4DUZM

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c, bound with streptomycin
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 25
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4duzM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4duzM02
1PJIA 2UUAM 4JI0M 1N34M 4NXNM 4DV3M 4LF7M 3GQ4A 1KFVA 4KHPM 4JV5M 1XMOM 4PCZA 1L2DA 1Q3BA 1Q39A 5ITRA 3JR4A 4LF9M 4DR1M 4DR2M 3SAVA 3GO8A 1XC8A 4DR6M 3SATA 2F5PA 1Z5CA 4MB7A 3SAWA 2UXDM 1L2CA 1HR0M 3OTOM 3GPXA 4JI6M 3W0FA 1XNRM 5IT9S 4X65M 1IBMM 3GP1A 1K3WA 3VK8A 2F5SA 4JI8M 4X64M 1R2YA 4DV4M 1IBKM 5LMNM 2UU9M 3JR5A 4G4NA 2F5NA 1PJJA 1XNQM 3A46A 4G4RA 5ITTA 3VK7A 4DUYM 4DR3M 4JI2M 4DR4M 1Z5BA 1HNXM 3U6PA 3A42A 2XZUA 1HNZM 1EE8A 2UUCM 3SARA 3T1YM 4LFBM 4NRWA 3U6DA 1N36M 4LF8M 1XMQM 1K82A 1L1ZA 4AQYM 3GPUA 3SASA 1I94M 4DV5M 4OX9M 1N32M 2F5QA 2UXBM 3J80S 4B3RM 1Q3CA 4ITQA 4LF6M 3J7AS 5FLXS 2EA0A 4JYAM 4JI3M 4DV1M 4G4OA 3GQ5A 4DV2M 4LF5M 2OPFA 1MX0A 4G4QA 1NNJA 3GPPA 4B3TM 4B3MM 3JAMS 1MU5A 2E5LM 3U6EA 1PM5A 2HHHM 3A45A 4DR5M 4LF4M 1HNWM 5LMUM 3GQ3A 1TDZA 4JI4M 3C58A 4PDGA 2ZBKB 3DOAA 5IWAM 4DV7M 5ITQA 2F5OA 4X62M 3SAUA 4B3SM 3J81S 1J5EM 3T1HM 4JI5M 1Z5AA 4GKJM 2XZFA 3U6CA 4PD2A 1R2ZA 4PDIA 3U6QA 2VQEM 5BR8M 3U6LA 3GPYA 4X66M 2HKJA 4DR7M 3SBJA 1TDHA 4NRVA 2ZM6M 5ITUA 4YY3M 4LFCM 4JI7M 2F4VM 2UXCM 4DV6M 5ITYA 2Q2EB 4GKKM 1IBLM 4LFAM 3U6OA 4YHHM 5ITXA 2OQ4A 1L2BA 4CISA 2UUBM 3TWKA 4K0KM 3TWMA 4JI1M 1L1TA 5A2QS 1Z59A 3TWLA 3U6MA 1K3XA 2VQFM 4DV0M 4NXMM 1N33M 1FJGM 5ITXE 3U6SA 4DUZM
chains in the Genus database with same CATH superfamily
3PXGA 3GRYA 3QAUA 5E6JA 3QYEA 4FWDA 1D0LA 2XGNA 4PCZA 3W0LB 1R4GA 2VDBB 2BNKA 1WXQA 2OOBA 3K9PA 4IBBA 3GLGA 3JR4A 5EP3A 4LF9M 4XBOA 1XC8A 4DR6M 3NBIA 3IG8A 3SATA 4D82A 3WHKA 2NQ8C 3KP1E 5JI2E 4MB7A 2LWXA 3CF6E 3ZC7B 3VFDA 3PNYA 3W67A 4OW0A 4I81A 1HR0M 5IT9S 1TR8A 4X65M 1DO0A 1IN8A 1K3WA 1QUSA 4X64M 3LQRA 3EIHA 2DVWB 4WW0A 3I04M 5EXSA 5LMNM 4AKIA 2DHYA 4LGMA 2OOAA 2MGWA 3FRIA 3U60B 2EJSA 4DUZM 4DR3M 4MM3B 4JI2M 3K2LA 2QHOB 4AW4A 2DWNA 2XF3A 1PJQA 2I7PA 1QYRA 2XH9A 2R45A 3AOEA 3FUWA 3HWSA 4OU7A 4L6V6 1OAIA 4KT0F 1QVRA 2EKFA 2K0BX 1LTMA 5DYGA 1HNZM 4QHTA 3SARA 1GJTA 2KNZA 2CWBA 1WHCA 4GIPA 4RF0A 4NRWA 1SXJE 3U6DA 1WJ7A 4GRIA 1IY0A 1GO5A 1K82A 4AQYM 4PT5A 4MGZE 1IY2A 3J80S 4B3RM 2H1RA 1V33A 4LF6M 3RGSA 3J7AS 3U5ZB 2EA0A 8CATA 3FUVA 3B9PA 3VLFB 4JYAM 4DV1M 4IBEA 3KOWE 4LJ4A 1IQPA 2HAKA 3GQ5A 3ZCBB 2OPFA 4LF5M 2M60A 1YLAA 3Q8XA 3GLFB 4G4QA 2KHHA 3B89A 2Y21A 1NNUC 2E5LM 3U6EA 4HLQA 3D8BA 4DR5M 4LF4M 2C5RA 4B7GA 1IM2A 3C3EA 3B7ZA 2JY6B 3U61B 3DOAA 2Z4RA 2O01F 1D0KA 1G8PA 2BJWA 2DZOB 3PFIA 4AG5A 4X62M 3R8FA 3A98B 1CUKA 1GL6A 2GNOA 2R4JA 2JY8A 5DYIA 2W82A 4BB9A 2JWSA 2APLA 2DZLA 4KO8A 4KODA 2K47A 2EUCA 3HU2A 2HKJA 1R7RA 4DR7M 3K1JA 4AKHA 1TDHA 1N77A 1HT2E 4BBAA 4W5WA 2CHQA 1JR3D 4M0WA 4F1IA 2XSZD 2Y0TA 2H5XA 3I01M 1GKIA 4NSOB 4XGIA 5ITYA 5GKNA 5L8RF 3E21A 3PVSA 2L4FA 3U6OA 4HEOA 3BXWA 4MGKE 3UJNA 3J2PB 3LQQA 4WURA 1DGHA 4QNMA 1L8QA 2KDLA 2Z4SA 5FSWA 2DENA 1OIZA 4AKGA 1ZQ9A 3FKEA 3TWMA 4JI1M 1G41A 1UM8A 4M0DA 4MH0E 3L29A 3FE3A 4FCVA 5FTLA 2D7GA 3B74A 4LCBA 1AIPC 4NSRA 2DWLA 2UUAM 1VEKA 1SXJB 2WSEF 2DAKA 3E46A 2G5GX 4QHSA 2YNMD 2CP8A 1W5SA 3HJQA 4Z6YA 4DV3M 2CHGA 2D7EA 1I4WA 3I4YA 5KQDA 3GQ4A 3HJ8A 1KFVA 4JV5M 1XMOM 5C18A 1L2DA 2XFTA 3FTEA 5KPRA 2KXEA 2Z3XA 2OO9A 2ERCA 1XXHE 3GLIE 2RRUA 1PJTA 4IBJA 4RF1A 2R6FA 1Z5CA 3SAWA 3FRHA 4GMQA 2L7HA 2LVQD 2QENA 3HU1A 5EP2A 3W0FA 3GPXA 4JI6M 2VF7A 1IBMM 1PRBA 1N78A 2F5SA 3VK8A 3SYKA 2L09A 1R2YA 3KS8A 3GLGE 2AHMA 3HKPA 1IBKM 3R9XB 2FH0A 2C9OA 2UU9M 1AUAA 2JP7A 2FOIC 2KW0A 5FTNA 2F5NA 4G4RA 1A5TA 3ZQJA 2R65A 3UK6A 3I51A 4B7HA 1NV8A 1VEGA 3U6PA 1VQ1A 2DAMA 4FCWA 3FUXA 2XZUA 1TTEA 1QAQA 1NVMA 3RGPA 2C9CA 1NV9A 4LFBM 3ZH9B 3L26A 3VDPA 4IJEA 4JN6A 2XEPA 4IBIA 3KVWA 4CHTB 4M9ZA 3FYDA 1L1ZA 2CFOA 4P16A 1I94M 1OQYA 4OX9M 2JZ0A 1Q3CA 4ITQA 3FUTA 3DA1A 1WGNA 4CGYB 3U5ZA 2ZTDA 2R46A 4CJ6A 2B3TA 1GLNA 3LVWA 1HT1E 1F4IA 5KQ8A 4Q7JA 4Y28F 2DXIA 4B08A 4P17A 4DV2M 4IBFA 2DWMA 2R4EA 1NNJA 1RU3A 2Z8YM 4QOZC 3JAMS 1MU5A 1YUBA 4DBGB 1IXZA 1OAOC 1PM5A 2HHHM 1HNWM 2JZ1A 1ZV1A 3HJSA 3C58A 4IBGA 1EFUB 3KOZE 4B7FA 2MROB 3IG5A 4DV7M 5FTMA 2F5OA 1IN6A 3I4VA 4LG2A 2ZANA 4B3SM 2FFJA 5DFLA 3J81S 1J5EM 3T1HM 1Z5AA 1VEJA 3RE8A 2XZFA 3U6CA 4PD2A 3KSJA 1XXHB 4PDIA 5BR8M 3GLIB 3PNVA 5EP1A 3U6QA 1QZMA 4GC9A 4X66M 1QAOA 2KRUA 4OVZA 4BLCA 2ZAMA 4GITA 5EXXA 2CV0A 3KOXE 1C7YA 4QNRA 1PJSA 2F4VM 1D0MA 1WIVA 2KNAA 3J27B 4L4UA 4DV6M 1VDLA 4R3DA 4GKKM 1OIPA 2L7IA 1NHWC 4GC5A 4IBCA 3GLGB 2FS1A 4S12A 2FNAA 4FWHA 2DAEA 5IZ7D 3GLHA 1S3SA 2MH8A 3TWKA 2KA6B 4K0KM 1HQYE 3SMSA 3V76A 1SG9A 1OFIA 1L1TA 1V92A 5EQTA 3RFWA 5FTKA 2X49A 4LY6A 2JY5A 2D7HA 2KEBA 3H4MA 3KDSE 5EXTA 3TQSA 2X8AA 4IBDA 4DV0M 1N33M 1FNNA 2K9DA 4LZZA 3SHGB 2LVAA 1JR3A 1SXJA 2WSCF 2XSZA 1H6UA 1ORYB 5EXPA 4JI0M 1PJIA 2RKOA 1QZEA 4NXNM 2L6OA 2C99A 3HU3A 1SXJD 4M9SA 3C9PA 1VG5A 1IXSA 2DI0A 1T6OA 5ITRA 1MN3A 4DR1M 1XHBA 2CE7A 2CV1A 2BWEA 1NY6A 3TE6A 3KXEC 3VDUA 1WGLA 3KFUG 4IIWA 1L2CA 3FTDA 4KLNA 4ZPXA 3UZUA 3T6PA 3GRVA 3OTOM 2ZAOA 2QBYA 3AOEC 4JI8M 1X37A 2HWJA 3AJIB 4DV4M 4ANRA 2J5YA 4R71A 1JQJC 1XWIA 2G3QA 2P5TA 1QQWA 3AOGA 3SHFA 5JI3E 3AV0A 4LJ7A 3CF0A 3JR5A 2DZNB 4G4NA 1PJJA 3FD9A 1XNQM 3A46A 1PGYA 3VK7A 5EP4A 3HY5A 3K92A 1Z5BA 3HHYA 4I5SA 1HNXM 1W5TA 2LNHC 3KP0E 3E9SA 2VF8A 1ZMUA 4FW9A 4FVMA 5EJCA 3FTFA 2N35A 2LBCA 1OJLA 2Z7JA 2LXEA 1D2NA 3HHWA 2UUCM 4GHLA 5C1BA 1DV0A 2WSFF 3H4JA 1NO1A 1OFHA 1QUTA 4AZFA 4NOOB 2EKKA 2YQZA 2YFQA 4RKUF 1R6BX 3GPUA 1QANA 1N32M 2BJVA 3LCUA 4LJ8A 2DNAA 5FLXS 3L28A 1HJPA 2MJ5B 3Q8GA 4LJ9A 2V1UA 3J7BA 3KW6A 4JXJA 4LGYA 3KSXA 3VKHA 3UMMA 2O5RA 4IBKA 3U60A 1MX0A 3KOYE 2K6BA 3C3DA 4B3MM 2XFSA 2QSFX 4LRSA 3GQ3A 1E9SA 4JI4M 4IJFA 3NBXX 1DGHB 4GHAA 1NJGA 1TH2A 1IFYA 1T43A 2ZBKB 2L2DA 1G3IA 2LH0A 3BOSA 2O25A 4LZJA 4F2LA 5ITQA 2DAIA 1WR1B 3GRRA 3AKZA 2VIIA 1LV7A 4JI5M 2QQ8A 4GKJM 1IN4A 1UFZA 1XXHA 2I7NA 4L15A 3T15A 2LVNC 1R2ZA 3AL0C 1NSFA 3GPYA 2QCUA 3B7NA 3SBJA 3F92A 4FCTA 5ITUA 5FTJA 2KZSA 4LJ5A 2L4EA 4AI6A 4YY3M 4L78A 4JI7M 2Y0QA 3GLFA 1XB2B 2R18A 4II7A 1E94E 2DHRA 3M0EA 1IBLM 1DGBA 4YHHM 5ITXA 1OTRA 3DZDA 3KS4A 2HCBA 2OQ4A 3HHZA 3AFHA 3U61A 3L27A 5DNYA 5BPVA 4G3OA 1ZMWA 1VDDA 3CGWA 3LVVA 4L8RC 2EO2A 3M6AA 2HL7A 1Z59A 1QAMA 2VQFM 4NXMM 1FJGM 1E9RA 3BBZA 4FD2A 4FWGA 3U6SA 3VKGA 4HL4A 2X4AA 3MJ5A 3QYBA 4NL4H 7CATA 2R44A 3NWLA 1QDTA 3GLHE 1TGUA 1KSFX 2JY7A 1N34M 1EIJA 3K9OA 4LF7M 1Q02A 1NY5A 4KHPM 3GRUA 2DKLA 1HQCA 1NHGC 1Q3BA 4M9XA 3W68A 2Y20A 2CEAA 2GQFA 1OKSA 2DAGA 1Q39A 4DR2M 3SAVA 2QNJA 3GO8A 1JR3E 1IY1A 4AG6A 2F5PA 2UXDM 3D8LA 1V34A 2CUZA 4QOSA 1XNRM 2ZTCA 2J7OA 2BWBA 3GP1A 2CRUA 3LW5F 1J7KA 1TF0B 2FE8A 3E4RA 3MK6A 2LTUA 4L16A 5E26A 2C96A 1TH4A 5KO3A 1Y8GA 2R62A 3CTWB 2RGHA 3IHPA 3TPZA 2QP9X 5ITTA 4DUYM 4DR4M 4UN2B 1QDRA 3MHVC 4Z8XA 3HZJA 1GVNA 1ZMVA 1C1KA 2LHGA 3A42A 3DFZA 1EE8A 2XLJA 3TL4X 1Z6TA 3T1YM 3SFZA 1IN5A 1IXRC 1DGFA 3THGA 3LMMA 3T38A 3L2AA 1P3QQ 1MJGM 4REZA 1N36M 4MGHA 4GH9A 4LF8M 1XMQM 2R0IA 3SYLA 3SASA 2A5YB 2JA2A 4XK8F 4DV5M 2F5QA 2C98A 2UXBM 3HHXA 1DO2A 2QPAA 4GEWA 2J7NA 5KPZA 4NC6A 4OVZB 3B7QA 4JI3M 2CV2A 4D80A 2G8LA 2YR0A 4G4OA 2LVPC 2QZ4A 2DWZB 1YSYA 2LHCA 1ZAEA 3WHLA 1YE9A 1GL7A 1N75A 1GJSA 4B3TM 3GPPA 3HX3A 3LCVB 2M5ZA 3A45A 5KPTA 5LMUM 1TDZA 3HGIA 4PDGA 4A3VB 3GLHB 4TUWA 5IWAM 3UGJA 3K8ZA 3SAUA 2RGOA 3M7GA 4R7GA 3IECA 4MGIE 2MR9A 4I4LA 1DGGA 1G59A 2CHVA 4I8OA 4MGYE 2VQEM 3FTCA 4WP2A 3U6LA 3FYCA 5IREB 1JB0F 2WZJA 3CF2A 4CIZA 4NRVA 2JNHA 2LVOC 4G6ZA 3MMPA 2ZM6M 2KNVA 1G71A 2V1CA 3FUUA 4LRTA 3EIEA 4LFCM 1NJFA 4LJAA 2UXCM 1KYIA 2Q2EB 3QWLA 4RNAA 4LFAM 1IXSB 5H37D 1GABA 1TH3A 1SXJC 2V6ZM 1L2BA 3SC3A 3L25A 1G4AE 3ILKA 4CISA 2UUBM 5F3WA 1J09A 3SMPA 1E32A 2JUJA 2JXNA 5A2QS 3TWLA 1IN7A 1R5LA 2QBYB 3U6MA 3GLFE 1K3XA 1T3TA 4D81A 1BVSA 4EIWA 5ITXE 3GLIA 4LJ6A 2KRKA 2KZUA
chains in the Genus database with same CATH topology
3PXGA 3GRYA 3QAUA 5E6JA 4FWDA 2XGNA 4PCZA 3W0LB 2BNKA 1WXQA 4IBBA 3GLGA 3JR4A 5EP3A 4LF9M 4XBOA 1XC8A 4DR6M 3NBIA 3IG8A 3SATA 4D82A 3WHKA 2NQ8C 3KP1E 5JI2E 4MB7A 2LWXA 3CF6E 3ZC7B 3VFDA 3PNYA 4OW0A 4I81A 1HR0M 5IT9S 4X65M 1DO0A 1IN8A 1K3WA 4X64M 3LQRA 3EIHA 2DVWB 4WW0A 5EXSA 5LMNM 4AKIA 4LGMA 3U60B 4DUZM 4DR3M 4MM3B 4JI2M 3K2LA 4AW4A 2DWNA 2XF3A 2I7PA 1QYRA 2XH9A 3HWSA 2R45A 3AOEA 3FUWA 4OU7A 1QVRA 5DYGA 1HNZM 4QHTA 3SARA 4GIPA 4RF0A 4NRWA 1SXJE 3U6DA 4GRIA 1IY0A 1K82A 4AQYM 4PT5A 4MGZE 1IY2A 3J80S 4B3RM 2H1RA 4LF6M 3RGSA 3J7AS 3U5ZB 2EA0A 8CATA 3FUVA 3B9PA 3VLFB 4JYAM 4DV1M 4IBEA 3KOWE 4LJ4A 1IQPA 3GQ5A 4LF5M 3ZCBB 2OPFA 2M60A 3Q8XA 3GLFB 4G4QA 2Y21A 1NNUC 2E5LM 3U6EA 4HLQA 3D8BA 4DR5M 4LF4M 2C5RA 4B7GA 1IM2A 3U61B 3DOAA 2Z4RA 3PFIA 1G8PA 2BJWA 2DZOB 3R8FA 4AG5A 4X62M 3A98B 1GL6A 2R4JA 5DYIA 2W82A 4BB9A 4KO8A 2KRKA 4KODA 2K47A 2EUCA 3HU2A 2HKJA 1R7RA 4DR7M 3K1JA 4AKHA 1TDHA 1N77A 1HT2E 4BBAA 4W5WA 2CHQA 1JR3D 4M0WA 2XSZD 2Y0TA 1GKIA 4NSOB 4XGIA 5ITYA 5GKNA 3PVSA 3U6OA 4MGKE 3UJNA 3J2PB 3LQQA 4WURA 1DGHA 4QNMA 1L8QA 2Z4SA 5FSWA 4AKGA 1ZQ9A 3FKEA 3TWMA 4JI1M 1G41A 1UM8A 4M0DA 4MH0E 3L29A 4FCVA 5FTLA 2D7GA 4LCBA 4NSRA 2DWLA 2UUAM 1SXJB 4QHSA 4Z6YA 2G5GX 2YNMD 3HJQA 1W5SA 4DV3M 2CHGA 2D7EA 1I4WA 3I4YA 5KQDA 3GQ4A 3HJ8A 1KFVA 4JV5M 1XMOM 5C18A 1L2DA 2XFTA 3FTEA 5KPRA 2KXEA 2Z3XA 2ERCA 4IBJA 4RF1A 1Z5CA 3SAWA 4GMQA 2L7HA 2QENA 3HU1A 5EP2A 3W0FA 3GPXA 4JI6M 1IBMM 1N78A 2F5SA 3VK8A 3SYKA 2L09A 1R2YA 3KS8A 2AHMA 3HKPA 1IBKM 3R9XB 2C9OA 2UU9M 2FOIC 2KW0A 5FTNA 2F5NA 4G4RA 2R65A 3UK6A 3I51A 4B7HA 3U6PA 4FCWA 3FUXA 2XZUA 1QAQA 1NVMA 3RGPA 2C9CA 4LFBM 3ZH9B 3L26A 3VDPA 4IJEA 4JN6A 2XEPA 4IBIA 3KVWA 4CHTB 4M9ZA 3FYDA 1L1ZA 2CFOA 4P16A 1I94M 4OX9M 1Q3CA 4ITQA 3FUTA 3DA1A 3U5ZA 4CGYB 2R46A 1GLNA 3LVWA 1HT1E 5KQ8A 2DXIA 4B08A 4DV2M 4IBFA 2DWMA 2R4EA 1NNJA 4QOZC 3JAMS 1MU5A 1YUBA 1IXZA 1PM5A 2HHHM 1HNWM 3HJSA 3C58A 4IBGA 3KOZE 4B7FA 4DV7M 3IG5A 5FTMA 2F5OA 1IN6A 3I4VA 4LG2A 2ZANA 4B3SM 2FFJA 3J81S 1J5EM 3T1HM 1Z5AA 3RE8A 2XZFA 3U6CA 4PD2A 3GLIB 1XXHB 4PDIA 5BR8M 3U6QA 3PNVA 5EP1A 1QZMA 4GC9A 4X66M 1QAOA 2KRUA 4OVZA 4BLCA 2ZAMA 4GITA 5EXXA 2CV0A 3KOXE 4QNRA 2F4VM 3J27B 4L4UA 4DV6M 4GKKM 4R3DA 4GC5A 2L7IA 1NHWC 4IBCA 3GLGB 4S12A 2FNAA 4FWHA 5IZ7D 3GLHA 1S3SA 3TWKA 4K0KM 2KA6B 1HQYE 3SMSA 1OFIA 1L1TA 5EQTA 3RFWA 5FTKA 2X49A 4LY6A 2D7HA 2KEBA 3H4MA 3KDSE 5EXTA 3TQSA 2X8AA 4IBDA 4DV0M 1N33M 1FNNA 4LZZA 3SHGB 1JR3A 1SXJA 1PJIA 2XSZA 1H6UA 1ORYB 5EXPA 4JI0M 2RKOA 4NXNM 2L6OA 2C99A 3HU3A 1SXJD 4M9SA 5ITRA 4DR1M 1XHBA 2CE7A 2CV1A 1NY6A 3TE6A 3KXEC 3VDUA 3KFUG 4IIWA 1L2CA 3FTDA 4KLNA 4ZPXA 3UZUA 3GRVA 3OTOM 2ZAOA 2QBYA 3AOEC 4JI8M 1X37A 3AJIB 4DV4M 1JQJC 1XWIA 2P5TA 3AOGA 1QQWA 3SHFA 5JI3E 3JR5A 3AV0A 4LJ7A 3CF0A 4G4NA 2DZNB 1PJJA 3FD9A 1XNQM 3A46A 3VK7A 5EP4A 3K92A 1Z5BA 3HHYA 4I5SA 1HNXM 1W5TA 2LNHC 3KP0E 3E9SA 4FVMA 4FW9A 5EJCA 3FTFA 1OJLA 2Z7JA 1D2NA 2LXEA 3HHWA 2UUCM 4GHLA 5C1BA 1OFHA 4AZFA 4NOOB 2YQZA 2YFQA 1R6BX 3GPUA 1QANA 1N32M 2BJVA 4LJ8A 5FLXS 3L28A 4LJ9A 2V1UA 3J7BA 3KW6A 4JXJA 4LGYA 3KSXA 3VKHA 3UMMA 2O5RA 4IBKA 3U60A 1MX0A 3KOYE 4B3MM 2XFSA 4LRSA 3GQ3A 1E9SA 4JI4M 4IJFA 1DGHB 4GHAA 1NJGA 1TH2A 2ZBKB 1G3IA 2LH0A 3BOSA 5ITQA 4LZJA 3GRRA 3AKZA 2VIIA 1LV7A 4JI5M 4GKJM 1IN4A 2I7NA 1XXHA 4L15A 3T15A 1R2ZA 3AL0C 1NSFA 3GPYA 2QCUA 3SBJA 4FCTA 5ITUA 5FTJA 2KZSA 4LJ5A 4AI6A 4YY3M 4L78A 4JI7M 2Y0QA 3GLFA 2R18A 4II7A 1E94E 2DHRA 3M0EA 1IBLM 1DGBA 4YHHM 5ITXA 3DZDA 3KS4A 2HCBA 2OQ4A 3HHZA 3AFHA 3U61A 3L27A 5DNYA 5BPVA 1VDDA 3LVVA 4L8RC 2EO2A 3M6AA 2HL7A 1Z59A 1QAMA 2VQFM 4NXMM 1FJGM 1E9RA 4FD2A 4FWGA 3U6SA 3VKGA 4HL4A 2X4AA 3MJ5A 4NL4H 7CATA 3NWLA 1TGUA 1KSFX 1N34M 4LF7M 1NY5A 4KHPM 3GRUA 1HQCA 1NHGC 1Q3BA 4M9XA 2Y20A 2CEAA 1Q39A 4DR2M 3SAVA 3GO8A 1IY1A 4AG6A 2F5PA 2UXDM 3D8LA 2CUZA 4QOSA 1XNRM 2J7OA 3GP1A 1J7KA 2FE8A 3E4RA 3MK6A 4L16A 5E26A 2C96A 1TH4A 5KO3A 2R62A 3CTWB 2RGHA 3TPZA 2QP9X 5ITTA 4DUYM 4DR4M 3MHVC 4Z8XA 1GVNA 1C1KA 3A42A 3DFZA 1EE8A 2XLJA 3TL4X 1Z6TA 3T1YM 3SFZA 1IN5A 1IXRC 1DGFA 3THGA 3LMMA 3T38A 3L2AA 4REZA 1N36M 4MGHA 4GH9A 4LF8M 1XMQM 3SYLA 3SASA 2A5YB 2JA2A 4DV5M 2F5QA 2C98A 2UXBM 3HHXA 1DO2A 2QPAA 2J7NA 5KPZA 4OVZB 4JI3M 2CV2A 4D80A 2G8LA 2YR0A 4G4OA 2QZ4A 2DWZB 1YSYA 1ZAEA 3WHLA 1YE9A 1GL7A 1N75A 4B3TM 3GPPA 2M5ZA 3A45A 5KPTA 5LMUM 1TDZA 3HGIA 4PDGA 4A3VB 3GLHB 4TUWA 5IWAM 3UGJA 3K8ZA 3SAUA 2RGOA 3M7GA 4R7GA 4MGIE 4I4LA 1DGGA 1G59A 2CHVA 4I8OA 4MGYE 2VQEM 3FTCA 3U6LA 3FYCA 5IREB 3CF2A 4NRVA 4G6ZA 2ZM6M 3FUUA 2V1CA 4LRTA 3EIEA 4LFCM 1NJFA 4LJAA 2UXCM 1KYIA 2Q2EB 3QWLA 4RNAA 4LFAM 1IXSB 5H37D 1TH3A 1SXJC 2V6ZM 1L2BA 3SC3A 3L25A 1G4AE 3ILKA 4CISA 2UUBM 5F3WA 1J09A 3SMPA 1E32A 5A2QS 3TWLA 1IN7A 2QBYB 3U6MA 1K3XA 1T3TA 4D81A 4EIWA 5ITXE 3GLIA 4LJ6A 3KSJA 2KZUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PJI A;  2UUA M;  4JI0 M;  1N34 M;  4NXN M;  4DV3 M;  4LF7 M;  3GQ4 A;  1KFV A;  4KHP M;  4JV5 M;  1XMO M;  4PCZ A;  1L2D A;  1Q3B A;  1Q39 A;  5ITR A;  3JR4 A;  4LF9 M;  4DR1 M;  4DR2 M;  3SAV A;  3GO8 A;  1XC8 A;  4DR6 M;  3SAT A;  2F5P A;  1Z5C A;  4MB7 A;  3SAW A;  2UXD M;  1L2C A;  1HR0 M;  3OTO M;  3GPX A;  4JI6 M;  3W0F A;  1XNR M;  5IT9 S;  4X65 M;  1IBM M;  3GP1 A;  1K3W A;  3VK8 A;  2F5S A;  4JI8 M;  4X64 M;  1R2Y A;  4DV4 M;  1IBK M;  5LMN M;  2UU9 M;  3JR5 A;  4G4N A;  2F5N A;  1PJJ A;  1XNQ M;  3A46 A;  4G4R A;  5ITT A;  3VK7 A;  4DUY M;  4DR3 M;  4JI2 M;  4DR4 M;  1Z5B A;  1HNX M;  3U6P A;  3A42 A;  2XZU A;  1HNZ M;  1EE8 A;  2UUC M;  3SAR A;  3T1Y M;  4LFB M;  4NRW A;  3U6D A;  1N36 M;  4LF8 M;  1XMQ M;  1K82 A;  1L1Z A;  4AQY M;  3GPU A;  3SAS A;  1I94 M;  4DV5 M;  4OX9 M;  1N32 M;  2F5Q A;  2UXB M;  3J80 S;  4B3R M;  1Q3C A;  4ITQ A;  4LF6 M;  3J7A S;  5FLX S;  2EA0 A;  4JYA M;  4JI3 M;  4DV1 M;  4G4O A;  3GQ5 A;  4DV2 M;  4LF5 M;  2OPF A;  1MX0 A;  4G4Q A;  1NNJ A;  3GPP A;  4B3T M;  4B3M M;  3JAM S;  1MU5 A;  2E5L M;  3U6E A;  1PM5 A;  2HHH M;  3A45 A;  4DR5 M;  4LF4 M;  1HNW M;  5LMU M;  3GQ3 A;  1TDZ A;  4JI4 M;  3C58 A;  4PDG A;  2ZBK B;  3DOA A;  5IWA M;  4DV7 M;  5ITQ A;  2F5O A;  4X62 M;  3SAU A;  4B3S M;  3J81 S;  1J5E M;  3T1H M;  4JI5 M;  1Z5A A;  4GKJ M;  2XZF A;  3U6C A;  4PD2 A;  1R2Z A;  4PDI A;  3U6Q A;  2VQE M;  5BR8 M;  3U6L A;  3GPY A;  4X66 M;  2HKJ A;  4DR7 M;  3SBJ A;  1TDH A;  4NRV A;  2ZM6 M;  5ITU A;  4YY3 M;  4LFC M;  4JI7 M;  2F4V M;  2UXC M;  4DV6 M;  5ITY A;  2Q2E B;  4GKK M;  1IBL M;  4LFA M;  3U6O A;  4YHH M;  5ITX A;  2OQ4 A;  1L2B A;  4CIS A;  2UUB M;  3TWK A;  4K0K M;  3TWM A;  4JI1 M;  1L1T A;  5A2Q S;  1Z59 A;  3TWL A;  3U6M A;  1K3X A;  2VQF M;  4DV0 M;  4NXM M;  1N33 M;  1FJG M;  5ITX E;  3U6S A;  4DUZ M; 
#chains in the Genus database with same CATH topology
 3PXG A;  3GRY A;  3QAU A;  5E6J A;  3QYE A;  4FWD A;  1D0L A;  2XGN A;  4PCZ A;  3W0L B;  1R4G A;  2VDB B;  2BNK A;  1WXQ A;  2OOB A;  3K9P A;  4IBB A;  3GLG A;  3JR4 A;  5EP3 A;  4LF9 M;  4XBO A;  1XC8 A;  4DR6 M;  3NBI A;  3IG8 A;  3SAT A;  4D82 A;  3WHK A;  2NQ8 C;  3KP1 E;  5JI2 E;  4MB7 A;  2LWX A;  3CF6 E;  3ZC7 B;  3VFD A;  3PNY A;  3W67 A;  4OW0 A;  4I81 A;  1HR0 M;  5IT9 S;  1TR8 A;  4X65 M;  1DO0 A;  1IN8 A;  1K3W A;  1QUS A;  4X64 M;  3LQR A;  3EIH A;  2DVW B;  4WW0 A;  3I04 M;  5EXS A;  5LMN M;  4AKI A;  2DHY A;  4LGM A;  2OOA A;  2MGW A;  3FRI A;  3U60 B;  2EJS A;  4DUZ M;  4DR3 M;  4MM3 B;  4JI2 M;  3K2L A;  2QHO B;  4AW4 A;  2DWN A;  2XF3 A;  1PJQ A;  2I7P A;  1QYR A;  2XH9 A;  2R45 A;  3AOE A;  3FUW A;  3HWS A;  4OU7 A;  4L6V 6;  1OAI A;  4KT0 F;  1QVR A;  2EKF A;  2K0B X;  1LTM A;  5DYG A;  1HNZ M;  4QHT A;  3SAR A;  1GJT A;  2KNZ A;  2CWB A;  1WHC A;  4GIP A;  4RF0 A;  4NRW A;  1SXJ E;  3U6D A;  1WJ7 A;  4GRI A;  1IY0 A;  1GO5 A;  1K82 A;  4AQY M;  4PT5 A;  4MGZ E;  1IY2 A;  3J80 S;  4B3R M;  2H1R A;  1V33 A;  4LF6 M;  3RGS A;  3J7A S;  3U5Z B;  2EA0 A;  8CAT A;  3FUV A;  3B9P A;  3VLF B;  4JYA M;  4DV1 M;  4IBE A;  3KOW E;  4LJ4 A;  1IQP A;  2HAK A;  3GQ5 A;  3ZCB B;  2OPF A;  4LF5 M;  2M60 A;  1YLA A;  3Q8X A;  3GLF B;  4G4Q A;  2KHH A;  3B89 A;  2Y21 A;  1NNU C;  2E5L M;  3U6E A;  4HLQ A;  3D8B A;  4DR5 M;  4LF4 M;  2C5R A;  4B7G A;  1IM2 A;  3C3E A;  3B7Z A;  2JY6 B;  3U61 B;  3DOA A;  2Z4R A;  2O01 F;  1D0K A;  1G8P A;  2BJW A;  2DZO B;  3PFI A;  4AG5 A;  4X62 M;  3R8F A;  3A98 B;  1CUK A;  1GL6 A;  2GNO A;  2R4J A;  2JY8 A;  5DYI A;  2W82 A;  4BB9 A;  2JWS A;  2APL A;  2DZL A;  4KO8 A;  4KOD A;  2K47 A;  2EUC A;  3HU2 A;  2HKJ A;  1R7R A;  4DR7 M;  3K1J A;  4AKH A;  1TDH A;  1N77 A;  1HT2 E;  4BBA A;  4W5W A;  2CHQ A;  1JR3 D;  4M0W A;  4F1I A;  2XSZ D;  2Y0T A;  2H5X A;  3I01 M;  1GKI A;  4NSO B;  4XGI A;  5ITY A;  5GKN A;  5L8R F;  3E21 A;  3PVS A;  2L4F A;  3U6O A;  4HEO A;  3BXW A;  4MGK E;  3UJN A;  3J2P B;  3LQQ A;  4WUR A;  1DGH A;  4QNM A;  1L8Q A;  2KDL A;  2Z4S A;  5FSW A;  2DEN A;  1OIZ A;  4AKG A;  1ZQ9 A;  3FKE A;  3TWM A;  4JI1 M;  1G41 A;  1UM8 A;  4M0D A;  4MH0 E;  3L29 A;  3FE3 A;  4FCV A;  5FTL A;  2D7G A;  3B74 A;  4LCB A;  1AIP C;  4NSR A;  2DWL A;  2UUA M;  1VEK A;  1SXJ B;  2WSE F;  2DAK A;  3E46 A;  2G5G X;  4QHS A;  2YNM D;  2CP8 A;  1W5S A;  3HJQ A;  4Z6Y A;  4DV3 M;  2CHG A;  2D7E A;  1I4W A;  3I4Y A;  5KQD A;  3GQ4 A;  3HJ8 A;  1KFV A;  4JV5 M;  1XMO M;  5C18 A;  1L2D A;  2XFT A;  3FTE A;  5KPR A;  2KXE A;  2Z3X A;  2OO9 A;  2ERC A;  1XXH E;  3GLI E;  2RRU A;  1PJT A;  4IBJ A;  4RF1 A;  2R6F A;  1Z5C A;  3SAW A;  3FRH A;  4GMQ A;  2L7H A;  2LVQ D;  2QEN A;  3HU1 A;  5EP2 A;  3W0F A;  3GPX A;  4JI6 M;  2VF7 A;  1IBM M;  1PRB A;  1N78 A;  2F5S A;  3VK8 A;  3SYK A;  2L09 A;  1R2Y A;  3KS8 A;  3GLG E;  2AHM A;  3HKP A;  1IBK M;  3R9X B;  2FH0 A;  2C9O A;  2UU9 M;  1AUA A;  2JP7 A;  2FOI C;  2KW0 A;  5FTN A;  2F5N A;  4G4R A;  1A5T A;  3ZQJ A;  2R65 A;  3UK6 A;  3I51 A;  4B7H A;  1NV8 A;  1VEG A;  3U6P A;  1VQ1 A;  2DAM A;  4FCW A;  3FUX A;  2XZU A;  1TTE A;  1QAQ A;  1NVM A;  3RGP A;  2C9C A;  1NV9 A;  4LFB M;  3ZH9 B;  3L26 A;  3VDP A;  4IJE A;  4JN6 A;  2XEP A;  4IBI A;  3KVW A;  4CHT B;  4M9Z A;  3FYD A;  1L1Z A;  2CFO A;  4P16 A;  1I94 M;  1OQY A;  4OX9 M;  2JZ0 A;  1Q3C A;  4ITQ A;  3FUT A;  3DA1 A;  1WGN A;  4CGY B;  3U5Z A;  2ZTD A;  2R46 A;  4CJ6 A;  2B3T A;  1GLN A;  3LVW A;  1HT1 E;  1F4I A;  5KQ8 A;  4Q7J A;  4Y28 F;  2DXI A;  4B08 A;  4P17 A;  4DV2 M;  4IBF A;  2DWM A;  2R4E A;  1NNJ A;  1RU3 A;  2Z8Y M;  4QOZ C;  3JAM S;  1MU5 A;  1YUB A;  4DBG B;  1IXZ A;  1OAO C;  1PM5 A;  2HHH M;  1HNW M;  2JZ1 A;  1ZV1 A;  3HJS A;  3C58 A;  4IBG A;  1EFU B;  3KOZ E;  4B7F A;  2MRO B;  3IG5 A;  4DV7 M;  5FTM A;  2F5O A;  1IN6 A;  3I4V A;  4LG2 A;  2ZAN A;  4B3S M;  2FFJ A;  5DFL A;  3J81 S;  1J5E M;  3T1H M;  1Z5A A;  1VEJ A;  3RE8 A;  2XZF A;  3U6C A;  4PD2 A;  3KSJ A;  1XXH B;  4PDI A;  5BR8 M;  3GLI B;  3PNV A;  5EP1 A;  3U6Q A;  1QZM A;  4GC9 A;  4X66 M;  1QAO A;  2KRU A;  4OVZ A;  4BLC A;  2ZAM A;  4GIT A;  5EXX A;  2CV0 A;  3KOX E;  1C7Y A;  4QNR A;  1PJS A;  2F4V M;  1D0M A;  1WIV A;  2KNA A;  3J27 B;  4L4U A;  4DV6 M;  1VDL A;  4R3D A;  4GKK M;  1OIP A;  2L7I A;  1NHW C;  4GC5 A;  4IBC A;  3GLG B;  2FS1 A;  4S12 A;  2FNA A;  4FWH A;  2DAE A;  5IZ7 D;  3GLH A;  1S3S A;  2MH8 A;  3TWK A;  2KA6 B;  4K0K M;  1HQY E;  3SMS A;  3V76 A;  1SG9 A;  1OFI A;  1L1T A;  1V92 A;  5EQT A;  3RFW A;  5FTK A;  2X49 A;  4LY6 A;  2JY5 A;  2D7H A;  2KEB A;  3H4M A;  3KDS E;  5EXT A;  3TQS A;  2X8A A;  4IBD A;  4DV0 M;  1N33 M;  1FNN A;  2K9D A;  4LZZ A;  3SHG B;  2LVA A;  1JR3 A;  1SXJ A;  2WSC F;  2XSZ A;  1H6U A;  1ORY B;  5EXP A;  4JI0 M;  1PJI A;  2RKO A;  1QZE A;  4NXN M;  2L6O A;  2C99 A;  3HU3 A;  1SXJ D;  4M9S A;  3C9P A;  1VG5 A;  1IXS A;  2DI0 A;  1T6O A;  5ITR A;  1MN3 A;  4DR1 M;  1XHB A;  2CE7 A;  2CV1 A;  2BWE A;  1NY6 A;  3TE6 A;  3KXE C;  3VDU A;  1WGL A;  3KFU G;  4IIW A;  1L2C A;  3FTD A;  4KLN A;  4ZPX A;  3UZU A;  3T6P A;  3GRV A;  3OTO M;  2ZAO A;  2QBY A;  3AOE C;  4JI8 M;  1X37 A;  2HWJ A;  3AJI B;  4DV4 M;  4ANR A;  2J5Y A;  4R71 A;  1JQJ C;  1XWI A;  2G3Q A;  2P5T A;  1QQW A;  3AOG A;  3SHF A;  5JI3 E;  3AV0 A;  4LJ7 A;  3CF0 A;  3JR5 A;  2DZN B;  4G4N A;  1PJJ A;  3FD9 A;  1XNQ M;  3A46 A;  1PGY A;  3VK7 A;  5EP4 A;  3HY5 A;  3K92 A;  1Z5B A;  3HHY A;  4I5S A;  1HNX M;  1W5T A;  2LNH C;  3KP0 E;  3E9S A;  2VF8 A;  1ZMU A;  4FW9 A;  4FVM A;  5EJC A;  3FTF A;  2N35 A;  2LBC A;  1OJL A;  2Z7J A;  2LXE A;  1D2N A;  3HHW A;  2UUC M;  4GHL A;  5C1B A;  1DV0 A;  2WSF F;  3H4J A;  1NO1 A;  1OFH A;  1QUT A;  4AZF A;  4NOO B;  2EKK A;  2YQZ A;  2YFQ A;  4RKU F;  1R6B X;  3GPU A;  1QAN A;  1N32 M;  2BJV A;  3LCU A;  4LJ8 A;  2DNA A;  5FLX S;  3L28 A;  1HJP A;  2MJ5 B;  3Q8G A;  4LJ9 A;  2V1U A;  3J7B A;  3KW6 A;  4JXJ A;  4LGY A;  3KSX A;  3VKH A;  3UMM A;  2O5R A;  4IBK A;  3U60 A;  1MX0 A;  3KOY E;  2K6B A;  3C3D A;  4B3M M;  2XFS A;  2QSF X;  4LRS A;  3GQ3 A;  1E9S A;  4JI4 M;  4IJF A;  3NBX X;  1DGH B;  4GHA A;  1NJG A;  1TH2 A;  1IFY A;  1T43 A;  2ZBK B;  2L2D A;  1G3I A;  2LH0 A;  3BOS A;  2O25 A;  4LZJ A;  4F2L A;  5ITQ A;  2DAI A;  1WR1 B;  3GRR A;  3AKZ A;  2VII A;  1LV7 A;  4JI5 M;  2QQ8 A;  4GKJ M;  1IN4 A;  1UFZ A;  1XXH A;  2I7N A;  4L15 A;  3T15 A;  2LVN C;  1R2Z A;  3AL0 C;  1NSF A;  3GPY A;  2QCU A;  3B7N A;  3SBJ A;  3F92 A;  4FCT A;  5ITU A;  5FTJ A;  2KZS A;  4LJ5 A;  2L4E A;  4AI6 A;  4YY3 M;  4L78 A;  4JI7 M;  2Y0Q A;  3GLF A;  1XB2 B;  2R18 A;  4II7 A;  1E94 E;  2DHR A;  3M0E A;  1IBL M;  1DGB A;  4YHH M;  5ITX A;  1OTR A;  3DZD A;  3KS4 A;  2HCB A;  2OQ4 A;  3HHZ A;  3AFH A;  3U61 A;  3L27 A;  5DNY A;  5BPV A;  4G3O A;  1ZMW A;  1VDD A;  3CGW A;  3LVV A;  4L8R C;  2EO2 A;  3M6A A;  2HL7 A;  1Z59 A;  1QAM A;  2VQF M;  4NXM M;  1FJG M;  1E9R A;  3BBZ A;  4FD2 A;  4FWG A;  3U6S A;  3VKG A;  4HL4 A;  2X4A A;  3MJ5 A;  3QYB A;  4NL4 H;  7CAT A;  2R44 A;  3NWL A;  1QDT A;  3GLH E;  1TGU A;  1KSF X;  2JY7 A;  1N34 M;  1EIJ A;  3K9O A;  4LF7 M;  1Q02 A;  1NY5 A;  4KHP M;  3GRU A;  2DKL A;  1HQC A;  1NHG C;  1Q3B A;  4M9X A;  3W68 A;  2Y20 A;  2CEA A;  2GQF A;  1OKS A;  2DAG A;  1Q39 A;  4DR2 M;  3SAV A;  2QNJ A;  3GO8 A;  1JR3 E;  1IY1 A;  4AG6 A;  2F5P A;  2UXD M;  3D8L A;  1V34 A;  2CUZ A;  4QOS A;  1XNR M;  2ZTC A;  2J7O A;  2BWB A;  3GP1 A;  2CRU A;  3LW5 F;  1J7K A;  1TF0 B;  2FE8 A;  3E4R A;  3MK6 A;  2LTU A;  4L16 A;  5E26 A;  2C96 A;  1TH4 A;  5KO3 A;  1Y8G A;  2R62 A;  3CTW B;  2RGH A;  3IHP A;  3TPZ A;  2QP9 X;  5ITT A;  4DUY M;  4DR4 M;  4UN2 B;  1QDR A;  3MHV C;  4Z8X A;  3HZJ A;  1GVN A;  1ZMV A;  1C1K A;  2LHG A;  3A42 A;  3DFZ A;  1EE8 A;  2XLJ A;  3TL4 X;  1Z6T A;  3T1Y M;  3SFZ A;  1IN5 A;  1IXR C;  1DGF A;  3THG A;  3LMM A;  3T38 A;  3L2A A;  1P3Q Q;  1MJG M;  4REZ A;  1N36 M;  4MGH A;  4GH9 A;  4LF8 M;  1XMQ M;  2R0I A;  3SYL A;  3SAS A;  2A5Y B;  2JA2 A;  4XK8 F;  4DV5 M;  2F5Q A;  2C98 A;  2UXB M;  3HHX A;  1DO2 A;  2QPA A;  4GEW A;  2J7N A;  5KPZ A;  4NC6 A;  4OVZ B;  3B7Q A;  4JI3 M;  2CV2 A;  4D80 A;  2G8L A;  2YR0 A;  4G4O A;  2LVP C;  2QZ4 A;  2DWZ B;  1YSY A;  2LHC A;  1ZAE A;  3WHL A;  1YE9 A;  1GL7 A;  1N75 A;  1GJS A;  4B3T M;  3GPP A;  3HX3 A;  3LCV B;  2M5Z A;  3A45 A;  5KPT A;  5LMU M;  1TDZ A;  3HGI A;  4PDG A;  4A3V B;  3GLH B;  4TUW A;  5IWA M;  3UGJ A;  3K8Z A;  3SAU A;  2RGO A;  3M7G A;  4R7G A;  3IEC A;  4MGI E;  2MR9 A;  4I4L A;  1DGG A;  1G59 A;  2CHV A;  4I8O A;  4MGY E;  2VQE M;  3FTC A;  4WP2 A;  3U6L A;  3FYC A;  5IRE B;  1JB0 F;  2WZJ A;  3CF2 A;  4CIZ A;  4NRV A;  2JNH A;  2LVO C;  4G6Z A;  3MMP A;  2ZM6 M;  2KNV A;  1G71 A;  2V1C A;  3FUU A;  4LRT A;  3EIE A;  4LFC M;  1NJF A;  4LJA A;  2UXC M;  1KYI A;  2Q2E B;  3QWL A;  4RNA A;  4LFA M;  1IXS B;  5H37 D;  1GAB A;  1TH3 A;  1SXJ C;  2V6Z M;  1L2B A;  3SC3 A;  3L25 A;  1G4A E;  3ILK A;  4CIS A;  2UUB M;  5F3W A;  1J09 A;  3SMP A;  1E32 A;  2JUJ A;  2JXN A;  5A2Q S;  3TWL A;  1IN7 A;  1R5L A;  2QBY B;  3U6M A;  3GLF E;  1K3X A;  1T3T A;  4D81 A;  1BVS A;  4EIW A;  5ITX E;  3GLI A;  4LJ6 A;  2KRK A;  2KZU A; 
#chains in the Genus database with same CATH homology
 3PXG A;  3GRY A;  3QAU A;  5E6J A;  4FWD A;  2XGN A;  4PCZ A;  3W0L B;  2BNK A;  1WXQ A;  4IBB A;  3GLG A;  3JR4 A;  5EP3 A;  4LF9 M;  4XBO A;  1XC8 A;  4DR6 M;  3NBI A;  3IG8 A;  3SAT A;  4D82 A;  3WHK A;  2NQ8 C;  3KP1 E;  5JI2 E;  4MB7 A;  2LWX A;  3CF6 E;  3ZC7 B;  3VFD A;  3PNY A;  4OW0 A;  4I81 A;  1HR0 M;  5IT9 S;  4X65 M;  1DO0 A;  1IN8 A;  1K3W A;  4X64 M;  3LQR A;  3EIH A;  2DVW B;  4WW0 A;  5EXS A;  5LMN M;  4AKI A;  4LGM A;  3U60 B;  4DUZ M;  4DR3 M;  4MM3 B;  4JI2 M;  3K2L A;  4AW4 A;  2DWN A;  2XF3 A;  2I7P A;  1QYR A;  2XH9 A;  3HWS A;  2R45 A;  3AOE A;  3FUW A;  4OU7 A;  1QVR A;  5DYG A;  1HNZ M;  4QHT A;  3SAR A;  4GIP A;  4RF0 A;  4NRW A;  1SXJ E;  3U6D A;  4GRI A;  1IY0 A;  1K82 A;  4AQY M;  4PT5 A;  4MGZ E;  1IY2 A;  3J80 S;  4B3R M;  2H1R A;  4LF6 M;  3RGS A;  3J7A S;  3U5Z B;  2EA0 A;  8CAT A;  3FUV A;  3B9P A;  3VLF B;  4JYA M;  4DV1 M;  4IBE A;  3KOW E;  4LJ4 A;  1IQP A;  3GQ5 A;  4LF5 M;  3ZCB B;  2OPF A;  2M60 A;  3Q8X A;  3GLF B;  4G4Q A;  2Y21 A;  1NNU C;  2E5L M;  3U6E A;  4HLQ A;  3D8B A;  4DR5 M;  4LF4 M;  2C5R A;  4B7G A;  1IM2 A;  3U61 B;  3DOA A;  2Z4R A;  3PFI A;  1G8P A;  2BJW A;  2DZO B;  3R8F A;  4AG5 A;  4X62 M;  3A98 B;  1GL6 A;  2R4J A;  5DYI A;  2W82 A;  4BB9 A;  4KO8 A;  2KRK A;  4KOD A;  2K47 A;  2EUC A;  3HU2 A;  2HKJ A;  1R7R A;  4DR7 M;  3K1J A;  4AKH A;  1TDH A;  1N77 A;  1HT2 E;  4BBA A;  4W5W A;  2CHQ A;  1JR3 D;  4M0W A;  2XSZ D;  2Y0T A;  1GKI A;  4NSO B;  4XGI A;  5ITY A;  5GKN A;  3PVS A;  3U6O A;  4MGK E;  3UJN A;  3J2P B;  3LQQ A;  4WUR A;  1DGH A;  4QNM A;  1L8Q A;  2Z4S A;  5FSW A;  4AKG A;  1ZQ9 A;  3FKE A;  3TWM A;  4JI1 M;  1G41 A;  1UM8 A;  4M0D A;  4MH0 E;  3L29 A;  4FCV A;  5FTL A;  2D7G A;  4LCB A;  4NSR A;  2DWL A;  2UUA M;  1SXJ B;  4QHS A;  4Z6Y A;  2G5G X;  2YNM D;  3HJQ A;  1W5S A;  4DV3 M;  2CHG A;  2D7E A;  1I4W A;  3I4Y A;  5KQD A;  3GQ4 A;  3HJ8 A;  1KFV A;  4JV5 M;  1XMO M;  5C18 A;  1L2D A;  2XFT A;  3FTE A;  5KPR A;  2KXE A;  2Z3X A;  2ERC A;  4IBJ A;  4RF1 A;  1Z5C A;  3SAW A;  4GMQ A;  2L7H A;  2QEN A;  3HU1 A;  5EP2 A;  3W0F A;  3GPX A;  4JI6 M;  1IBM M;  1N78 A;  2F5S A;  3VK8 A;  3SYK A;  2L09 A;  1R2Y A;  3KS8 A;  2AHM A;  3HKP A;  1IBK M;  3R9X B;  2C9O A;  2UU9 M;  2FOI C;  2KW0 A;  5FTN A;  2F5N A;  4G4R A;  2R65 A;  3UK6 A;  3I51 A;  4B7H A;  3U6P A;  4FCW A;  3FUX A;  2XZU A;  1QAQ A;  1NVM A;  3RGP A;  2C9C A;  4LFB M;  3ZH9 B;  3L26 A;  3VDP A;  4IJE A;  4JN6 A;  2XEP A;  4IBI A;  3KVW A;  4CHT B;  4M9Z A;  3FYD A;  1L1Z A;  2CFO A;  4P16 A;  1I94 M;  4OX9 M;  1Q3C A;  4ITQ A;  3FUT A;  3DA1 A;  3U5Z A;  4CGY B;  2R46 A;  1GLN A;  3LVW A;  1HT1 E;  5KQ8 A;  2DXI A;  4B08 A;  4DV2 M;  4IBF A;  2DWM A;  2R4E A;  1NNJ A;  4QOZ C;  3JAM S;  1MU5 A;  1YUB A;  1IXZ A;  1PM5 A;  2HHH M;  1HNW M;  3HJS A;  3C58 A;  4IBG A;  3KOZ E;  4B7F A;  4DV7 M;  3IG5 A;  5FTM A;  2F5O A;  1IN6 A;  3I4V A;  4LG2 A;  2ZAN A;  4B3S M;  2FFJ A;  3J81 S;  1J5E M;  3T1H M;  1Z5A A;  3RE8 A;  2XZF A;  3U6C A;  4PD2 A;  3GLI B;  1XXH B;  4PDI A;  5BR8 M;  3U6Q A;  3PNV A;  5EP1 A;  1QZM A;  4GC9 A;  4X66 M;  1QAO A;  2KRU A;  4OVZ A;  4BLC A;  2ZAM A;  4GIT A;  5EXX A;  2CV0 A;  3KOX E;  4QNR A;  2F4V M;  3J27 B;  4L4U A;  4DV6 M;  4GKK M;  4R3D A;  4GC5 A;  2L7I A;  1NHW C;  4IBC A;  3GLG B;  4S12 A;  2FNA A;  4FWH A;  5IZ7 D;  3GLH A;  1S3S A;  3TWK A;  4K0K M;  2KA6 B;  1HQY E;  3SMS A;  1OFI A;  1L1T A;  5EQT A;  3RFW A;  5FTK A;  2X49 A;  4LY6 A;  2D7H A;  2KEB A;  3H4M A;  3KDS E;  5EXT A;  3TQS A;  2X8A A;  4IBD A;  4DV0 M;  1N33 M;  1FNN A;  4LZZ A;  3SHG B;  1JR3 A;  1SXJ A;  1PJI A;  2XSZ A;  1H6U A;  1ORY B;  5EXP A;  4JI0 M;  2RKO A;  4NXN M;  2L6O A;  2C99 A;  3HU3 A;  1SXJ D;  4M9S A;  5ITR A;  4DR1 M;  1XHB A;  2CE7 A;  2CV1 A;  1NY6 A;  3TE6 A;  3KXE C;  3VDU A;  3KFU G;  4IIW A;  1L2C A;  3FTD A;  4KLN A;  4ZPX A;  3UZU A;  3GRV A;  3OTO M;  2ZAO A;  2QBY A;  3AOE C;  4JI8 M;  1X37 A;  3AJI B;  4DV4 M;  1JQJ C;  1XWI A;  2P5T A;  3AOG A;  1QQW A;  3SHF A;  5JI3 E;  3JR5 A;  3AV0 A;  4LJ7 A;  3CF0 A;  4G4N A;  2DZN B;  1PJJ A;  3FD9 A;  1XNQ M;  3A46 A;  3VK7 A;  5EP4 A;  3K92 A;  1Z5B A;  3HHY A;  4I5S A;  1HNX M;  1W5T A;  2LNH C;  3KP0 E;  3E9S A;  4FVM A;  4FW9 A;  5EJC A;  3FTF A;  1OJL A;  2Z7J A;  1D2N A;  2LXE A;  3HHW A;  2UUC M;  4GHL A;  5C1B A;  1OFH A;  4AZF A;  4NOO B;  2YQZ A;  2YFQ A;  1R6B X;  3GPU A;  1QAN A;  1N32 M;  2BJV A;  4LJ8 A;  5FLX S;  3L28 A;  4LJ9 A;  2V1U A;  3J7B A;  3KW6 A;  4JXJ A;  4LGY A;  3KSX A;  3VKH A;  3UMM A;  2O5R A;  4IBK A;  3U60 A;  1MX0 A;  3KOY E;  4B3M M;  2XFS A;  4LRS A;  3GQ3 A;  1E9S A;  4JI4 M;  4IJF A;  1DGH B;  4GHA A;  1NJG A;  1TH2 A;  2ZBK B;  1G3I A;  2LH0 A;  3BOS A;  5ITQ A;  4LZJ A;  3GRR A;  3AKZ A;  2VII A;  1LV7 A;  4JI5 M;  4GKJ M;  1IN4 A;  2I7N A;  1XXH A;  4L15 A;  3T15 A;  1R2Z A;  3AL0 C;  1NSF A;  3GPY A;  2QCU A;  3SBJ A;  4FCT A;  5ITU A;  5FTJ A;  2KZS A;  4LJ5 A;  4AI6 A;  4YY3 M;  4L78 A;  4JI7 M;  2Y0Q A;  3GLF A;  2R18 A;  4II7 A;  1E94 E;  2DHR A;  3M0E A;  1IBL M;  1DGB A;  4YHH M;  5ITX A;  3DZD A;  3KS4 A;  2HCB A;  2OQ4 A;  3HHZ A;  3AFH A;  3U61 A;  3L27 A;  5DNY A;  5BPV A;  1VDD A;  3LVV A;  4L8R C;  2EO2 A;  3M6A A;  2HL7 A;  1Z59 A;  1QAM A;  2VQF M;  4NXM M;  1FJG M;  1E9R A;  4FD2 A;  4FWG A;  3U6S A;  3VKG A;  4HL4 A;  2X4A A;  3MJ5 A;  4NL4 H;  7CAT A;  3NWL A;  1TGU A;  1KSF X;  1N34 M;  4LF7 M;  1NY5 A;  4KHP M;  3GRU A;  1HQC A;  1NHG C;  1Q3B A;  4M9X A;  2Y20 A;  2CEA A;  1Q39 A;  4DR2 M;  3SAV A;  3GO8 A;  1IY1 A;  4AG6 A;  2F5P A;  2UXD M;  3D8L A;  2CUZ A;  4QOS A;  1XNR M;  2J7O A;  3GP1 A;  1J7K A;  2FE8 A;  3E4R A;  3MK6 A;  4L16 A;  5E26 A;  2C96 A;  1TH4 A;  5KO3 A;  2R62 A;  3CTW B;  2RGH A;  3TPZ A;  2QP9 X;  5ITT A;  4DUY M;  4DR4 M;  3MHV C;  4Z8X A;  1GVN A;  1C1K A;  3A42 A;  3DFZ A;  1EE8 A;  2XLJ A;  3TL4 X;  1Z6T A;  3T1Y M;  3SFZ A;  1IN5 A;  1IXR C;  1DGF A;  3THG A;  3LMM A;  3T38 A;  3L2A A;  4REZ A;  1N36 M;  4MGH A;  4GH9 A;  4LF8 M;  1XMQ M;  3SYL A;  3SAS A;  2A5Y B;  2JA2 A;  4DV5 M;  2F5Q A;  2C98 A;  2UXB M;  3HHX A;  1DO2 A;  2QPA A;  2J7N A;  5KPZ A;  4OVZ B;  4JI3 M;  2CV2 A;  4D80 A;  2G8L A;  2YR0 A;  4G4O A;  2QZ4 A;  2DWZ B;  1YSY A;  1ZAE A;  3WHL A;  1YE9 A;  1GL7 A;  1N75 A;  4B3T M;  3GPP A;  2M5Z A;  3A45 A;  5KPT A;  5LMU M;  1TDZ A;  3HGI A;  4PDG A;  4A3V B;  3GLH B;  4TUW A;  5IWA M;  3UGJ A;  3K8Z A;  3SAU A;  2RGO A;  3M7G A;  4R7G A;  4MGI E;  4I4L A;  1DGG A;  1G59 A;  2CHV A;  4I8O A;  4MGY E;  2VQE M;  3FTC A;  3U6L A;  3FYC A;  5IRE B;  3CF2 A;  4NRV A;  4G6Z A;  2ZM6 M;  3FUU A;  2V1C A;  4LRT A;  3EIE A;  4LFC M;  1NJF A;  4LJA A;  2UXC M;  1KYI A;  2Q2E B;  3QWL A;  4RNA A;  4LFA M;  1IXS B;  5H37 D;  1TH3 A;  1SXJ C;  2V6Z M;  1L2B A;  3SC3 A;  3L25 A;  1G4A E;  3ILK A;  4CIS A;  2UUB M;  5F3W A;  1J09 A;  3SMP A;  1E32 A;  5A2Q S;  3TWL A;  1IN7 A;  2QBY B;  3U6M A;  1K3X A;  1T3T A;  4D81 A;  4EIW A;  5ITX E;  3GLI A;  4LJ6 A;  3KSJ A;  2KZU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...