4DUZM

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c, bound with streptomycin
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
118
structure length
118
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 25
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4duzM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4duzM02
3SARA 4LFBM 3U6QA 5ITUA 4B3MM 1HR0M 3SAWA 5FLXS 3SAVA 2F5QA 1PJIA 4LF8M 3OTOM 4LF5M 1J5EM 4LF9M 2UXCM 4X64M 1IBMM 2E5LM 4JI7M 2UXBM 3GO8A 2UUCM 1TDZA 1L2CA 1XMQM 2F5OA 1I94M 4KHPM 1L1TA 5LMNM 4DR5M 1K3XA 4DV4M 2OPFA 2F5SA 4B3TM 5ITXA 4DR2M 4GKKM 5ITRA 3JAMS 4DR3M 1IBKM 4CISA 4X62M 4DUYM 4LFCM 1Z5AA 4PDGA 4B3RM 3TWMA 5A2QS 3GQ5A 4OX9M 2ZM6M 4JV5M 4G4NA 4DV7M 4K0KM 2ZBKB 2F5PA 1L2BA 3JR4A 3GPXA 2UUAM 3TWLA 4NXMM 1MU5A 3A45A 1Q39A 1HNZM 1K3WA 3U6DA 3W0FA 3VK7A 1N34M 3A42A 1NNJA 2UXDM 4PD2A 3SAUA 4JI4M 1N32M 4NXNM 3J81S 2F5NA 4JYAM 2XZUA 3U6CA 4DR6M 4JI3M 1Z5BA 3VK8A 3GPPA 5BR8M 4DUZM 3T1YM 4G4RA 4DV1M 4JI1M 3TWKA 4DV6M 4DV3M 2UUBM 4PDIA 4JI6M 3SASA 1N36M 5ITYA 4NRVA 3JR5A 4X65M 5ITQA 1HNWM 5LMUM 4JI8M 1Z5CA 4G4OA 1Q3CA 3GP1A 1PJJA 1HNXM 5ITXE 2UU9M 1EE8A 3C58A 1XC8A 1K82A 4JI2M 4LF7M 2HKJA 1PM5A 3GPUA 4JI0M 4DV2M 3U6EA 4ITQA 3U6LA 1FJGM 3U6MA 1IBLM 3U6SA 3GQ4A 1TDHA 5IWAM 1L1ZA 1R2YA 2HHHM 4PCZA 2XZFA 2F4VM 3U6OA 4MB7A 4X66M 1Q3BA 1L2DA 1MX0A 4LFAM 2Q2EB 3GPYA 1XMOM 4JI5M 4DR7M 1N33M 5IT9S 2VQEM 4YY3M 3SBJA 1KFVA 1R2ZA 4DR4M 5ITTA 2EA0A 4LF4M 3GQ3A 3U6PA 4GKJM 4DV0M 4NRWA 3T1HM 1XNRM 4AQYM 4DV5M 4G4QA 4LF6M 3DOAA 4B3SM 2VQFM 3J7AS 1XNQM 3SATA 4YHHM 2OQ4A 4DR1M 3A46A 3J80S 1Z59A
chains in the Genus database with same CATH superfamily
3U60A 1IXZA 4D81A 4IBGA 3KP0E 3LVWA 4HL4A 4Q7JA 4M0WA 4AW4A 4B3MM 2CRUA 5EP2A 1GJTA 2BJWA 3Q8GA 2JA2A 1IN6A 4NL4H 1YE9A 3SHFA 5C1BA 3AV0A 5KPZA 1J5EM 4LF8M 3AOEA 4X64M 1LTMA 2UXBM 3GO8A 2JY8A 3RE8A 1TDZA 3FD9A 2M60A 3KOWE 4LJAA 1TTEA 4FVMA 3KOZE 1L2CA 1XMQM 3U5ZA 4EIWA 3R8FA 2D7EA 1GABA 4GRIA 1K3XA 4B3TM 3IG8A 4DV4M 5ITXA 3ZQJA 4DR2M 2DZNB 2XEPA 4GKKM 1QAOA 2JZ1A 3GLFE 3B9PA 3IECA 1XB2B 1Q02A 2EUCA 1GL6A 4MGHA 1VDDA 5L8RF 3GQ5A 3GRRA 3SYLA 2VDBB 1T3TA 3K8ZA 1YLAA 4LJ8A 3LQQA 2ZBKB 2RGOA 3AOGA 3TWLA 2DI0A 3CF2A 4IIWA 3ZCBB 2DVWB 1MU5A 3D8BA 3H4MA 1G59A 1MJGM 2LWXA 3AOEC 3ZC7B 3KOXE 2RKOA 4LRSA 3U6DA 4QHTA 3A42A 3BBZA 3AL0C 2Y21A 2UXDM 3QYBA 4PD2A 4A3VB 1XXHE 1G8PA 3J81S 1JR3E 1SXJD 1QAQA 3BXWA 2BNKA 4LJ7A 4ZPXA 2DWLA 4QOZC 2M5ZA 5BR8M 3T1YM 3SAUA 3KP1E 1DGHB 4JI6M 4DV3M 3E46A 1OKSA 2XF3A 1SXJC 3BOSA 3T38A 2V1CA 3C3DA 4QHSA 3LQRA 4X65M 2J5YA 1R7RA 1Z5CA 2UU9M 2CV2A 2H5XA 2CFOA 3IHPA 4DV2M 1WJ7A 2K47A 2ERCA 2LVNC 2Z7JA 3I51A 2QQ8A 2GQFA 7CATA 1NY6A 4IJFA 3NWLA 3ZH9B 3E9SA 2EKFA 2DWMA 2KNAA 3U6SA 1TDHA 2YR0A 1L1ZA 4RKUF 1GLNA 1OIPA 3M0EA 4ANRA 2XH9A 2I7PA 1QUSA 2XZFA 1QQWA 3U6OA 1G71A 4MB7A 3AKZA 2MGWA 3KS8A 2I7NA 3SFZA 1L2DA 1MX0A 2FNAA 2LVPC 3HJ8A 3M7GA 4LRTA 3GPYA 1XMOM 4JI5M 3GLFA 2QP9X 4TUWA 4AKGA 1NHGC 1NV8A 2O25A 1R4GA 4YY3M 3U61A 3MJ5A 4CJ6A 1KFVA 5ITTA 2XSZA 2EA0A 3GQ3A 2L6OA 2LVOC 4FWDA 3GLGB 1S3SA 4GKJM 4DV0M 4LJ6A 3I4VA 2YFQA 1XNRM 2JNHA 3VKGA 4NSRA 3GLHB 2LHCA 4RF1A 1E32A 5C18A 4PT5A 1XHBA 2G8LA 2JWSA 3GRUA 2WSFF 3EIEA 1Z59A 1HR0M 2R45A 3L2AA 3SARA 1ZMVA 3MMPA 4LFBM 3L27A 1KSFX 5ITUA 1UM8A 1XXHA 3F92A 3SAWA 3FRHA 2F5QA 2JZ0A 4LF9M 3B89A 3CF6E 2R4EA 1HNXM 2X49A 2EJSA 2WZJA 3FYDA 4WURA 4B7FA 2MR9A 3HHXA 3HU2A 2F5OA 2MROB 3PNVA 3HHZA 1J7KA 1FNNA 2LVQD 5LMNM 1C1KA 2F5SA 1IN4A 4LZJA 1ZQ9A 3LW5F 4DR3M 3JAMS 3THGA 4CISA 3FUXA 2FOIC 1PJTA 1VG5A 1P3QQ 4PDGA 2Z4RA 2A5YB 1NO1A 2KRUA 4B3RM 1PGYA 2G3QA 2KA6B 2ZM6M 4JV5M 2CEAA 3D8LA 3SYKA 4DV7M 2W82A 4CGYB 2D7HA 4HLQA 1IQPA 1E94E 1JR3D 2L4FA 3GPXA 3JR4A 4NXMM 3HKPA 1D2NA 4M0DA 4RNAA 3A45A 3L28A 4F2LA 5FTJA 2DAKA 3FTEA 2KZSA 4FCVA 1QDRA 5F3WA 4IBFA 1K3WA 1HNZM 1EFUB 2G5GX 4G6ZA 3W0FA 3R9XB 3KDSE 1N75A 1NNJA 1QANA 3HZJA 5EXTA 4M9XA 5H37D 3CTWB 2F5NA 4JYAM 4AZFA 2XZUA 1KYIA 4P16A 2CP8A 3GPPA 3U60B 3HGIA 5EQTA 3TL4X 4G4RA 3TWKA 2Y0QA 1QYRA 1IY2A 2Y0TA 3JR5A 1OIZA 3FTCA 2MH8A 3MHVC 4QNRA 5LMUM 1OFIA 4LFCM 4DR4M 4QNMA 5E6JA 1EE8A 4LF7M 1K82A 1UFZA 2C96A 2HKJA 3GPUA 2AHMA 1HT2E 3M6AA 3U5ZB 4L15A 5IREB 4IBJA 3FE3A 2L2DA 3HX3A 1DGFA 1SXJB 2L4EA 2CE7A 3B7QA 3SMSA 2OOAA 1QZEA 2R18A 4OVZA 2ZANA 4AI6A 2F4VM 2CWBA 3AFHA 4L16A 3VLFB 2YNMD 1GKIA 5FTKA 4LG2A 4DR7M 1N33M 5EP3A 2QZ4A 3GRYA 1OJLA 3TQSA 2R4JA 3HU1A 5BPVA 2V6ZM 3SBJA 1IY0A 3VFDA 2KEBA 3FRIA 4NRWA 2QBYA 3E21A 5E26A 3UMMA 1YSYA 2WSCF 4GEWA 2X8AA 4G4QA 4AQYM 1F4IA 1GJSA 2DAGA 1OTRA 1RU3A 2CV0A 3CGWA 3J7AS 1XNQM 2J7OA 3FTFA 1ZAEA 3C3EA 4NOOB 1IN8A 3I4YA 2Z4SA 4DBGB 2DZLA 2JY7A 2DAIA 2L7IA 4GC5A 3KXEC 5JI3E 4AKHA 2ZAMA 3C9PA 2DNAA 5FTMA 4AG5A 1VEKA 2P5TA 3U6QA 3J7BA 1X37A 1V33A 4MGYE 2XFTA 2XGNA 5FLXS 3SAVA 4Y28F 3UGJA 3NBXX 2E5LM 1MN3A 2J7NA 3A98B 3PVSA 4Z6YA 3FYCA 4XBOA 4JI7M 4FD2A 3UJNA 3HJQA 1I4WA 4CIZA 1NHWC 4LJ5A 4B08A 1NJFA 4MGIE 4WP2A 2BJVA 2JUJA 2QPAA 1V34A 4II7A 1DGGA 2KW0A 4NSOB 4F1IA 1L1TA 1ZV1A 4MGZE 4DR5M 4GH9A 1D0LA 3K9PA 4FW9A 4I8OA 1CUKA 3WHKA 1VDLA 3QAUA 3KOYE 1OFHA 5ITRA 3A46A 4JN6A 2R65A 1JQJC 4X62M 1QAMA 3HY5A 3KSJA 4MH0E 1A5TA 3I04M 4B7GA 2LVAA 3ILKA 2DWNA 2C5RA 1IXSA 2KXEA 4G4NA 2R0IA 1JB0F 4K0KM 3T15A 1PJJA 2F5PA 1TH3A 1L2BA 1J09A 2H1RA 5EXSA 2KHHA 3AJIB 1WXQA 4REZA 3KW6A 1NV9A 4JXJA 3I01M 3L26A 5JI2E 1Q39A 2O5RA 2B3TA 1PJQA 2XSZD 4IBBA 1XWIA 3J2PB 4IBCA 2LHGA 2VF8A 5GKNA 3T6PA 4LCBA 1OAIA 1N32M 2HAKA 1VQ1A 4FCTA 3KVWA 4I5SA 3U6CA 1Z5BA 4JI3M 1ZMWA 2HCBA 2N35A 3SMPA 2LH0A 3QWLA 5DNYA 4IBDA 1C7YA 3W68A 4DV1M 3GLIB 5KPRA 1V92A 2C9OA 4IBIA 4DV6M 2UUBM 4JI1M 2OOBA 5FTLA 2FS1A 1N36M 4GHLA 2C9CA 1OQYA 3KS4A 2LXEA 1YUBA 4NRVA 5ITYA 3SC3A 1D0KA 1PRBA 2CUZA 1HNWM 3J27B 3PNYA 3GP1A 1ZMUA 1IY1A 4G4OA 4JI2M 4LY6A 3C58A 1XC8A 3MK6A 4R71A 3L25A 2K9DA 3TE6A 4OW0A 2RGHA 3HJSA 3FUWA 4GC9A 3K1JA 1HQCA 3K92A 4FWGA 3RGSA 4L6V6 3KSXA 3GQ4A 5IWAM 3FTDA 3UZUA 4I4LA 1QVRA 1R2YA 1Z6TA 2JY5A 1EIJA 1HQYE 4MM3B 2WSEF 2VIIA 2NQ8C 3CF0A 1OAOC 1Q3BA 4IBEA 3RFWA 4LJ4A 3VDUA 2KZUA 2D7GA 3SHGB 1R6BX 2APLA 3GLGE 5IT9S 4M9SA 2OO9A 1VEJA 2DENA 4XK8F 4Z8XA 2EKKA 2VQEM 3GLHE 3EIHA 2BWEA 1ORYB 4KT0F 3LCVB 3LMMA 4GITA 3PXGA 2JXNA 2CV1A 5KQ8A 1R5LA 4FCWA 4DV5M 5KQDA 4LF6M 3DOAA 2O01F 2K0BX 3LVVA 1SXJA 1NSFA 4D82A 1W5TA 3HWSA 2C99A 3SATA 3FUVA 2ZAOA 2OQ4A 3H4JA 2FFJA 3TPZA 5EXPA 1WGLA 3VK7A 1BVSA 3V76A 4IBKA 3QYEA 1LV7A 3W0LB 1DGHA 4NC6A 1NJGA 4BB9A 1WIVA 3L29A 4I81A 1GL7A 1WGNA 1T43A 2Y20A 1PJIA 2FH0A 3OTOM 4LF5M 2UXCM 3W67A 1IBMM 2VF7A 4FWHA 2UUCM 1HT1E 2JY6B 4R3DA 8CATA 2DXIA 1T6OA 2FE8A 3HHWA 4LZZA 2L7HA 1WR1B 5IZ7D 1D0MA 2KNZA 1I94M 2MJ5B 1QUTA 2QSFX 4L8RC 4KHPM 5DYIA 3VK8A 1DO2A 3GLIE 2OPFA 4RF0A 2BWBA 2DKLA 1IBKM 4DUYM 5FTNA 1NVMA 3FUTA 4OVZB 1Z5AA 3FKEA 2DHYA 3HU3A 4BLCA 4CHTB 3TWMA 5A2QS 4OX9M 2C98A 2HL7A 2L09A 2DWZB 1SG9A 2LBCA 3HHYA 1TF0B 2DHRA 2JP7A 3KFUG 4IJEA 2UUAM 3LCUA 1PJSA 1AUAA 1W5SA 4GHAA 4P17A 4R7GA 3GLGA 2KNVA 1NNUC 1TGUA 3K9OA 2QBYB 1GO5A 2YQZA 1L8QA 1DO0A 3E4RA 3GLHA 1TR8A 2K6BA 3Q8XA 1N34M 4G3OA 3DZDA 4LGYA 1IM2A 5EP4A 2EO2A 2Z8YM 3B7ZA 1TH4A 1E9SA 4KLNA 2ZTCA 5KPTA 4NXNM 4JI4M 4D80A 2KDLA 3RGPA 4DR6M 3K2LA 4DUZM 5EXXA 1IN7A 4KODA 4PDIA 3DFZA 1TH2A 4AG6A 1QDTA 4WW0A 3SASA 3GLFB 3FUUA 2HWJA 1Y8GA 5ITQA 1N78A 4JI8M 1Q3CA 2X4AA 1H6UA 1NY5A 2R46A 3WHLA 2LNHC 4GMQA 2R6FA 4M9ZA 3NBIA 1AIPC 5ITXE 2DZOB 5DFLA 2QNJA 2Z3XA 3U61B 1IXRC 1SXJE 5DYGA 4JI0M 1PM5A 3U6EA 4ITQA 3U6LA 1FJGM 5EJCA 2V1UA 5FSWA 4MGKE 4KO8A 3B74A 1HJPA 3U6MA 4LJ9A 1G3IA 3VDPA 1IBLM 4S12A 4LGMA 2GNOA 2QCUA 2HHHM 4PCZA 1IN5A 1DV0A 3GLIA 2KRKA 2XFSA 4UN2B 4X66M 1IFYA 2QHOB 1IXSB 2XLJA 4QOSA 2Q2EB 4LFAM 4BBAA 1JR3A 1XXHB 3GRVA 3UK6A 2LTUA 4B7HA 1N77A 2CHGA 1E9RA 2CHVA 1QZMA 3VKHA 1G41A 4XGIA 2R62A 1R2ZA 4AKIA 3PFIA 4LF4M 1GVNA 3B7NA 3U6PA 4OU7A 4W5WA 1VEGA 2DAMA 2RRUA 3T1HM 4L78A 2ZTDA 2R44A 4B3SM 2DAEA 2VQFM 4GIPA 1WHCA 1DGBA 3IG5A 4YHHM 3DA1A 4DR1M 5EP1A 2QENA 1G4AE 4HEOA 2CHQA 5KO3A 3J80S 4L4UA
chains in the Genus database with same CATH topology
3U60A 1IXZA 4D81A 4IBGA 3KP0E 3LVWA 4HL4A 4M0WA 4AW4A 4B3MM 5EP2A 1HR0M 2BJWA 2JA2A 1IN6A 4NL4H 1YE9A 3SHFA 5C1BA 3AV0A 5KPZA 1J5EM 4LF8M 3AOEA 4X64M 2UXBM 3GO8A 3RE8A 1TDZA 3FD9A 2M60A 3KOWE 4LJAA 4FVMA 3KOZE 1L2CA 1XMQM 3U5ZA 4EIWA 3R8FA 2D7EA 4GRIA 1K3XA 4B3TM 3IG8A 4DV4M 5ITXA 4DR2M 2DZNB 2XEPA 4GKKM 1QAOA 3B9PA 2EUCA 1GL6A 4MGHA 1VDDA 3GQ5A 3GRRA 3SYLA 1T3TA 3K8ZA 4LJ8A 3LQQA 2ZBKB 2RGOA 3AOGA 3TWLA 3CF2A 4IIWA 3ZCBB 2DVWB 1MU5A 3D8BA 3H4MA 1G59A 2LWXA 3AOEC 3ZC7B 3KOXE 2RKOA 4LRSA 3U6DA 4QHTA 3A42A 3AL0C 2Y21A 2UXDM 4PD2A 4A3VB 1G8PA 3J81S 2DWLA 1SXJD 1QAQA 4ZPXA 2BNKA 4LJ7A 4QOZC 2M5ZA 5BR8M 3T1YM 3KP1E 1DGHB 4JI6M 4DV3M 2XF3A 1SXJC 3BOSA 3T38A 2V1CA 4QHSA 3LQRA 4X65M 1R7RA 1Z5CA 2UU9M 2CV2A 2CFOA 4DV2M 2K47A 2ERCA 2Z7JA 3I51A 7CATA 1NY6A 4IJFA 3NWLA 3ZH9B 3E9SA 2DWMA 3U6SA 1TDHA 2YR0A 1L1ZA 1GLNA 3M0EA 2XH9A 2I7PA 2XZFA 1QQWA 3U6OA 4MB7A 3AKZA 3KS8A 2I7NA 3SFZA 1L2DA 1MX0A 2FNAA 3HJ8A 3M7GA 4LRTA 3GPYA 1XMOM 4JI5M 4AKGA 3GLFA 2QP9X 1NHGC 4YY3M 3U61A 3MJ5A 1KFVA 5ITTA 2XSZA 2EA0A 3GQ3A 2L6OA 4FWDA 3GLGB 1S3SA 4GKJM 4DV0M 4LJ6A 3I4VA 2YFQA 1XNRM 4NSRA 3GLHB 4RF1A 5C18A 1E32A 4PT5A 1XHBA 2G8LA 3GRUA 3EIEA 1Z59A 2R45A 3L2AA 3SARA 4LFBM 3L27A 1KSFX 5ITUA 1UM8A 1XXHA 3SAWA 2F5QA 4LF9M 3CF6E 2R4EA 2X49A 4WURA 3FYDA 4B7FA 3HHXA 3HU2A 2F5OA 3PNVA 3HHZA 1J7KA 1FNNA 5LMNM 1C1KA 2F5SA 1IN4A 4LZJA 1ZQ9A 4DR3M 3JAMS 3THGA 4CISA 3FUXA 2FOIC 4PDGA 2Z4RA 2A5YB 4B3RM 2KRUA 2KA6B 2ZM6M 4JV5M 2CEAA 3D8LA 3SYKA 4DV7M 2W82A 4CGYB 2D7HA 4HLQA 1IQPA 1E94E 1JR3D 3GPXA 3JR4A 4NXMM 3HKPA 1D2NA 4M0DA 4RNAA 3A45A 3L28A 5FTJA 3FTEA 2KZSA 4FCVA 5F3WA 1K3WA 4IBFA 1HNZM 3R9XB 2G5GX 4G6ZA 3W0FA 3KDSE 1N75A 1NNJA 1QANA 5EXTA 4M9XA 5H37D 3CTWB 2F5NA 4JYAM 4AZFA 2XZUA 1KYIA 4P16A 3GPPA 3U60B 3HGIA 5EQTA 3TL4X 4G4RA 3TWKA 2Y0QA 1QYRA 1IY2A 2Y0TA 3JR5A 3FTCA 3MHVC 4QNRA 5LMUM 1OFIA 4LFCM 4DR4M 4QNMA 5E6JA 1EE8A 4LF7M 1K82A 2C96A 2HKJA 3GPUA 2AHMA 1HT2E 3M6AA 3U5ZB 4L15A 5IREB 4IBJA 1DGFA 1SXJB 3SMSA 2CE7A 2R18A 4OVZA 2ZANA 4AI6A 2F4VM 3AFHA 4L16A 3VLFB 2YNMD 1GKIA 5FTKA 4LG2A 4DR7M 1N33M 5EP3A 2QZ4A 3GRYA 1OJLA 3TQSA 2R4JA 3HU1A 5BPVA 2V6ZM 3SBJA 1IY0A 3VFDA 2KEBA 4NRWA 2QBYA 5E26A 3UMMA 1YSYA 4AQYM 2X8AA 4G4QA 2CV0A 3J7AS 1XNQM 2J7OA 3FTFA 1ZAEA 4NOOB 1IN8A 3I4YA 2Z4SA 2L7IA 4GC5A 3KXEC 5JI3E 4AKHA 2ZAMA 5FTMA 4AG5A 2P5TA 3U6QA 3J7BA 1X37A 4MGYE 2XFTA 2XGNA 5FLXS 3SAVA 3UGJA 2E5LM 2J7NA 3A98B 3PVSA 4Z6YA 3FYCA 4XBOA 4JI7M 4FD2A 3UJNA 3HJQA 1I4WA 1NHWC 4LJ5A 4B08A 1NJFA 4MGIE 2BJVA 2QPAA 4II7A 1DGGA 2KW0A 4NSOB 1L1TA 4MGZE 4DR5M 4GH9A 4FW9A 4I8OA 3WHKA 3QAUA 3KOYE 1OFHA 5ITRA 3A46A 4JN6A 2R65A 1JQJC 4X62M 1QAMA 3KSJA 4MH0E 4B7GA 3ILKA 2DWNA 2C5RA 2KXEA 4G4NA 4K0KM 3T15A 1PJJA 2F5PA 1TH3A 1L2BA 1J09A 2H1RA 5EXSA 3AJIB 1WXQA 4REZA 3KW6A 4JXJA 3L26A 5JI2E 1Q39A 2O5RA 4IBBA 2XSZD 1XWIA 3J2PB 4IBCA 5GKNA 4LCBA 1N32M 4FCTA 3KVWA 4I5SA 3U6CA 1Z5BA 4JI3M 2HCBA 3SMPA 3VK8A 2LH0A 3QWLA 5DNYA 4IBDA 4DV1M 3GLIB 5KPRA 2C9OA 4IBIA 4DV6M 4JI1M 2UUBM 5FTLA 1N36M 4GHLA 2C9CA 3KS4A 4NRVA 2LXEA 1YUBA 5ITYA 3SC3A 2CUZA 1HNWM 3J27B 3PNYA 3GP1A 4G4OA 1IY1A 4JI2M 4LY6A 3C58A 1XC8A 3MK6A 3L25A 3TE6A 4OW0A 2RGHA 3HJSA 3FUWA 4GC9A 3K1JA 1HQCA 3K92A 4FWGA 3RGSA 3KSXA 3GQ4A 5IWAM 3FTDA 3UZUA 4I4LA 1QVRA 1R2YA 1Z6TA 1HQYE 4MM3B 2VIIA 2NQ8C 3CF0A 1Q3BA 3RFWA 4IBEA 3VDUA 4LJ4A 2KZUA 2D7GA 3SHGB 1R6BX 5IT9S 4M9SA 4Z8XA 2VQEM 3EIHA 1ORYB 3LMMA 4GITA 3PXGA 2CV1A 5KQ8A 4FCWA 4DV5M 5KQDA 4LF6M 3DOAA 3LVVA 1SXJA 1NSFA 4D82A 1W5TA 3HWSA 2C99A 3SATA 3FUVA 2ZAOA 2OQ4A 2FFJA 3TPZA 5EXPA 3VK7A 4IBKA 1LV7A 3W0LB 1DGHA 1NJGA 4BB9A 3L29A 4I81A 1GL7A 2Y20A 1PJIA 3OTOM 4LF5M 2UXCM 1IBMM 4FWHA 2UUCM 1HT1E 4R3DA 8CATA 2DXIA 2FE8A 3HHWA 4LZZA 2L7HA 5IZ7D 4KHPM 1I94M 4L8RC 5DYIA 1DO2A 2OPFA 4RF0A 1IBKM 4DUYM 5FTNA 1NVMA 3FUTA 4OVZB 1Z5AA 3FKEA 3HU3A 4BLCA 4CHTB 3TWMA 5A2QS 4OX9M 2C98A 2HL7A 2L09A 2DWZB 3HHYA 2DHRA 3KFUG 4IJEA 2UUAM 1W5SA 4GHAA 4R7GA 3GLGA 1NNUC 1TGUA 2QBYB 2YQZA 1L8QA 1DO0A 3E4RA 3GLHA 3Q8XA 1N34M 3DZDA 4LGYA 1IM2A 5EP4A 2EO2A 5KPTA 3SAUA 1TH4A 1E9SA 4KLNA 4JI4M 4NXNM 4D80A 3RGPA 4DR6M 3K2LA 4DUZM 5EXXA 1IN7A 4KODA 4PDIA 3DFZA 1TH2A 4AG6A 4WW0A 3SASA 3GLFB 3FUUA 1N78A 5ITQA 4JI8M 1Q3CA 2X4AA 1H6UA 1NY5A 2R46A 3WHLA 2LNHC 4GMQA 4M9ZA 5ITXE 3NBIA 3U61B 1HNXM 2DZOB 4TUWA 2Z3XA 3VKGA 1IXRC 1SXJE 5DYGA 4JI0M 1PM5A 3U6EA 4ITQA 3U6LA 1FJGM 5EJCA 2V1UA 5FSWA 4MGKE 4KO8A 3U6MA 4LJ9A 1G3IA 3VDPA 1IBLM 4S12A 4LGMA 2QCUA 2HHHM 4PCZA 1IN5A 3GLIA 2KRKA 2XFSA 4X66M 1IXSB 2XLJA 4QOSA 2Q2EB 4LFAM 4BBAA 1JR3A 1XXHB 3GRVA 3UK6A 4B7HA 1N77A 2CHGA 1E9RA 2CHVA 1QZMA 3VKHA 1G41A 4XGIA 2R62A 1R2ZA 4AKIA 3PFIA 4LF4M 1GVNA 3U6PA 4OU7A 4W5WA 3T1HM 4L78A 4B3SM 2VQFM 4GIPA 1DGBA 3IG5A 4YHHM 3DA1A 4DR1M 5EP1A 2QENA 1G4AE 2CHQA 5KO3A 3J80S 4L4UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SAR A;  4LFB M;  3U6Q A;  5ITU A;  4B3M M;  1HR0 M;  3SAW A;  5FLX S;  3SAV A;  2F5Q A;  1PJI A;  4LF8 M;  3OTO M;  4LF5 M;  1J5E M;  4LF9 M;  2UXC M;  4X64 M;  1IBM M;  2E5L M;  4JI7 M;  2UXB M;  3GO8 A;  2UUC M;  1TDZ A;  1L2C A;  1XMQ M;  2F5O A;  1I94 M;  4KHP M;  1L1T A;  5LMN M;  4DR5 M;  1K3X A;  4DV4 M;  2OPF A;  2F5S A;  4B3T M;  5ITX A;  4DR2 M;  4GKK M;  5ITR A;  3JAM S;  4DR3 M;  1IBK M;  4CIS A;  4X62 M;  4DUY M;  4LFC M;  1Z5A A;  4PDG A;  4B3R M;  3TWM A;  5A2Q S;  3GQ5 A;  4OX9 M;  2ZM6 M;  4JV5 M;  4G4N A;  4DV7 M;  4K0K M;  2ZBK B;  2F5P A;  1L2B A;  3JR4 A;  3GPX A;  2UUA M;  3TWL A;  4NXM M;  1MU5 A;  3A45 A;  1Q39 A;  1HNZ M;  1K3W A;  3U6D A;  3W0F A;  3VK7 A;  1N34 M;  3A42 A;  1NNJ A;  2UXD M;  4PD2 A;  3SAU A;  4JI4 M;  1N32 M;  4NXN M;  3J81 S;  2F5N A;  4JYA M;  2XZU A;  3U6C A;  4DR6 M;  4JI3 M;  1Z5B A;  3VK8 A;  3GPP A;  5BR8 M;  4DUZ M;  3T1Y M;  4G4R A;  4DV1 M;  4JI1 M;  3TWK A;  4DV6 M;  4DV3 M;  2UUB M;  4PDI A;  4JI6 M;  3SAS A;  1N36 M;  5ITY A;  4NRV A;  3JR5 A;  4X65 M;  5ITQ A;  1HNW M;  5LMU M;  4JI8 M;  1Z5C A;  4G4O A;  1Q3C A;  3GP1 A;  1PJJ A;  1HNX M;  5ITX E;  2UU9 M;  1EE8 A;  3C58 A;  1XC8 A;  1K82 A;  4JI2 M;  4LF7 M;  2HKJ A;  1PM5 A;  3GPU A;  4JI0 M;  4DV2 M;  3U6E A;  4ITQ A;  3U6L A;  1FJG M;  3U6M A;  1IBL M;  3U6S A;  3GQ4 A;  1TDH A;  5IWA M;  1L1Z A;  1R2Y A;  2HHH M;  4PCZ A;  2XZF A;  2F4V M;  3U6O A;  4MB7 A;  4X66 M;  1Q3B A;  1L2D A;  1MX0 A;  4LFA M;  2Q2E B;  3GPY A;  1XMO M;  4JI5 M;  4DR7 M;  1N33 M;  5IT9 S;  2VQE M;  4YY3 M;  3SBJ A;  1KFV A;  1R2Z A;  4DR4 M;  5ITT A;  2EA0 A;  4LF4 M;  3GQ3 A;  3U6P A;  4GKJ M;  4DV0 M;  4NRW A;  3T1H M;  1XNR M;  4AQY M;  4DV5 M;  4G4Q A;  4LF6 M;  3DOA A;  4B3S M;  2VQF M;  3J7A S;  1XNQ M;  3SAT A;  4YHH M;  2OQ4 A;  4DR1 M;  3A46 A;  3J80 S;  1Z59 A; 
#chains in the Genus database with same CATH topology
 3U60 A;  1IXZ A;  4D81 A;  4IBG A;  3KP0 E;  3LVW A;  4HL4 A;  4Q7J A;  4M0W A;  4AW4 A;  4B3M M;  2CRU A;  5EP2 A;  1GJT A;  2BJW A;  3Q8G A;  2JA2 A;  1IN6 A;  4NL4 H;  1YE9 A;  3SHF A;  5C1B A;  3AV0 A;  5KPZ A;  1J5E M;  4LF8 M;  3AOE A;  4X64 M;  1LTM A;  2UXB M;  3GO8 A;  2JY8 A;  3RE8 A;  1TDZ A;  3FD9 A;  2M60 A;  3KOW E;  4LJA A;  1TTE A;  4FVM A;  3KOZ E;  1L2C A;  1XMQ M;  3U5Z A;  4EIW A;  3R8F A;  2D7E A;  1GAB A;  4GRI A;  1K3X A;  4B3T M;  3IG8 A;  4DV4 M;  5ITX A;  3ZQJ A;  4DR2 M;  2DZN B;  2XEP A;  4GKK M;  1QAO A;  2JZ1 A;  3GLF E;  3B9P A;  3IEC A;  1XB2 B;  1Q02 A;  2EUC A;  1GL6 A;  4MGH A;  1VDD A;  5L8R F;  3GQ5 A;  3GRR A;  3SYL A;  2VDB B;  1T3T A;  3K8Z A;  1YLA A;  4LJ8 A;  3LQQ A;  2ZBK B;  2RGO A;  3AOG A;  3TWL A;  2DI0 A;  3CF2 A;  4IIW A;  3ZCB B;  2DVW B;  1MU5 A;  3D8B A;  3H4M A;  1G59 A;  1MJG M;  2LWX A;  3AOE C;  3ZC7 B;  3KOX E;  2RKO A;  4LRS A;  3U6D A;  4QHT A;  3A42 A;  3BBZ A;  3AL0 C;  2Y21 A;  2UXD M;  3QYB A;  4PD2 A;  4A3V B;  1XXH E;  1G8P A;  3J81 S;  1JR3 E;  1SXJ D;  1QAQ A;  3BXW A;  2BNK A;  4LJ7 A;  4ZPX A;  2DWL A;  4QOZ C;  2M5Z A;  5BR8 M;  3T1Y M;  3SAU A;  3KP1 E;  1DGH B;  4JI6 M;  4DV3 M;  3E46 A;  1OKS A;  2XF3 A;  1SXJ C;  3BOS A;  3T38 A;  2V1C A;  3C3D A;  4QHS A;  3LQR A;  4X65 M;  2J5Y A;  1R7R A;  1Z5C A;  2UU9 M;  2CV2 A;  2H5X A;  2CFO A;  3IHP A;  4DV2 M;  1WJ7 A;  2K47 A;  2ERC A;  2LVN C;  2Z7J A;  3I51 A;  2QQ8 A;  2GQF A;  7CAT A;  1NY6 A;  4IJF A;  3NWL A;  3ZH9 B;  3E9S A;  2EKF A;  2DWM A;  2KNA A;  3U6S A;  1TDH A;  2YR0 A;  1L1Z A;  4RKU F;  1GLN A;  1OIP A;  3M0E A;  4ANR A;  2XH9 A;  2I7P A;  1QUS A;  2XZF A;  1QQW A;  3U6O A;  1G71 A;  4MB7 A;  3AKZ A;  2MGW A;  3KS8 A;  2I7N A;  3SFZ A;  1L2D A;  1MX0 A;  2FNA A;  2LVP C;  3HJ8 A;  3M7G A;  4LRT A;  3GPY A;  1XMO M;  4JI5 M;  3GLF A;  2QP9 X;  4TUW A;  4AKG A;  1NHG C;  1NV8 A;  2O25 A;  1R4G A;  4YY3 M;  3U61 A;  3MJ5 A;  4CJ6 A;  1KFV A;  5ITT A;  2XSZ A;  2EA0 A;  3GQ3 A;  2L6O A;  2LVO C;  4FWD A;  3GLG B;  1S3S A;  4GKJ M;  4DV0 M;  4LJ6 A;  3I4V A;  2YFQ A;  1XNR M;  2JNH A;  3VKG A;  4NSR A;  3GLH B;  2LHC A;  4RF1 A;  1E32 A;  5C18 A;  4PT5 A;  1XHB A;  2G8L A;  2JWS A;  3GRU A;  2WSF F;  3EIE A;  1Z59 A;  1HR0 M;  2R45 A;  3L2A A;  3SAR A;  1ZMV A;  3MMP A;  4LFB M;  3L27 A;  1KSF X;  5ITU A;  1UM8 A;  1XXH A;  3F92 A;  3SAW A;  3FRH A;  2F5Q A;  2JZ0 A;  4LF9 M;  3B89 A;  3CF6 E;  2R4E A;  1HNX M;  2X49 A;  2EJS A;  2WZJ A;  3FYD A;  4WUR A;  4B7F A;  2MR9 A;  3HHX A;  3HU2 A;  2F5O A;  2MRO B;  3PNV A;  3HHZ A;  1J7K A;  1FNN A;  2LVQ D;  5LMN M;  1C1K A;  2F5S A;  1IN4 A;  4LZJ A;  1ZQ9 A;  3LW5 F;  4DR3 M;  3JAM S;  3THG A;  4CIS A;  3FUX A;  2FOI C;  1PJT A;  1VG5 A;  1P3Q Q;  4PDG A;  2Z4R A;  2A5Y B;  1NO1 A;  2KRU A;  4B3R M;  1PGY A;  2G3Q A;  2KA6 B;  2ZM6 M;  4JV5 M;  2CEA A;  3D8L A;  3SYK A;  4DV7 M;  2W82 A;  4CGY B;  2D7H A;  4HLQ A;  1IQP A;  1E94 E;  1JR3 D;  2L4F A;  3GPX A;  3JR4 A;  4NXM M;  3HKP A;  1D2N A;  4M0D A;  4RNA A;  3A45 A;  3L28 A;  4F2L A;  5FTJ A;  2DAK A;  3FTE A;  2KZS A;  4FCV A;  1QDR A;  5F3W A;  4IBF A;  1K3W A;  1HNZ M;  1EFU B;  2G5G X;  4G6Z A;  3W0F A;  3R9X B;  3KDS E;  1N75 A;  1NNJ A;  1QAN A;  3HZJ A;  5EXT A;  4M9X A;  5H37 D;  3CTW B;  2F5N A;  4JYA M;  4AZF A;  2XZU A;  1KYI A;  4P16 A;  2CP8 A;  3GPP A;  3U60 B;  3HGI A;  5EQT A;  3TL4 X;  4G4R A;  3TWK A;  2Y0Q A;  1QYR A;  1IY2 A;  2Y0T A;  3JR5 A;  1OIZ A;  3FTC A;  2MH8 A;  3MHV C;  4QNR A;  5LMU M;  1OFI A;  4LFC M;  4DR4 M;  4QNM A;  5E6J A;  1EE8 A;  4LF7 M;  1K82 A;  1UFZ A;  2C96 A;  2HKJ A;  3GPU A;  2AHM A;  1HT2 E;  3M6A A;  3U5Z B;  4L15 A;  5IRE B;  4IBJ A;  3FE3 A;  2L2D A;  3HX3 A;  1DGF A;  1SXJ B;  2L4E A;  2CE7 A;  3B7Q A;  3SMS A;  2OOA A;  1QZE A;  2R18 A;  4OVZ A;  2ZAN A;  4AI6 A;  2F4V M;  2CWB A;  3AFH A;  4L16 A;  3VLF B;  2YNM D;  1GKI A;  5FTK A;  4LG2 A;  4DR7 M;  1N33 M;  5EP3 A;  2QZ4 A;  3GRY A;  1OJL A;  3TQS A;  2R4J A;  3HU1 A;  5BPV A;  2V6Z M;  3SBJ A;  1IY0 A;  3VFD A;  2KEB A;  3FRI A;  4NRW A;  2QBY A;  3E21 A;  5E26 A;  3UMM A;  1YSY A;  2WSC F;  4GEW A;  2X8A A;  4G4Q A;  4AQY M;  1F4I A;  1GJS A;  2DAG A;  1OTR A;  1RU3 A;  2CV0 A;  3CGW A;  3J7A S;  1XNQ M;  2J7O A;  3FTF A;  1ZAE A;  3C3E A;  4NOO B;  1IN8 A;  3I4Y A;  2Z4S A;  4DBG B;  2DZL A;  2JY7 A;  2DAI A;  2L7I A;  4GC5 A;  3KXE C;  5JI3 E;  4AKH A;  2ZAM A;  3C9P A;  2DNA A;  5FTM A;  4AG5 A;  1VEK A;  2P5T A;  3U6Q A;  3J7B A;  1X37 A;  1V33 A;  4MGY E;  2XFT A;  2XGN A;  5FLX S;  3SAV A;  4Y28 F;  3UGJ A;  3NBX X;  2E5L M;  1MN3 A;  2J7N A;  3A98 B;  3PVS A;  4Z6Y A;  3FYC A;  4XBO A;  4JI7 M;  4FD2 A;  3UJN A;  3HJQ A;  1I4W A;  4CIZ A;  1NHW C;  4LJ5 A;  4B08 A;  1NJF A;  4MGI E;  4WP2 A;  2BJV A;  2JUJ A;  2QPA A;  1V34 A;  4II7 A;  1DGG A;  2KW0 A;  4NSO B;  4F1I A;  1L1T A;  1ZV1 A;  4MGZ E;  4DR5 M;  4GH9 A;  1D0L A;  3K9P A;  4FW9 A;  4I8O A;  1CUK A;  3WHK A;  1VDL A;  3QAU A;  3KOY E;  1OFH A;  5ITR A;  3A46 A;  4JN6 A;  2R65 A;  1JQJ C;  4X62 M;  1QAM A;  3HY5 A;  3KSJ A;  4MH0 E;  1A5T A;  3I04 M;  4B7G A;  2LVA A;  3ILK A;  2DWN A;  2C5R A;  1IXS A;  2KXE A;  4G4N A;  2R0I A;  1JB0 F;  4K0K M;  3T15 A;  1PJJ A;  2F5P A;  1TH3 A;  1L2B A;  1J09 A;  2H1R A;  5EXS A;  2KHH A;  3AJI B;  1WXQ A;  4REZ A;  3KW6 A;  1NV9 A;  4JXJ A;  3I01 M;  3L26 A;  5JI2 E;  1Q39 A;  2O5R A;  2B3T A;  1PJQ A;  2XSZ D;  4IBB A;  1XWI A;  3J2P B;  4IBC A;  2LHG A;  2VF8 A;  5GKN A;  3T6P A;  4LCB A;  1OAI A;  1N32 M;  2HAK A;  1VQ1 A;  4FCT A;  3KVW A;  4I5S A;  3U6C A;  1Z5B A;  4JI3 M;  1ZMW A;  2HCB A;  2N35 A;  3SMP A;  2LH0 A;  3QWL A;  5DNY A;  4IBD A;  1C7Y A;  3W68 A;  4DV1 M;  3GLI B;  5KPR A;  1V92 A;  2C9O A;  4IBI A;  4DV6 M;  2UUB M;  4JI1 M;  2OOB A;  5FTL A;  2FS1 A;  1N36 M;  4GHL A;  2C9C A;  1OQY A;  3KS4 A;  2LXE A;  1YUB A;  4NRV A;  5ITY A;  3SC3 A;  1D0K A;  1PRB A;  2CUZ A;  1HNW M;  3J27 B;  3PNY A;  3GP1 A;  1ZMU A;  1IY1 A;  4G4O A;  4JI2 M;  4LY6 A;  3C58 A;  1XC8 A;  3MK6 A;  4R71 A;  3L25 A;  2K9D A;  3TE6 A;  4OW0 A;  2RGH A;  3HJS A;  3FUW A;  4GC9 A;  3K1J A;  1HQC A;  3K92 A;  4FWG A;  3RGS A;  4L6V 6;  3KSX A;  3GQ4 A;  5IWA M;  3FTD A;  3UZU A;  4I4L A;  1QVR A;  1R2Y A;  1Z6T A;  2JY5 A;  1EIJ A;  1HQY E;  4MM3 B;  2WSE F;  2VII A;  2NQ8 C;  3CF0 A;  1OAO C;  1Q3B A;  4IBE A;  3RFW A;  4LJ4 A;  3VDU A;  2KZU A;  2D7G A;  3SHG B;  1R6B X;  2APL A;  3GLG E;  5IT9 S;  4M9S A;  2OO9 A;  1VEJ A;  2DEN A;  4XK8 F;  4Z8X A;  2EKK A;  2VQE M;  3GLH E;  3EIH A;  2BWE A;  1ORY B;  4KT0 F;  3LCV B;  3LMM A;  4GIT A;  3PXG A;  2JXN A;  2CV1 A;  5KQ8 A;  1R5L A;  4FCW A;  4DV5 M;  5KQD A;  4LF6 M;  3DOA A;  2O01 F;  2K0B X;  3LVV A;  1SXJ A;  1NSF A;  4D82 A;  1W5T A;  3HWS A;  2C99 A;  3SAT A;  3FUV A;  2ZAO A;  2OQ4 A;  3H4J A;  2FFJ A;  3TPZ A;  5EXP A;  1WGL A;  3VK7 A;  1BVS A;  3V76 A;  4IBK A;  3QYE A;  1LV7 A;  3W0L B;  1DGH A;  4NC6 A;  1NJG A;  4BB9 A;  1WIV A;  3L29 A;  4I81 A;  1GL7 A;  1WGN A;  1T43 A;  2Y20 A;  1PJI A;  2FH0 A;  3OTO M;  4LF5 M;  2UXC M;  3W67 A;  1IBM M;  2VF7 A;  4FWH A;  2UUC M;  1HT1 E;  2JY6 B;  4R3D A;  8CAT A;  2DXI A;  1T6O A;  2FE8 A;  3HHW A;  4LZZ A;  2L7H A;  1WR1 B;  5IZ7 D;  1D0M A;  2KNZ A;  1I94 M;  2MJ5 B;  1QUT A;  2QSF X;  4L8R C;  4KHP M;  5DYI A;  3VK8 A;  1DO2 A;  3GLI E;  2OPF A;  4RF0 A;  2BWB A;  2DKL A;  1IBK M;  4DUY M;  5FTN A;  1NVM A;  3FUT A;  4OVZ B;  1Z5A A;  3FKE A;  2DHY A;  3HU3 A;  4BLC A;  4CHT B;  3TWM A;  5A2Q S;  4OX9 M;  2C98 A;  2HL7 A;  2L09 A;  2DWZ B;  1SG9 A;  2LBC A;  3HHY A;  1TF0 B;  2DHR A;  2JP7 A;  3KFU G;  4IJE A;  2UUA M;  3LCU A;  1PJS A;  1AUA A;  1W5S A;  4GHA A;  4P17 A;  4R7G A;  3GLG A;  2KNV A;  1NNU C;  1TGU A;  3K9O A;  2QBY B;  1GO5 A;  2YQZ A;  1L8Q A;  1DO0 A;  3E4R A;  3GLH A;  1TR8 A;  2K6B A;  3Q8X A;  1N34 M;  4G3O A;  3DZD A;  4LGY A;  1IM2 A;  5EP4 A;  2EO2 A;  2Z8Y M;  3B7Z A;  1TH4 A;  1E9S A;  4KLN A;  2ZTC A;  5KPT A;  4NXN M;  4JI4 M;  4D80 A;  2KDL A;  3RGP A;  4DR6 M;  3K2L A;  4DUZ M;  5EXX A;  1IN7 A;  4KOD A;  4PDI A;  3DFZ A;  1TH2 A;  4AG6 A;  1QDT A;  4WW0 A;  3SAS A;  3GLF B;  3FUU A;  2HWJ A;  1Y8G A;  5ITQ A;  1N78 A;  4JI8 M;  1Q3C A;  2X4A A;  1H6U A;  1NY5 A;  2R46 A;  3WHL A;  2LNH C;  4GMQ A;  2R6F A;  4M9Z A;  3NBI A;  1AIP C;  5ITX E;  2DZO B;  5DFL A;  2QNJ A;  2Z3X A;  3U61 B;  1IXR C;  1SXJ E;  5DYG A;  4JI0 M;  1PM5 A;  3U6E A;  4ITQ A;  3U6L A;  1FJG M;  5EJC A;  2V1U A;  5FSW A;  4MGK E;  4KO8 A;  3B74 A;  1HJP A;  3U6M A;  4LJ9 A;  1G3I A;  3VDP A;  1IBL M;  4S12 A;  4LGM A;  2GNO A;  2QCU A;  2HHH M;  4PCZ A;  1IN5 A;  1DV0 A;  3GLI A;  2KRK A;  2XFS A;  4UN2 B;  4X66 M;  1IFY A;  2QHO B;  1IXS B;  2XLJ A;  4QOS A;  2Q2E B;  4LFA M;  4BBA A;  1JR3 A;  1XXH B;  3GRV A;  3UK6 A;  2LTU A;  4B7H A;  1N77 A;  2CHG A;  1E9R A;  2CHV A;  1QZM A;  3VKH A;  1G41 A;  4XGI A;  2R62 A;  1R2Z A;  4AKI A;  3PFI A;  4LF4 M;  1GVN A;  3B7N A;  3U6P A;  4OU7 A;  4W5W A;  1VEG A;  2DAM A;  2RRU A;  3T1H M;  4L78 A;  2ZTD A;  2R44 A;  4B3S M;  2DAE A;  2VQF M;  4GIP A;  1WHC A;  1DGB A;  3IG5 A;  4YHH M;  3DA1 A;  4DR1 M;  5EP1 A;  2QEN A;  1G4A E;  4HEO A;  2CHQ A;  5KO3 A;  3J80 S;  4L4U A; 
#chains in the Genus database with same CATH homology
 3U60 A;  1IXZ A;  4D81 A;  4IBG A;  3KP0 E;  3LVW A;  4HL4 A;  4M0W A;  4AW4 A;  4B3M M;  5EP2 A;  1HR0 M;  2BJW A;  2JA2 A;  1IN6 A;  4NL4 H;  1YE9 A;  3SHF A;  5C1B A;  3AV0 A;  5KPZ A;  1J5E M;  4LF8 M;  3AOE A;  4X64 M;  2UXB M;  3GO8 A;  3RE8 A;  1TDZ A;  3FD9 A;  2M60 A;  3KOW E;  4LJA A;  4FVM A;  3KOZ E;  1L2C A;  1XMQ M;  3U5Z A;  4EIW A;  3R8F A;  2D7E A;  4GRI A;  1K3X A;  4B3T M;  3IG8 A;  4DV4 M;  5ITX A;  4DR2 M;  2DZN B;  2XEP A;  4GKK M;  1QAO A;  3B9P A;  2EUC A;  1GL6 A;  4MGH A;  1VDD A;  3GQ5 A;  3GRR A;  3SYL A;  1T3T A;  3K8Z A;  4LJ8 A;  3LQQ A;  2ZBK B;  2RGO A;  3AOG A;  3TWL A;  3CF2 A;  4IIW A;  3ZCB B;  2DVW B;  1MU5 A;  3D8B A;  3H4M A;  1G59 A;  2LWX A;  3AOE C;  3ZC7 B;  3KOX E;  2RKO A;  4LRS A;  3U6D A;  4QHT A;  3A42 A;  3AL0 C;  2Y21 A;  2UXD M;  4PD2 A;  4A3V B;  1G8P A;  3J81 S;  2DWL A;  1SXJ D;  1QAQ A;  4ZPX A;  2BNK A;  4LJ7 A;  4QOZ C;  2M5Z A;  5BR8 M;  3T1Y M;  3KP1 E;  1DGH B;  4JI6 M;  4DV3 M;  2XF3 A;  1SXJ C;  3BOS A;  3T38 A;  2V1C A;  4QHS A;  3LQR A;  4X65 M;  1R7R A;  1Z5C A;  2UU9 M;  2CV2 A;  2CFO A;  4DV2 M;  2K47 A;  2ERC A;  2Z7J A;  3I51 A;  7CAT A;  1NY6 A;  4IJF A;  3NWL A;  3ZH9 B;  3E9S A;  2DWM A;  3U6S A;  1TDH A;  2YR0 A;  1L1Z A;  1GLN A;  3M0E A;  2XH9 A;  2I7P A;  2XZF A;  1QQW A;  3U6O A;  4MB7 A;  3AKZ A;  3KS8 A;  2I7N A;  3SFZ A;  1L2D A;  1MX0 A;  2FNA A;  3HJ8 A;  3M7G A;  4LRT A;  3GPY A;  1XMO M;  4JI5 M;  4AKG A;  3GLF A;  2QP9 X;  1NHG C;  4YY3 M;  3U61 A;  3MJ5 A;  1KFV A;  5ITT A;  2XSZ A;  2EA0 A;  3GQ3 A;  2L6O A;  4FWD A;  3GLG B;  1S3S A;  4GKJ M;  4DV0 M;  4LJ6 A;  3I4V A;  2YFQ A;  1XNR M;  4NSR A;  3GLH B;  4RF1 A;  5C18 A;  1E32 A;  4PT5 A;  1XHB A;  2G8L A;  3GRU A;  3EIE A;  1Z59 A;  2R45 A;  3L2A A;  3SAR A;  4LFB M;  3L27 A;  1KSF X;  5ITU A;  1UM8 A;  1XXH A;  3SAW A;  2F5Q A;  4LF9 M;  3CF6 E;  2R4E A;  2X49 A;  4WUR A;  3FYD A;  4B7F A;  3HHX A;  3HU2 A;  2F5O A;  3PNV A;  3HHZ A;  1J7K A;  1FNN A;  5LMN M;  1C1K A;  2F5S A;  1IN4 A;  4LZJ A;  1ZQ9 A;  4DR3 M;  3JAM S;  3THG A;  4CIS A;  3FUX A;  2FOI C;  4PDG A;  2Z4R A;  2A5Y B;  4B3R M;  2KRU A;  2KA6 B;  2ZM6 M;  4JV5 M;  2CEA A;  3D8L A;  3SYK A;  4DV7 M;  2W82 A;  4CGY B;  2D7H A;  4HLQ A;  1IQP A;  1E94 E;  1JR3 D;  3GPX A;  3JR4 A;  4NXM M;  3HKP A;  1D2N A;  4M0D A;  4RNA A;  3A45 A;  3L28 A;  5FTJ A;  3FTE A;  2KZS A;  4FCV A;  5F3W A;  1K3W A;  4IBF A;  1HNZ M;  3R9X B;  2G5G X;  4G6Z A;  3W0F A;  3KDS E;  1N75 A;  1NNJ A;  1QAN A;  5EXT A;  4M9X A;  5H37 D;  3CTW B;  2F5N A;  4JYA M;  4AZF A;  2XZU A;  1KYI A;  4P16 A;  3GPP A;  3U60 B;  3HGI A;  5EQT A;  3TL4 X;  4G4R A;  3TWK A;  2Y0Q A;  1QYR A;  1IY2 A;  2Y0T A;  3JR5 A;  3FTC A;  3MHV C;  4QNR A;  5LMU M;  1OFI A;  4LFC M;  4DR4 M;  4QNM A;  5E6J A;  1EE8 A;  4LF7 M;  1K82 A;  2C96 A;  2HKJ A;  3GPU A;  2AHM A;  1HT2 E;  3M6A A;  3U5Z B;  4L15 A;  5IRE B;  4IBJ A;  1DGF A;  1SXJ B;  3SMS A;  2CE7 A;  2R18 A;  4OVZ A;  2ZAN A;  4AI6 A;  2F4V M;  3AFH A;  4L16 A;  3VLF B;  2YNM D;  1GKI A;  5FTK A;  4LG2 A;  4DR7 M;  1N33 M;  5EP3 A;  2QZ4 A;  3GRY A;  1OJL A;  3TQS A;  2R4J A;  3HU1 A;  5BPV A;  2V6Z M;  3SBJ A;  1IY0 A;  3VFD A;  2KEB A;  4NRW A;  2QBY A;  5E26 A;  3UMM A;  1YSY A;  4AQY M;  2X8A A;  4G4Q A;  2CV0 A;  3J7A S;  1XNQ M;  2J7O A;  3FTF A;  1ZAE A;  4NOO B;  1IN8 A;  3I4Y A;  2Z4S A;  2L7I A;  4GC5 A;  3KXE C;  5JI3 E;  4AKH A;  2ZAM A;  5FTM A;  4AG5 A;  2P5T A;  3U6Q A;  3J7B A;  1X37 A;  4MGY E;  2XFT A;  2XGN A;  5FLX S;  3SAV A;  3UGJ A;  2E5L M;  2J7N A;  3A98 B;  3PVS A;  4Z6Y A;  3FYC A;  4XBO A;  4JI7 M;  4FD2 A;  3UJN A;  3HJQ A;  1I4W A;  1NHW C;  4LJ5 A;  4B08 A;  1NJF A;  4MGI E;  2BJV A;  2QPA A;  4II7 A;  1DGG A;  2KW0 A;  4NSO B;  1L1T A;  4MGZ E;  4DR5 M;  4GH9 A;  4FW9 A;  4I8O A;  3WHK A;  3QAU A;  3KOY E;  1OFH A;  5ITR A;  3A46 A;  4JN6 A;  2R65 A;  1JQJ C;  4X62 M;  1QAM A;  3KSJ A;  4MH0 E;  4B7G A;  3ILK A;  2DWN A;  2C5R A;  2KXE A;  4G4N A;  4K0K M;  3T15 A;  1PJJ A;  2F5P A;  1TH3 A;  1L2B A;  1J09 A;  2H1R A;  5EXS A;  3AJI B;  1WXQ A;  4REZ A;  3KW6 A;  4JXJ A;  3L26 A;  5JI2 E;  1Q39 A;  2O5R A;  4IBB A;  2XSZ D;  1XWI A;  3J2P B;  4IBC A;  5GKN A;  4LCB A;  1N32 M;  4FCT A;  3KVW A;  4I5S A;  3U6C A;  1Z5B A;  4JI3 M;  2HCB A;  3SMP A;  3VK8 A;  2LH0 A;  3QWL A;  5DNY A;  4IBD A;  4DV1 M;  3GLI B;  5KPR A;  2C9O A;  4IBI A;  4DV6 M;  4JI1 M;  2UUB M;  5FTL A;  1N36 M;  4GHL A;  2C9C A;  3KS4 A;  4NRV A;  2LXE A;  1YUB A;  5ITY A;  3SC3 A;  2CUZ A;  1HNW M;  3J27 B;  3PNY A;  3GP1 A;  4G4O A;  1IY1 A;  4JI2 M;  4LY6 A;  3C58 A;  1XC8 A;  3MK6 A;  3L25 A;  3TE6 A;  4OW0 A;  2RGH A;  3HJS A;  3FUW A;  4GC9 A;  3K1J A;  1HQC A;  3K92 A;  4FWG A;  3RGS A;  3KSX A;  3GQ4 A;  5IWA M;  3FTD A;  3UZU A;  4I4L A;  1QVR A;  1R2Y A;  1Z6T A;  1HQY E;  4MM3 B;  2VII A;  2NQ8 C;  3CF0 A;  1Q3B A;  3RFW A;  4IBE A;  3VDU A;  4LJ4 A;  2KZU A;  2D7G A;  3SHG B;  1R6B X;  5IT9 S;  4M9S A;  4Z8X A;  2VQE M;  3EIH A;  1ORY B;  3LMM A;  4GIT A;  3PXG A;  2CV1 A;  5KQ8 A;  4FCW A;  4DV5 M;  5KQD A;  4LF6 M;  3DOA A;  3LVV A;  1SXJ A;  1NSF A;  4D82 A;  1W5T A;  3HWS A;  2C99 A;  3SAT A;  3FUV A;  2ZAO A;  2OQ4 A;  2FFJ A;  3TPZ A;  5EXP A;  3VK7 A;  4IBK A;  1LV7 A;  3W0L B;  1DGH A;  1NJG A;  4BB9 A;  3L29 A;  4I81 A;  1GL7 A;  2Y20 A;  1PJI A;  3OTO M;  4LF5 M;  2UXC M;  1IBM M;  4FWH A;  2UUC M;  1HT1 E;  4R3D A;  8CAT A;  2DXI A;  2FE8 A;  3HHW A;  4LZZ A;  2L7H A;  5IZ7 D;  4KHP M;  1I94 M;  4L8R C;  5DYI A;  1DO2 A;  2OPF A;  4RF0 A;  1IBK M;  4DUY M;  5FTN A;  1NVM A;  3FUT A;  4OVZ B;  1Z5A A;  3FKE A;  3HU3 A;  4BLC A;  4CHT B;  3TWM A;  5A2Q S;  4OX9 M;  2C98 A;  2HL7 A;  2L09 A;  2DWZ B;  3HHY A;  2DHR A;  3KFU G;  4IJE A;  2UUA M;  1W5S A;  4GHA A;  4R7G A;  3GLG A;  1NNU C;  1TGU A;  2QBY B;  2YQZ A;  1L8Q A;  1DO0 A;  3E4R A;  3GLH A;  3Q8X A;  1N34 M;  3DZD A;  4LGY A;  1IM2 A;  5EP4 A;  2EO2 A;  5KPT A;  3SAU A;  1TH4 A;  1E9S A;  4KLN A;  4JI4 M;  4NXN M;  4D80 A;  3RGP A;  4DR6 M;  3K2L A;  4DUZ M;  5EXX A;  1IN7 A;  4KOD A;  4PDI A;  3DFZ A;  1TH2 A;  4AG6 A;  4WW0 A;  3SAS A;  3GLF B;  3FUU A;  1N78 A;  5ITQ A;  4JI8 M;  1Q3C A;  2X4A A;  1H6U A;  1NY5 A;  2R46 A;  3WHL A;  2LNH C;  4GMQ A;  4M9Z A;  5ITX E;  3NBI A;  3U61 B;  1HNX M;  2DZO B;  4TUW A;  2Z3X A;  3VKG A;  1IXR C;  1SXJ E;  5DYG A;  4JI0 M;  1PM5 A;  3U6E A;  4ITQ A;  3U6L A;  1FJG M;  5EJC A;  2V1U A;  5FSW A;  4MGK E;  4KO8 A;  3U6M A;  4LJ9 A;  1G3I A;  3VDP A;  1IBL M;  4S12 A;  4LGM A;  2QCU A;  2HHH M;  4PCZ A;  1IN5 A;  3GLI A;  2KRK A;  2XFS A;  4X66 M;  1IXS B;  2XLJ A;  4QOS A;  2Q2E B;  4LFA M;  4BBA A;  1JR3 A;  1XXH B;  3GRV A;  3UK6 A;  4B7H A;  1N77 A;  2CHG A;  1E9R A;  2CHV A;  1QZM A;  3VKH A;  1G41 A;  4XGI A;  2R62 A;  1R2Z A;  4AKI A;  3PFI A;  4LF4 M;  1GVN A;  3U6P A;  4OU7 A;  4W5W A;  3T1H M;  4L78 A;  4B3S M;  2VQF M;  4GIP A;  1DGB A;  3IG5 A;  4YHH M;  3DA1 A;  4DR1 M;  5EP1 A;  2QEN A;  1G4A E;  2CHQ A;  5KO3 A;  3J80 S;  4L4U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...