4DUZD

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c, bound with streptomycin
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
208
structure length
208
Chain Sequence
GRYIGPVCRLCRREGVKLYLKGERCYSPKCAMERRPYPPGQHGQKRARRPSDYAVRLREKQKLRRIYGISERQFRNLFEEASKKKGVTGSVFLGLLESRLDNVVYRLGFAVSRRQARQLVRHGHITVNGRRVDLPSYRVRPGDEIAVAEKSRNLELIRQNLEAMKGRKVGPWLSLDVEGMKGKFLRLPDREDLALPVNEQLVIEFYSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 56
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00163 Ribosomal_S4 Ribosomal protein S4/S9 N-terminal domain
D PF01479 S4 S4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1050.10 Mainly Alpha Orthogonal Bundle Ribosomal Protein S4 Delta 41; Chain A, domain 1 Ribosomal Protein S4 Delta 41; Chain A, domain 1 4duzD01
3.10.290.10 Alpha Beta Roll Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A RNA-binding S4 domain 4duzD02
2UUBD 4X64D 3T1YD 4GKKD 4JI0D 2HHHD 4DV0D 1J5ED 4JI1D 4JI8D 4JI6D 4K0KD 4X62D 1XNRD 2UXDD 3DH3A 4LF5D 3KBGA 4DV2D 4KHPD 2ISTA 3OTOD 1FKAD 1C06A 1N34D 4GKJD 1VIOA 4JI4D 1IBLD 5LMND 1XMOD 5LMUD 1I94D 4DR1D 4YHHD 1KSVA 4DV6D 1KSKA 1HNZD 1IBMD 4LFBD 1IBKD 4LFAD 2K6PA 4LF4D 4AQYD 2UXBD 4LGTA 2VQED 4DR3D 4DR2D 1XMQD 1N32D 1C05A 5BR8D 4DR4D 1N33D 2ZM6D 2UU9D 4B3MD 4DV1D 4LF9D 2UUAD 4OUDA 2UUCD 4LF8D 4OX9D 5IWAD 4NXND 4DUYD 2E5LD 4DR7D 1KSLA 1H3EA 1N36D 4X66D 4JV5D 4NXMD 4DV3D 4JI7D 4DUZD 4X65D 4B3RD 4B3SD 2F4VD 4YY3D 4DV4D 4LFCD 1DM9A 3HP7A 2KTLA 1JH3A 4LF7D 2UXCD 1FJGD 4DR5D 4B3TD 1P9KA 1HR0D 2JANA 1H3FA 4JI3D 4JI5D 4DV5D 3T1HD 1XNQD 4LF6D 2VQFD 1HNXD 4JI2D 1HNWD 4DV7D 4JYAD 4DR6D
chains in the Genus database with same CATH superfamily
2ZTBA 2UUBD 4II3A 4X64D 3T1YD 4GKKD 4JI0D 2HHHD 4DV0D 1J5ED 3J81E 4JI1D 4JI8D 4JI6D 3FN1A 4K0KD 4X62D 1XNRD 2UXDD 3DH3A 2I1SA 4LF5D 3KBGA 4DV2D 4KHPD 2ISTA 5FLXE 3OTOD 1FKAD 1C06A 1N34D 4GKJD 1VIOA 5FQ2B 4JI4D 5KNLA 1IBLD 5LMND 1XMOD 3J80E 5LMUD 1I94D 4DR1D 4YHHD 1KSVA 4DV6D 1KSKA 1Y8XB 1HNZD 1Y8QB 1IBMD 4LFBD 1IBKD 4LFAD 3ONHA 2K6PA 4LF4D 4AQYD 2UXBD 3ONGA 4LGTA 2VQED 5IT9E 4DR3D 4DR2D 1XMQD 3JAME 1N32D 2NVUB 1C05A 5BR8D 4DR4D 1N33D 2ZM6D 3KYCB 2UU9D 4B3MD 4DV1D 4LF9D 1Y8RB 2UUAD 4OUDA 2UUCD 4LF8D 4OX9D 5IWAD 2LQ7A 4NXND 4DUYD 2E5LD 3CMMA 4W5VB 2L3NA 4DR7D 1KSLA 1H3EA 1N36D 4X66D 4JV5D 4NXMD 4DV3D 4JI7D 4DUZD 4X65D 4B3RD 4B3SD 2F4VD 4YY3D 3KYDB 4DV4D 4LFCD 1DM9A 3HP7A 2KTLA 1JH3A 4LF7D 2UXCD 1FJGD 4DR5D 4B3TD 1P9KA 1HR0D 4NNJA 3J7AF 2JANA 1H3FA 4JI3D 4JI5D 4II2A 4DV5D 3T1HD 1XNQD 4LF6D 2VQFD 1HNXD 4JI2D 5A2QE 1HNWD 4DV7D 4JYAD 4DR6D 5LL6S
chains in the Genus database with same CATH topology
2UUBD 4X64D 3T1YD 4GKKD 4JI0D 2HHHD 4DV0D 1J5ED 4JI1D 4JI8D 4JI6D 4K0KD 4X62D 1XNRD 2UXDD 3DH3A 4LF5D 3KBGA 4DV2D 4KHPD 2ISTA 3OTOD 1FKAD 1C06A 1N34D 4GKJD 1VIOA 4JI4D 1IBLD 5LMND 1XMOD 5LMUD 1I94D 4DR1D 4YHHD 1KSVA 4DV6D 1KSKA 1HNZD 1IBMD 4LFBD 1IBKD 4LFAD 2K6PA 4LF4D 4AQYD 2UXBD 4LGTA 2VQED 4DR3D 4DR2D 1XMQD 1N32D 1C05A 5BR8D 4DR4D 1N33D 2ZM6D 2UU9D 4B3MD 4DV1D 4LF9D 2UUAD 4OUDA 2UUCD 4LF8D 4OX9D 5IWAD 4NXND 4DUYD 2E5LD 2L3NA 4DR7D 1KSLA 1H3EA 1N36D 4X66D 4JV5D 4NXMD 4DV3D 4JI7D 4DUZD 4X65D 4B3RD 4B3SD 2F4VD 4YY3D 4DV4D 4LFCD 1DM9A 3HP7A 2KTLA 1JH3A 4LF7D 2UXCD 1FJGD 4DR5D 4B3TD 1P9KA 1HR0D 2JANA 1H3FA 4JI3D 4JI5D 4DV5D 3T1HD 1XNQD 4LF6D 2VQFD 1HNXD 4JI2D 1HNWD 4DV7D 4JYAD 4DR6D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUB D;  4X64 D;  3T1Y D;  4GKK D;  4JI0 D;  2HHH D;  4DV0 D;  1J5E D;  4JI1 D;  4JI8 D;  4JI6 D;  4K0K D;  4X62 D;  1XNR D;  2UXD D;  3DH3 A;  4LF5 D;  3KBG A;  4DV2 D;  4KHP D;  2IST A;  3OTO D;  1FKA D;  1C06 A;  1N34 D;  4GKJ D;  1VIO A;  4JI4 D;  1IBL D;  5LMN D;  1XMO D;  5LMU D;  1I94 D;  4DR1 D;  4YHH D;  1KSV A;  4DV6 D;  1KSK A;  1HNZ D;  1IBM D;  4LFB D;  1IBK D;  4LFA D;  2K6P A;  4LF4 D;  4AQY D;  2UXB D;  4LGT A;  2VQE D;  4DR3 D;  4DR2 D;  1XMQ D;  1N32 D;  1C05 A;  5BR8 D;  4DR4 D;  1N33 D;  2ZM6 D;  2UU9 D;  4B3M D;  4DV1 D;  4LF9 D;  2UUA D;  4OUD A;  2UUC D;  4LF8 D;  4OX9 D;  5IWA D;  4NXN D;  4DUY D;  2E5L D;  4DR7 D;  1KSL A;  1H3E A;  1N36 D;  4X66 D;  4JV5 D;  4NXM D;  4DV3 D;  4JI7 D;  4DUZ D;  4X65 D;  4B3R D;  4B3S D;  2F4V D;  4YY3 D;  4DV4 D;  4LFC D;  1DM9 A;  3HP7 A;  2KTL A;  1JH3 A;  4LF7 D;  2UXC D;  1FJG D;  4DR5 D;  4B3T D;  1P9K A;  1HR0 D;  2JAN A;  1H3F A;  4JI3 D;  4JI5 D;  4DV5 D;  3T1H D;  1XNQ D;  4LF6 D;  2VQF D;  1HNX D;  4JI2 D;  1HNW D;  4DV7 D;  4JYA D;  4DR6 D; 
#chains in the Genus database with same CATH topology
 2ZTB A;  2UUB D;  4II3 A;  4X64 D;  3T1Y D;  4GKK D;  4JI0 D;  2HHH D;  4DV0 D;  1J5E D;  3J81 E;  4JI1 D;  4JI8 D;  4JI6 D;  3FN1 A;  4K0K D;  4X62 D;  1XNR D;  2UXD D;  3DH3 A;  2I1S A;  4LF5 D;  3KBG A;  4DV2 D;  4KHP D;  2IST A;  5FLX E;  3OTO D;  1FKA D;  1C06 A;  1N34 D;  4GKJ D;  1VIO A;  5FQ2 B;  4JI4 D;  5KNL A;  1IBL D;  5LMN D;  1XMO D;  3J80 E;  5LMU D;  1I94 D;  4DR1 D;  4YHH D;  1KSV A;  4DV6 D;  1KSK A;  1Y8X B;  1HNZ D;  1Y8Q B;  1IBM D;  4LFB D;  1IBK D;  4LFA D;  3ONH A;  2K6P A;  4LF4 D;  4AQY D;  2UXB D;  3ONG A;  4LGT A;  2VQE D;  5IT9 E;  4DR3 D;  4DR2 D;  1XMQ D;  3JAM E;  1N32 D;  2NVU B;  1C05 A;  5BR8 D;  4DR4 D;  1N33 D;  2ZM6 D;  3KYC B;  2UU9 D;  4B3M D;  4DV1 D;  4LF9 D;  1Y8R B;  2UUA D;  4OUD A;  2UUC D;  4LF8 D;  4OX9 D;  5IWA D;  2LQ7 A;  4NXN D;  4DUY D;  2E5L D;  3CMM A;  4W5V B;  2L3N A;  4DR7 D;  1KSL A;  1H3E A;  1N36 D;  4X66 D;  4JV5 D;  4NXM D;  4DV3 D;  4JI7 D;  4DUZ D;  4X65 D;  4B3R D;  4B3S D;  2F4V D;  4YY3 D;  3KYD B;  4DV4 D;  4LFC D;  1DM9 A;  3HP7 A;  2KTL A;  1JH3 A;  4LF7 D;  2UXC D;  1FJG D;  4DR5 D;  4B3T D;  1P9K A;  1HR0 D;  4NNJ A;  3J7A F;  2JAN A;  1H3F A;  4JI3 D;  4JI5 D;  4II2 A;  4DV5 D;  3T1H D;  1XNQ D;  4LF6 D;  2VQF D;  1HNX D;  4JI2 D;  5A2Q E;  1HNW D;  4DV7 D;  4JYA D;  4DR6 D;  5LL6 S; 
#chains in the Genus database with same CATH homology
 2UUB D;  4X64 D;  3T1Y D;  4GKK D;  4JI0 D;  2HHH D;  4DV0 D;  1J5E D;  4JI1 D;  4JI8 D;  4JI6 D;  4K0K D;  4X62 D;  1XNR D;  2UXD D;  3DH3 A;  4LF5 D;  3KBG A;  4DV2 D;  4KHP D;  2IST A;  3OTO D;  1FKA D;  1C06 A;  1N34 D;  4GKJ D;  1VIO A;  4JI4 D;  1IBL D;  5LMN D;  1XMO D;  5LMU D;  1I94 D;  4DR1 D;  4YHH D;  1KSV A;  4DV6 D;  1KSK A;  1HNZ D;  1IBM D;  4LFB D;  1IBK D;  4LFA D;  2K6P A;  4LF4 D;  4AQY D;  2UXB D;  4LGT A;  2VQE D;  4DR3 D;  4DR2 D;  1XMQ D;  1N32 D;  1C05 A;  5BR8 D;  4DR4 D;  1N33 D;  2ZM6 D;  2UU9 D;  4B3M D;  4DV1 D;  4LF9 D;  2UUA D;  4OUD A;  2UUC D;  4LF8 D;  4OX9 D;  5IWA D;  4NXN D;  4DUY D;  2E5L D;  2L3N A;  4DR7 D;  1KSL A;  1H3E A;  1N36 D;  4X66 D;  4JV5 D;  4NXM D;  4DV3 D;  4JI7 D;  4DUZ D;  4X65 D;  4B3R D;  4B3S D;  2F4V D;  4YY3 D;  4DV4 D;  4LFC D;  1DM9 A;  3HP7 A;  2KTL A;  1JH3 A;  4LF7 D;  2UXC D;  1FJG D;  4DR5 D;  4B3T D;  1P9K A;  1HR0 D;  2JAN A;  1H3F A;  4JI3 D;  4JI5 D;  4DV5 D;  3T1H D;  1XNQ D;  4LF6 D;  2VQF D;  1HNX D;  4JI2 D;  1HNW D;  4DV7 D;  4JYA D;  4DR6 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...