4DUZD

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c, bound with streptomycin
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
208
structure length
208
Chain Sequence
GRYIGPVCRLCRREGVKLYLKGERCYSPKCAMERRPYPPGQHGQKRARRPSDYAVRLREKQKLRRIYGISERQFRNLFEEASKKKGVTGSVFLGLLESRLDNVVYRLGFAVSRRQARQLVRHGHITVNGRRVDLPSYRVRPGDEIAVAEKSRNLELIRQNLEAMKGRKVGPWLSLDVEGMKGKFLRLPDREDLALPVNEQLVIEFYSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 56
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00163 Ribosomal_S4 Ribosomal protein S4/S9 N-terminal domain
D PF01479 S4 S4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1050.10 Mainly Alpha Orthogonal Bundle Ribosomal Protein S4 Delta 41; Chain A, domain 1 Ribosomal Protein S4 Delta 41; Chain A, domain 1 4duzD01
3.10.290.10 Alpha Beta Roll Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A RNA-binding S4 domain 4duzD02
4GKJD 4LF5D 4X65D 2UXDD 1KSLA 4OX9D 1HNXD 4DV3D 4JYAD 1H3FA 3T1HD 4DR7D 4DR1D 4JI6D 4JI8D 5LMND 1DM9A 4JI0D 3T1YD 4NXND 1HNZD 4DV0D 1N32D 2UUAD 4JI1D 1C05A 4LFCD 4LFBD 1IBLD 4DUYD 4LF9D 4LF4D 2E5LD 2ZM6D 2UU9D 4YHHD 1IBMD 5LMUD 1H3EA 1KSVA 2KTLA 1N34D 4DR3D 4JI5D 4JV5D 4LGTA 1JH3A 1FJGD 4B3TD 4B3RD 1XNQD 1N36D 4B3MD 2K6PA 4LF7D 1C06A 4X66D 1KSKA 4DV1D 1FKAD 2F4VD 1J5ED 4NXMD 4LF6D 4DR5D 4DUZD 4AQYD 4KHPD 1XMQD 3OTOD 4JI7D 4LFAD 4JI3D 4DV5D 1XMOD 4DV2D 2UXBD 4DV4D 1HNWD 2ISTA 1VIOA 4B3SD 4GKKD 2JANA 2VQED 4X62D 4DR6D 4DR4D 5IWAD 2UUCD 1IBKD 4DV6D 1N33D 3HP7A 1P9KA 2VQFD 1HR0D 3KBGA 4OUDA 4X64D 4YY3D 2HHHD 5BR8D 2UXCD 1I94D 4JI4D 3DH3A 4LF8D 2UUBD 4JI2D 4DR2D 1XNRD 4DV7D 4K0KD
chains in the Genus database with same CATH superfamily
4GKJD 4LF5D 4X65D 2UXDD 1KSLA 4OX9D 1HNXD 4DV3D 4NNJA 3J81E 4JYAD 1H3FA 4W5VB 3T1HD 2NVUB 3KYDB 4DR7D 4DR1D 4JI6D 4JI8D 1Y8XB 5LMND 1DM9A 4JI0D 3FN1A 3T1YD 4NXND 1HNZD 4DV0D 1N32D 2UUAD 5FLXE 4JI1D 1C05A 4LFCD 3ONGA 4LFBD 1IBLD 1Y8QB 4DUYD 5FQ2B 4LF9D 4LF4D 2E5LD 2ZM6D 2UU9D 3JAME 4YHHD 1IBMD 5LMUD 1H3EA 1KSVA 2KTLA 2LQ7A 4II3A 2L3NA 1N34D 4DR3D 4JI5D 4JV5D 4LGTA 1JH3A 3KYCB 1FJGD 4B3TD 4B3RD 1XNQD 1N36D 4B3MD 2K6PA 4LF7D 5KNLA 5IT9E 1C06A 4X66D 1KSKA 4DV1D 1FKAD 2F4VD 1J5ED 4NXMD 4LF6D 4DR5D 4DUZD 4AQYD 3J7AF 4KHPD 1XMQD 3OTOD 4JI7D 5A2QE 3J80E 4LFAD 4JI3D 4II2A 4DV5D 2ZTBA 1XMOD 3CMMA 4DV2D 1Y8RB 2UXBD 4DV4D 1HNWD 2ISTA 1VIOA 4B3SD 4GKKD 2JANA 2VQED 3ONHA 4X62D 4DR6D 4DR4D 5IWAD 2UUCD 1IBKD 4DV6D 2I1SA 1N33D 3HP7A 1P9KA 2VQFD 1HR0D 3KBGA 4OUDA 4X64D 4YY3D 2HHHD 5BR8D 2UXCD 1I94D 4JI4D 3DH3A 4LF8D 2UUBD 4JI2D 5LL6S 4DR2D 1XNRD 4DV7D 4K0KD
chains in the Genus database with same CATH topology
4GKJD 4LF5D 4X65D 2UXDD 1KSLA 4OX9D 1HNXD 4DV3D 4JYAD 1H3FA 3T1HD 4DR7D 4DR1D 4JI6D 4JI8D 5LMND 1DM9A 4JI0D 3T1YD 4NXND 1HNZD 4DV0D 1N32D 2UUAD 4JI1D 1C05A 4LFCD 4LFBD 1IBLD 4DUYD 4LF9D 4LF4D 2E5LD 2ZM6D 2UU9D 4YHHD 1IBMD 5LMUD 1H3EA 1KSVA 2KTLA 2L3NA 1N34D 4DR3D 4JI5D 4JV5D 4LGTA 1JH3A 1FJGD 4B3TD 4B3RD 1XNQD 1N36D 4B3MD 2K6PA 4LF7D 1C06A 4X66D 1KSKA 4DV1D 1FKAD 2F4VD 1J5ED 4NXMD 4LF6D 4DR5D 4DUZD 4AQYD 4KHPD 1XMQD 3OTOD 4JI7D 4LFAD 4JI3D 4DV5D 1XMOD 4DV2D 2UXBD 4DV4D 1HNWD 2ISTA 1VIOA 4B3SD 4GKKD 2JANA 2VQED 4X62D 4DR6D 4DR4D 5IWAD 2UUCD 1IBKD 4DV6D 1N33D 3HP7A 1P9KA 2VQFD 1HR0D 3KBGA 4OUDA 4X64D 4YY3D 2HHHD 5BR8D 2UXCD 1I94D 4JI4D 3DH3A 4LF8D 2UUBD 4JI2D 4DR2D 1XNRD 4DV7D 4K0KD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GKJ D;  4LF5 D;  4X65 D;  2UXD D;  1KSL A;  4OX9 D;  1HNX D;  4DV3 D;  4JYA D;  1H3F A;  3T1H D;  4DR7 D;  4DR1 D;  4JI6 D;  4JI8 D;  5LMN D;  1DM9 A;  4JI0 D;  3T1Y D;  4NXN D;  1HNZ D;  4DV0 D;  1N32 D;  2UUA D;  4JI1 D;  1C05 A;  4LFC D;  4LFB D;  1IBL D;  4DUY D;  4LF9 D;  4LF4 D;  2E5L D;  2ZM6 D;  2UU9 D;  4YHH D;  1IBM D;  5LMU D;  1H3E A;  1KSV A;  2KTL A;  1N34 D;  4DR3 D;  4JI5 D;  4JV5 D;  4LGT A;  1JH3 A;  1FJG D;  4B3T D;  4B3R D;  1XNQ D;  1N36 D;  4B3M D;  2K6P A;  4LF7 D;  1C06 A;  4X66 D;  1KSK A;  4DV1 D;  1FKA D;  2F4V D;  1J5E D;  4NXM D;  4LF6 D;  4DR5 D;  4DUZ D;  4AQY D;  4KHP D;  1XMQ D;  3OTO D;  4JI7 D;  4LFA D;  4JI3 D;  4DV5 D;  1XMO D;  4DV2 D;  2UXB D;  4DV4 D;  1HNW D;  2IST A;  1VIO A;  4B3S D;  4GKK D;  2JAN A;  2VQE D;  4X62 D;  4DR6 D;  4DR4 D;  5IWA D;  2UUC D;  1IBK D;  4DV6 D;  1N33 D;  3HP7 A;  1P9K A;  2VQF D;  1HR0 D;  3KBG A;  4OUD A;  4X64 D;  4YY3 D;  2HHH D;  5BR8 D;  2UXC D;  1I94 D;  4JI4 D;  3DH3 A;  4LF8 D;  2UUB D;  4JI2 D;  4DR2 D;  1XNR D;  4DV7 D;  4K0K D; 
#chains in the Genus database with same CATH topology
 4GKJ D;  4LF5 D;  4X65 D;  2UXD D;  1KSL A;  4OX9 D;  1HNX D;  4DV3 D;  4NNJ A;  3J81 E;  4JYA D;  1H3F A;  4W5V B;  3T1H D;  2NVU B;  3KYD B;  4DR7 D;  4DR1 D;  4JI6 D;  4JI8 D;  1Y8X B;  5LMN D;  1DM9 A;  4JI0 D;  3FN1 A;  3T1Y D;  4NXN D;  1HNZ D;  4DV0 D;  1N32 D;  2UUA D;  5FLX E;  4JI1 D;  1C05 A;  4LFC D;  3ONG A;  4LFB D;  1IBL D;  1Y8Q B;  4DUY D;  5FQ2 B;  4LF9 D;  4LF4 D;  2E5L D;  2ZM6 D;  2UU9 D;  3JAM E;  4YHH D;  1IBM D;  5LMU D;  1H3E A;  1KSV A;  2KTL A;  2LQ7 A;  4II3 A;  2L3N A;  1N34 D;  4DR3 D;  4JI5 D;  4JV5 D;  4LGT A;  1JH3 A;  3KYC B;  1FJG D;  4B3T D;  4B3R D;  1XNQ D;  1N36 D;  4B3M D;  2K6P A;  4LF7 D;  5KNL A;  5IT9 E;  1C06 A;  4X66 D;  1KSK A;  4DV1 D;  1FKA D;  2F4V D;  1J5E D;  4NXM D;  4LF6 D;  4DR5 D;  4DUZ D;  4AQY D;  3J7A F;  4KHP D;  1XMQ D;  3OTO D;  4JI7 D;  5A2Q E;  3J80 E;  4LFA D;  4JI3 D;  4II2 A;  4DV5 D;  2ZTB A;  1XMO D;  3CMM A;  4DV2 D;  1Y8R B;  2UXB D;  4DV4 D;  1HNW D;  2IST A;  1VIO A;  4B3S D;  4GKK D;  2JAN A;  2VQE D;  3ONH A;  4X62 D;  4DR6 D;  4DR4 D;  5IWA D;  2UUC D;  1IBK D;  4DV6 D;  2I1S A;  1N33 D;  3HP7 A;  1P9K A;  2VQF D;  1HR0 D;  3KBG A;  4OUD A;  4X64 D;  4YY3 D;  2HHH D;  5BR8 D;  2UXC D;  1I94 D;  4JI4 D;  3DH3 A;  4LF8 D;  2UUB D;  4JI2 D;  5LL6 S;  4DR2 D;  1XNR D;  4DV7 D;  4K0K D; 
#chains in the Genus database with same CATH homology
 4GKJ D;  4LF5 D;  4X65 D;  2UXD D;  1KSL A;  4OX9 D;  1HNX D;  4DV3 D;  4JYA D;  1H3F A;  3T1H D;  4DR7 D;  4DR1 D;  4JI6 D;  4JI8 D;  5LMN D;  1DM9 A;  4JI0 D;  3T1Y D;  4NXN D;  1HNZ D;  4DV0 D;  1N32 D;  2UUA D;  4JI1 D;  1C05 A;  4LFC D;  4LFB D;  1IBL D;  4DUY D;  4LF9 D;  4LF4 D;  2E5L D;  2ZM6 D;  2UU9 D;  4YHH D;  1IBM D;  5LMU D;  1H3E A;  1KSV A;  2KTL A;  2L3N A;  1N34 D;  4DR3 D;  4JI5 D;  4JV5 D;  4LGT A;  1JH3 A;  1FJG D;  4B3T D;  4B3R D;  1XNQ D;  1N36 D;  4B3M D;  2K6P A;  4LF7 D;  1C06 A;  4X66 D;  1KSK A;  4DV1 D;  1FKA D;  2F4V D;  1J5E D;  4NXM D;  4LF6 D;  4DR5 D;  4DUZ D;  4AQY D;  4KHP D;  1XMQ D;  3OTO D;  4JI7 D;  4LFA D;  4JI3 D;  4DV5 D;  1XMO D;  4DV2 D;  2UXB D;  4DV4 D;  1HNW D;  2IST A;  1VIO A;  4B3S D;  4GKK D;  2JAN A;  2VQE D;  4X62 D;  4DR6 D;  4DR4 D;  5IWA D;  2UUC D;  1IBK D;  4DV6 D;  1N33 D;  3HP7 A;  1P9K A;  2VQF D;  1HR0 D;  3KBG A;  4OUD A;  4X64 D;  4YY3 D;  2HHH D;  5BR8 D;  2UXC D;  1I94 D;  4JI4 D;  3DH3 A;  4LF8 D;  2UUB D;  4JI2 D;  4DR2 D;  1XNR D;  4DV7 D;  4K0K D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...