CBF A;  4FM0 A;  3SJB C;  4JTC B;  1I94 B;  5BXZ A;  4B7K A;  5EC2 C;  1KC8 W;  1GMG A;  1FYJ A;  2WLH A;  4FFB B;  1YTF B;  3ASN B;  4I7Z B;  4L87 A;  2PF4 E;  3ZRW A;  4GLX A;  3CXC U;  3ABK C;  3ZX6 A;  4KUM A;  3H1J H;  3FAV A;  1I0H A;  4LF8 B;  4ZBM A;  3CEI A;  1PV0 A;  2ZR2 A;  4IHJ B;  1IVS A;  1BQZ A;  1DK1 A;  3CXH F;  1VQK V;  3EVK A;  3ABM B;  2UXB B;  2UXB O;  4YY3 O;  4ZKI A;  5LP6 C;  1XL6 A;  3CRR A;  4GKK O;  2UU9 O;  2ARH A;  1GM9 A;  3D3I A;  2NN4 A;  2LGW A;  1VQN V;  1PP9 H;  3SYO A;  2EZO A;  1TVK A;  1FFT B;  2B5U A;  1EN5 A;  2DWD C;  2QKC A;  1XIL A;  1VF5 B;  3CCQ V;  5KX5 A;  1CEZ A;  1EZJ A;  1B06 A;  2FKX A;  4F6E A;  3CRQ A;  1SQB H;  1XI1 A;  1H2N A;  1A32 A;  2Q4P A;  4X1I B;  1JJO A;  3L73 H;  4UCV A;  4JI6 B;  3T2M A;  3CCM V;  4DR2 B;  4TWK A;  3K08 A;  3ZN0 A;  3SYQ A;  2IM9 A;  3ZJZ A;  3FB5 C;  4O2B A;  4JF3 A;  1Q7Y W;  4JTA B;  1M57 B;  3I56 V;  2O57 A;  1PPJ H;  3O65 A;  5IJ9 B;  1SA0 A;  3RYC A;  1NTK H;  2GV9 A;  4PDR A;  1TUB B;  1MZE A;  1NR7 A;  2K9P A;  4FLZ A;  3RFR A;  4ZIB A;  3RYF B;  1X59 A;  4X8A A;  1YZB A;  2EIL C;  2Q5Z A;  2HG5 C;  4E2L A;  1VP7 A;  4FLV A;  3LUT B;  2DYR C;  1BQ0 A;  4GCZ A;  4JYY A;  4TV8 A;  3QF7 A;  2WA4 A;  4CC5 A;  2IU0 A;  2LQT A;  1VEW A;  2KQX A;  3HKB B;  1AI7 A;  1VQ6 V;  2GHY A;  2GDS A;  3DC5 A;  3GVM A;  2X6B A;  2EIN B;  4I50 B;  3N2G A;  1NVP D;  3RGB A;  2Y69 B;  4FM2 A;  1MAB G;  2JK5 C;  3QG5 A;  1MSW D;  5KHK A;  2DOS A;  4DR2 O;  4LF5 O;  3OMN B;  1ZSP A;  1TGO A;  4FZ0 A;  2YXH A;  4DV3 B;  2QTO A;  3ETQ A;  1GN4 A;  4KFM A;  4NVP A;  4Q20 A;  4I0X A;  4H0L B;  1H2L A;  2IJI A;  5CA0 A;  2ADP A;  3A0H Z;  4J41 A;  1T5E A;  5L3D A;  3DGE A;  5L3G A;  3L70 H;  3SYC A;  1BMF G;  3U0Z A;  4QGP A;  3RW0 A;  1THZ A;  2HEP A;  3HKE A;  1OCO B;  4I4T B;  4DW0 A;  3M8A A;  1HNZ O;  3JSN A;  4ZI7 B;  2WA3 A;  1NI8 A;  2F95 B;  1N0N A;  1NT2 B;  3JAT B;  2YIB D;  2LW7 A;  2UUB O;  4ZOL A;  3ASN C;  4JI2 B;  1FJG B;  2JGD A;  1YF2 A;  2W0F C;  4UB8 Z;  3SPC A;  4WFF A;  5TIS Z;  4I55 A;  2OWO A;  3WB1 A;  1P7B A;  4TSF G;  1HR0 O;  1I08 A;  1S5L Z;  3AG4 C;  3TCU A;  4TT3 G;  2N74 A;  1WB8 A;  4GX0 A;  5LA6 A;  1RM1 B;  5KAF Z;  2XAH A;  3EFF K;  4X1K B;  2EIL B;  4K35 A;  3NXS A;  2DYR B;  1E79 G;  4JI3 O;  2EIK B;  1K92 A;  1FPO A;  2AZ0 A;  2QKS A;  5EZY B;  1K4C C;  5LMU O;  4PA9 A;  2EIJ C;  4J7K A;  1K7D A;  1YEW A;  2EIJ B;  2Y69 C;  4O4L B;  5KHJ A;  1K3E A;  2ZKO A;  2XHB A;  4MW8 A;  2Q0O C;  2YEV B;  2DMX A;  4MTF A;  3BRC A;  3BY6 A;  5KHH A;  5IWA B;  2WLI A;  1WPX A;  2QM8 A;  1L8D A;  4LF7 O;  2YI8 A;  1AI4 A;  1MOF A;  2NNU A;  1Q86 W;  1G6U A;  1KQS U;  1VF7 A;  2HVJ C;  4IL6 Z;  4JI1 O;  1D5N A;  2ZR3 A;  1BCC H;  5LXT A;  2HFE C;  4GX1 A;  3K5M A;  4UFZ A;  2Z5U A;  5HFM A;  2P5O A;  1RPO A;  4GKJ O;  1AVM A;  2HLD G;  2FB5 A;  4LF4 O;  4J42 A;  3CWB H;  2KSD A;  1ENV A;  5B3S B;  4HAM A;  2Y4T A;  4FLT A;  3K57 A;  3IC7 A;  2ZD9 A;  5L3C A;  2QWR B;  4TOI A;  1AJN A;  5LMN O;  4D6T H;  5JH7 B;  2IBZ H;  1KU9 A;  1DGS A;  4AI8 A;  2PYJ A;  4DR5 B;  4KP4 A;  3VQW A;  2X0L A;  5CA1 B;  3W7S A;  3JAW B;  4X89 A;  1Q6I A;  1R6N A;  1RPR A;  1QNM A;  1D2D A;  3ZN1 A;  5IYC O;  2E5L B;  2V7Q G;  2UXD O;  3FB7 C;  4LC1 A;  2BSK A;  1MMM A;  4UVC A;  3E86 A;  2GBO A;  4MVS A;  4DV6 O;  3P3P A;  3R66 A;  4HYO A;  4UCT A;  3HR0 A;  4WCE V;  3J80 N;  1V54 B;  4H33 A;  4FLW A;  1YDX A;  2HVK C;  1G4Y B;  3CME V;  4X64 B;  4X64 O;  2UU9 B;  1M56 C;  2YUA A;  2RQ6 A;  2LFS A;  2VWJ A;  4WBN A;  3OT7 A;  3JD1 A;  2QEX V;  2R70 A;  3TJT A;  3IAY A;  1U96 A;  1UFI A;  5H9C A;  3T1Y B;  4UCO A;  3ETE A;  2VWK A;  1NKD A;  1TUE B;  4YIO A;  1KB9 F;  2HP8 A;  1F51 A;  2EBO A;  4IHJ A;  3SPI A;  1DLB A;  3T4D A;  2OT5 A;  4YHH O;  4MTO A;  5KUK A;  2RCV A;  1UPG A;  2JDI G;  4AQY O;  1R6K A;  3FD9 A;  4DR5 O;  2CGO A;  2ODM A;  1IXB A;  4JGS A;  4X62 O;  2UUA O;  3EXA A;  4JI1 B;  5JJJ B;  4TUY B;  3SPJ A;  4FPP A;  4JI5 O;  2NLJ C;  4PD4 F;  1BGY H;  4TQF A;  1NVP B;  1HW7 A;  4PDV A;  3K3W A;  4FIP C;  3CCV V;  1JX9 A;  2KG7 B;  3QO5 A;  1FXH A;  1AJQ A;  1N8R W;  2CE4 A;  1KP2 A;  1WN7 A;  2KB1 A;  3ZRX A;  4D7S A;  2PI4 A;  5IYB O;  4DUZ B;  2UXC B;  2EX3 A;  5CB4 A;  1ZX3 A;  1N32 O;  1XMO O;  2DE0 X;  5IY5 C;  4DK0 A;  5E1A C;  4MW3 A;  3BCC H;  2CTP A;  3M99 B;  3UT5 B;  4DV0 O;  1K5S A;  3X2Q C;  1XOU A;  3ZMS A;  5H5N A;  3BA8 A;  5B1N A;  5DM6 V;  3RT3 C;  2PUS A;  1YIJ V;  4DR6 O;  4OX9 O;  4U7N A;  3ZMZ A;  1MG1 A;  3OGC C;  1MA1 A;  3LDE A;  4W4L A;  4WFB V;  3C3T A;  2X6C A;  2YEV A;  3BA9 A;  3LNN A;  1B6Q A;  3ABM C;  4LF9 B;  2LGQ A;  4K3A A;  2IH1 C;  2FL4 A;  1QVF U;  4DUY O;  1SQQ H;  4QNH B;  1FJG O;  5JJE B;  5EK0 A;  1XL4 A;  4UCR A;  1P7G A;  4PA4 A;  3SGI A;  5EIB C;  1WNS A;  3SJC C;  3VBB A;  4DW1 A;  3ABT A;  4JI8 B;  5KHI A;  2P6J A;  1AI5 A;  1AR1 B;  1XMQ O;  2P22 C;  3ZRS A;  3E8B A;  1KKC A;  2GTS A;  5KA6 A;  2WLK A;  2R9A A;  3ZIA G;  3CCL V;  1KBH A;  4DRX B;  1YJW V;  5EBW C;  4P9P A;  2Q7E A;  3RBZ A;  1VMG A;  5IYZ A;  4DXW A;  1BHA A;  1FXV A;  4NXN B;  4G2K A;  3ZCC A;  4FK5 C;  3IC9 A;  4DR1 B;  1YVW A;  2ZIO A;  1GTO A;  2Y48 A;  2X7R B;  1ZL8 A;  2YI9 A;  2Y0P A;  4N21 A;  5FPO A;  1N36 O;  1V55 B;  1S5H C;  4I9W A;  4R6Z A;  5D5Q A;  4B3R O;  4CS3 A;  1W0K G;  2CK3 G;  5F2V O;  1OCZ C;  1S0V A;  1PL0 A;  2IJK A;  3CD6 V;  1B04 A;  1OCO C;  2IJJ A;  1XNQ O;  2PY5 A;  3CJH B;  1S5J A;  2DW4 A;  3H1K H;  4X1Y A;  1Y76 A;  5K1P A;  4MSW C;  5B66 Z;  2W6I G;  4X1Y B;  3SDL A;  3NR7 A;  4PDM A;  3ABL B;  4OGQ B;  3JCU Z;  2WLL B;  1GK9 A;  5IYZ B;  3OR6 C;  3S3W A;  4YIP A;  1KP3 A;  2EZP A;  3WG7 B;  3JYC A;  4X65 O;  4DV0 B;  1QLE C;  3HKD A;  4PA7 A;  3K5L A;  5E79 Z;  3E89 A;  4LCU C;  1D5A A;  4U3J B;  3D36 A;  5JQG B;  4YXW G;  4O4J B;  4O4I B;  1N32 B;  3IJ4 A;  5L3E A;  3OTF A;  5IYD O;  4WFA V;  4FJC C;  2E75 B;  4IIJ A;  2KG7 A;  3K0D A;  4JTD B;  3Q4H A;  1AB3 A;  3K58 A;  3ABU A;  4O4H B;  3RYF A;  3N2K A;  3D3Q A;  4XDK A;  4O4L A;  1OCC C;  4AIL C;  1MSD A;  2DQ0 A;  2DYS C;  2CH7 A;  5BZB A;  5AG2 A;  5ITZ A;  4PA3 A;  3K06 A;  3BAB A;  4MVZ A;  3JAR B;  4O2A B;  1SQX H;  4I4T A;  1YI2 V;  4X62 B;  3L71 H;  1AIL A;  2ZM6 O;  3APQ A;  4O2B B;  4MTX A;  5H2F Z;  3ZED A;  4JPR A;  3F5W C;  1SQF A;  4LBE C;  4JYB A;  3QVN A;  1AP5 A;  3RVY A;  4MT8 A;  2HJD A;  3CHX A;  1R73 A;  3I55 V;  3C90 A;  1W2B U;  1H2M A;  1HDJ A;  2F43 G;  3MAQ A;  4WBN B;  1ZLZ A;  3MD0 A;  4RUE A;  1Y74 B;  2B9Z A;  1EFR G;  2PGG A;  2ZQM A;  4FM1 A;  4J11 A;  1K5Q A;  4L8J A;  4NXN O;  2ETN A;  1HR0 B;  1IXM A;  1AR5 A;  1JCH A;  3KZI Z;  5EYP A;  3HKB A;  4DV5 B;  1EZV H;  2XAQ A;  3ETD A;  4BIO A;  3UT5 A;  4MVQ A;  3E22 B;  3G6E V;  1HNX B;  3JAL B;  4K0K B;  5CBG A;  3H1L H;  4EFB A;  3HB3 B;  2N04 A;  2UUC O;  4FLU A;  3K03 A;  4J80 A;  4Q6G A;  4JI8 O;  1PNK A;  5J2U B;  1V9P A;  4RO2 A;  5CA0 B;  2CGN A;  2HHH O;  3ZHU A;  1EM1 A;  1DTO A;  1ARO P;  2A7W A;  5BR8 B;  1LR1 A;  2A3Q A;  3CC7 V;  3JD4 A;  1FD9 A;  5IE9 A;  4X9Q A;  2FTK A;  2Y0I A;  4CS4 A;  1S3J A;  4IYH A;  2YID A;  2BE3 A;  3ZHT A;  1RSO B;  2Q6A A;  2VQE B;  1S76 D;  3P3N A;  4I0X B;  1GM7 A;  1X4T A;  3CP1 A;  3L9D A;  3RYI A;  1ZAU A;  3UCS C;  2RNB A;  5GON A;  2Q9L A;  5KUM A;  3H1I H;  2BTO A;  3ZBH A;  2F4V B;  4JAV A;  1O9G A;  2ATK C;  3CCJ V;  3CC2 V;  4LF5 B;  2ZIN A;  1WP7 A;  1VQO V;  4JYA O;  2QSA A;  2VS0 A;  4WFE A;  3A2F A;  1QR8 A;  3B2E E;  3C3S A;  4KXR A;  3T1H O;  2HKO A;  2Y4U A;  2F66 C;  3JAM N;  3A8T A;  4D7T A;  1XUQ A;  1K33 A;  2YXY A;  4XDJ A;  4JYA B;  1N34 O;  1N0J A;  1JA8 A;  5IWA O;  4TV9 B;  2FML A;  5LHI A;  2Q67 A;  3H01 A;  4F6R A;  2ZIM A;  1IZ3 A;  2E3C A;  3ZHS A;  4GYC B;  3F5T A;  2H3O A;  3D36 C;  4DYL A;  1H2G A;  3ZMU A;  5ITZ B;  1YJN V;  1PNM A;  2XOK G;  3BAA A;  2P90 A;  4R8C A;  1WAZ A;  4JI7 B;  4BIU A;  1JPX A;  4CH5 A;  3AG3 C;  2OYQ A;  1GRJ A;  1OHH G;  5GTI Z;  1XMO B;  2QDO A;  4GUN A;  2QJ1 A;  3DXR B;  1VQP V;  2UUA B;  4JI4 B;  4JI3 B;  3AG2 B;  3H1H H;  5CN0 A;  5B5E Z;  2JS3 A;  2D3O W;  5FNV B;  3WU2 Z;  2CH7 B;  2AZ2 A;  2XAS A;  1WJZ A;  4A5U B;  4X1K A;  2DN9 A;  2ZCE A;  4IGG A;  2P67 A;  2OCC C;  1DF4 A;  3OMA B;  2WLL A;  2Q8V A;  1HNX O;  3CE2 A;  4CZZ A;  3UO2 A;  2VQE O;  4DR4 B;  3TXQ A;  3W7U A;  3MHH C;  2K1E A;  3ML0 A;  3OD4 A;  1TAE A;  4FFK A;  2JEX A;  1YJ9 V;  3BEH A;  1GN2 A;  1SZX A;  4GKK B;  4UCS A;  4JV5 O;  3F7V C;  1RP3 B;  2WLJ A;  1S77 D;  1QQC A;  1US6 A;  2XT9 A;  3HKC A;  4FLY A;  3N27 A;  1JJ2 U;  3CCU V;  2F93 B;  3OMI B;  4U7O A;  1M90 W;  5DEC A;  1V54 C;  3F7Y C;  3CCR V;  3ZMT A;  4UVB A;  5K1X A;  5B1B B;  4DV5 O;  1OJH A;  1AR4 A;  1M56 B;  1OV9 A;  1SZT A;  5H6R A;  3SYP A;  2QE7 G;  4DV4 O;  2BCC H;  2QKA A;  4J9Z B;  2IH3 C;  5KLV H;  1VQ8 V;  5JH7 A;  4Z1V A;  5LGU A;  5LYJ A;  3W7W A;  4PV1 B;  2OIE A;  1KYO F;  1K34 A;  2QTS A;  4QIW F;  3MHS C;  4JZG A;  2OTL V;  5LXT B;  1K73 W;  4J9Y B;  1K9M W;  1KD1 W;  1IBK O;  1R6T A;  1YSC A;  2HR3 A;  1HWY A;  2EJR A;  1M1K W;  2CTW A;  3ZHR A;  3AG4 B;  2DJV A;  3AG3 B;  3SJA C;  3TXS A;  1KEC A;  1JR9 A;  2BOC C;  4JI7 O;  1ZTE A;  2Q0A A;  4QPJ A;  1WA8 A;  4LF4 B;  2IJH A;  2P06 A;  4EFE A;  2QWN B;  3O9O A;  5CA3 A;  4LF7 B;  3JAT A;  1SKV A;  1IUR A;  5FPR A;  2JRI A;  5EZY A;  1XBL A;  2CDY A;  1SRY A;  2JIZ G;  2WAM A;  4RUF A;  1BZK A;  2JVD A;  4I55 B;  1XNQ B;  1I7F A;  1KMI Z;  1FFX B;  4LFC B;  4PHZ A;  1PD3 A;  3LNM B;  3RYH A;  1N33 O;  1I5X A;  2YIB A;  3STL C;  1CP9 A;  5LL6 Y;  4LR3 A;  4YJ2 A;  3FYE B;  1BSM A;  2M6Y A;  4BW9 A;  3WG7 C;  5C8Y B;  1OCR C;  4TQD A;  4OXS A;  3BFR A;  4HNA B;  2PI5 A;  2Q73 A;  4LP8 A;  3L74 H;  4MTG A;  4KHP O;  1QBZ A;  5EYP B;  4DK1 A;  5KX5 B;  1ZWI C;  2ZE5 A;  2JEU A;  4TV8 B;  3EHB B;  3G67 A;  3G71 V;  3QO8 A;  3SPH A;  1BHB A;  2YC0 A;  1JQ0 A;  4DV1 B;  2MK3 A;  3ZRV A;  1M4U A;  1QVG U;  2LFR A;  1J5E B;  2HHH B;  5IDJ A;  1NH2 B;  3T1C A;  3PN1 A;  4H44 B;  4DO2 A;  5D5P A;  1G8M A;  4B7E A;  1PM9 A;  4WFH A;  3IGA C;  3WB0 A;  1Z5V A;  2WLM A;  3AG1 C;  5IJ9 A;  3E2E A;  1VAR A;  1Y66 A;  2H94 A;  4JZ2 A;  1PL4 A;  4BIZ A;  1PKX A;  3ASO C;  5LYJ B;  4PA6 A;  3QO7 A;  1J5E O;  3TGU H;  4DUY B;  5DN6 G;  2V1D A;  2YIC A;  1NJI W;  2NR5 A;  2YDE A;  4KHP B;  1FXK A;  2C2A A;  3ZHV A;  1Q3E A;  3CS5 A;  4NB5 A;  5CBH A;  2F1M A;  3T4Z A;  1RSO A;  4OPH A;  3AK2 A;  3B4S A;  2JS5 A;  1Q82 W;  3M7M X;  3DTU B;  4FVM A;  5BY1 A;  3VQV A;  4NYK A;  1XNR O;  3OGI B;  3SYA A;  3JD0 A;  5A2Q N;  2A9H A;  4I50 A;  4H13 B;  3UO3 A;  4DV1 O;  3AG2 C;  4K8X A;  2ZXW B;  2A79 B;  3JCZ A;  4Z1M G;  1B3Q A;  1SQP H;  2Q7H A;  4R7C A;  3K0G A;  4JAS A;  3CCS V;  1M5I A;  1LUW A;  2LO1 A;  5BMV B;  4LFC O;  2RMK B;  1QHT A;  2ZM6 B;  3HKD B;  3K9A A;  3IFX A;  2PZS A;  2YIA A;  3AEI A;  1NTM H;  4CH6 A;  2XUM A;  1BS3 A;  1VF6 A;  2CAZ C;  5KMG B;  2ZE6 A;  2ADQ B;  1GN6 A;  3SPG A;  4NTY A;  1ROP A;  3D8C A;  3JD2 A;  4MVM A;  2H8P C;  4DR6 B;  1M93 A;  2G38 A;  1COW G;  3TET A;  1CPY A;  1S72 V;  4NTX A;  3K59 A;  5IT9 N;  3OTO B;  3U11 A;  5A9G A;  4YJ2 B;  5JJN B;  1P49 A;  2R9I A;  4EKW A;  2XAF A;  5JCO A;  3UQ8 A;  3A0B Z;  3J81 N;  1Y74 A;  3J7A U;  1N33 B;  1K8A W;  5C8Y A;  1FFX A;  2QWP B;  4LNU B;  5J2T A;  1HNW O;  1JFF A;  1GM8 A;  1NS1 A;  1CXZ B;  4PDL A;  3B8N A;  4XDL A;  2A0L A;  1SA0 B;  2JGU A;  5EBL C;  3P32 A;  3RYC B;  4YHH B;  5J2U A;  5B1B C;  3FKS G;  5C93 A;  3AK1 A;  1OCZ B;  4JI6 O;  2CUG A;  4EB6 A;  3JD3 A;  4DUZ O;  3E83 A;  2ITC C;  4P9O A;  1NQT A;  4BW5 A;  4CH4 A;  1HP8 A;  1H8E G;  2L35 A;  4HNA A;  2AHZ A;  3FYI B;  1KUQ A;  2Z0A A;  5KA5 A;  1BE3 H;  4QPK A;  3ZRW B;  2QA4 V;  4JI5 B;  3E8H A;  3X2Q B;  4AQY B;  5JVD A;  4DR7 B;  1VF6 C;  1Q5O A;  3DC6 A;  3FB6 C;  1Q6H A;  2L6L A;  1IBK B;  1EN6 A;  2LP7 A;  3B77 A;  1H38 A;  1AI6 A;  2AGA A;  2UXX A;  2YSU B;  1E1Q G;  1L1F A;  1QLE B;  4W4K A;  4CH3 A;  4P30 A;  1VQ9 V;  1N36 B;  4X20 A;  2LW1 A;  2D2C B;  4UB6 Z; 
#chains in the Genus database with same CATH homology
 2UXD O;  3JAM N;  4LF9 O;  4X66 O;  2DOS A;  4DV0 O;  4B3R O;  4OPA A;  2E5L O;  4DR2 O;  4LF5 O;  4LFC O;  4DV6 O;  3T1Y O;  4DV5 O;  5LMU O;  4GKK O;  1F7Y A;  2UU9 O;  5H5N A;  2UXC O;  3R66 A;  3OTO O;  1N34 O;  4DV4 O;  3J80 N;  1G1X B;  3RT3 C;  4NXM O;  5IWA O;  4NXN O;  2ZKO A;  4DR6 O;  4LFA O;  4OX9 O;  1XNQ O;  4X64 O;  4KHP O;  4DR7 O;  1R1B A;  4LF8 O;  2FKX A;  3F5T A;  4LF6 O;  3SDL A;  4LF7 O;  5IT9 N;  1A32 A;  2VQF O;  4DUY O;  2UUC O;  4X65 O;  3J81 N;  3J7A U;  1FJG O;  1IBM O;  4JI1 O;  4JI8 O;  2F4V O;  5BR8 O;  4YHH O;  1HNW O;  1IBK O;  1R6T A;  3O65 A;  1NS1 A;  3M8A A;  4DR1 O;  4DR3 O;  1HNZ O;  4AQY O;  2HHH O;  1XMQ O;  5FLX N;  2DJV A;  4DR5 O;  1XEQ A;  4JI4 O;  4X62 O;  4JI6 O;  2UUA O;  2LW7 A;  4DUZ O;  4A5U B;  2UUB O;  4DR4 O;  4GKJ O;  4JI7 O;  1AB3 A;  4DV7 O;  1J5E O;  4B3T O;  4JI5 O;  5BXZ A;  4LF4 O;  1X59 A;  1FYJ A;  1I94 O;  4K0K O;  1YZB A;  1HNX O;  2VQE O;  1KUQ A;  2Z0A A;  4DV3 O;  1HR0 O;  4B3S O;  2JRI A;  4B3M O;  4OPH A;  5LMN O;  4JI2 O;  4DV2 O;  2N74 A;  1AIL A;  5BY1 A;  2ZM6 O;  1XNR O;  4JV5 O;  1IBL O;  4JI0 O;  2AGA A;  1DK1 A;  4LFB O;  1N33 O;  5A2Q N;  4JYA O;  1XMO O;  1N32 O;  4JI3 O;  4DV1 O;  1D2D A;  5LL6 Y;  1N36 O;  3T1H O;  2UXB O;  4YY3 O;  1FKA O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...