4DUZM

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c, bound with streptomycin
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 25
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4duzM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4duzM02
1XNRM 3GPXA 1EE8A 4DR7M 4MB7A 3T1HM 4DV0M 1Q3CA 4X62M 1PJJA 1IBKM 4PDGA 4JI2M 1HNWM 4NXNM 2ZM6M 3GPPA 3U6DA 3SATA 1L1TA 1K3WA 1K82A 5BR8M 2F5QA 5ITRA 3TWMA 3J7AS 2F4VM 3JR4A 4DV4M 3GO8A 2Q2EB 4B3SM 3GQ3A 2UUCM 5ITUA 2UU9M 4JI7M 3U6MA 4X64M 5LMNM 3JR5A 4X65M 4ITQA 1XC8A 2XZFA 4DV5M 1NNJA 1TDHA 2UXCM 3U6QA 1FJGM 4DR4M 1Z5BA 3SAUA 1XMQM 4DR6M 1K3XA 5ITYA 4PCZA 3GQ5A 4DR2M 5IWAM 3VK8A 2HKJA 3SARA 3SAVA 1IBMM 3A42A 4LF6M 4LFAM 1MU5A 1J5EM 1N36M 2OQ4A 3W0FA 4PD2A 4DUZM 2EA0A 1KFVA 1HR0M 1L2DA 5ITQA 1TDZA 3TWKA 4JI0M 4LF8M 2UUAM 4CISA 2VQEM 4KHPM 4DV3M 4K0KM 4JYAM 3GPYA 4DV2M 1L2BA 2UUBM 1N33M 3U6EA 4YY3M 4NRVA 3J81S 4G4NA 1I94M 1R2ZA 4LF5M 3A45A 4LFCM 4OX9M 1Q3BA 4JI1M 3GPUA 4DR5M 4DV6M 1Q39A 1PJIA 1N34M 4JV5M 5ITTA 1MX0A 1R2YA 1Z5CA 3U6LA 3VK7A 4X66M 4G4OA 3U6OA 4JI8M 2VQFM 3U6PA 1IBLM 2F5NA 3J80S 4JI5M 1N32M 5ITXE 3T1YM 3C58A 3SBJA 3DOAA 4JI4M 5FLXS 4AQYM 4GKKM 3GQ4A 4NRWA 3U6CA 3A46A 1HNZM 4YHHM 4DV7M 4G4QA 4DUYM 3JAMS 4DR1M 1PM5A 4JI3M 1L1ZA 1L2CA 1XNQM 4LFBM 5IT9S 4GKJM 4B3RM 2UXBM 4NXMM 2E5LM 5A2QS 4B3TM 5LMUM 4G4RA 5ITXA 4B3MM 4LF9M 2F5SA 4DV1M 2ZBKB 3SAWA 3OTOM 1Z5AA 2XZUA 4PDIA 2F5OA 4LF7M 4JI6M 1HNXM 3U6SA 2HHHM 1Z59A 3GP1A 4DR3M 2F5PA 2UXDM 1XMOM 3TWLA 2OPFA 4LF4M 3SASA
chains in the Genus database with same CATH superfamily
3AL0C 1EIJA 2H5XA 4IBIA 3UMMA 4GHLA 1IXRC 3GLGB 2JY7A 4DR7M 1YSYA 5FTJA 4P16A 2OPFA 1PJJA 3Q8GA 2Y0TA 2LVAA 4GITA 1NSFA 5H37D 2DHYA 2X4AA 4PDGA 1ZMWA 4GRIA 2KDLA 2DAGA 5C1BA 3SATA 4NC6A 5KPZA 1N75A 2C99A 4OVZB 2X8AA 5FTNA 1P3QQ 3KS8A 1K82A 1GJSA 1I4WA 2QP9X 2F5QA 5ITRA 3J7AS 2DAMA 2FOIC 4RNAA 5FTKA 2F4VM 4DV4M 4B3SM 3M0EA 2P5TA 1QAQA 2J5YA 3MK6A 5E26A 1RU3A 2LXEA 3HJQA 1HQCA 2LVPC 4LJAA 2L4EA 2YFQA 2KXEA 4DV5M 3FTDA 3FD9A 4DR4M 2EJSA 4TUWA 1XMQM 2APLA 3J2PB 3U5ZA 2GNOA 4LJ7A 4FWHA 4IBFA 2CV2A 1IBMM 1NY5A 3A42A 3WHKA 4GMQA 2RGOA 4M9XA 4W5WA 3W0FA 1R4GA 1KFVA 2FS1A 1HR0M 1ZQ9A 1G8PA 3SHGB 8CATA 3GLFE 4FD2A 3VKHA 1OAIA 2L7IA 3MHVC 4KHPM 2XLJA 2G5GX 3HZJA 4FWDA 1AIPC 1E9SA 4IBKA 3W0LB 2C96A 1TR8A 4JYAM 4DV2M 1GL7A 3TQSA 2LNHC 1DGGA 1GL6A 4YY3M 4LCBA 1IFYA 3FRIA 4OVZA 4G4NA 1I94M 5EJCA 1JR3A 1JQJC 5KQDA 2HL7A 5KPRA 1N34M 4GC5A 1J7KA 1IN8A 1MX0A 1S3SA 1TGUA 4D80A 3AV0A 1GO5A 3VKGA 4QOSA 4KO8A 3K9PA 3ZQJA 3AFHA 4IBCA 3VK7A 1NY6A 3I04M 1IBLM 2G3QA 1OIPA 1N32M 1WXQA 3UK6A 1NNUC 2LH0A 3M6AA 4AG5A 2W82A 2ZTDA 2CV1A 1HJPA 3LQQA 5FLXS 1TH3A 3HHXA 5JI3E 3H4MA 1VEKA 3U6CA 1HNZM 4NRWA 2HAKA 2R18A 3I4VA 4JI3M 2KZSA 1PJTA 4MM3B 2XSZD 3E4RA 3PNYA 2CHGA 1E94E 1IY2A 5EP4A 4L78A 3HX3A 5DYIA 2OO9A 4RF1A 1WGLA 4FWGA 3HU3A 4B7HA 1C1KA 2JA2A 4BLCA 2JY8A 4MGZE 5FTLA 2R4JA 1WGNA 1QYRA 5BPVA 4LF9M 3MJ5A 2DXIA 3H4JA 2ZBKB 2QSFX 3HKPA 3QYEA 2DHRA 1NJGA 5EXSA 2CEAA 2DWLA 1XB2B 2O01F 5GKNA 2XZUA 2EKFA 1HT2E 1D0LA 2N35A 2F5OA 4LF7M 4Z6YA 2JUJA 3T6PA 3I51A 7CATA 4AKIA 2RKOA 3FRHA 2H1RA 3BOSA 4L16A 3TWLA 3CF2A 2V6ZM 4LZZA 1IY1A 2XEPA 4AG6A 5L8RF 2I7PA 2YQZA 4CGYB 1NJFA 1TTEA 2JP7A 4LGYA 1EE8A 5IREB 2FFJA 3HU1A 3F92A 4DV0M 4MH0E 2YR0A 2VF8A 2ZANA 4QNRA 1QZEA 4XK8F 1DV0A 1HQYE 3HHZA 1HNWM 2ZM6M 4IBGA 1GKIA 2XF3A 3NBIA 1L1TA 3DFZA 1K3WA 1GLNA 2D7GA 2R6FA 2FE8A 1G59A 4FCWA 2BJWA 2DWMA 1OTRA 3RE8A 4FVMA 3GQ3A 3SYLA 2UU9M 3SC3A 2L2DA 4X64M 5LMNM 3I4YA 3JR5A 1TF0B 1XC8A 1OIZA 3IG5A 2XZFA 4HL4A 1OQYA 3KW6A 1KYIA 2KHHA 4WW0A 2CV0A 3KXEC 2Z4RA 1K3XA 4AZFA 4AI6A 3VK8A 4DR2M 5IWAM 2KRUA 1Q02A 4L4UA 3SYKA 4LF6M 2CP8A 1MU5A 4LG2A 2L6OA 3FYCA 5JI2E 2OQ4A 4PD2A 2J7OA 1XXHB 4KT0F 4UN2B 3LW5F 2WSEF 4CHTB 1BVSA 1E32A 2YNMD 3L29A 4G6ZA 4LF8M 3HWSA 1IM2A 1OAOC 3HGIA 4AKHA 5FSWA 2VQEM 1PRBA 2JWSA 3SHFA 4K0KM 1QZMA 1R6BX 2VF7A 3IG8A 2V1UA 1J09A 1L2BA 2UUBM 1OJLA 2WSFF 2BNKA 3K92A 1N33M 2DWNA 2FH0A 4NRVA 2I7NA 1NVMA 2QZ4A 1JB0F 3VFDA 4LFCM 2J7NA 4JI1M 1IY0A 1NHGC 2LVNC 4L15A 4DR5M 1PJIA 3VDPA 3PFIA 4IBDA 2ZTCA 2Z4SA 1QAOA 1IN6A 3GRUA 1CUKA 3QYBA 3D8BA 1R2YA 2EUCA 1WIVA 3R8FA 3U6OA 2VQFM 1DO2A 4AW4A 4D82A 3B7NA 1T6OA 2O25A 3FUWA 4KODA 4QNMA 3HHWA 3DOAA 4GKKM 4NSRA 5EXTA 4AQYM 3GQ4A 1C7YA 1PJQA 3A46A 4YHHM 4G4QA 1FNNA 4DUYM 3JAMS 2JY5A 2L4FA 3KP0E 3KOZE 4DR1M 1L2CA 2M5ZA 4F2LA 2V1CA 4GKJM 4NXMM 2E5LM 1MJGM 4XBOA 2K9DA 1EFUB 2R0IA 4OU7A 5E6JA 4I8OA 2KW0A 2JNHA 3WHLA 4B3TM 3VLFB 2K0BX 4NOOB 5LMUM 2MROB 4GHAA 4G4RA 5ITXA 4B3MM 3QAUA 3KOXE 1NO1A 2DNAA 3E21A 3AKZA 2B3TA 1Y8GA 4PDIA 3FTCA 2C9OA 3THGA 2CHVA 2HHHM 3DZDA 3GP1A 2F5PA 2DZNB 2LVQD 2UXDM 4LGMA 1XMOM 4Y28F 4GH9A 3SASA 2XH9A 3UZUA 2DI0A 4MB7A 2GQFA 1Q3CA 4CIZA 4KLNA 1A5TA 4L6V6 2EKKA 2KZUA 2LBCA 3U6DA 3FTFA 3FUTA 3KVWA 4FCTA 3PXGA 2OOAA 2L09A 1SG9A 4XGIA 2RRUA 3JR4A 4BBAA 3GO8A 2K47A 1PJSA 1ZMVA 3SMPA 3TPZA 1NHWC 1PGYA 3HJSA 3R9XB 4OW0A 3D8LA 3U60B 2KNVA 3GLHA 4D81A 2LWXA 4I5SA 2BJVA 4X65M 3HHYA 3AOEA 1DGHB 4M0DA 5C18A 1IXSA 2BWEA 3M7GA 3GLHB 5DNYA 2QNJA 3UGJA 1WJ7A 1TDHA 1WHCA 2VDBB 3NBXX 3V76A 4F1IA 2UXCM 2EO2A 3U6QA 1FJGM 1Z5BA 3HJ8A 2KNZA 3FUUA 5ITYA 3CGWA 3GQ5A 2QBYB 2Z3XA 3TL4X 2HKJA 3SARA 2D7HA 3SAVA 1OFHA 2DZOB 1IN5A 4BB9A 3U5ZB 4HLQA 1VDLA 1QQWA 2KNAA 1J5EM 2A5YB 1OFIA 1SXJD 2XFSA 5DFLA 5KQ8A 1TH4A 2EA0A 3KFUG 2Z7JA 1DGBA 4B08A 1VG5A 5ITQA 2AHMA 4QOZC 1UM8A 1TDZA 3EIHA 1TH2A 4JI0M 4LJ5A 3GLIE 4DV3M 2C98A 5EP2A 3KDSE 3IHPA 3AOEC 1SXJE 3W67A 1N77A 1IXZA 2R45A 4HEOA 3B74A 4IBBA 1G71A 4R7GA 4ZPXA 3FUXA 1W5TA 3FKEA 4LF5M 4OX9M 3J27B 3KSXA 4MGYE 3GPUA 3LQRA 3GRRA 1Q39A 3PVSA 1W5SA 1KSFX 3RFWA 4WP2A 3KS4A 1R5LA 2ZAOA 4P17A 1GABA 3CTWB 1G4AE 1H6UA 4R3DA 1Z5CA 4X66M 1V34A 2MR9A 3U60A 4A3VB 2Z8YM 1YLAA 1N78A 4JI8M 5EXXA 2JY6B 3U6PA 1IN7A 3GLFB 1QVRA 1XXHA 3J80S 4JI5M 5ITXE 4LJ4A 3C58A 3FTEA 1IN4A 1AUAA 3SBJA 1DO0A 4RF0A 3BBZA 2ZAMA 1DGFA 4DV7M 4G3OA 4LFBM 1PM5A 1ORYB 1V92A 3K8ZA 5IT9S 1XWIA 1VEGA 3B9PA 5EXPA 1VEJA 4B3RM 4PT5A 2UXBM 3CF0A 3ZH9B 2DENA 5A2QS 3GLGE 1DGHA 3LCUA 3AOGA 4EIWA 2DWZB 2KEBA 1SXJB 4JXJA 3FYDA 2R4EA 1E9RA 2O5RA 1D2NA 4I4LA 5EQTA 2F5SA 1Z6TA 2QBYA 4IBEA 3Q8XA 3OTOM 1Z5AA 2Y0QA 2CFOA 4M0WA 1XHBA 3K9OA 4LJ6A 5DYGA 3FUVA 4JI6M 1Z59A 3LVVA 1WR1B 1QAMA 3GRVA 3L26A 1HT1E 4LF4M 1XNRM 3ZCBB 2DVWB 2VIIA 3RGSA 4L8RC 3GPXA 2MGWA 4MGIE 3T1HM 2JZ0A 2X49A 5FTMA 1LTMA 2RGHA 3BXWA 4X62M 3GLIB 4NSOB 1IBKM 1UFZA 2QENA 1QANA 1NV9A 4JI2M 4CJ6A 1F4IA 1G3IA 2M60A 1VDDA 2C9CA 4NXNM 3LMMA 3GPPA 4ANRA 2HWJA 3A98B 2Y21A 4Z8XA 5BR8M 1R7RA 5KPTA 3TWMA 2C5RA 4FW9A 3B7ZA 4FCVA 2CRUA 2FNAA 2Q2EB 3PNVA 4WURA 3T38A 2DAEA 1XXHE 5EP3A 1IQPA 5ITUA 3T15A 2UUCM 4JI7M 1D0MA 1GJTA 4LRSA 3U6MA 2DKLA 2WSCF 1MN3A 4ITQA 1GVNA 1NNJA 1OKSA 1SXJA 5IZ7D 3FE3A 2G8LA 3KSJA 3KP1E 4B7FA 3SAUA 4DR6M 4PCZA 3K2LA 1ZMUA 2DAIA 3EIEA 2QPAA 3E46A 3B7QA 1ZV1A 3VDUA 4LFAM 1YUBA 4GIPA 3I01M 4M9ZA 1YE9A 1N36M 3C3EA 4DUZM 3L25A 3LCVB 2NQ8C 3C3DA 3KOYE 3W68A 1L2DA 2LVOC 3DA1A 5EP1A 3KOWE 3QWLA 4Q7JA 1D0KA 4IJEA 3TWKA 4LJ9A 3IECA 3HY5A 2LHCA 3SMSA 2QCUA 3LVWA 4R71A 2D7EA 2OOBA 2UUAM 4CISA 2WZJA 1LV7A 2KA6B 4LZJA 4QHTA 1V33A 3AJIB 2XSZA 3K1JA 3GPYA 2CWBA 2R46A 3HU2A 4LY6A 4MGHA 3U6EA 1ZAEA 3L28A 3TE6A 1JR3E 2R62A 3J81S 4M9SA 4GC9A 1T43A 3RGPA 3A45A 4B7GA 1R2ZA 1Q3BA 4DV6M 4JV5M 2HCBA 2QQ8A 5ITTA 2K6BA 2XFTA 1QUSA 2XGNA 3GLIA 3U6LA 2KRKA 4RKUF 3GLFA 1JR3D 4G4OA 2JZ1A 3GRYA 2F5NA 2DZLA 4DBGB 1IXSB 4AKGA 3NWLA 3T1YM 4IJFA 5KO3A 2CHQA 4I81A 4JI4M 3SFZA 4IBJA 2Y20A 2BWBA 2R65A 2CUZA 4S12A 2L7HA 1QUTA 1L1ZA 1XNQM 1NV8A 3L2AA 3U61B 2ERCA 1VQ1A 4REZA 4LRTA 2JXNA 1L8QA 3L27A 3B89A 4NL4H 4QHSA 3UJNA 3U61A 4II7A 2QHOB 2LHGA 3GLHE 4IIWA 1SXJC 1G41A 1QDTA 2R44A 2MH8A 1QDRA 3ZC7B 4DV1M 3SAWA 3CF6E 3ILKA 5F3WA 2LTUA 3C9PA 2CE7A 3E9SA 4LJ8A 1T3TA 3MMPA 1X37A 4JN6A 1HNXM 3U6SA 3J7BA 4DR3M 2DAKA 4MGKE 2MJ5B 4GEWA 3GLGA
chains in the Genus database with same CATH topology
3AL0C 4IBIA 3UMMA 4GHLA 1IXRC 3GLGB 4DR7M 1YSYA 5FTJA 4P16A 2OPFA 1PJJA 2Y0TA 4GITA 1NSFA 5H37D 2X4AA 4PDGA 4GRIA 5C1BA 3SATA 5KPZA 1N75A 2C99A 4OVZB 2X8AA 5FTNA 3KS8A 1K82A 1I4WA 2QP9X 2F5QA 5ITRA 3J7AS 2FOIC 4RNAA 5FTKA 2F4VM 4DV4M 4B3SM 3M0EA 2P5TA 1QAQA 3MK6A 5E26A 2LXEA 3HJQA 1HQCA 4LJAA 2YFQA 2KXEA 4DV5M 3FTDA 3FD9A 4DR4M 4TUWA 1XMQM 3J2PB 3U5ZA 4LJ7A 4FWHA 4IBFA 2CV2A 1IBMM 1NY5A 3A42A 3WHKA 4GMQA 2RGOA 4M9XA 4W5WA 3W0FA 1KFVA 1HR0M 1ZQ9A 1G8PA 3SHGB 8CATA 4FD2A 3VKHA 2L7IA 3MHVC 4KHPM 2XLJA 2G5GX 4FWDA 4IBKA 1E9SA 3W0LB 2C96A 4JYAM 4DV2M 1GL7A 3TQSA 2LNHC 1DGGA 1GL6A 4YY3M 4LCBA 4OVZA 4G4NA 1I94M 5EJCA 1JR3A 1JQJC 5KQDA 2HL7A 5KPRA 1N34M 4GC5A 1J7KA 1S3SA 1IN8A 1MX0A 1TGUA 4D80A 3AV0A 3VKGA 4QOSA 4KO8A 3AFHA 4IBCA 3VK7A 1NY6A 1IBLM 1N32M 1WXQA 3UK6A 1NNUC 2LH0A 3M6AA 4AG5A 2W82A 2CV1A 3LQQA 5FLXS 1TH3A 3HHXA 5JI3E 3H4MA 3U6CA 4NRWA 1HNZM 2R18A 3I4VA 4JI3M 2KZSA 4MM3B 2XSZD 3E4RA 3PNYA 2CHGA 1E94E 1IY2A 5EP4A 4L78A 5DYIA 4RF1A 4FWGA 3HU3A 4B7HA 1C1KA 2JA2A 4BLCA 4MGZE 5FTLA 2R4JA 4LF9M 1QYRA 5BPVA 3MJ5A 2DXIA 2ZBKB 3HKPA 2DWLA 2DHRA 1NJGA 5EXSA 2CEAA 5GKNA 2XZUA 2F5OA 1HT2E 4LF7M 4Z6YA 4AKIA 3I51A 7CATA 2RKOA 2H1RA 3BOSA 4L16A 3TWLA 3CF2A 2V6ZM 4LZZA 1IY1A 2XEPA 4AG6A 2I7PA 2YQZA 4CGYB 1NJFA 4LGYA 1EE8A 5IREB 2FFJA 3HU1A 4DV0M 4MH0E 2YR0A 2ZANA 4QNRA 1HQYE 3HHZA 1HNWM 2ZM6M 4IBGA 1GKIA 2XF3A 3NBIA 1L1TA 3DFZA 1K3WA 1GLNA 2D7GA 2FE8A 1G59A 4FCWA 2BJWA 2DWMA 3RE8A 4FVMA 3GQ3A 3SYLA 2UU9M 3SC3A 4X64M 5LMNM 3I4YA 3JR5A 1XC8A 3IG5A 2XZFA 4HL4A 3KW6A 1KYIA 4WW0A 2CV0A 3KXEC 2Z4RA 1K3XA 4AZFA 4AI6A 3VK8A 4DR2M 5IWAM 2KRUA 4L4UA 3SYKA 4LF6M 1MU5A 4LG2A 2L6OA 3FYCA 5JI2E 2OQ4A 4PD2A 2J7OA 1XXHB 4CHTB 1E32A 2YNMD 3L29A 4G6ZA 4LF8M 3HWSA 1IM2A 3HGIA 4AKHA 5FSWA 2VQEM 3SHFA 4K0KM 1QZMA 1R6BX 3IG8A 2V1UA 1J09A 1L2BA 2UUBM 1OJLA 3K92A 2BNKA 1N33M 2DWNA 4NRVA 2I7NA 1NVMA 2QZ4A 3VFDA 4LFCM 2J7NA 4JI1M 1IY0A 1NHGC 4L15A 4DR5M 1PJIA 3VDPA 3PFIA 4IBDA 2Z4SA 1QAOA 1IN6A 3GRUA 3D8BA 1R2YA 2EUCA 3R8FA 3U6OA 2VQFM 1DO2A 4AW4A 4D82A 3FUWA 4KODA 4QNMA 3HHWA 3DOAA 4GKKM 4NSRA 5EXTA 4AQYM 3GQ4A 3A46A 4YHHM 4G4QA 1FNNA 4DUYM 3JAMS 3KP0E 3KOZE 4DR1M 1L2CA 2M5ZA 2V1CA 4GKJM 4NXMM 2E5LM 4XBOA 4OU7A 5E6JA 4I8OA 2KW0A 3WHLA 4B3TM 3VLFB 5LMUM 4NOOB 4GHAA 4G4RA 5ITXA 4B3MM 3QAUA 3KOXE 3AKZA 4PDIA 3FTCA 2C9OA 3THGA 2CHVA 2HHHM 3DZDA 3GP1A 2F5PA 2DZNB 2UXDM 4LGMA 1XMOM 4GH9A 3SASA 2XH9A 3UZUA 4MB7A 1Q3CA 4KLNA 2KZUA 3U6DA 3FTFA 3FUTA 3KVWA 4FCTA 3PXGA 2L09A 4XGIA 3JR4A 4BBAA 3GO8A 2K47A 3SMPA 3TPZA 1NHWC 3R9XB 3HJSA 4OW0A 3D8LA 3U60B 3GLHA 4D81A 2LWXA 4I5SA 2BJVA 4X65M 3HHYA 3AOEA 1DGHB 4M0DA 5C18A 3M7GA 3GLHB 5DNYA 3UGJA 1TDHA 2UXCM 2EO2A 3U6QA 1FJGM 1Z5BA 3HJ8A 3FUUA 5ITYA 3GQ5A 2QBYB 2Z3XA 3TL4X 2HKJA 3SARA 2D7HA 3SAVA 1OFHA 2DZOB 1IN5A 4BB9A 3U5ZB 4HLQA 1QQWA 1J5EM 2A5YB 1OFIA 1SXJD 2XFSA 5KQ8A 3KFUG 1TH4A 2EA0A 2Z7JA 1DGBA 4B08A 5ITQA 2AHMA 4QOZC 1UM8A 1TDZA 3EIHA 1TH2A 4JI0M 4LJ5A 4DV3M 2C98A 5EP2A 3KDSE 3AOEC 1SXJE 1N77A 1IXZA 2R45A 4IBBA 4R7GA 4ZPXA 3FUXA 1W5TA 3FKEA 4LF5M 4OX9M 3J27B 3KSXA 4MGYE 3GPUA 3LQRA 3GRRA 1Q39A 3PVSA 1W5SA 1KSFX 3RFWA 3KS4A 2ZAOA 3CTWB 1G4AE 1H6UA 4R3DA 1Z5CA 4X66M 3U60A 4A3VB 1N78A 4JI8M 5EXXA 3U6PA 1IN7A 3GLFB 1QVRA 3J80S 4JI5M 5ITXE 4LJ4A 3C58A 3FTEA 1IN4A 3SBJA 1DO0A 4RF0A 2ZAMA 1DGFA 4DV7M 4LFBM 1PM5A 1ORYB 3K8ZA 5IT9S 1XWIA 3B9PA 5EXPA 4B3RM 2UXBM 4PT5A 3CF0A 3ZH9B 5A2QS 1DGHA 3AOGA 4EIWA 2DWZB 2KEBA 1SXJB 4JXJA 3FYDA 2R4EA 1E9RA 2O5RA 1D2NA 4I4LA 5EQTA 2F5SA 1Z6TA 2QBYA 4IBEA 3Q8XA 3OTOM 1Z5AA 2Y0QA 2CFOA 4M0WA 1XHBA 5DYGA 4LJ6A 4JI6M 3FUVA 1Z59A 3LVVA 1QAMA 3GRVA 3L26A 1HT1E 4LF4M 1XNRM 3ZCBB 2DVWB 2VIIA 3RGSA 4L8RC 3GPXA 4MGIE 3T1HM 2X49A 5FTMA 3GLIB 2RGHA 4X62M 4NSOB 1IBKM 2QENA 1QANA 4JI2M 1G3IA 2M60A 1VDDA 2C9CA 4NXNM 3LMMA 3GPPA 3A98B 2Y21A 4Z8XA 5BR8M 1R7RA 5KPTA 3TWMA 2C5RA 4FW9A 4FCVA 2FNAA 2Q2EB 3PNVA 4WURA 3T38A 5EP3A 1IQPA 5ITUA 3T15A 2UUCM 4JI7M 4LRSA 3U6MA 4ITQA 1GVNA 1NNJA 1SXJA 5IZ7D 3KSJA 2G8LA 3KP1E 4B7FA 3SAUA 4DR6M 4PCZA 3K2LA 3EIEA 2QPAA 3VDUA 4LFAM 1YUBA 4GIPA 4M9ZA 1N36M 1YE9A 3L25A 4DUZM 2NQ8C 3KOYE 1L2DA 3DA1A 5EP1A 3KOWE 3QWLA 3TWKA 4IJEA 4LJ9A 2UUAM 3SMSA 2QCUA 3LVWA 4CISA 2D7EA 1LV7A 2KA6B 4LZJA 4QHTA 3AJIB 3K1JA 2XSZA 3GPYA 2R46A 3HU2A 4LY6A 4MGHA 3U6EA 1ZAEA 3L28A 3TE6A 3J81S 2R62A 4M9SA 4GC9A 3RGPA 1R2ZA 3A45A 4B7GA 1Q3BA 4DV6M 4JV5M 2HCBA 5ITTA 2XFTA 2XGNA 3GLIA 3U6LA 2KRKA 3GLFA 1JR3D 4G4OA 3GRYA 2F5NA 4AKGA 1IXSB 3NWLA 3T1YM 4IJFA 5KO3A 2CHQA 4I81A 4JI4M 3SFZA 4IBJA 2Y20A 2R65A 2CUZA 4S12A 2L7HA 1L1ZA 1XNQM 3L2AA 3U61B 2ERCA 4REZA 4LRTA 3L27A 1L8QA 4NL4H 4QHSA 3UJNA 3U61A 4II7A 4IIWA 1SXJC 1G41A 3ZC7B 4DV1M 3SAWA 3CF6E 3ILKA 5F3WA 2CE7A 3E9SA 4LJ8A 1T3TA 4JN6A 1X37A 1HNXM 3U6SA 3J7BA 4DR3M 4MGKE 1XXHA 3GLGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XNR M;  3GPX A;  1EE8 A;  4DR7 M;  4MB7 A;  3T1H M;  4DV0 M;  1Q3C A;  4X62 M;  1PJJ A;  1IBK M;  4PDG A;  4JI2 M;  1HNW M;  4NXN M;  2ZM6 M;  3GPP A;  3U6D A;  3SAT A;  1L1T A;  1K3W A;  1K82 A;  5BR8 M;  2F5Q A;  5ITR A;  3TWM A;  3J7A S;  2F4V M;  3JR4 A;  4DV4 M;  3GO8 A;  2Q2E B;  4B3S M;  3GQ3 A;  2UUC M;  5ITU A;  2UU9 M;  4JI7 M;  3U6M A;  4X64 M;  5LMN M;  3JR5 A;  4X65 M;  4ITQ A;  1XC8 A;  2XZF A;  4DV5 M;  1NNJ A;  1TDH A;  2UXC M;  3U6Q A;  1FJG M;  4DR4 M;  1Z5B A;  3SAU A;  1XMQ M;  4DR6 M;  1K3X A;  5ITY A;  4PCZ A;  3GQ5 A;  4DR2 M;  5IWA M;  3VK8 A;  2HKJ A;  3SAR A;  3SAV A;  1IBM M;  3A42 A;  4LF6 M;  4LFA M;  1MU5 A;  1J5E M;  1N36 M;  2OQ4 A;  3W0F A;  4PD2 A;  4DUZ M;  2EA0 A;  1KFV A;  1HR0 M;  1L2D A;  5ITQ A;  1TDZ A;  3TWK A;  4JI0 M;  4LF8 M;  2UUA M;  4CIS A;  2VQE M;  4KHP M;  4DV3 M;  4K0K M;  4JYA M;  3GPY A;  4DV2 M;  1L2B A;  2UUB M;  1N33 M;  3U6E A;  4YY3 M;  4NRV A;  3J81 S;  4G4N A;  1I94 M;  1R2Z A;  4LF5 M;  3A45 A;  4LFC M;  4OX9 M;  1Q3B A;  4JI1 M;  3GPU A;  4DR5 M;  4DV6 M;  1Q39 A;  1PJI A;  1N34 M;  4JV5 M;  5ITT A;  1MX0 A;  1R2Y A;  1Z5C A;  3U6L A;  3VK7 A;  4X66 M;  4G4O A;  3U6O A;  4JI8 M;  2VQF M;  3U6P A;  1IBL M;  2F5N A;  3J80 S;  4JI5 M;  1N32 M;  5ITX E;  3T1Y M;  3C58 A;  3SBJ A;  3DOA A;  4JI4 M;  5FLX S;  4AQY M;  4GKK M;  3GQ4 A;  4NRW A;  3U6C A;  3A46 A;  1HNZ M;  4YHH M;  4DV7 M;  4G4Q A;  4DUY M;  3JAM S;  4DR1 M;  1PM5 A;  4JI3 M;  1L1Z A;  1L2C A;  1XNQ M;  4LFB M;  5IT9 S;  4GKJ M;  4B3R M;  2UXB M;  4NXM M;  2E5L M;  5A2Q S;  4B3T M;  5LMU M;  4G4R A;  5ITX A;  4B3M M;  4LF9 M;  2F5S A;  4DV1 M;  2ZBK B;  3SAW A;  3OTO M;  1Z5A A;  2XZU A;  4PDI A;  2F5O A;  4LF7 M;  4JI6 M;  1HNX M;  3U6S A;  2HHH M;  1Z59 A;  3GP1 A;  4DR3 M;  2F5P A;  2UXD M;  1XMO M;  3TWL A;  2OPF A;  4LF4 M;  3SAS A; 
#chains in the Genus database with same CATH topology
 3AL0 C;  1EIJ A;  2H5X A;  4IBI A;  3UMM A;  4GHL A;  1IXR C;  3GLG B;  2JY7 A;  4DR7 M;  1YSY A;  5FTJ A;  4P16 A;  2OPF A;  1PJJ A;  3Q8G A;  2Y0T A;  2LVA A;  4GIT A;  1NSF A;  5H37 D;  2DHY A;  2X4A A;  4PDG A;  1ZMW A;  4GRI A;  2KDL A;  2DAG A;  5C1B A;  3SAT A;  4NC6 A;  5KPZ A;  1N75 A;  2C99 A;  4OVZ B;  2X8A A;  5FTN A;  1P3Q Q;  3KS8 A;  1K82 A;  1GJS A;  1I4W A;  2QP9 X;  2F5Q A;  5ITR A;  3J7A S;  2DAM A;  2FOI C;  4RNA A;  5FTK A;  2F4V M;  4DV4 M;  4B3S M;  3M0E A;  2P5T A;  1QAQ A;  2J5Y A;  3MK6 A;  5E26 A;  1RU3 A;  2LXE A;  3HJQ A;  1HQC A;  2LVP C;  4LJA A;  2L4E A;  2YFQ A;  2KXE A;  4DV5 M;  3FTD A;  3FD9 A;  4DR4 M;  2EJS A;  4TUW A;  1XMQ M;  2APL A;  3J2P B;  3U5Z A;  2GNO A;  4LJ7 A;  4FWH A;  4IBF A;  2CV2 A;  1IBM M;  1NY5 A;  3A42 A;  3WHK A;  4GMQ A;  2RGO A;  4M9X A;  4W5W A;  3W0F A;  1R4G A;  1KFV A;  2FS1 A;  1HR0 M;  1ZQ9 A;  1G8P A;  3SHG B;  8CAT A;  3GLF E;  4FD2 A;  3VKH A;  1OAI A;  2L7I A;  3MHV C;  4KHP M;  2XLJ A;  2G5G X;  3HZJ A;  4FWD A;  1AIP C;  1E9S A;  4IBK A;  3W0L B;  2C96 A;  1TR8 A;  4JYA M;  4DV2 M;  1GL7 A;  3TQS A;  2LNH C;  1DGG A;  1GL6 A;  4YY3 M;  4LCB A;  1IFY A;  3FRI A;  4OVZ A;  4G4N A;  1I94 M;  5EJC A;  1JR3 A;  1JQJ C;  5KQD A;  2HL7 A;  5KPR A;  1N34 M;  4GC5 A;  1J7K A;  1IN8 A;  1MX0 A;  1S3S A;  1TGU A;  4D80 A;  3AV0 A;  1GO5 A;  3VKG A;  4QOS A;  4KO8 A;  3K9P A;  3ZQJ A;  3AFH A;  4IBC A;  3VK7 A;  1NY6 A;  3I04 M;  1IBL M;  2G3Q A;  1OIP A;  1N32 M;  1WXQ A;  3UK6 A;  1NNU C;  2LH0 A;  3M6A A;  4AG5 A;  2W82 A;  2ZTD A;  2CV1 A;  1HJP A;  3LQQ A;  5FLX S;  1TH3 A;  3HHX A;  5JI3 E;  3H4M A;  1VEK A;  3U6C A;  1HNZ M;  4NRW A;  2HAK A;  2R18 A;  3I4V A;  4JI3 M;  2KZS A;  1PJT A;  4MM3 B;  2XSZ D;  3E4R A;  3PNY A;  2CHG A;  1E94 E;  1IY2 A;  5EP4 A;  4L78 A;  3HX3 A;  5DYI A;  2OO9 A;  4RF1 A;  1WGL A;  4FWG A;  3HU3 A;  4B7H A;  1C1K A;  2JA2 A;  4BLC A;  2JY8 A;  4MGZ E;  5FTL A;  2R4J A;  1WGN A;  1QYR A;  5BPV A;  4LF9 M;  3MJ5 A;  2DXI A;  3H4J A;  2ZBK B;  2QSF X;  3HKP A;  3QYE A;  2DHR A;  1NJG A;  5EXS A;  2CEA A;  2DWL A;  1XB2 B;  2O01 F;  5GKN A;  2XZU A;  2EKF A;  1HT2 E;  1D0L A;  2N35 A;  2F5O A;  4LF7 M;  4Z6Y A;  2JUJ A;  3T6P A;  3I51 A;  7CAT A;  4AKI A;  2RKO A;  3FRH A;  2H1R A;  3BOS A;  4L16 A;  3TWL A;  3CF2 A;  2V6Z M;  4LZZ A;  1IY1 A;  2XEP A;  4AG6 A;  5L8R F;  2I7P A;  2YQZ A;  4CGY B;  1NJF A;  1TTE A;  2JP7 A;  4LGY A;  1EE8 A;  5IRE B;  2FFJ A;  3HU1 A;  3F92 A;  4DV0 M;  4MH0 E;  2YR0 A;  2VF8 A;  2ZAN A;  4QNR A;  1QZE A;  4XK8 F;  1DV0 A;  1HQY E;  3HHZ A;  1HNW M;  2ZM6 M;  4IBG A;  1GKI A;  2XF3 A;  3NBI A;  1L1T A;  3DFZ A;  1K3W A;  1GLN A;  2D7G A;  2R6F A;  2FE8 A;  1G59 A;  4FCW A;  2BJW A;  2DWM A;  1OTR A;  3RE8 A;  4FVM A;  3GQ3 A;  3SYL A;  2UU9 M;  3SC3 A;  2L2D A;  4X64 M;  5LMN M;  3I4Y A;  3JR5 A;  1TF0 B;  1XC8 A;  1OIZ A;  3IG5 A;  2XZF A;  4HL4 A;  1OQY A;  3KW6 A;  1KYI A;  2KHH A;  4WW0 A;  2CV0 A;  3KXE C;  2Z4R A;  1K3X A;  4AZF A;  4AI6 A;  3VK8 A;  4DR2 M;  5IWA M;  2KRU A;  1Q02 A;  4L4U A;  3SYK A;  4LF6 M;  2CP8 A;  1MU5 A;  4LG2 A;  2L6O A;  3FYC A;  5JI2 E;  2OQ4 A;  4PD2 A;  2J7O A;  1XXH B;  4KT0 F;  4UN2 B;  3LW5 F;  2WSE F;  4CHT B;  1BVS A;  1E32 A;  2YNM D;  3L29 A;  4G6Z A;  4LF8 M;  3HWS A;  1IM2 A;  1OAO C;  3HGI A;  4AKH A;  5FSW A;  2VQE M;  1PRB A;  2JWS A;  3SHF A;  4K0K M;  1QZM A;  1R6B X;  2VF7 A;  3IG8 A;  2V1U A;  1J09 A;  1L2B A;  2UUB M;  1OJL A;  2WSF F;  2BNK A;  3K92 A;  1N33 M;  2DWN A;  2FH0 A;  4NRV A;  2I7N A;  1NVM A;  2QZ4 A;  1JB0 F;  3VFD A;  4LFC M;  2J7N A;  4JI1 M;  1IY0 A;  1NHG C;  2LVN C;  4L15 A;  4DR5 M;  1PJI A;  3VDP A;  3PFI A;  4IBD A;  2ZTC A;  2Z4S A;  1QAO A;  1IN6 A;  3GRU A;  1CUK A;  3QYB A;  3D8B A;  1R2Y A;  2EUC A;  1WIV A;  3R8F A;  3U6O A;  2VQF M;  1DO2 A;  4AW4 A;  4D82 A;  3B7N A;  1T6O A;  2O25 A;  3FUW A;  4KOD A;  4QNM A;  3HHW A;  3DOA A;  4GKK M;  4NSR A;  5EXT A;  4AQY M;  3GQ4 A;  1C7Y A;  1PJQ A;  3A46 A;  4YHH M;  4G4Q A;  1FNN A;  4DUY M;  3JAM S;  2JY5 A;  2L4F A;  3KP0 E;  3KOZ E;  4DR1 M;  1L2C A;  2M5Z A;  4F2L A;  2V1C A;  4GKJ M;  4NXM M;  2E5L M;  1MJG M;  4XBO A;  2K9D A;  1EFU B;  2R0I A;  4OU7 A;  5E6J A;  4I8O A;  2KW0 A;  2JNH A;  3WHL A;  4B3T M;  3VLF B;  2K0B X;  4NOO B;  5LMU M;  2MRO B;  4GHA A;  4G4R A;  5ITX A;  4B3M M;  3QAU A;  3KOX E;  1NO1 A;  2DNA A;  3E21 A;  3AKZ A;  2B3T A;  1Y8G A;  4PDI A;  3FTC A;  2C9O A;  3THG A;  2CHV A;  2HHH M;  3DZD A;  3GP1 A;  2F5P A;  2DZN B;  2LVQ D;  2UXD M;  4LGM A;  1XMO M;  4Y28 F;  4GH9 A;  3SAS A;  2XH9 A;  3UZU A;  2DI0 A;  4MB7 A;  2GQF A;  1Q3C A;  4CIZ A;  4KLN A;  1A5T A;  4L6V 6;  2EKK A;  2KZU A;  2LBC A;  3U6D A;  3FTF A;  3FUT A;  3KVW A;  4FCT A;  3PXG A;  2OOA A;  2L09 A;  1SG9 A;  4XGI A;  2RRU A;  3JR4 A;  4BBA A;  3GO8 A;  2K47 A;  1PJS A;  1ZMV A;  3SMP A;  3TPZ A;  1NHW C;  1PGY A;  3HJS A;  3R9X B;  4OW0 A;  3D8L A;  3U60 B;  2KNV A;  3GLH A;  4D81 A;  2LWX A;  4I5S A;  2BJV A;  4X65 M;  3HHY A;  3AOE A;  1DGH B;  4M0D A;  5C18 A;  1IXS A;  2BWE A;  3M7G A;  3GLH B;  5DNY A;  2QNJ A;  3UGJ A;  1WJ7 A;  1TDH A;  1WHC A;  2VDB B;  3NBX X;  3V76 A;  4F1I A;  2UXC M;  2EO2 A;  3U6Q A;  1FJG M;  1Z5B A;  3HJ8 A;  2KNZ A;  3FUU A;  5ITY A;  3CGW A;  3GQ5 A;  2QBY B;  2Z3X A;  3TL4 X;  2HKJ A;  3SAR A;  2D7H A;  3SAV A;  1OFH A;  2DZO B;  1IN5 A;  4BB9 A;  3U5Z B;  4HLQ A;  1VDL A;  1QQW A;  2KNA A;  1J5E M;  2A5Y B;  1OFI A;  1SXJ D;  2XFS A;  5DFL A;  5KQ8 A;  1TH4 A;  2EA0 A;  3KFU G;  2Z7J A;  1DGB A;  4B08 A;  1VG5 A;  5ITQ A;  2AHM A;  4QOZ C;  1UM8 A;  1TDZ A;  3EIH A;  1TH2 A;  4JI0 M;  4LJ5 A;  3GLI E;  4DV3 M;  2C98 A;  5EP2 A;  3KDS E;  3IHP A;  3AOE C;  1SXJ E;  3W67 A;  1N77 A;  1IXZ A;  2R45 A;  4HEO A;  3B74 A;  4IBB A;  1G71 A;  4R7G A;  4ZPX A;  3FUX A;  1W5T A;  3FKE A;  4LF5 M;  4OX9 M;  3J27 B;  3KSX A;  4MGY E;  3GPU A;  3LQR A;  3GRR A;  1Q39 A;  3PVS A;  1W5S A;  1KSF X;  3RFW A;  4WP2 A;  3KS4 A;  1R5L A;  2ZAO A;  4P17 A;  1GAB A;  3CTW B;  1G4A E;  1H6U A;  4R3D A;  1Z5C A;  4X66 M;  1V34 A;  2MR9 A;  3U60 A;  4A3V B;  2Z8Y M;  1YLA A;  1N78 A;  4JI8 M;  5EXX A;  2JY6 B;  3U6P A;  1IN7 A;  3GLF B;  1QVR A;  1XXH A;  3J80 S;  4JI5 M;  5ITX E;  4LJ4 A;  3C58 A;  3FTE A;  1IN4 A;  1AUA A;  3SBJ A;  1DO0 A;  4RF0 A;  3BBZ A;  2ZAM A;  1DGF A;  4DV7 M;  4G3O A;  4LFB M;  1PM5 A;  1ORY B;  1V92 A;  3K8Z A;  5IT9 S;  1XWI A;  1VEG A;  3B9P A;  5EXP A;  1VEJ A;  4B3R M;  4PT5 A;  2UXB M;  3CF0 A;  3ZH9 B;  2DEN A;  5A2Q S;  3GLG E;  1DGH A;  3LCU A;  3AOG A;  4EIW A;  2DWZ B;  2KEB A;  1SXJ B;  4JXJ A;  3FYD A;  2R4E A;  1E9R A;  2O5R A;  1D2N A;  4I4L A;  5EQT A;  2F5S A;  1Z6T A;  2QBY A;  4IBE A;  3Q8X A;  3OTO M;  1Z5A A;  2Y0Q A;  2CFO A;  4M0W A;  1XHB A;  3K9O A;  4LJ6 A;  5DYG A;  3FUV A;  4JI6 M;  1Z59 A;  3LVV A;  1WR1 B;  1QAM A;  3GRV A;  3L26 A;  1HT1 E;  4LF4 M;  1XNR M;  3ZCB B;  2DVW B;  2VII A;  3RGS A;  4L8R C;  3GPX A;  2MGW A;  4MGI E;  3T1H M;  2JZ0 A;  2X49 A;  5FTM A;  1LTM A;  2RGH A;  3BXW A;  4X62 M;  3GLI B;  4NSO B;  1IBK M;  1UFZ A;  2QEN A;  1QAN A;  1NV9 A;  4JI2 M;  4CJ6 A;  1F4I A;  1G3I A;  2M60 A;  1VDD A;  2C9C A;  4NXN M;  3LMM A;  3GPP A;  4ANR A;  2HWJ A;  3A98 B;  2Y21 A;  4Z8X A;  5BR8 M;  1R7R A;  5KPT A;  3TWM A;  2C5R A;  4FW9 A;  3B7Z A;  4FCV A;  2CRU A;  2FNA A;  2Q2E B;  3PNV A;  4WUR A;  3T38 A;  2DAE A;  1XXH E;  5EP3 A;  1IQP A;  5ITU A;  3T15 A;  2UUC M;  4JI7 M;  1D0M A;  1GJT A;  4LRS A;  3U6M A;  2DKL A;  2WSC F;  1MN3 A;  4ITQ A;  1GVN A;  1NNJ A;  1OKS A;  1SXJ A;  5IZ7 D;  3FE3 A;  2G8L A;  3KSJ A;  3KP1 E;  4B7F A;  3SAU A;  4DR6 M;  4PCZ A;  3K2L A;  1ZMU A;  2DAI A;  3EIE A;  2QPA A;  3E46 A;  3B7Q A;  1ZV1 A;  3VDU A;  4LFA M;  1YUB A;  4GIP A;  3I01 M;  4M9Z A;  1YE9 A;  1N36 M;  3C3E A;  4DUZ M;  3L25 A;  3LCV B;  2NQ8 C;  3C3D A;  3KOY E;  3W68 A;  1L2D A;  2LVO C;  3DA1 A;  5EP1 A;  3KOW E;  3QWL A;  4Q7J A;  1D0K A;  4IJE A;  3TWK A;  4LJ9 A;  3IEC A;  3HY5 A;  2LHC A;  3SMS A;  2QCU A;  3LVW A;  4R71 A;  2D7E A;  2OOB A;  2UUA M;  4CIS A;  2WZJ A;  1LV7 A;  2KA6 B;  4LZJ A;  4QHT A;  1V33 A;  3AJI B;  2XSZ A;  3K1J A;  3GPY A;  2CWB A;  2R46 A;  3HU2 A;  4LY6 A;  4MGH A;  3U6E A;  1ZAE A;  3L28 A;  3TE6 A;  1JR3 E;  2R62 A;  3J81 S;  4M9S A;  4GC9 A;  1T43 A;  3RGP A;  3A45 A;  4B7G A;  1R2Z A;  1Q3B A;  4DV6 M;  4JV5 M;  2HCB A;  2QQ8 A;  5ITT A;  2K6B A;  2XFT A;  1QUS A;  2XGN A;  3GLI A;  3U6L A;  2KRK A;  4RKU F;  3GLF A;  1JR3 D;  4G4O A;  2JZ1 A;  3GRY A;  2F5N A;  2DZL A;  4DBG B;  1IXS B;  4AKG A;  3NWL A;  3T1Y M;  4IJF A;  5KO3 A;  2CHQ A;  4I81 A;  4JI4 M;  3SFZ A;  4IBJ A;  2Y20 A;  2BWB A;  2R65 A;  2CUZ A;  4S12 A;  2L7H A;  1QUT A;  1L1Z A;  1XNQ M;  1NV8 A;  3L2A A;  3U61 B;  2ERC A;  1VQ1 A;  4REZ A;  4LRT A;  2JXN A;  1L8Q A;  3L27 A;  3B89 A;  4NL4 H;  4QHS A;  3UJN A;  3U61 A;  4II7 A;  2QHO B;  2LHG A;  3GLH E;  4IIW A;  1SXJ C;  1G41 A;  1QDT A;  2R44 A;  2MH8 A;  1QDR A;  3ZC7 B;  4DV1 M;  3SAW A;  3CF6 E;  3ILK A;  5F3W A;  2LTU A;  3C9P A;  2CE7 A;  3E9S A;  4LJ8 A;  1T3T A;  3MMP A;  1X37 A;  4JN6 A;  1HNX M;  3U6S A;  3J7B A;  4DR3 M;  2DAK A;  4MGK E;  2MJ5 B;  4GEW A;  3GLG A; 
#chains in the Genus database with same CATH homology
 3AL0 C;  4IBI A;  3UMM A;  4GHL A;  1IXR C;  3GLG B;  4DR7 M;  1YSY A;  5FTJ A;  4P16 A;  2OPF A;  1PJJ A;  2Y0T A;  4GIT A;  1NSF A;  5H37 D;  2X4A A;  4PDG A;  4GRI A;  5C1B A;  3SAT A;  5KPZ A;  1N75 A;  2C99 A;  4OVZ B;  2X8A A;  5FTN A;  3KS8 A;  1K82 A;  1I4W A;  2QP9 X;  2F5Q A;  5ITR A;  3J7A S;  2FOI C;  4RNA A;  5FTK A;  2F4V M;  4DV4 M;  4B3S M;  3M0E A;  2P5T A;  1QAQ A;  3MK6 A;  5E26 A;  2LXE A;  3HJQ A;  1HQC A;  4LJA A;  2YFQ A;  2KXE A;  4DV5 M;  3FTD A;  3FD9 A;  4DR4 M;  4TUW A;  1XMQ M;  3J2P B;  3U5Z A;  4LJ7 A;  4FWH A;  4IBF A;  2CV2 A;  1IBM M;  1NY5 A;  3A42 A;  3WHK A;  4GMQ A;  2RGO A;  4M9X A;  4W5W A;  3W0F A;  1KFV A;  1HR0 M;  1ZQ9 A;  1G8P A;  3SHG B;  8CAT A;  4FD2 A;  3VKH A;  2L7I A;  3MHV C;  4KHP M;  2XLJ A;  2G5G X;  4FWD A;  4IBK A;  1E9S A;  3W0L B;  2C96 A;  4JYA M;  4DV2 M;  1GL7 A;  3TQS A;  2LNH C;  1DGG A;  1GL6 A;  4YY3 M;  4LCB A;  4OVZ A;  4G4N A;  1I94 M;  5EJC A;  1JR3 A;  1JQJ C;  5KQD A;  2HL7 A;  5KPR A;  1N34 M;  4GC5 A;  1J7K A;  1S3S A;  1IN8 A;  1MX0 A;  1TGU A;  4D80 A;  3AV0 A;  3VKG A;  4QOS A;  4KO8 A;  3AFH A;  4IBC A;  3VK7 A;  1NY6 A;  1IBL M;  1N32 M;  1WXQ A;  3UK6 A;  1NNU C;  2LH0 A;  3M6A A;  4AG5 A;  2W82 A;  2CV1 A;  3LQQ A;  5FLX S;  1TH3 A;  3HHX A;  5JI3 E;  3H4M A;  3U6C A;  4NRW A;  1HNZ M;  2R18 A;  3I4V A;  4JI3 M;  2KZS A;  4MM3 B;  2XSZ D;  3E4R A;  3PNY A;  2CHG A;  1E94 E;  1IY2 A;  5EP4 A;  4L78 A;  5DYI A;  4RF1 A;  4FWG A;  3HU3 A;  4B7H A;  1C1K A;  2JA2 A;  4BLC A;  4MGZ E;  5FTL A;  2R4J A;  4LF9 M;  1QYR A;  5BPV A;  3MJ5 A;  2DXI A;  2ZBK B;  3HKP A;  2DWL A;  2DHR A;  1NJG A;  5EXS A;  2CEA A;  5GKN A;  2XZU A;  2F5O A;  1HT2 E;  4LF7 M;  4Z6Y A;  4AKI A;  3I51 A;  7CAT A;  2RKO A;  2H1R A;  3BOS A;  4L16 A;  3TWL A;  3CF2 A;  2V6Z M;  4LZZ A;  1IY1 A;  2XEP A;  4AG6 A;  2I7P A;  2YQZ A;  4CGY B;  1NJF A;  4LGY A;  1EE8 A;  5IRE B;  2FFJ A;  3HU1 A;  4DV0 M;  4MH0 E;  2YR0 A;  2ZAN A;  4QNR A;  1HQY E;  3HHZ A;  1HNW M;  2ZM6 M;  4IBG A;  1GKI A;  2XF3 A;  3NBI A;  1L1T A;  3DFZ A;  1K3W A;  1GLN A;  2D7G A;  2FE8 A;  1G59 A;  4FCW A;  2BJW A;  2DWM A;  3RE8 A;  4FVM A;  3GQ3 A;  3SYL A;  2UU9 M;  3SC3 A;  4X64 M;  5LMN M;  3I4Y A;  3JR5 A;  1XC8 A;  3IG5 A;  2XZF A;  4HL4 A;  3KW6 A;  1KYI A;  4WW0 A;  2CV0 A;  3KXE C;  2Z4R A;  1K3X A;  4AZF A;  4AI6 A;  3VK8 A;  4DR2 M;  5IWA M;  2KRU A;  4L4U A;  3SYK A;  4LF6 M;  1MU5 A;  4LG2 A;  2L6O A;  3FYC A;  5JI2 E;  2OQ4 A;  4PD2 A;  2J7O A;  1XXH B;  4CHT B;  1E32 A;  2YNM D;  3L29 A;  4G6Z A;  4LF8 M;  3HWS A;  1IM2 A;  3HGI A;  4AKH A;  5FSW A;  2VQE M;  3SHF A;  4K0K M;  1QZM A;  1R6B X;  3IG8 A;  2V1U A;  1J09 A;  1L2B A;  2UUB M;  1OJL A;  3K92 A;  2BNK A;  1N33 M;  2DWN A;  4NRV A;  2I7N A;  1NVM A;  2QZ4 A;  3VFD A;  4LFC M;  2J7N A;  4JI1 M;  1IY0 A;  1NHG C;  4L15 A;  4DR5 M;  1PJI A;  3VDP A;  3PFI A;  4IBD A;  2Z4S A;  1QAO A;  1IN6 A;  3GRU A;  3D8B A;  1R2Y A;  2EUC A;  3R8F A;  3U6O A;  2VQF M;  1DO2 A;  4AW4 A;  4D82 A;  3FUW A;  4KOD A;  4QNM A;  3HHW A;  3DOA A;  4GKK M;  4NSR A;  5EXT A;  4AQY M;  3GQ4 A;  3A46 A;  4YHH M;  4G4Q A;  1FNN A;  4DUY M;  3JAM S;  3KP0 E;  3KOZ E;  4DR1 M;  1L2C A;  2M5Z A;  2V1C A;  4GKJ M;  4NXM M;  2E5L M;  4XBO A;  4OU7 A;  5E6J A;  4I8O A;  2KW0 A;  3WHL A;  4B3T M;  3VLF B;  5LMU M;  4NOO B;  4GHA A;  4G4R A;  5ITX A;  4B3M M;  3QAU A;  3KOX E;  3AKZ A;  4PDI A;  3FTC A;  2C9O A;  3THG A;  2CHV A;  2HHH M;  3DZD A;  3GP1 A;  2F5P A;  2DZN B;  2UXD M;  4LGM A;  1XMO M;  4GH9 A;  3SAS A;  2XH9 A;  3UZU A;  4MB7 A;  1Q3C A;  4KLN A;  2KZU A;  3U6D A;  3FTF A;  3FUT A;  3KVW A;  4FCT A;  3PXG A;  2L09 A;  4XGI A;  3JR4 A;  4BBA A;  3GO8 A;  2K47 A;  3SMP A;  3TPZ A;  1NHW C;  3R9X B;  3HJS A;  4OW0 A;  3D8L A;  3U60 B;  3GLH A;  4D81 A;  2LWX A;  4I5S A;  2BJV A;  4X65 M;  3HHY A;  3AOE A;  1DGH B;  4M0D A;  5C18 A;  3M7G A;  3GLH B;  5DNY A;  3UGJ A;  1TDH A;  2UXC M;  2EO2 A;  3U6Q A;  1FJG M;  1Z5B A;  3HJ8 A;  3FUU A;  5ITY A;  3GQ5 A;  2QBY B;  2Z3X A;  3TL4 X;  2HKJ A;  3SAR A;  2D7H A;  3SAV A;  1OFH A;  2DZO B;  1IN5 A;  4BB9 A;  3U5Z B;  4HLQ A;  1QQW A;  1J5E M;  2A5Y B;  1OFI A;  1SXJ D;  2XFS A;  5KQ8 A;  3KFU G;  1TH4 A;  2EA0 A;  2Z7J A;  1DGB A;  4B08 A;  5ITQ A;  2AHM A;  4QOZ C;  1UM8 A;  1TDZ A;  3EIH A;  1TH2 A;  4JI0 M;  4LJ5 A;  4DV3 M;  2C98 A;  5EP2 A;  3KDS E;  3AOE C;  1SXJ E;  1N77 A;  1IXZ A;  2R45 A;  4IBB A;  4R7G A;  4ZPX A;  3FUX A;  1W5T A;  3FKE A;  4LF5 M;  4OX9 M;  3J27 B;  3KSX A;  4MGY E;  3GPU A;  3LQR A;  3GRR A;  1Q39 A;  3PVS A;  1W5S A;  1KSF X;  3RFW A;  3KS4 A;  2ZAO A;  3CTW B;  1G4A E;  1H6U A;  4R3D A;  1Z5C A;  4X66 M;  3U60 A;  4A3V B;  1N78 A;  4JI8 M;  5EXX A;  3U6P A;  1IN7 A;  3GLF B;  1QVR A;  3J80 S;  4JI5 M;  5ITX E;  4LJ4 A;  3C58 A;  3FTE A;  1IN4 A;  3SBJ A;  1DO0 A;  4RF0 A;  2ZAM A;  1DGF A;  4DV7 M;  4LFB M;  1PM5 A;  1ORY B;  3K8Z A;  5IT9 S;  1XWI A;  3B9P A;  5EXP A;  4B3R M;  2UXB M;  4PT5 A;  3CF0 A;  3ZH9 B;  5A2Q S;  1DGH A;  3AOG A;  4EIW A;  2DWZ B;  2KEB A;  1SXJ B;  4JXJ A;  3FYD A;  2R4E A;  1E9R A;  2O5R A;  1D2N A;  4I4L A;  5EQT A;  2F5S A;  1Z6T A;  2QBY A;  4IBE A;  3Q8X A;  3OTO M;  1Z5A A;  2Y0Q A;  2CFO A;  4M0W A;  1XHB A;  5DYG A;  4LJ6 A;  4JI6 M;  3FUV A;  1Z59 A;  3LVV A;  1QAM A;  3GRV A;  3L26 A;  1HT1 E;  4LF4 M;  1XNR M;  3ZCB B;  2DVW B;  2VII A;  3RGS A;  4L8R C;  3GPX A;  4MGI E;  3T1H M;  2X49 A;  5FTM A;  3GLI B;  2RGH A;  4X62 M;  4NSO B;  1IBK M;  2QEN A;  1QAN A;  4JI2 M;  1G3I A;  2M60 A;  1VDD A;  2C9C A;  4NXN M;  3LMM A;  3GPP A;  3A98 B;  2Y21 A;  4Z8X A;  5BR8 M;  1R7R A;  5KPT A;  3TWM A;  2C5R A;  4FW9 A;  4FCV A;  2FNA A;  2Q2E B;  3PNV A;  4WUR A;  3T38 A;  5EP3 A;  1IQP A;  5ITU A;  3T15 A;  2UUC M;  4JI7 M;  4LRS A;  3U6M A;  4ITQ A;  1GVN A;  1NNJ A;  1SXJ A;  5IZ7 D;  3KSJ A;  2G8L A;  3KP1 E;  4B7F A;  3SAU A;  4DR6 M;  4PCZ A;  3K2L A;  3EIE A;  2QPA A;  3VDU A;  4LFA M;  1YUB A;  4GIP A;  4M9Z A;  1N36 M;  1YE9 A;  3L25 A;  4DUZ M;  2NQ8 C;  3KOY E;  1L2D A;  3DA1 A;  5EP1 A;  3KOW E;  3QWL A;  3TWK A;  4IJE A;  4LJ9 A;  2UUA M;  3SMS A;  2QCU A;  3LVW A;  4CIS A;  2D7E A;  1LV7 A;  2KA6 B;  4LZJ A;  4QHT A;  3AJI B;  3K1J A;  2XSZ A;  3GPY A;  2R46 A;  3HU2 A;  4LY6 A;  4MGH A;  3U6E A;  1ZAE A;  3L28 A;  3TE6 A;  3J81 S;  2R62 A;  4M9S A;  4GC9 A;  3RGP A;  1R2Z A;  3A45 A;  4B7G A;  1Q3B A;  4DV6 M;  4JV5 M;  2HCB A;  5ITT A;  2XFT A;  2XGN A;  3GLI A;  3U6L A;  2KRK A;  3GLF A;  1JR3 D;  4G4O A;  3GRY A;  2F5N A;  4AKG A;  1IXS B;  3NWL A;  3T1Y M;  4IJF A;  5KO3 A;  2CHQ A;  4I81 A;  4JI4 M;  3SFZ A;  4IBJ A;  2Y20 A;  2R65 A;  2CUZ A;  4S12 A;  2L7H A;  1L1Z A;  1XNQ M;  3L2A A;  3U61 B;  2ERC A;  4REZ A;  4LRT A;  3L27 A;  1L8Q A;  4NL4 H;  4QHS A;  3UJN A;  3U61 A;  4II7 A;  4IIW A;  1SXJ C;  1G41 A;  3ZC7 B;  4DV1 M;  3SAW A;  3CF6 E;  3ILK A;  5F3W A;  2CE7 A;  3E9S A;  4LJ8 A;  1T3T A;  4JN6 A;  1X37 A;  1HNX M;  3U6S A;  3J7B A;  4DR3 M;  4MGK E;  1XXH A;  3GLG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...