4DUZM

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c, bound with streptomycin
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 25
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4duzM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4duzM02
2OQ4A 1IBLM 4LFAM 4B3MM 3A42A 4LF7M 5BR8M 3J81S 1IBKM 3SAUA 3U6DA 3GQ5A 4LFBM 3JAMS 4JI8M 2E5LM 4YY3M 1L2DA 1K3XA 4X62M 4AQYM 5FLXS 4LFCM 4G4OA 3JR5A 1J5EM 2UXCM 4DV3M 2F5NA 5ITXA 3SASA 3VK7A 3SBJA 1XMOM 5ITRA 5ITTA 3GQ3A 3J7AS 3GPXA 3SAWA 4DUYM 3A45A 3GP1A 3U6SA 2XZFA 4DR4M 3C58A 3U6OA 3GQ4A 3T1HM 3GO8A 3GPYA 4JI1M 4LF5M 5A2QS 4DV6M 4LF4M 4CISA 4DV2M 3U6LA 3T1YM 1K82A 3GPUA 1L1TA 2UU9M 4PD2A 2VQEM 4G4QA 4B3RM 1FJGM 1N34M 4GKJM 1TDHA 1I94M 3GPPA 3U6QA 3U6CA 4DR7M 2F5OA 5LMNM 4K0KM 2UXDM 4NXMM 4PCZA 5ITXE 4DR3M 1Q3BA 1KFVA 1Z5BA 2UUBM 1K3WA 4JI3M 2F5QA 1N32M 3OTOM 4DV4M 4OX9M 2ZM6M 4B3TM 4DR2M 4JI4M 4LF6M 1Q39A 4ITQA 3TWLA 2UUAM 2F5PA 4JI5M 3VK8A 2EA0A 1MU5A 1PJJA 1HNZM 2UXBM 5ITYA 4X65M 4DUZM 1N33M 2HHHM 2F5SA 1XNRM 4B3SM 5IT9S 1L2BA 1IBMM 3DOAA 1Z5AA 4MB7A 3J80S 4PDIA 4DV7M 3SATA 4DR1M 4KHPM 4JI2M 3A46A 2VQFM 2HKJA 4PDGA 2F4VM 1XC8A 2XZUA 4JI0M 3U6MA 3TWKA 4GKKM 1TDZA 3U6EA 1R2YA 1NNJA 1XMQM 1PM5A 5LMUM 4DV5M 4DV0M 1Z59A 1XNQM 1Q3CA 3SAVA 1L2CA 4NXNM 4X64M 4JYAM 4YHHM 2UUCM 4JI6M 5ITQA 4G4RA 1HNWM 1EE8A 3JR4A 2ZBKB 4NRVA 3TWMA 1R2ZA 1L1ZA 1PJIA 1N36M 4LF8M 2Q2EB 5ITUA 3W0FA 1HNXM 4DR5M 1MX0A 4X66M 3U6PA 4LF9M 5IWAM 4DR6M 3SARA 2OPFA 4DV1M 4G4NA 4JI7M 4JV5M 1Z5CA 4NRWA 1HR0M
chains in the Genus database with same CATH superfamily
4FD2A 3W0LB 1YE9A 4R3DA 1IBLM 2EJSA 3E46A 4LF7M 1H6UA 2QHOB 4HL4A 1NJGA 3KS4A 1NHWC 3L26A 2YR0A 4FCVA 2XLJA 4AKGA 3KP1E 1GLNA 4IJEA 4MGHA 4CGYB 3PNYA 2JY6B 3MJ5A 4FWGA 3GLGB 2X8AA 1QAMA 4IBBA 1SXJB 1RU3A 1XXHE 3LVWA 4LFCM 2K9DA 2KXEA 3MMPA 1T3TA 4IJFA 1QDRA 2J7NA 5FTJA 2Y20A 5EP2A 2DAMA 1PJQA 3KOZE 2ZAMA 3T6PA 3WHLA 1OFIA 2F5NA 1UM8A 3VKHA 4GRIA 2Y0TA 1DV0A 5EP3A 3HU1A 4LZZA 2DAEA 1NVMA 3A45A 4DR4M 2XZFA 2DAKA 3GRYA 2KNVA 2C98A 1LTMA 3T1HM 2DZOB 4JI1M 3QYEA 3FE3A 3UMMA 4GMQA 5EXTA 3VLFB 4ZPXA 2ZTCA 3PNVA 4PT5A 1TF0B 2OO9A 3NBIA 3T1YM 1K82A 2WSCF 3W68A 2Y21A 4PD2A 1W5TA 2VQEM 4G4QA 1J09A 3AV0A 2FH0A 5BPVA 1I94M 3GPPA 4GC5A 4K0KM 2L6OA 2F5OA 2UXDM 1R7RA 4PCZA 2CHVA 3GLIB 2UUBM 2KNAA 3LQRA 2F5QA 1IXSB 4L6V6 2QENA 2VF8A 4DR2M 4JI4M 2NQ8C 2LVNC 2UUAM 2CUZA 3VK8A 2EA0A 1XXHB 2G5GX 3VDPA 4AZFA 3LQQA 3B74A 5KO3A 3M0EA 2L09A 4TUWA 4B3SM 1R6BX 3GLFA 2RRUA 3FTCA 3HKPA 4P17A 4II7A 5IT9S 2HCBA 1Z5AA 3MK6A 2QP9X 1VDLA 2JUJA 1IFYA 4IIWA 3J80S 3SATA 4KHPM 2VQFM 2HKJA 4PDGA 4AKHA 2LVQD 2WSEF 4L15A 3U61A 1DGFA 2JXNA 3KVWA 1XWIA 4D80A 4MGZE 1MN3A 1TDZA 3HU3A 1E32A 3AOEA 5KPTA 2C5RA 1MJGM 2CEAA 2JY5A 3SMPA 1YLAA 2Z8YM 3L2AA 3HHYA 3GLHB 4DV5M 2VDBB 1C7YA 3E9SA 4OVZB 5KQDA 1Z59A 1QZMA 2D7HA 2X49A 2APLA 4I4LA 4F2LA 2KZSA 4RF1A 4KT0F 1GKIA 2MGWA 1HNWM 3LVVA 4IBDA 1EE8A 4AW4A 4BLCA 2RGHA 4AI6A 1R2ZA 2LVPC 4KO8A 2KEBA 1GJSA 1R4GA 5IZ7D 1NV9A 5EQTA 3W0FA 3K9OA 1HNXM 3LCVB 4NSOB 4QHTA 3TQSA 1GO5A 3U6PA 4JN6A 4Y28F 1NNUC 4WW0A 4DR6M 4LGYA 1QVRA 3THGA 2EO2A 1V33A 2JNHA 4G4NA 4HEOA 4NOOB 1Z5CA 1XXHA 1DGHA 3FUXA 2FE8A 2L4EA 3I04M 3GRVA 4LFAM 2OQ4A 3B9PA 4NL4H 1QAQA 2EKKA 3J7BA 4HLQA 3HU2A 3SAUA 4D81A 4L78A 1ZQ9A 1ZMUA 1NY5A 4M9ZA 4LCBA 4LJAA 1TR8A 1Z6TA 2FNAA 7CATA 2WSFF 1K3XA 4X62M 1C1KA 2D7GA 5KPRA 3GLHE 3KFUG 4RF0A 3A98B 3FYCA 2KHHA 2L7HA 8CATA 2VIIA 5E6JA 4G4OA 4QOZC 2M5ZA 1ZMWA 3KOXE 1G41A 2EKFA 1J5EM 2UXCM 3QAUA 3J27B 4DV3M 3DFZA 1J7KA 5ITXA 1QAOA 1OKSA 2LVAA 3SBJA 2JP7A 3VK7A 1OTRA 3NBXX 1EIJA 1IY1A 1ZMVA 2DWZB 3HWSA 1OQYA 2W82A 4XK8F 3J7AS 1SXJE 1TGUA 3GP1A 1WXQA 3U6SA 4LZJA 3Q8XA 1BVSA 5FTMA 1TTEA 2A5YB 3BOSA 3RGSA 4L8RC 3F92A 2K6BA 3H4MA 4AKIA 4DV6M 2DVWB 1L1TA 3GPUA 2UU9M 1SXJA 3C3EA 3HJQA 4MGIE 3U60A 3PFIA 2R0IA 3U6CA 3HY5A 4LRTA 1IY2A 4CHTB 1G8PA 5ITXE 4OX9M 1SG9A 2B3TA 3D8BA 3I4VA 4KLNA 3SC3A 1Q39A 2F5PA 4JI5M 1MU5A 2G3QA 1AUAA 2X4AA 2RGOA 4X65M 4DUZM 1N33M 5DFLA 4G6ZA 2DWLA 4FW9A 4LJ7A 5EP4A 2XEPA 3CF0A 1IN6A 3FYDA 1TH3A 3DOAA 3GLHA 4MB7A 1IBMM 1ORYB 4DV7M 4DR1M 2R45A 4ANRA 3C9PA 4GHLA 4QHSA 4WURA 4IBJA 3R8FA 2LHCA 2F4VM 3GRRA 2L2DA 2LWXA 1D2NA 3HGIA 2XZUA 4JI0M 3SYKA 3U60B 3TWKA 2QBYB 1LV7A 4GKKM 1OAIA 3UGJA 4GHAA 2LXEA 2XH9A 2GQFA 1CUKA 2MROB 2LBCA 2Z4RA 3SHGB 3FUUA 1F4IA 5LMUM 3FD9A 3LW5F 2WZJA 1DGHB 4DV0M 5JI3E 1XNQM 4M9XA 4NXNM 3C3DA 1ZV1A 4JI6M 3L27A 1G71A 3ILKA 4R71A 4IBCA 4IBIA 4B7FA 4F1IA 2ZBKB 1E9RA 3TWMA 1L1ZA 1PJIA 2YNMD 4QNRA 1QDTA 4R7GA 1TH2A 5EP1A 1L8QA 2QPAA 5EJCA 2P5TA 1MX0A 4LJ5A 2QZ4A 4Z6YA 1GABA 5DYGA 1JB0F 4XBOA 3SHFA 3VDUA 3ZQJA 1E9SA 5IWAM 5C1BA 2QQ8A 2OPFA 4DV1M 2ZANA 2R4JA 3K1JA 2KRUA 3E21A 4JI7M 1N77A 1DGGA 2CE7A 4QOSA 4JV5M 1HT1E 2MR9A 3QYBA 4NRWA 3CGWA 4B3MM 1IN7A 3KS8A 1QANA 5KQ8A 3A42A 2Z4SA 1GL7A 3SYLA 3UK6A 2DWNA 1JQJC 4M0WA 5BR8M 1E94E 1IBKM 3HJSA 2V6ZM 4FWHA 2JA2A 5L8RF 3GQ5A 2BWEA 2E5LM 3B89A 4JI8M 4P16A 1I4WA 3GLFE 4YY3M 3FTDA 2YQZA 1L2DA 1XHBA 3RFWA 1OIPA 1VDDA 3K8ZA 2C9CA 3KOYE 2DHYA 1GJTA 4LJ8A 5FLXS 2R6FA 2H1RA 1T43A 5KPZA 3FUWA 2ZAOA 3KXEC 3V76A 1V34A 1W5SA 1KYIA 5ITRA 1XMOM 5H37D 3KW6A 3R9XB 2R44A 4OW0A 3W67A 4RNAA 2DAGA 5ITTA 3GQ3A 1G3IA 1YUBA 2OOAA 3BXWA 5EXPA 3SAWA 1R5LA 2HL7A 3BBZA 3GLIA 5IREB 3C58A 3GQ4A 1PJSA 2DNAA 3GO8A 3GPYA 4LF5M 5A2QS 2AHMA 2KA6B 3GLGA 2H5XA 4DV2M 2BJVA 1FJGM 1PJTA 4LY6A 4A3VB 1TDHA 3RGPA 3FTEA 2XF3A 3U6QA 4DR7M 1IXRC 5LMNM 2LVOC 4NXMM 1IQPA 1OFHA 1Q3BA 1IXSA 1Z5BA 2JZ1A 1QUTA 2K47A 1KSFX 4MGYE 3OTOM 1GVNA 1KFVA 3TPZA 1QUSA 2KNZA 3KSJA 4B3TM 3GLGE 2DWMA 3RE8A 2J7OA 1IN8A 1A5TA 1WGNA 2MH8A 5EXXA 3TWLA 2JZ0A 1OAOC 3DZDA 1HNZM 5ITYA 2K0BX 1IN4A 2HHHM 3KOWE 2BNKA 1AIPC 1TH4A 2I7PA 2F5SA 3KSXA 2KRKA 4CIZA 2L7IA 3FTFA 4FVMA 3IECA 4D82A 4PDIA 3HHXA 2ZTDA 2JY8A 3VFDA 4JI2M 4WP2A 2KZUA 1XC8A 3IG5A 2HWJA 2VF7A 3U6MA 1NO1A 1NSFA 3NWLA 1WR1B 1V92A 4GEWA 2DXIA 1Q02A 3U5ZA 2G8LA 4M0DA 4OVZA 5FTNA 3CTWB 1PRBA 1Q3CA 3SFZA 5C18A 3SAVA 5FSWA 4X64M 4JYAM 3VKGA 4FCWA 4YHHM 1YSYA 2UUCM 1DO2A 2XSZA 1D0LA 2QBYA 1HJPA 4MH0E 3HHWA 3Q8GA 3AJIB 3ZCBB 4G4RA 4M9SA 1HT2E 2XFTA 2LNHC 4EIWA 1S3SA 2DZLA 1WGLA 4I5SA 3HZJA 4B7HA 3GLIE 4IBEA 3KDSE 2DENA 3I01M 4LJ9A 4DR3M 4LG2A 3CF6E 4W5WA 3K9PA 3KP0E 1QYRA 3B7NA 2DZNB 4DR5M 4NC6A 2HAKA 4IBFA 4X66M 3IHPA 3DA1A 1VEGA 4GIPA 3GLFB 3SARA 3B7QA 1N75A 3LMMA 2YFQA 3QWLA 3WHKA 4CJ6A 1VEJA 3EIHA 2CHQA 1X37A 2QCUA 3ZH9B 2V1UA 2FS1A 3EIEA 2C96A 1SXJC 1UFZA 1JR3D 3U61B 2CFOA 3I51A 1NJFA 2CHGA 3FUVA 3J81S 3U6DA 1OIZA 4LFBM 1FNNA 3JAMS 3E4RA 2JWSA 1DO0A 4BB9A 1DGBA 2QNJA 3HX3A 4AQYM 2J5YA 2CRUA 3FRIA 1QQWA 3L29A 2CP8A 2O25A 4GC9A 4GH9A 2BWBA 5EXSA 1IN5A 3AFHA 1VQ1A 3JR5A 2FFJA 1G4AE 1JR3E 4AG6A 3M6AA 2R46A 2Y0QA 2O01F 4B7GA 3SASA 1IXZA 1OJLA 4L16A 2KW0A 3L28A 3FRHA 4G3OA 2CWBA 2CV2A 2XFSA 2I7NA 1WIVA 1HQCA 2LTUA 3MHVC 2MJ5B 3GPXA 1D0MA 4DUYM 5E26A 3U6OA 3FKEA 4LJ4A 3ZC7B 1N78A 2O5RA 1WHCA 4OU7A 1NHGC 4LF4M 4CISA 2R18A 3U6LA 2FOIC 4B3RM 4FCTA 3AKZA 1N34M 4GKJM 3J2PB 2DKLA 3T15A 2RKOA 3K92A 3AOEC 5FTLA 2C99A 4L4UA 4LRSA 1N32M 1K3WA 4JI3M 4DV4M 1PGYA 2ZM6M 4LF6M 4MM3B 5FTKA 1WJ7A 2L4FA 1NV8A 3PVSA 4IBGA 4ITQA 5JI2E 2C9OA 3M7GA 4MGKE 2UXBM 4FWDA 3HJ8A 1XB2B 4UN2B 4BBAA 3AOGA 2EUCA 1JR3A 1PJJA 3GRUA 4QNMA 1ZAEA 2N35A 1XNRM 2BJWA 3PXGA 1L2BA 3U5ZB 3K2LA 4RKUF 4LJ6A 3T38A 2Z3XA 4GITA 4LGMA 3A46A 3L25A 2LHGA 4I81A 1QZEA 5DNYA 5DYIA 2LH0A 2QSFX 1Y8GA 2DAIA 2XGNA 3D8LA 2OOBA 4S12A 3FUTA 3U6EA 1R2YA 1IY0A 1VEKA 2V1CA 4B08A 1XMQM 1PM5A 1NNJA 1GL6A 1L2CA 1G59A 2DHRA 2XSZD 3H4JA 3TE6A 2GNOA 4Q7JA 4JXJA 1SXJD 1VG5A 3B7ZA 3SMSA 2D7EA 2JY7A 5ITQA 3HHZA 1P3QQ 4DBGB 2R4EA 3UJNA 5F3WA 3JR4A 4XGIA 4NRVA 2CV1A 2M60A 1HR0M 4REZA 1N36M 3AL0C 4LF8M 2Q2EB 1IM2A 5ITUA 2DI0A 5GKNA 1D0KA 1EFUB 3TL4X 2ERCA 4I8OA 4KODA 3LCUA 4IBKA 2R65A 4NSRA 1T6OA 4LF9M 4Z8XA 1NY6A 4AG5A 2R62A 2KDLA 1HQYE 3CF2A 3IG8A 2CV0A 3UZUA 3I4YA 2Z7JA
chains in the Genus database with same CATH topology
4FD2A 3W0LB 1YE9A 4R3DA 1IBLM 4LF7M 1H6UA 4HL4A 1NJGA 3KS4A 1NHWC 3L26A 2YR0A 4FCVA 2XLJA 4AKGA 3KP1E 1GLNA 4IJEA 4MGHA 4CGYB 3PNYA 3MJ5A 4FWGA 3GLGB 2X8AA 1QAMA 4IBBA 1SXJB 3LVWA 4LFCM 2KXEA 1T3TA 4IJFA 2J7NA 5FTJA 2Y20A 5EP2A 2F5NA 3KOZE 2ZAMA 3WHLA 1OFIA 1UM8A 3VKHA 4GRIA 2Y0TA 5EP3A 3HU1A 4LZZA 1NVMA 3A45A 4DR4M 2XZFA 3GRYA 2C98A 3T1HM 4JI1M 2DZOB 3UMMA 4GMQA 5EXTA 3VLFB 4ZPXA 3PNVA 4PT5A 3T1YM 3NBIA 1K82A 4PD2A 2VQEM 2Y21A 1W5TA 4G4QA 1J09A 3AV0A 5BPVA 1I94M 3GPPA 4GC5A 4K0KM 2L6OA 2F5OA 2UXDM 1R7RA 4PCZA 2CHVA 3GLIB 2UUBM 3LQRA 2F5QA 1IXSB 2QENA 4DR2M 4JI4M 2NQ8C 2UUAM 2CUZA 3VK8A 2EA0A 1XXHB 2G5GX 3VDPA 4AZFA 3LQQA 5KO3A 3M0EA 2L09A 4TUWA 4B3SM 1R6BX 3GLFA 3FTCA 3HKPA 5IT9S 4II7A 2HCBA 1Z5AA 3MK6A 2QP9X 4IIWA 3J80S 3SATA 4KHPM 2VQFM 2HKJA 4PDGA 4AKHA 4L15A 3U61A 1DGFA 4D80A 3KVWA 1XWIA 4MGZE 1TDZA 3HU3A 1E32A 3AOEA 5KPTA 2C5RA 2CEAA 3SMPA 3L2AA 3HHYA 3GLHB 4DV5M 3E9SA 4OVZB 5KQDA 1Z59A 1QZMA 2D7HA 2X49A 4I4LA 2KZSA 4RF1A 1GKIA 1HNWM 3LVVA 4IBDA 1EE8A 4AW4A 4BLCA 2RGHA 4AI6A 1R2ZA 4KO8A 2KEBA 5IZ7D 5EQTA 3W0FA 1HNXM 4NSOB 4QHTA 3TQSA 3U6PA 4JN6A 1NNUC 4WW0A 4DR6M 4LGYA 1QVRA 3THGA 2EO2A 4G4NA 4NOOB 1Z5CA 1XXHA 1DGHA 3FUXA 2FE8A 2OQ4A 3GRVA 4LFAM 3B9PA 4NL4H 1QAQA 3J7BA 4HLQA 3HU2A 3SAUA 4D81A 4L78A 1ZQ9A 1NY5A 4M9ZA 4LCBA 4LJAA 1Z6TA 2FNAA 7CATA 1K3XA 4X62M 1C1KA 2D7GA 5KPRA 3KFUG 4RF0A 3A98B 3FYCA 2L7HA 8CATA 2VIIA 5E6JA 4G4OA 4QOZC 2M5ZA 3KOXE 1G41A 1J5EM 2UXCM 3QAUA 3J27B 4DV3M 3DFZA 1J7KA 5ITXA 1QAOA 3VK7A 3SBJA 1IY1A 2DWZB 3HWSA 2W82A 3J7AS 1SXJE 1TGUA 3GP1A 1WXQA 3U6SA 4LZJA 3Q8XA 5FTMA 2A5YB 3BOSA 3RGSA 4L8RC 3H4MA 4AKIA 4DV6M 2DVWB 1L1TA 3GPUA 2UU9M 1SXJA 3HJQA 4MGIE 3U60A 3PFIA 3U6CA 4LRTA 1IY2A 4CHTB 1G8PA 5ITXE 4OX9M 4KLNA 3D8BA 3I4VA 3SC3A 1Q39A 2F5PA 4JI5M 1MU5A 2X4AA 2RGOA 4X65M 4DUZM 1N33M 4G6ZA 2DWLA 4FW9A 4LJ7A 5EP4A 2XEPA 3CF0A 1IN6A 3FYDA 1TH3A 3DOAA 3GLHA 4MB7A 1IBMM 1ORYB 4DV7M 4DR1M 2R45A 4GHLA 4QHSA 4WURA 4IBJA 3R8FA 2F4VM 3GRRA 2LWXA 1D2NA 3HGIA 2XZUA 4JI0M 3SYKA 3U60B 3TWKA 2QBYB 1LV7A 4GKKM 3UGJA 4GHAA 2LXEA 2XH9A 3SHGB 2Z4RA 3FUUA 5LMUM 3FD9A 1DGHB 4DV0M 5JI3E 1XNQM 4M9XA 4NXNM 4JI6M 3L27A 3ILKA 4IBCA 4IBIA 4B7FA 2ZBKB 1E9RA 3TWMA 1L1ZA 1PJIA 2YNMD 4QNRA 4R7GA 1TH2A 5EP1A 1L8QA 2QPAA 5EJCA 2P5TA 1MX0A 4LJ5A 2QZ4A 4Z6YA 5DYGA 4XBOA 3SHFA 3VDUA 5IWAM 1E9SA 5C1BA 2OPFA 4DV1M 2ZANA 3K1JA 2R4JA 2KRUA 4JI7M 1N77A 1DGGA 2CE7A 4QOSA 4JV5M 1HT1E 4NRWA 4B3MM 1IN7A 3KS8A 1QANA 5KQ8A 3A42A 2Z4SA 1GL7A 3SYLA 3UK6A 2DWNA 1JQJC 4M0WA 5BR8M 1E94E 1IBKM 3HJSA 2V6ZM 4FWHA 2JA2A 3GQ5A 4JI8M 2E5LM 4P16A 1I4WA 4YY3M 3FTDA 2YQZA 1L2DA 1XHBA 3RFWA 1VDDA 3K8ZA 2C9CA 3KOYE 5FLXS 4LJ8A 2H1RA 5KPZA 3FUWA 2ZAOA 3KXEC 1W5SA 1XMOM 1KYIA 5ITRA 3R9XB 5H37D 3KW6A 4OW0A 4RNAA 5ITTA 3GQ3A 1G3IA 1YUBA 5EXPA 3SAWA 2HL7A 3GLIA 5IREB 3C58A 3GQ4A 3GO8A 3GPYA 4LF5M 5A2QS 2AHMA 2KA6B 3GLGA 4DV2M 2BJVA 1FJGM 4LY6A 4A3VB 1TDHA 3RGPA 3FTEA 2XF3A 3U6QA 4DR7M 1IXRC 5LMNM 4NXMM 1IQPA 1OFHA 1Q3BA 4MGYE 1Z5BA 4DR3M 1KFVA 2K47A 1KSFX 3OTOM 1GVNA 3TPZA 3KSJA 4B3TM 2DWMA 3RE8A 2J7OA 1IN8A 5EXXA 3TWLA 3DZDA 1HNZM 5ITYA 1IN4A 2HHHM 3KOWE 2BNKA 2I7PA 1TH4A 2F5SA 3KSXA 2KRKA 2L7IA 3FTFA 4FVMA 4D82A 4PDIA 3HHXA 3VFDA 4JI2M 2KZUA 1XC8A 3IG5A 3U6MA 1NSFA 3NWLA 2DXIA 3U5ZA 2G8LA 4M0DA 4OVZA 5FTNA 3CTWB 1Q3CA 3SFZA 5C18A 3SAVA 3VKGA 5FSWA 4X64M 4JYAM 4FCWA 4YHHM 1YSYA 2UUCM 1DO2A 2XSZA 2QBYA 4MH0E 3HHWA 3ZCBB 3AJIB 4G4RA 4M9SA 1HT2E 2XFTA 2LNHC 4EIWA 1S3SA 4I5SA 4B7HA 4IBEA 3KDSE 4LJ9A 4LG2A 3CF6E 4W5WA 3KP0E 1QYRA 4DR5M 2DZNB 4IBFA 4X66M 3DA1A 4GIPA 3GLFB 3SARA 3QWLA 3LMMA 1N75A 2YFQA 3WHKA 3EIHA 2CHQA 1X37A 2QCUA 3ZH9B 2V1UA 3EIEA 2C96A 1SXJC 1JR3D 3U61B 2CFOA 3I51A 1NJFA 2CHGA 3FUVA 3J81S 3U6DA 4LFBM 1FNNA 3JAMS 3E4RA 1DO0A 4BB9A 1DGBA 4AQYM 1QQWA 3L29A 4GC9A 4GH9A 5EXSA 1IN5A 3AFHA 3JR5A 2FFJA 1G4AE 4AG6A 3M6AA 2R46A 2Y0QA 4B7GA 3SASA 1IXZA 1OJLA 4L16A 2KW0A 3L28A 2CV2A 2XFSA 2I7NA 1HQCA 3MHVC 3GPXA 4DUYM 5E26A 3U6OA 3FKEA 4LJ4A 3ZC7B 1N78A 2O5RA 4OU7A 1NHGC 4LF4M 4CISA 2R18A 3U6LA 2FOIC 4B3RM 4FCTA 3AKZA 1N34M 4GKJM 3J2PB 3T15A 2RKOA 3K92A 3AOEC 5FTLA 2C99A 4L4UA 4LRSA 1N32M 1K3WA 4JI3M 4DV4M 2ZM6M 4LF6M 4MM3B 5FTKA 4IBGA 4ITQA 3PVSA 5JI2E 2C9OA 3M7GA 4MGKE 2UXBM 4FWDA 3HJ8A 1PJJA 4BBAA 3AOGA 2EUCA 1JR3A 3GRUA 4QNMA 1ZAEA 1XNRM 2BJWA 3PXGA 1L2BA 3U5ZB 3K2LA 3T38A 4LJ6A 2Z3XA 4GITA 4LGMA 3A46A 3L25A 4I81A 5DNYA 5DYIA 2LH0A 2XGNA 3D8LA 4S12A 3U6EA 3FUTA 1R2YA 1IY0A 2V1CA 4B08A 1NNJA 1XMQM 1PM5A 1GL6A 1L2CA 1G59A 2DHRA 2XSZD 3TE6A 3SMSA 5ITQA 4JXJA 1SXJD 2D7EA 3HHZA 2R4EA 3UJNA 5F3WA 3JR4A 4XGIA 4NRVA 2CV1A 2M60A 1HR0M 4REZA 1N36M 3AL0C 4LF8M 2Q2EB 1IM2A 5ITUA 5GKNA 3TL4X 2ERCA 4I8OA 4KODA 4IBKA 2R65A 4NSRA 4LF9M 4Z8XA 1NY6A 4AG5A 2R62A 3IG8A 1HQYE 3CF2A 2CV0A 3UZUA 3I4YA 2Z7JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OQ4 A;  1IBL M;  4LFA M;  4B3M M;  3A42 A;  4LF7 M;  5BR8 M;  3J81 S;  1IBK M;  3SAU A;  3U6D A;  3GQ5 A;  4LFB M;  3JAM S;  4JI8 M;  2E5L M;  4YY3 M;  1L2D A;  1K3X A;  4X62 M;  4AQY M;  5FLX S;  4LFC M;  4G4O A;  3JR5 A;  1J5E M;  2UXC M;  4DV3 M;  2F5N A;  5ITX A;  3SAS A;  3VK7 A;  3SBJ A;  1XMO M;  5ITR A;  5ITT A;  3GQ3 A;  3J7A S;  3GPX A;  3SAW A;  4DUY M;  3A45 A;  3GP1 A;  3U6S A;  2XZF A;  4DR4 M;  3C58 A;  3U6O A;  3GQ4 A;  3T1H M;  3GO8 A;  3GPY A;  4JI1 M;  4LF5 M;  5A2Q S;  4DV6 M;  4LF4 M;  4CIS A;  4DV2 M;  3U6L A;  3T1Y M;  1K82 A;  3GPU A;  1L1T A;  2UU9 M;  4PD2 A;  2VQE M;  4G4Q A;  4B3R M;  1FJG M;  1N34 M;  4GKJ M;  1TDH A;  1I94 M;  3GPP A;  3U6Q A;  3U6C A;  4DR7 M;  2F5O A;  5LMN M;  4K0K M;  2UXD M;  4NXM M;  4PCZ A;  5ITX E;  4DR3 M;  1Q3B A;  1KFV A;  1Z5B A;  2UUB M;  1K3W A;  4JI3 M;  2F5Q A;  1N32 M;  3OTO M;  4DV4 M;  4OX9 M;  2ZM6 M;  4B3T M;  4DR2 M;  4JI4 M;  4LF6 M;  1Q39 A;  4ITQ A;  3TWL A;  2UUA M;  2F5P A;  4JI5 M;  3VK8 A;  2EA0 A;  1MU5 A;  1PJJ A;  1HNZ M;  2UXB M;  5ITY A;  4X65 M;  4DUZ M;  1N33 M;  2HHH M;  2F5S A;  1XNR M;  4B3S M;  5IT9 S;  1L2B A;  1IBM M;  3DOA A;  1Z5A A;  4MB7 A;  3J80 S;  4PDI A;  4DV7 M;  3SAT A;  4DR1 M;  4KHP M;  4JI2 M;  3A46 A;  2VQF M;  2HKJ A;  4PDG A;  2F4V M;  1XC8 A;  2XZU A;  4JI0 M;  3U6M A;  3TWK A;  4GKK M;  1TDZ A;  3U6E A;  1R2Y A;  1NNJ A;  1XMQ M;  1PM5 A;  5LMU M;  4DV5 M;  4DV0 M;  1Z59 A;  1XNQ M;  1Q3C A;  3SAV A;  1L2C A;  4NXN M;  4X64 M;  4JYA M;  4YHH M;  2UUC M;  4JI6 M;  5ITQ A;  4G4R A;  1HNW M;  1EE8 A;  3JR4 A;  2ZBK B;  4NRV A;  3TWM A;  1R2Z A;  1L1Z A;  1PJI A;  1N36 M;  4LF8 M;  2Q2E B;  5ITU A;  3W0F A;  1HNX M;  4DR5 M;  1MX0 A;  4X66 M;  3U6P A;  4LF9 M;  5IWA M;  4DR6 M;  3SAR A;  2OPF A;  4DV1 M;  4G4N A;  4JI7 M;  4JV5 M;  1Z5C A;  4NRW A;  1HR0 M; 
#chains in the Genus database with same CATH topology
 4FD2 A;  3W0L B;  1YE9 A;  4R3D A;  1IBL M;  2EJS A;  3E46 A;  4LF7 M;  1H6U A;  2QHO B;  4HL4 A;  1NJG A;  3KS4 A;  1NHW C;  3L26 A;  2YR0 A;  4FCV A;  2XLJ A;  4AKG A;  3KP1 E;  1GLN A;  4IJE A;  4MGH A;  4CGY B;  3PNY A;  2JY6 B;  3MJ5 A;  4FWG A;  3GLG B;  2X8A A;  1QAM A;  4IBB A;  1SXJ B;  1RU3 A;  1XXH E;  3LVW A;  4LFC M;  2K9D A;  2KXE A;  3MMP A;  1T3T A;  4IJF A;  1QDR A;  2J7N A;  5FTJ A;  2Y20 A;  5EP2 A;  2DAM A;  1PJQ A;  3KOZ E;  2ZAM A;  3T6P A;  3WHL A;  1OFI A;  2F5N A;  1UM8 A;  3VKH A;  4GRI A;  2Y0T A;  1DV0 A;  5EP3 A;  3HU1 A;  4LZZ A;  2DAE A;  1NVM A;  3A45 A;  4DR4 M;  2XZF A;  2DAK A;  3GRY A;  2KNV A;  2C98 A;  1LTM A;  3T1H M;  2DZO B;  4JI1 M;  3QYE A;  3FE3 A;  3UMM A;  4GMQ A;  5EXT A;  3VLF B;  4ZPX A;  2ZTC A;  3PNV A;  4PT5 A;  1TF0 B;  2OO9 A;  3NBI A;  3T1Y M;  1K82 A;  2WSC F;  3W68 A;  2Y21 A;  4PD2 A;  1W5T A;  2VQE M;  4G4Q A;  1J09 A;  3AV0 A;  2FH0 A;  5BPV A;  1I94 M;  3GPP A;  4GC5 A;  4K0K M;  2L6O A;  2F5O A;  2UXD M;  1R7R A;  4PCZ A;  2CHV A;  3GLI B;  2UUB M;  2KNA A;  3LQR A;  2F5Q A;  1IXS B;  4L6V 6;  2QEN A;  2VF8 A;  4DR2 M;  4JI4 M;  2NQ8 C;  2LVN C;  2UUA M;  2CUZ A;  3VK8 A;  2EA0 A;  1XXH B;  2G5G X;  3VDP A;  4AZF A;  3LQQ A;  3B74 A;  5KO3 A;  3M0E A;  2L09 A;  4TUW A;  4B3S M;  1R6B X;  3GLF A;  2RRU A;  3FTC A;  3HKP A;  4P17 A;  4II7 A;  5IT9 S;  2HCB A;  1Z5A A;  3MK6 A;  2QP9 X;  1VDL A;  2JUJ A;  1IFY A;  4IIW A;  3J80 S;  3SAT A;  4KHP M;  2VQF M;  2HKJ A;  4PDG A;  4AKH A;  2LVQ D;  2WSE F;  4L15 A;  3U61 A;  1DGF A;  2JXN A;  3KVW A;  1XWI A;  4D80 A;  4MGZ E;  1MN3 A;  1TDZ A;  3HU3 A;  1E32 A;  3AOE A;  5KPT A;  2C5R A;  1MJG M;  2CEA A;  2JY5 A;  3SMP A;  1YLA A;  2Z8Y M;  3L2A A;  3HHY A;  3GLH B;  4DV5 M;  2VDB B;  1C7Y A;  3E9S A;  4OVZ B;  5KQD A;  1Z59 A;  1QZM A;  2D7H A;  2X49 A;  2APL A;  4I4L A;  4F2L A;  2KZS A;  4RF1 A;  4KT0 F;  1GKI A;  2MGW A;  1HNW M;  3LVV A;  4IBD A;  1EE8 A;  4AW4 A;  4BLC A;  2RGH A;  4AI6 A;  1R2Z A;  2LVP C;  4KO8 A;  2KEB A;  1GJS A;  1R4G A;  5IZ7 D;  1NV9 A;  5EQT A;  3W0F A;  3K9O A;  1HNX M;  3LCV B;  4NSO B;  4QHT A;  3TQS A;  1GO5 A;  3U6P A;  4JN6 A;  4Y28 F;  1NNU C;  4WW0 A;  4DR6 M;  4LGY A;  1QVR A;  3THG A;  2EO2 A;  1V33 A;  2JNH A;  4G4N A;  4HEO A;  4NOO B;  1Z5C A;  1XXH A;  1DGH A;  3FUX A;  2FE8 A;  2L4E A;  3I04 M;  3GRV A;  4LFA M;  2OQ4 A;  3B9P A;  4NL4 H;  1QAQ A;  2EKK A;  3J7B A;  4HLQ A;  3HU2 A;  3SAU A;  4D81 A;  4L78 A;  1ZQ9 A;  1ZMU A;  1NY5 A;  4M9Z A;  4LCB A;  4LJA A;  1TR8 A;  1Z6T A;  2FNA A;  7CAT A;  2WSF F;  1K3X A;  4X62 M;  1C1K A;  2D7G A;  5KPR A;  3GLH E;  3KFU G;  4RF0 A;  3A98 B;  3FYC A;  2KHH A;  2L7H A;  8CAT A;  2VII A;  5E6J A;  4G4O A;  4QOZ C;  2M5Z A;  1ZMW A;  3KOX E;  1G41 A;  2EKF A;  1J5E M;  2UXC M;  3QAU A;  3J27 B;  4DV3 M;  3DFZ A;  1J7K A;  5ITX A;  1QAO A;  1OKS A;  2LVA A;  3SBJ A;  2JP7 A;  3VK7 A;  1OTR A;  3NBX X;  1EIJ A;  1IY1 A;  1ZMV A;  2DWZ B;  3HWS A;  1OQY A;  2W82 A;  4XK8 F;  3J7A S;  1SXJ E;  1TGU A;  3GP1 A;  1WXQ A;  3U6S A;  4LZJ A;  3Q8X A;  1BVS A;  5FTM A;  1TTE A;  2A5Y B;  3BOS A;  3RGS A;  4L8R C;  3F92 A;  2K6B A;  3H4M A;  4AKI A;  4DV6 M;  2DVW B;  1L1T A;  3GPU A;  2UU9 M;  1SXJ A;  3C3E A;  3HJQ A;  4MGI E;  3U60 A;  3PFI A;  2R0I A;  3U6C A;  3HY5 A;  4LRT A;  1IY2 A;  4CHT B;  1G8P A;  5ITX E;  4OX9 M;  1SG9 A;  2B3T A;  3D8B A;  3I4V A;  4KLN A;  3SC3 A;  1Q39 A;  2F5P A;  4JI5 M;  1MU5 A;  2G3Q A;  1AUA A;  2X4A A;  2RGO A;  4X65 M;  4DUZ M;  1N33 M;  5DFL A;  4G6Z A;  2DWL A;  4FW9 A;  4LJ7 A;  5EP4 A;  2XEP A;  3CF0 A;  1IN6 A;  3FYD A;  1TH3 A;  3DOA A;  3GLH A;  4MB7 A;  1IBM M;  1ORY B;  4DV7 M;  4DR1 M;  2R45 A;  4ANR A;  3C9P A;  4GHL A;  4QHS A;  4WUR A;  4IBJ A;  3R8F A;  2LHC A;  2F4V M;  3GRR A;  2L2D A;  2LWX A;  1D2N A;  3HGI A;  2XZU A;  4JI0 M;  3SYK A;  3U60 B;  3TWK A;  2QBY B;  1LV7 A;  4GKK M;  1OAI A;  3UGJ A;  4GHA A;  2LXE A;  2XH9 A;  2GQF A;  1CUK A;  2MRO B;  2LBC A;  2Z4R A;  3SHG B;  3FUU A;  1F4I A;  5LMU M;  3FD9 A;  3LW5 F;  2WZJ A;  1DGH B;  4DV0 M;  5JI3 E;  1XNQ M;  4M9X A;  4NXN M;  3C3D A;  1ZV1 A;  4JI6 M;  3L27 A;  1G71 A;  3ILK A;  4R71 A;  4IBC A;  4IBI A;  4B7F A;  4F1I A;  2ZBK B;  1E9R A;  3TWM A;  1L1Z A;  1PJI A;  2YNM D;  4QNR A;  1QDT A;  4R7G A;  1TH2 A;  5EP1 A;  1L8Q A;  2QPA A;  5EJC A;  2P5T A;  1MX0 A;  4LJ5 A;  2QZ4 A;  4Z6Y A;  1GAB A;  5DYG A;  1JB0 F;  4XBO A;  3SHF A;  3VDU A;  3ZQJ A;  1E9S A;  5IWA M;  5C1B A;  2QQ8 A;  2OPF A;  4DV1 M;  2ZAN A;  2R4J A;  3K1J A;  2KRU A;  3E21 A;  4JI7 M;  1N77 A;  1DGG A;  2CE7 A;  4QOS A;  4JV5 M;  1HT1 E;  2MR9 A;  3QYB A;  4NRW A;  3CGW A;  4B3M M;  1IN7 A;  3KS8 A;  1QAN A;  5KQ8 A;  3A42 A;  2Z4S A;  1GL7 A;  3SYL A;  3UK6 A;  2DWN A;  1JQJ C;  4M0W A;  5BR8 M;  1E94 E;  1IBK M;  3HJS A;  2V6Z M;  4FWH A;  2JA2 A;  5L8R F;  3GQ5 A;  2BWE A;  2E5L M;  3B89 A;  4JI8 M;  4P16 A;  1I4W A;  3GLF E;  4YY3 M;  3FTD A;  2YQZ A;  1L2D A;  1XHB A;  3RFW A;  1OIP A;  1VDD A;  3K8Z A;  2C9C A;  3KOY E;  2DHY A;  1GJT A;  4LJ8 A;  5FLX S;  2R6F A;  2H1R A;  1T43 A;  5KPZ A;  3FUW A;  2ZAO A;  3KXE C;  3V76 A;  1V34 A;  1W5S A;  1KYI A;  5ITR A;  1XMO M;  5H37 D;  3KW6 A;  3R9X B;  2R44 A;  4OW0 A;  3W67 A;  4RNA A;  2DAG A;  5ITT A;  3GQ3 A;  1G3I A;  1YUB A;  2OOA A;  3BXW A;  5EXP A;  3SAW A;  1R5L A;  2HL7 A;  3BBZ A;  3GLI A;  5IRE B;  3C58 A;  3GQ4 A;  1PJS A;  2DNA A;  3GO8 A;  3GPY A;  4LF5 M;  5A2Q S;  2AHM A;  2KA6 B;  3GLG A;  2H5X A;  4DV2 M;  2BJV A;  1FJG M;  1PJT A;  4LY6 A;  4A3V B;  1TDH A;  3RGP A;  3FTE A;  2XF3 A;  3U6Q A;  4DR7 M;  1IXR C;  5LMN M;  2LVO C;  4NXM M;  1IQP A;  1OFH A;  1Q3B A;  1IXS A;  1Z5B A;  2JZ1 A;  1QUT A;  2K47 A;  1KSF X;  4MGY E;  3OTO M;  1GVN A;  1KFV A;  3TPZ A;  1QUS A;  2KNZ A;  3KSJ A;  4B3T M;  3GLG E;  2DWM A;  3RE8 A;  2J7O A;  1IN8 A;  1A5T A;  1WGN A;  2MH8 A;  5EXX A;  3TWL A;  2JZ0 A;  1OAO C;  3DZD A;  1HNZ M;  5ITY A;  2K0B X;  1IN4 A;  2HHH M;  3KOW E;  2BNK A;  1AIP C;  1TH4 A;  2I7P A;  2F5S A;  3KSX A;  2KRK A;  4CIZ A;  2L7I A;  3FTF A;  4FVM A;  3IEC A;  4D82 A;  4PDI A;  3HHX A;  2ZTD A;  2JY8 A;  3VFD A;  4JI2 M;  4WP2 A;  2KZU A;  1XC8 A;  3IG5 A;  2HWJ A;  2VF7 A;  3U6M A;  1NO1 A;  1NSF A;  3NWL A;  1WR1 B;  1V92 A;  4GEW A;  2DXI A;  1Q02 A;  3U5Z A;  2G8L A;  4M0D A;  4OVZ A;  5FTN A;  3CTW B;  1PRB A;  1Q3C A;  3SFZ A;  5C18 A;  3SAV A;  5FSW A;  4X64 M;  4JYA M;  3VKG A;  4FCW A;  4YHH M;  1YSY A;  2UUC M;  1DO2 A;  2XSZ A;  1D0L A;  2QBY A;  1HJP A;  4MH0 E;  3HHW A;  3Q8G A;  3AJI B;  3ZCB B;  4G4R A;  4M9S A;  1HT2 E;  2XFT A;  2LNH C;  4EIW A;  1S3S A;  2DZL A;  1WGL A;  4I5S A;  3HZJ A;  4B7H A;  3GLI E;  4IBE A;  3KDS E;  2DEN A;  3I01 M;  4LJ9 A;  4DR3 M;  4LG2 A;  3CF6 E;  4W5W A;  3K9P A;  3KP0 E;  1QYR A;  3B7N A;  2DZN B;  4DR5 M;  4NC6 A;  2HAK A;  4IBF A;  4X66 M;  3IHP A;  3DA1 A;  1VEG A;  4GIP A;  3GLF B;  3SAR A;  3B7Q A;  1N75 A;  3LMM A;  2YFQ A;  3QWL A;  3WHK A;  4CJ6 A;  1VEJ A;  3EIH A;  2CHQ A;  1X37 A;  2QCU A;  3ZH9 B;  2V1U A;  2FS1 A;  3EIE A;  2C96 A;  1SXJ C;  1UFZ A;  1JR3 D;  3U61 B;  2CFO A;  3I51 A;  1NJF A;  2CHG A;  3FUV A;  3J81 S;  3U6D A;  1OIZ A;  4LFB M;  1FNN A;  3JAM S;  3E4R A;  2JWS A;  1DO0 A;  4BB9 A;  1DGB A;  2QNJ A;  3HX3 A;  4AQY M;  2J5Y A;  2CRU A;  3FRI A;  1QQW A;  3L29 A;  2CP8 A;  2O25 A;  4GC9 A;  4GH9 A;  2BWB A;  5EXS A;  1IN5 A;  3AFH A;  1VQ1 A;  3JR5 A;  2FFJ A;  1G4A E;  1JR3 E;  4AG6 A;  3M6A A;  2R46 A;  2Y0Q A;  2O01 F;  4B7G A;  3SAS A;  1IXZ A;  1OJL A;  4L16 A;  2KW0 A;  3L28 A;  3FRH A;  4G3O A;  2CWB A;  2CV2 A;  2XFS A;  2I7N A;  1WIV A;  1HQC A;  2LTU A;  3MHV C;  2MJ5 B;  3GPX A;  1D0M A;  4DUY M;  5E26 A;  3U6O A;  3FKE A;  4LJ4 A;  3ZC7 B;  1N78 A;  2O5R A;  1WHC A;  4OU7 A;  1NHG C;  4LF4 M;  4CIS A;  2R18 A;  3U6L A;  2FOI C;  4B3R M;  4FCT A;  3AKZ A;  1N34 M;  4GKJ M;  3J2P B;  2DKL A;  3T15 A;  2RKO A;  3K92 A;  3AOE C;  5FTL A;  2C99 A;  4L4U A;  4LRS A;  1N32 M;  1K3W A;  4JI3 M;  4DV4 M;  1PGY A;  2ZM6 M;  4LF6 M;  4MM3 B;  5FTK A;  1WJ7 A;  2L4F A;  1NV8 A;  3PVS A;  4IBG A;  4ITQ A;  5JI2 E;  2C9O A;  3M7G A;  4MGK E;  2UXB M;  4FWD A;  3HJ8 A;  1XB2 B;  4UN2 B;  4BBA A;  3AOG A;  2EUC A;  1JR3 A;  1PJJ A;  3GRU A;  4QNM A;  1ZAE A;  2N35 A;  1XNR M;  2BJW A;  3PXG A;  1L2B A;  3U5Z B;  3K2L A;  4RKU F;  4LJ6 A;  3T38 A;  2Z3X A;  4GIT A;  4LGM A;  3A46 A;  3L25 A;  2LHG A;  4I81 A;  1QZE A;  5DNY A;  5DYI A;  2LH0 A;  2QSF X;  1Y8G A;  2DAI A;  2XGN A;  3D8L A;  2OOB A;  4S12 A;  3FUT A;  3U6E A;  1R2Y A;  1IY0 A;  1VEK A;  2V1C A;  4B08 A;  1XMQ M;  1PM5 A;  1NNJ A;  1GL6 A;  1L2C A;  1G59 A;  2DHR A;  2XSZ D;  3H4J A;  3TE6 A;  2GNO A;  4Q7J A;  4JXJ A;  1SXJ D;  1VG5 A;  3B7Z A;  3SMS A;  2D7E A;  2JY7 A;  5ITQ A;  3HHZ A;  1P3Q Q;  4DBG B;  2R4E A;  3UJN A;  5F3W A;  3JR4 A;  4XGI A;  4NRV A;  2CV1 A;  2M60 A;  1HR0 M;  4REZ A;  1N36 M;  3AL0 C;  4LF8 M;  2Q2E B;  1IM2 A;  5ITU A;  2DI0 A;  5GKN A;  1D0K A;  1EFU B;  3TL4 X;  2ERC A;  4I8O A;  4KOD A;  3LCU A;  4IBK A;  2R65 A;  4NSR A;  1T6O A;  4LF9 M;  4Z8X A;  1NY6 A;  4AG5 A;  2R62 A;  2KDL A;  1HQY E;  3CF2 A;  3IG8 A;  2CV0 A;  3UZU A;  3I4Y A;  2Z7J A; 
#chains in the Genus database with same CATH homology
 4FD2 A;  3W0L B;  1YE9 A;  4R3D A;  1IBL M;  4LF7 M;  1H6U A;  4HL4 A;  1NJG A;  3KS4 A;  1NHW C;  3L26 A;  2YR0 A;  4FCV A;  2XLJ A;  4AKG A;  3KP1 E;  1GLN A;  4IJE A;  4MGH A;  4CGY B;  3PNY A;  3MJ5 A;  4FWG A;  3GLG B;  2X8A A;  1QAM A;  4IBB A;  1SXJ B;  3LVW A;  4LFC M;  2KXE A;  1T3T A;  4IJF A;  2J7N A;  5FTJ A;  2Y20 A;  5EP2 A;  2F5N A;  3KOZ E;  2ZAM A;  3WHL A;  1OFI A;  1UM8 A;  3VKH A;  4GRI A;  2Y0T A;  5EP3 A;  3HU1 A;  4LZZ A;  1NVM A;  3A45 A;  4DR4 M;  2XZF A;  3GRY A;  2C98 A;  3T1H M;  4JI1 M;  2DZO B;  3UMM A;  4GMQ A;  5EXT A;  3VLF B;  4ZPX A;  3PNV A;  4PT5 A;  3T1Y M;  3NBI A;  1K82 A;  4PD2 A;  2VQE M;  2Y21 A;  1W5T A;  4G4Q A;  1J09 A;  3AV0 A;  5BPV A;  1I94 M;  3GPP A;  4GC5 A;  4K0K M;  2L6O A;  2F5O A;  2UXD M;  1R7R A;  4PCZ A;  2CHV A;  3GLI B;  2UUB M;  3LQR A;  2F5Q A;  1IXS B;  2QEN A;  4DR2 M;  4JI4 M;  2NQ8 C;  2UUA M;  2CUZ A;  3VK8 A;  2EA0 A;  1XXH B;  2G5G X;  3VDP A;  4AZF A;  3LQQ A;  5KO3 A;  3M0E A;  2L09 A;  4TUW A;  4B3S M;  1R6B X;  3GLF A;  3FTC A;  3HKP A;  5IT9 S;  4II7 A;  2HCB A;  1Z5A A;  3MK6 A;  2QP9 X;  4IIW A;  3J80 S;  3SAT A;  4KHP M;  2VQF M;  2HKJ A;  4PDG A;  4AKH A;  4L15 A;  3U61 A;  1DGF A;  4D80 A;  3KVW A;  1XWI A;  4MGZ E;  1TDZ A;  3HU3 A;  1E32 A;  3AOE A;  5KPT A;  2C5R A;  2CEA A;  3SMP A;  3L2A A;  3HHY A;  3GLH B;  4DV5 M;  3E9S A;  4OVZ B;  5KQD A;  1Z59 A;  1QZM A;  2D7H A;  2X49 A;  4I4L A;  2KZS A;  4RF1 A;  1GKI A;  1HNW M;  3LVV A;  4IBD A;  1EE8 A;  4AW4 A;  4BLC A;  2RGH A;  4AI6 A;  1R2Z A;  4KO8 A;  2KEB A;  5IZ7 D;  5EQT A;  3W0F A;  1HNX M;  4NSO B;  4QHT A;  3TQS A;  3U6P A;  4JN6 A;  1NNU C;  4WW0 A;  4DR6 M;  4LGY A;  1QVR A;  3THG A;  2EO2 A;  4G4N A;  4NOO B;  1Z5C A;  1XXH A;  1DGH A;  3FUX A;  2FE8 A;  2OQ4 A;  3GRV A;  4LFA M;  3B9P A;  4NL4 H;  1QAQ A;  3J7B A;  4HLQ A;  3HU2 A;  3SAU A;  4D81 A;  4L78 A;  1ZQ9 A;  1NY5 A;  4M9Z A;  4LCB A;  4LJA A;  1Z6T A;  2FNA A;  7CAT A;  1K3X A;  4X62 M;  1C1K A;  2D7G A;  5KPR A;  3KFU G;  4RF0 A;  3A98 B;  3FYC A;  2L7H A;  8CAT A;  2VII A;  5E6J A;  4G4O A;  4QOZ C;  2M5Z A;  3KOX E;  1G41 A;  1J5E M;  2UXC M;  3QAU A;  3J27 B;  4DV3 M;  3DFZ A;  1J7K A;  5ITX A;  1QAO A;  3VK7 A;  3SBJ A;  1IY1 A;  2DWZ B;  3HWS A;  2W82 A;  3J7A S;  1SXJ E;  1TGU A;  3GP1 A;  1WXQ A;  3U6S A;  4LZJ A;  3Q8X A;  5FTM A;  2A5Y B;  3BOS A;  3RGS A;  4L8R C;  3H4M A;  4AKI A;  4DV6 M;  2DVW B;  1L1T A;  3GPU A;  2UU9 M;  1SXJ A;  3HJQ A;  4MGI E;  3U60 A;  3PFI A;  3U6C A;  4LRT A;  1IY2 A;  4CHT B;  1G8P A;  5ITX E;  4OX9 M;  4KLN A;  3D8B A;  3I4V A;  3SC3 A;  1Q39 A;  2F5P A;  4JI5 M;  1MU5 A;  2X4A A;  2RGO A;  4X65 M;  4DUZ M;  1N33 M;  4G6Z A;  2DWL A;  4FW9 A;  4LJ7 A;  5EP4 A;  2XEP A;  3CF0 A;  1IN6 A;  3FYD A;  1TH3 A;  3DOA A;  3GLH A;  4MB7 A;  1IBM M;  1ORY B;  4DV7 M;  4DR1 M;  2R45 A;  4GHL A;  4QHS A;  4WUR A;  4IBJ A;  3R8F A;  2F4V M;  3GRR A;  2LWX A;  1D2N A;  3HGI A;  2XZU A;  4JI0 M;  3SYK A;  3U60 B;  3TWK A;  2QBY B;  1LV7 A;  4GKK M;  3UGJ A;  4GHA A;  2LXE A;  2XH9 A;  3SHG B;  2Z4R A;  3FUU A;  5LMU M;  3FD9 A;  1DGH B;  4DV0 M;  5JI3 E;  1XNQ M;  4M9X A;  4NXN M;  4JI6 M;  3L27 A;  3ILK A;  4IBC A;  4IBI A;  4B7F A;  2ZBK B;  1E9R A;  3TWM A;  1L1Z A;  1PJI A;  2YNM D;  4QNR A;  4R7G A;  1TH2 A;  5EP1 A;  1L8Q A;  2QPA A;  5EJC A;  2P5T A;  1MX0 A;  4LJ5 A;  2QZ4 A;  4Z6Y A;  5DYG A;  4XBO A;  3SHF A;  3VDU A;  5IWA M;  1E9S A;  5C1B A;  2OPF A;  4DV1 M;  2ZAN A;  3K1J A;  2R4J A;  2KRU A;  4JI7 M;  1N77 A;  1DGG A;  2CE7 A;  4QOS A;  4JV5 M;  1HT1 E;  4NRW A;  4B3M M;  1IN7 A;  3KS8 A;  1QAN A;  5KQ8 A;  3A42 A;  2Z4S A;  1GL7 A;  3SYL A;  3UK6 A;  2DWN A;  1JQJ C;  4M0W A;  5BR8 M;  1E94 E;  1IBK M;  3HJS A;  2V6Z M;  4FWH A;  2JA2 A;  3GQ5 A;  4JI8 M;  2E5L M;  4P16 A;  1I4W A;  4YY3 M;  3FTD A;  2YQZ A;  1L2D A;  1XHB A;  3RFW A;  1VDD A;  3K8Z A;  2C9C A;  3KOY E;  5FLX S;  4LJ8 A;  2H1R A;  5KPZ A;  3FUW A;  2ZAO A;  3KXE C;  1W5S A;  1XMO M;  1KYI A;  5ITR A;  3R9X B;  5H37 D;  3KW6 A;  4OW0 A;  4RNA A;  5ITT A;  3GQ3 A;  1G3I A;  1YUB A;  5EXP A;  3SAW A;  2HL7 A;  3GLI A;  5IRE B;  3C58 A;  3GQ4 A;  3GO8 A;  3GPY A;  4LF5 M;  5A2Q S;  2AHM A;  2KA6 B;  3GLG A;  4DV2 M;  2BJV A;  1FJG M;  4LY6 A;  4A3V B;  1TDH A;  3RGP A;  3FTE A;  2XF3 A;  3U6Q A;  4DR7 M;  1IXR C;  5LMN M;  4NXM M;  1IQP A;  1OFH A;  1Q3B A;  4MGY E;  1Z5B A;  4DR3 M;  1KFV A;  2K47 A;  1KSF X;  3OTO M;  1GVN A;  3TPZ A;  3KSJ A;  4B3T M;  2DWM A;  3RE8 A;  2J7O A;  1IN8 A;  5EXX A;  3TWL A;  3DZD A;  1HNZ M;  5ITY A;  1IN4 A;  2HHH M;  3KOW E;  2BNK A;  2I7P A;  1TH4 A;  2F5S A;  3KSX A;  2KRK A;  2L7I A;  3FTF A;  4FVM A;  4D82 A;  4PDI A;  3HHX A;  3VFD A;  4JI2 M;  2KZU A;  1XC8 A;  3IG5 A;  3U6M A;  1NSF A;  3NWL A;  2DXI A;  3U5Z A;  2G8L A;  4M0D A;  4OVZ A;  5FTN A;  3CTW B;  1Q3C A;  3SFZ A;  5C18 A;  3SAV A;  3VKG A;  5FSW A;  4X64 M;  4JYA M;  4FCW A;  4YHH M;  1YSY A;  2UUC M;  1DO2 A;  2XSZ A;  2QBY A;  4MH0 E;  3HHW A;  3ZCB B;  3AJI B;  4G4R A;  4M9S A;  1HT2 E;  2XFT A;  2LNH C;  4EIW A;  1S3S A;  4I5S A;  4B7H A;  4IBE A;  3KDS E;  4LJ9 A;  4LG2 A;  3CF6 E;  4W5W A;  3KP0 E;  1QYR A;  4DR5 M;  2DZN B;  4IBF A;  4X66 M;  3DA1 A;  4GIP A;  3GLF B;  3SAR A;  3QWL A;  3LMM A;  1N75 A;  2YFQ A;  3WHK A;  3EIH A;  2CHQ A;  1X37 A;  2QCU A;  3ZH9 B;  2V1U A;  3EIE A;  2C96 A;  1SXJ C;  1JR3 D;  3U61 B;  2CFO A;  3I51 A;  1NJF A;  2CHG A;  3FUV A;  3J81 S;  3U6D A;  4LFB M;  1FNN A;  3JAM S;  3E4R A;  1DO0 A;  4BB9 A;  1DGB A;  4AQY M;  1QQW A;  3L29 A;  4GC9 A;  4GH9 A;  5EXS A;  1IN5 A;  3AFH A;  3JR5 A;  2FFJ A;  1G4A E;  4AG6 A;  3M6A A;  2R46 A;  2Y0Q A;  4B7G A;  3SAS A;  1IXZ A;  1OJL A;  4L16 A;  2KW0 A;  3L28 A;  2CV2 A;  2XFS A;  2I7N A;  1HQC A;  3MHV C;  3GPX A;  4DUY M;  5E26 A;  3U6O A;  3FKE A;  4LJ4 A;  3ZC7 B;  1N78 A;  2O5R A;  4OU7 A;  1NHG C;  4LF4 M;  4CIS A;  2R18 A;  3U6L A;  2FOI C;  4B3R M;  4FCT A;  3AKZ A;  1N34 M;  4GKJ M;  3J2P B;  3T15 A;  2RKO A;  3K92 A;  3AOE C;  5FTL A;  2C99 A;  4L4U A;  4LRS A;  1N32 M;  1K3W A;  4JI3 M;  4DV4 M;  2ZM6 M;  4LF6 M;  4MM3 B;  5FTK A;  4IBG A;  4ITQ A;  3PVS A;  5JI2 E;  2C9O A;  3M7G A;  4MGK E;  2UXB M;  4FWD A;  3HJ8 A;  1PJJ A;  4BBA A;  3AOG A;  2EUC A;  1JR3 A;  3GRU A;  4QNM A;  1ZAE A;  1XNR M;  2BJW A;  3PXG A;  1L2B A;  3U5Z B;  3K2L A;  3T38 A;  4LJ6 A;  2Z3X A;  4GIT A;  4LGM A;  3A46 A;  3L25 A;  4I81 A;  5DNY A;  5DYI A;  2LH0 A;  2XGN A;  3D8L A;  4S12 A;  3U6E A;  3FUT A;  1R2Y A;  1IY0 A;  2V1C A;  4B08 A;  1NNJ A;  1XMQ M;  1PM5 A;  1GL6 A;  1L2C A;  1G59 A;  2DHR A;  2XSZ D;  3TE6 A;  3SMS A;  5ITQ A;  4JXJ A;  1SXJ D;  2D7E A;  3HHZ A;  2R4E A;  3UJN A;  5F3W A;  3JR4 A;  4XGI A;  4NRV A;  2CV1 A;  2M60 A;  1HR0 M;  4REZ A;  1N36 M;  3AL0 C;  4LF8 M;  2Q2E B;  1IM2 A;  5ITU A;  5GKN A;  3TL4 X;  2ERC A;  4I8O A;  4KOD A;  4IBK A;  2R65 A;  4NSR A;  4LF9 M;  4Z8X A;  1NY6 A;  4AG5 A;  2R62 A;  3IG8 A;  1HQY E;  3CF2 A;  2CV0 A;  3UZU A;  3I4Y A;  2Z7J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...