4DUZO

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c, bound with streptomycin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
87
structure length
87
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 31
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4duzO00
4DV6O 2LW7A 3F5TA 4DUZO 2JRIA 3J7AU 4LF8O 4LFAO 4JI8O 4YHHO 4B3MO 2F4VO 4JI2O 1XEQA 4GKKO 1R1BA 3J80N 5FLXN 4DR3O 3SDLA 4DR1O 1NS1A 4LF7O 3J81N 5IWAO 4DV7O 5LMUO 1N33O 4DV5O 1XMOO 4OX9O 4JI5O 4JI7O 1N34O 1FKAO 4YY3O 2Z0AA 1N36O 2FKXA 1XMQO 2VQFO 2UUCO 4A5UB 1KUQA 1DK1A 2UXBO 2ZKOA 2UUBO 4DR6O 1D2DA 1G1XB 4OPAA 1XNRO 4AQYO 4JI3O 3M8AA 4X64O 4K0KO 1HNWO 4X65O 3O65A 2UUAO 2UXDO 3T1YO 4OPHA 1XNQO 4JI1O 4JI0O 2HHHO 3OTOO 1AILA 4B3SO 1HNXO 5BR8O 4DV1O 4DV3O 4DV4O 4LF9O 2ZM6O 1N32O 4LFCO 5LMNO 4DV0O 2DJVA 4DV2O 5H5NA 1YZBA 2E5LO 4DR4O 1F7YA 1J5EO 4X62O 2N74A 4JYAO 4NXMO 5BY1A 1IBMO 2UU9O 4B3RO 3JAMN 5A2QN 4DR7O 1X59A 1FJGO 4LF5O 1A32A 4JI4O 4GKJO 2UXCO 4DR5O 1FYJA 5IT9N 1R6TA 3T1HO 5BXZA 4X66O 4KHPO 4DUYO 4JI6O 3RT3C 4LF4O 3R66A 4LF6O 4NXNO 1HNZO 2DOSA 2VQEO 4LFBO 5LL6Y 4JV5O 4B3TO 2AGAA 1IBKO 1IBLO 1AB3A 4DR2O 1I94O 1HR0O
chains in the Genus database with same CATH superfamily
1Z2GA 1SQQH 1XOUA 4XDKA 4LF8O 1Y66A 1KECA 1PL0A 5B66Z 2XT9A 1MA1A 2UXNA 2ZDIA 3E86A 1N4CA 5FLXN 2H94A 3BABA 4U3JB 5IYZB 5IWAB 1H2NA 4LF7O 2RNBA 1TUEB 3VQYA 3CPWU 3K08A 1N34O 1GN2A 3ZMUA 4BIUA 1L0NH 1K97A 3JSLA 4FLYA 2YUAA 2EILC 2P6JA 3E8FA 4DRXB 1P84F 5CBFA 4GKJB 5B5EZ 4FLUA 3H01A 3O65A 1RM1B 2JJ2G 3WB0A 1M56C 3STLC 4Z1VA 2ILMA 4KXRA 3CRCA 4UCUA 1G6UA 1DF4A 3JCZA 4G2KA 3L73H 4ZHQB 3JD4A 4J7JA 3TXQA 2Y4UA 4Q20A 2HJDA 5KHJA 1QHTA 3K5MA 1YHQV 5KMGA 4ASUG 1XI1A 3VQVA 2YXHA 4LC1A 1LNQA 4LF6O 1THZA 1BS3A 3D3QA 5LMUB 3MDSA 2XHBA 4LF7B 4DV6B 1XILA 2Z3YA 4BIOA 3OR6C 1N32B 5GW7A 2OT5A 5LBQA 3J7AU 4DR2B 2P5OA 5BZBA 4TV9A 4NVPA 1W2BU 4K35A 5CA0A 2OIEA 1R1BA 2X6BA 3HPLC 1Z5WA 3ZMSA 1HW7A 4GX0A 3WG7C 2R9AA 5DECA 5LYJA 5KHIA 2WPDG 1I7FA 1XBLA 2VRZA 3K06A 2QA4V 4DV5O 1SS3A 1WJZA 4MVQA 4YY3O 5H6QA 3BEHA 1R3LC 4X1YA 1LR1A 2VS0A 1KC8W 4A5UB 4FLWA 2OYQA 2G38A 4QE9A 1S0VA 2UXCB 4DR6O 3HB3B 4F6EA 2WLLB 3QO5A 1IBKB 4I7ZB 2YIBD 3SGIA 2W6JG 2PUSA 2YSUB 4B7KA 5EC2C 3LNMB 3TETA 2F4VB 2P22C 4GX2A 2EJRA 4N21A 2D3OW 4DV0O 5C93A 4F4LA 5L3DA 5GTHZ 3SYAA 4FM2A 2QEXV 2EZOA 3H1HH 1N36B 4K3AA 1Y6XA 3FD9A 5KA6A 3LSSA 4DV0B 2EIJB 4FPPA 1VQOV 4Q6GA 2W0FC 3JARA 4JGSA 2E76B 2B9ZA 4I55A 5DM6V 4R7CA 2ITDC 3E8GA 3DTUB 5B1AC 4KHPO 4ZI7B 5JQGA 2LW1A 1YCIA 4D7TA 1Q86W 2IU0A 2RMKB 3FAVA 2ARHA 2ETNA 3L70H 2EINC 4MVZA 5GONA 1Y76A 2YEVA 3BPZA 4L87A 2YXLA 3L71H 4J80A 4DV5B 3G80A 3HKCB 3L75H 3W7UA 1FFTB 1YXBA 2DQ0A 5LGUA 3A0RA 4DR1O 3CRQA 3P3PA 4MT8A 1SQBH 4FIPC 3AG4C 1IXMA 2KKWA 3FAVB 4IL6Z 2BTOA 2JDIG 3UT5A 3E8BA 1OCRB 5D5PA 1SQFA 2ZR3A 4JYAB 1VEWA 1XUQA 2WA3A 1KUQA 2UXBO 3ASOC 3HKBB 3L9DA 3X2QB 1FXVA 2JGUA 3HKCA 4I5SA 4NXMB 4PDRA 1ZTEA 3OGCC 3U10A 1BZKA 3EXAA 1JA8A 1N32O 3M7MX 4LFCO 5K1PA 1SA0B 5DN6G 2UUCB 4PA6A 1XNQB 4J42A 3IC9A 2ZIOA 3UO3A 4BWAA 1ZLZA 4WFEA 3AG3C 1BE3H 3JD0A 1H2SB 2BCCH 5B1BC 5KUMA 1YF2A 3OM3B 3SJAC 5LP6B 1VQNV 4RQEA 1NJIW 4X1IB 3SYQA 4OXSA 2WLMA 1NH2D 1GN3A 2XASA 1QLEB 2AW9A 2A06H 2EULA 4JV5O 4B3TO 2LGWA 3H1IH 1E79G 4MW8A 3JCUZ 1IDSA 5FPRA 2CH7A 4DR1B 5JVDB 2GBOA 3CB2A 1K34A 4X20B 2WSSG 2PGGA 1J95A 2AZ0A 3ZN0A 3OTFA 3DGEA 1GTOA 3T1CA 5LHGA 4PHZA 2GV9A 4R8CA 1OV9A 5AG2A 1GRJA 3CXHF 2F93B 1YSCA 4UXNA 4PDLA 4CC6A 2IH1C 1JJ2U 4J9YB 3MHSC 1Q81W 4IGGA 3RYHB 1HDJA 3T4DA 5K1XA 4QNHB 3CYOA 4ZHQA 3UCSC 2CTQA 3P30A 1JQ0A 1NKDA 3SPCA 2UXBB 1VF6C 4Z1MG 4GX1A 4YJ3A 2CDYA 2YIBA 2HR3A 4WFFA 2MK3A 1KBHA 1NR1A 2CGOA 1B06A 4QIWF 4MTGA 3RYIA 3RGBA 4TOIA 1VQ6V 3A2FA 2LP7A 3CMEV 5A9GA 1QLNA 1F7YA 2Q7HA 3SPHA 1PP9H 3ZX6A 1JCHA 3CCRV 3IGAC 4KFMA 4DR7O 1I5XA 4DRXA 1RPOA 1PV0A 1SQXH 3OE7G 4GKJO 2LFSA 4ZOLB 5IYBO 2L35A 2QM8A 1S72V 2CTPA 4LR3A 3G4SV 1TVKB 2JVDA 4LFCB 2JS3A 4JF3A 4MVRA 4LF5B 1HNZB 1LUWA 4EFBA 1WPXA 4KHPB 1XL6A 1WA8A 1R3KC 4MVUA 2VQEO 1WLEA 1KU9A 3JSNA 2EIMC 5EZYB 1AB3A 1SQVH 4FM1A 3ZMZA 1I94B 4I9WA 4IYIA 5CMUA 2ZD9A 1QVGU 2VQEB 4ZOLA 2E3CA 2KSDA 5IJ0B 4GKKO 1AVMA 3AG4B 3H1JH 4J7ZA 4DR3O 3S3WA 4OGQB 2V1DA 4GYCB 2O57A 5EC1C 3WB1A 2QTSA 1GM8A 2YS8A 2VQFB 1JR9A 1XMOO 2LJ2A 4LF4B 3F7YC 5KHKA 3H1LH 2YICA 4O4LA 4WFGA 3H9VA 4R50A 4UVBA 4JTAB 5TISZ 1PNKA 4NYKA 2EILB 1D2DA 1UFIA 1K9MW 3JATB 1AP6A 4DV3B 3K79A 4IT5A 2IJJA 1XDCA 4K0KO 1HNWO 4JI4B 1FJGB 4KP4A 4O2AA 1FAFA 4RQFA 4ICGA 3KCYA 1NH2B 4JYBA 3LDDA 2H8PC 4PA4A 2DMXA 3FB6C 2EBOA 2BSKA 2EIKC 3JD2A 1DTOA 3GVMA 2GDSA 5EBWC 1ZUQA 4MS2A 5C8YA 2AHYA 3ABTA 2IH3C 3OMAB 1H2GA 3BAAA 2WLIB 2FTKA 4P2ZA 2UU9O 5CB4B 2UU9B 4PDMA 1R6NA 3HR0A 2W6IG 1YVWA 4YIPA 3D3IA 4DXWA 2QM7A 2OWOA 1GM9A 1URFA 4HBNA 3F5WC 1QBZA 2B1GA 1NZ6A 1P7BA 3R66A 2LFRA 3X2QC 5BMVB 1CPYA 5LL6Y 3K59A 4IIJA 5CA3A 1SQPH 1ORQC 1IBKO 2NLJC 4FJCC 1K73W 4DUZO 1JOYA 4R6ZA 4NXNB 1XEQA 2X0LA 3CD6V 3CC4V 1IXBA 3A8TA 4JI2B 4DK0A 2DYRC 1S3JA 1K92A 2HJFC 3ZEDA 1S5HC 2QDOA 4CS4A 1CP9A 2Q69A 1K3EA 1M57B 2GHYA 1Y76B 4QGPA 3TJTA 3T2MA 1E1RG 3FFQA 4X9QA 1QVFU 2Q0OC 1GO3F 3WG7B 1YTFD 1NR7A 1BCCH 1OCCC 4MTFA 1RFYA 4JI1O 2ZINA 1YTFB 1TGOA 1L1FA 2ZIMA 5LHIA 4BAYA 1OCOC 4PI0A 3B77A 3K5LA 4LP8A 3JAMN 5JVDA 2PZSA 4ZKIA 4JAAA 4GX5A 1SC5B 2QKAA 3T1HO 2JK5C 3CCVV 4LBEC 1OHHG 3RWRD 3G67A 4RWUA 5B3SC 2P4KA 1KKDA 4NXNO 2DOSA 4F6RB 1SA0A 2NR5A 3STZC 4CH6A 3N2KA 5KA5A 2Q73A 4WF9V 1OCRC 5EK0A 4YHHO 3D36C 4B7EA 2Y48A 4Z2WA 4W4KA 1B04A 2RQ6A 1SF9A 3BVOA 3CCJV 2ODMA 1VMGA 1FD9A 4X1IA 3P3NA 3ZHSA 2P06A 4O4IB 4UVCA 1PNMA 4F6RA 3N2GA 3T1YB 1EZJA 4D7SA 3OD4A 1FKAO 3N2KB 3BHPA 1W0JG 4L8JA 3K9SA 5KHHA 1U96A 2FMLA 4PV1B 1HR0B 1M5IA 4AHCA 3FB8C 3SJCC 4WFAV 1AR1B 4W4LA 2Q8VA 4B3SB 3AK2A 4X65O 3SPJA 4TUYA 1Q6IA 3RFRA 2UUAO 3OMNB 3BRCA 4OPHA 2CAZC 1VQ9V 2CGNA 2ADQB 4FLTA 1X4TA 3ICXA 2QWPB 3E2EA 3BA9A 3JASB 3RYHA 1IX9A 2IM9A 1VQ4V 1GK9A 4X62O 2N74A 3IFXA 3QO7A 1AJQA 1H2KA 5DEDA 3CCUV 2WWWA 5IJ0A 3ZRWB 1YJNV 4TUYB 1M93A 5JH7A 1V54B 3JAWA 3DXRA 3B4SA 3JALB 1H8EG 2DYSB 4DR3B 3RYIB 1EM1A 2HG5C 4JI6B 4CBCA 1J5EB 3ETEA 3ABKB 3SYPA 1Q43A 2R70A 3JASA 1I08A 3AG2C 2A0LA 1VQPV 2IU3A 1FXKC 5LHHA 4JZGA 2XOKG 2LW7A 3BFRA 1AJNA 2JRIA 4JTCB 3UM7A 1LUVA 4LFAO 1SESA 2R72A 3K03A 1QR9A 4H33A 4B3MO 3G6BA 2BE3A 3ZRWA 4YJ2A 3JATA 1ZSPA 5JH7B 3L74H 4JTDB 3JAWB 3TK1A 4IHJA 4U7OA 3VQWA 3ZHRA 4FMTA 2WLNA 1NBMG 2WAMA 1GH6A 2ZDIC 2YXYA 2BSKB 1ZL8B 1HWYA 1U97A 4DR4B 3ZHQA 1YJ9V 3K04A 2X6AA 2LGQA 2Q0AA 5C8YB 4DV7B 2ZKOA 2FL4A 1I5YA 4NTXA 5CB4A 1AR4A 1EBOA 3P32A 5HFMA 4B3TB 2KG7A 3H1KH 1KYOF 3CJHA 1EN4A 3CS5A 4K0KB 4X65B 2ZCEA 4DR5B 4DV1O 3JD3A 4O4LB 3S3XA 5H5NA 4DR4O 3ABMC 2D2CB 2ZT9B 4I0XA 4ABMA 2ZR2A 4FM0A 3MD0A 1VQ7V 1S76D 5BY1A 4JZ2A 1X59A 4FLZA 1M57C 1XQ8A 2CUGA 2GSMB 3CC7V 1QU7A 2C2AA 3QVNA 1OZ0A 2FYUH 2DN9A 3O9OA 5IT9N 1Q7YW 2QKCA 4JI0B 2YC0A 2ZNIA 1YITV 4YIOA 4JI1B 5CBHA 2IJHA 4C7UA 1US6A 4X1KA 1AJPA 3RT3C 3HKDB 3VOUA 1QCEA 1EFRG 1SRYA 4X64B 2Q9LA 4UUJC 2RN9A 4P9PA 1IBLO 4LWSB 2EIKB 4DR6B 4JASA 5E79Z 4AILC 3K58A 1RM1C 5LA6B 2VWKA 3SDLA 3ASNB 3ETQA 1N0JA 1TUBB 2W0XA 4X1KB 1NS1A 3K57A 3B2EE 4DV7O 2M7WA 2ZE7A 5FPOA 4IIJB 1NI8A 5GONB 3E89A 2Z0AA 1VQLV 3AG3B 2NNUA 1YDXA 1DLBA 1CEZA 1H2LA 4QPKA 4QJFB 1WPBA 4TV8B 2DW4A 2NN4A 2WA4A 2V4DA 3E8HA 3U0ZA 4CH3A 1FFXB 1KB9F 1KP3A 4J7KA 3JYCA 2OCCB 2HFEC 1UJWB 5CA1B 3MAQA 3EHBB 3ZBHA 5LGTA 2BTQA 2F66C 4K8ZA 3CEIA 2RDCA 2XAJA 1YEWA 2YDEA 3HKBA 1NU1H 3B09A 1FJGO 4N23A 1BHBA 5H2FZ 4FZ1A 4AQYB 1HNXB 5EBMC 1PKXA 1FYJA 2EJ7A 4O4HA 5JCOC 3AK1A 4I50A 2EIJC 2LQTA 1PPJH 5ITZB 4E4EA 1MZFA 2JGDA 3ZCCA 3UQ8A 1SZTA 2ZXWB 4YHHB 2F1MA 2BTQB 2F95B 4G27B 2LO1A 1HNWB 1VQKV 2HEPA 2ZM6B 3T4ZA 4B3RO 4XBFA 1JPXA 1D5AA 4MVSA 4JI8O 4HYOA 2A79B 1VIBA 1M9NA 3RVYA 3CX5F 3FYIB 3ABKC 4U7NA 4B08A 4I50B 2RJZA 3SJQC 2IW5A 3WB2A 1BQZA 1B3QA 2JGDB 3C90A 3RN4A 2CK3G 2K9PA 1N36O 3G6EV 1EZVH 1K5SA 2CH7B 4U3FH 2UUCO 2ZE8A 5IYDO 3W7XA 3AG2B 4EEQA 4X20A 3WFVA 1BGYH 1OCOB 2ZE6A 1H2MA 3ZHUA 1ZAUA 1ENVA 4CH4A 2EX3A 1O9HA 4MVOA 3A0BZ 1JFFB 3TGUH 1SKVA 3K0GA 4JI7B 3AEIA 4O4IA 1Y74A 3ZRXA 3CWBH 2N05A 2A9HA 2AXTZ 1OCCB 5B1NA 2PYLA 3JALA 1K8AW 3CCLV 4BW9A 3AG1C 1JJOA 3ZMVA 4ZBMA 4DV2O 1O9GA 2E74B 2AZ2A 3JAKA 1J5EO 3UO2A 2XUMA 3W7WA 1A32A 2Q5ZA 3CP1A 3ZMTA 2R9IA 2GTAA 4NB5A 4HZ3A 1NTKH 2RCVA 3OTOB 5KUKA 1FS0G 5KLVH 3G71V 4OX9B 1QQCA 3VBBA 5L3FA 1M1KW 1I94O 3LDEA 4O2BB 1MSDA 3F5TA 1Q3EA 3QTCA 2OCCC 3U11A 4LF6B 3BY6A 2QR4A 3RVZA 1TVKA 1ROPA 3CE2A 1L0LH 1BHAA 2WLHA 4FFKA 4I4TB 4LFAB 3IC7A 4XDLA 5B1OA 1F4NA 1W0KG 3LDCA 2IJIA 5IWAO 1XHZA 4JYCA 3HKEA 1WA8B 4OX9O 4UV9A 5LGNA 5EZYA 3R65A 4O2BA 3WU2Z 2DE0X 1F51A 2WLKA 2WLJA 1DK1A 4I0XB 4LF8B 4G28B 2ADPA 2Q67A 2UUBO 2MW2B 1WP8A 3GWKC 1G1XB 4YJ2B 4UCTA 2ZXWC 3CCQV 4I4TA 2Q68A 2M6YA 1SERA 1RSOB 1XMQB 1NTZH 2IJKA 1V54C 2P90A 5KMGB 4NTWA 2PYJA 2Y69B 3HKEB 2QTOA 3KZIZ 1M90W 5BR8O 3HKDA 4QPJA 2QKSA 2ZM6O 2Q6AA 4UB6Z 2KB1A 2ZNJA 4CS3A 2BOBC 2H3OA 2KQXA 4TT3G 4UCSA 2DQ3A 4J10A 1IZ3A 1AP5A 3K3WA 5EYPB 2Y0PA 3QNEA 1N34B 4H0LB 3AG7A 3T1HB 1BQ0A 2V7QG 1W59A 3D8CA 2XAHA 1RSOA 5LA6A 1COWG 5LYJB 3FB5C 4UB8Z 1FXHA 5D5QA 1TUBA 2UXDB 1WB7A 4GKKB 4JI5B 3DSQA 4PA9A 1JVMA 2ITCC 4H44B 3CCMV 2R9RB 4DV6O 3DC6A 4FLVA 4HAMA 4MSWC 2IBZH 2QGNA 2PI5A 1K4CC 4JI2O 5LOVB 3OUSA 3RW0A 1WAZA 3OEHG 1NQTA 5J2TA 1K7DA 1P4RA 1G4YB 1MABG 1BT8A 2B1IA 4HNAB 1WB8A 4YXWG 3J81N 3CRAA 2GTSA 2Z5UA 2Y4TA 5E1AC 4PA3A 1S5JA 1XMQO 4JAUA 2JEXA 2P7TC 1H38A 1GN4A 5LOVA 5LXTB 1AR5A 1QR8A 4DO2A 1XNRO 4LFBB 1K5QA 5B3SB 5J2TB 3JARB 2OIGA 1WNSA 4O4HB 3T1YO 2ATKC 2CTRA 3ZJZA 1NVPD 1Q5OA 4B3SO 1QNMA 1NT2B 5LMNO 3W7TA 2DJVA 3FKSG 1YZBA 3VQXA 1CXZB 4JYAO 4P30A 5EIBC 4TV8A 1VQ8V 2JIZG 5LXTA 2JJ1G 5LMNB 1PL4A 2OTLV 3ZS8C 1Q90D 3B8MA 1F4MA 4P9OA 1FFXA 4RUEA 4GLXA 2EINB 1KP2A 5CA1A 4DW1A 2OTJV 3RYCA 4UFZA 1QLEC 5IJ9B 1AI4A 3OFNG 3D36A 4WFBV 4PELA 4EKWA 2L6LA 1V55B 2FB5A 4JV5B 1SZXA 4FVMA 1NTMH 2X6CA 1BMFG 4DUYB 4GT1A 1UPGA 1BL8A 1MZEA 3LNNA 1JFFA 3APQA 4JYYA 4DUZB 1B6QA 3RYCB 1DGSA 3SJBC 5IJ9A 1IBLB 5LMUO 3NR7A 4UV8A 2HP8A 3ML0A 4JI7O 3K5NA 4PJ0Z 1GAXA 3IAYA 4TQDA 3M99B 1IURA 3ZN1A 3JAKB 2YIDA 2K1EA 3BA8A 2XAQA 4ZIBA 3ZHVA 1FPOA 1F23A 4RAIA 1EN5A 3TXSA 4MVMA 3W7SA 1E1QG 4KL1A 4LH6A 1XREA 3ETGA 3ABLB 3KCXA 5EIBD 2EIMB 2EZPA 1AROP 2E5LO 5L3CA 5JJNB 5EBLC 1VARA 4X62B 1KMIZ 1AI7A 5JWPA 2DYSC 4X8AA 3GB7C 4LF5O 2AHZA 4FLXA 3CCSV 1KQSU 4IYHA 3SR2C 1GMGA 3E22B 5JCOA 4LCUC 1MMMA 2DYRB 2UUAB 4JPRA 4DR7B 1VQ5V 2QE7G 2ZE5A 2BOCC 3ABMB 1XL4A 2Q7EA 5GTIZ 2YI9A 4DR2O 1HR0O 1Y67A 4MTXA 5H9CA 2UXXA 3CMAV 1R3JC 4FFBA 4KUMA 4X89A 3OEEG 1OCZB 3DXRB 3DC5A 4YJ3B 5IDJA 5JJJB 2HLDG 1M4UA 4UCVA 4D6TH 3KG2A 1PD3A 1WN7A 2CTWA 5IY5C 1KD1W 4JI5O 2Q7GA 2VWJA 1VQMV 2PTMA 5KAIZ 4H37A 4B3RB 4DK1A 4FFBB 3EFFK 3TCUA 1ZWIC 4FZ0A 4OPAA 5EYPA 3SYOA 1T5EA 2HHHB 4NKGB 4X88A 3RBZA 1L8DA 1VF6A 1VF7A 4IHJB 1ZX3A 5IYZA 1N8RW 1XNQO 3B8NA 2QWNB 1XMOB 2HHHO 4FK5C 4JI3B 3OTOO 1R73A 3CXCU 3N27A 5KHGA 1HNXO 4LH7A 5J2UB 4LF9B 4DV3O 4NR1A 2UUBB 1ZL8A 1IVSA 4LNUB 5FNVB 4CZZA 4I9QA 3GWOA 2JS5A 3CHXA 1RP3B 4NXMO 5A2QN 1R3IC 5L3BA 3THOA 4TV9B 1PM9A 3ZHTA 2KG7B 1N0NA 3CJHB 3MHHC 1S77D 1R6TA 4UVAA 2P4VA 2QSAA 2HKOA 2F23A 5J2UA 4K8XA 2ZQMA 2QWOB 1HNZO 2F43G 3JD1A 3BCCH 4LNUA 5FNVA 1N33B 2QJ1A 4PDVA 1H8HG 3FYEB 4PD4F 2QWRB 4UCRA 5JJEB 1YI2V 1GKFA 1R6KA 3OGIB 1I0HA 2HVKC 2A7WA 2WLLA 5H6RA 3OW2U 4O2AB 2DWEC 3L72H 3PN1A 4AI8A 4PI2A 1OJHA 5L3GA 4BW5A 2Y69C 3LSUA 1Y4MA 2XAFA 3SYCA 1FXKA 4LWSA 2FKXA 2PF4E 1P49A 1VF5B 2XAGA 1YJWV 1Q8IA 4DW0A 1BSMA 2WLIA 3E35A 1GN6A 3QF7A 5CA0B 1G8MA 4E2LA 3ZRSA 4JI3O 4X64O 2YI8A 1JMKC 3C3TA 5B1AB 3NXSA 3OAAG 4I55B 2UXDO 4HNAA 1S5LZ 5LP6C 4JI0O 4TWKA 4DV2B 4ZI7A 1WP7A 3ETDA 5JQGB 2DWDC 4DV4B 2B5UA 3QG5A 1KKCA 4MW3A 4DV4O 1FXKB 4GZRB 5BMVA 2A3QA 1Z5VA 4X1YB 1OCZC 3LSQA 3UKMA 3OR7C 4EFEA 4BIZA 4RUFA 4QE7A 1PNLA 1AI6A 3E83A 1IBMO 1IBMB 4BR6A 4B3MB 3ABLC 5KAFZ 4NTYA 1MNGA 3I56V 5IY5B 1MG1A 3OMIB 4JAVA 1P7GA 3ZRVA 4CC5A 4DR5O 3AK3A 1K4DC 4J9ZB 4DV1B 2XTAA 1HP8A 3IJ4A 4DUYO 5IYCO 4JI6O 1RPRA 4JI8B 4LFBO 3UT5B 1XNRB 3KKYA 3ASOB 3LUTB 3SPGA 2Q4PA 3QO8A 1Q6HA 4XDJA 1YIJV 3EVKA 3F7VC 3FB7C 2F4VO 3K0DA 3K5OA 1SQGA 3K9AA 3J80N 1GM7A 1JX9A 4X66B 4PA7A 4O4JB 4H13B 1MOFA 1TAEA 3OT7A 4J11A 5ITZA 2N04A 1TA8A 1N33O 4WBNA 1MSWD 3Q4HB 3RYFA 2QM4A 5L3EA 3SPIA 4CS2A 2VQFO 1SETA 2Y0IA 2YEVB 4TSFG 1XHXA 3C3SA 4CH5A 1D5NA 5FL7G 3B40A 2XNDG 3CSXA 2P67A 4UCOA 4AQYO 3M8AA 3AG1B 4O4JA 1Q82W 3ABUA 2CE4A 5IE9A 5LP6A 4GUNA 3E22A 3I5DA 2OCHA 5CBGA 1AI5A 4WBNB 1AILA 2PI4A 2JEUA 1Q6UA 3CRRA 3Q4HA 3ZIAG 4WCEV 4LF9O 3CCEV 1DF5A 4EB6B 3RYFB 3CRMA 2GUZA 4MTOA 1VP7A 5J9PC 1V9PA 2X7RB 3A0HZ 2HVJC 5KX5B 5CN0A 2PY5A 1EN6A 4TQFA 4JI4O 4DYLA 1V55C 2UXCO 3I55V 3OUFA 5BR8B 1K33A 4U3JA 1M56B 1Y74B 4WFHA 4GCZA 3ASNC 5BXZA 4X66O 3APOA 2YIAA 4LF4O 5F2VO 3FX7A 5HFLA 3PJSK 4YY3B 4J41A 4EB6A 2QWQB 2GUZB 4RO2A 3N2GB 2E5LB 2AGAA 1NVPB 2E75B 3CC2V 5KX5A 5B1BB
chains in the Genus database with same CATH topology
4DV6O 2LW7A 3F5TA 4DUZO 2JRIA 3J7AU 4LF8O 4LFAO 4JI8O 4YHHO 4B3MO 2F4VO 4JI2O 1XEQA 4GKKO 1R1BA 3J80N 5FLXN 4DR3O 3SDLA 4DR1O 1NS1A 4LF7O 3J81N 5IWAO 4DV7O 5LMUO 1N33O 4DV5O 1XMOO 4OX9O 4JI5O 4JI7O 1N34O 1FKAO 4YY3O 2Z0AA 1N36O 2FKXA 1XMQO 2VQFO 2UUCO 4A5UB 1KUQA 1DK1A 2UXBO 2ZKOA 2UUBO 4DR6O 1D2DA 1G1XB 4OPAA 1XNRO 4AQYO 4JI3O 3M8AA 4X64O 4K0KO 1HNWO 4X65O 3O65A 2UUAO 2UXDO 3T1YO 4OPHA 1XNQO 4JI1O 4JI0O 2HHHO 3OTOO 1AILA 4B3SO 1HNXO 5BR8O 4DV1O 4DV3O 4DV4O 4LF9O 2ZM6O 1N32O 4LFCO 5LMNO 4DV0O 2DJVA 4DV2O 5H5NA 1YZBA 2E5LO 4DR4O 1F7YA 1J5EO 4X62O 2N74A 4JYAO 4NXMO 5BY1A 1IBMO 2UU9O 4B3RO 3JAMN 5A2QN 4DR7O 1X59A 1FJGO 4LF5O 1A32A 4JI4O 4GKJO 2UXCO 4DR5O 1FYJA 5IT9N 1R6TA 3T1HO 5BXZA 4X66O 4KHPO 4DUYO 4JI6O 3RT3C 4LF4O 3R66A 4LF6O 4NXNO 1HNZO 2DOSA 2VQEO 4LFBO 5LL6Y 4JV5O 4B3TO 2AGAA 1IBKO 1IBLO 1AB3A 4DR2O 1I94O 1HR0O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV6 O;  2LW7 A;  3F5T A;  4DUZ O;  2JRI A;  3J7A U;  4LF8 O;  4LFA O;  4JI8 O;  4YHH O;  4B3M O;  2F4V O;  4JI2 O;  1XEQ A;  4GKK O;  1R1B A;  3J80 N;  5FLX N;  4DR3 O;  3SDL A;  4DR1 O;  1NS1 A;  4LF7 O;  3J81 N;  5IWA O;  4DV7 O;  5LMU O;  1N33 O;  4DV5 O;  1XMO O;  4OX9 O;  4JI5 O;  4JI7 O;  1N34 O;  1FKA O;  4YY3 O;  2Z0A A;  1N36 O;  2FKX A;  1XMQ O;  2VQF O;  2UUC O;  4A5U B;  1KUQ A;  1DK1 A;  2UXB O;  2ZKO A;  2UUB O;  4DR6 O;  1D2D A;  1G1X B;  4OPA A;  1XNR O;  4AQY O;  4JI3 O;  3M8A A;  4X64 O;  4K0K O;  1HNW O;  4X65 O;  3O65 A;  2UUA O;  2UXD O;  3T1Y O;  4OPH A;  1XNQ O;  4JI1 O;  4JI0 O;  2HHH O;  3OTO O;  1AIL A;  4B3S O;  1HNX O;  5BR8 O;  4DV1 O;  4DV3 O;  4DV4 O;  4LF9 O;  2ZM6 O;  1N32 O;  4LFC O;  5LMN O;  4DV0 O;  2DJV A;  4DV2 O;  5H5N A;  1YZB A;  2E5L O;  4DR4 O;  1F7Y A;  1J5E O;  4X62 O;  2N74 A;  4JYA O;  4NXM O;  5BY1 A;  1IBM O;  2UU9 O;  4B3R O;  3JAM N;  5A2Q N;  4DR7 O;  1X59 A;  1FJG O;  4LF5 O;  1A32 A;  4JI4 O;  4GKJ O;  2UXC O;  4DR5 O;  1FYJ A;  5IT9 N;  1R6T A;  3T1H O;  5BXZ A;  4X66 O;  4KHP O;  4DUY O;  4JI6 O;  3RT3 C;  4LF4 O;  3R66 A;  4LF6 O;  4NXN O;  1HNZ O;  2DOS A;  2VQE O;  4LFB O;  5LL6 Y;  4JV5 O;  4B3T O;  2AGA A;  1IBK O;  1IBL O;  1AB3 A;  4DR2 O;  1I94 O;  1HR0 O; 
#chains in the Genus database with same CATH topology
 1Z2G A;  1SQQ H;  1XOU A;  4XDK A;  4LF8 O;  1Y66 A;  1KEC A;  1PL0 A;  5B66 Z;  2XT9 A;  1MA1 A;  2UXN A;  2ZDI A;  3E86 A;  1N4C A;  5FLX N;  2H94 A;  3BAB A;  4U3J B;  5IYZ B;  5IWA B;  1H2N A;  4LF7 O;  2RNB A;  1TUE B;  3VQY A;  3CPW U;  3K08 A;  1N34 O;  1GN2 A;  3ZMU A;  4BIU A;  1L0N H;  1K97 A;  3JSL A;  4FLY A;  2YUA A;  2EIL C;  2P6J A;  3E8F A;  4DRX B;  1P84 F;  5CBF A;  4GKJ B;  5B5E Z;  4FLU A;  3H01 A;  3O65 A;  1RM1 B;  2JJ2 G;  3WB0 A;  1M56 C;  3STL C;  4Z1V A;  2ILM A;  4KXR A;  3CRC A;  4UCU A;  1G6U A;  1DF4 A;  3JCZ A;  4G2K A;  3L73 H;  4ZHQ B;  3JD4 A;  4J7J A;  3TXQ A;  2Y4U A;  4Q20 A;  2HJD A;  5KHJ A;  1QHT A;  3K5M A;  1YHQ V;  5KMG A;  4ASU G;  1XI1 A;  3VQV A;  2YXH A;  4LC1 A;  1LNQ A;  4LF6 O;  1THZ A;  1BS3 A;  3D3Q A;  5LMU B;  3MDS A;  2XHB A;  4LF7 B;  4DV6 B;  1XIL A;  2Z3Y A;  4BIO A;  3OR6 C;  1N32 B;  5GW7 A;  2OT5 A;  5LBQ A;  3J7A U;  4DR2 B;  2P5O A;  5BZB A;  4TV9 A;  4NVP A;  1W2B U;  4K35 A;  5CA0 A;  2OIE A;  1R1B A;  2X6B A;  3HPL C;  1Z5W A;  3ZMS A;  1HW7 A;  4GX0 A;  3WG7 C;  2R9A A;  5DEC A;  5LYJ A;  5KHI A;  2WPD G;  1I7F A;  1XBL A;  2VRZ A;  3K06 A;  2QA4 V;  4DV5 O;  1SS3 A;  1WJZ A;  4MVQ A;  4YY3 O;  5H6Q A;  3BEH A;  1R3L C;  4X1Y A;  1LR1 A;  2VS0 A;  1KC8 W;  4A5U B;  4FLW A;  2OYQ A;  2G38 A;  4QE9 A;  1S0V A;  2UXC B;  4DR6 O;  3HB3 B;  4F6E A;  2WLL B;  3QO5 A;  1IBK B;  4I7Z B;  2YIB D;  3SGI A;  2W6J G;  2PUS A;  2YSU B;  4B7K A;  5EC2 C;  3LNM B;  3TET A;  2F4V B;  2P22 C;  4GX2 A;  2EJR A;  4N21 A;  2D3O W;  4DV0 O;  5C93 A;  4F4L A;  5L3D A;  5GTH Z;  3SYA A;  4FM2 A;  2QEX V;  2EZO A;  3H1H H;  1N36 B;  4K3A A;  1Y6X A;  3FD9 A;  5KA6 A;  3LSS A;  4DV0 B;  2EIJ B;  4FPP A;  1VQO V;  4Q6G A;  2W0F C;  3JAR A;  4JGS A;  2E76 B;  2B9Z A;  4I55 A;  5DM6 V;  4R7C A;  2ITD C;  3E8G A;  3DTU B;  5B1A C;  4KHP O;  4ZI7 B;  5JQG A;  2LW1 A;  1YCI A;  4D7T A;  1Q86 W;  2IU0 A;  2RMK B;  3FAV A;  2ARH A;  2ETN A;  3L70 H;  2EIN C;  4MVZ A;  5GON A;  1Y76 A;  2YEV A;  3BPZ A;  4L87 A;  2YXL A;  3L71 H;  4J80 A;  4DV5 B;  3G80 A;  3HKC B;  3L75 H;  3W7U A;  1FFT B;  1YXB A;  2DQ0 A;  5LGU A;  3A0R A;  4DR1 O;  3CRQ A;  3P3P A;  4MT8 A;  1SQB H;  4FIP C;  3AG4 C;  1IXM A;  2KKW A;  3FAV B;  4IL6 Z;  2BTO A;  2JDI G;  3UT5 A;  3E8B A;  1OCR B;  5D5P A;  1SQF A;  2ZR3 A;  4JYA B;  1VEW A;  1XUQ A;  2WA3 A;  1KUQ A;  2UXB O;  3ASO C;  3HKB B;  3L9D A;  3X2Q B;  1FXV A;  2JGU A;  3HKC A;  4I5S A;  4NXM B;  4PDR A;  1ZTE A;  3OGC C;  3U10 A;  1BZK A;  3EXA A;  1JA8 A;  1N32 O;  3M7M X;  4LFC O;  5K1P A;  1SA0 B;  5DN6 G;  2UUC B;  4PA6 A;  1XNQ B;  4J42 A;  3IC9 A;  2ZIO A;  3UO3 A;  4BWA A;  1ZLZ A;  4WFE A;  3AG3 C;  1BE3 H;  3JD0 A;  1H2S B;  2BCC H;  5B1B C;  5KUM A;  1YF2 A;  3OM3 B;  3SJA C;  5LP6 B;  1VQN V;  4RQE A;  1NJI W;  4X1I B;  3SYQ A;  4OXS A;  2WLM A;  1NH2 D;  1GN3 A;  2XAS A;  1QLE B;  2AW9 A;  2A06 H;  2EUL A;  4JV5 O;  4B3T O;  2LGW A;  3H1I H;  1E79 G;  4MW8 A;  3JCU Z;  1IDS A;  5FPR A;  2CH7 A;  4DR1 B;  5JVD B;  2GBO A;  3CB2 A;  1K34 A;  4X20 B;  2WSS G;  2PGG A;  1J95 A;  2AZ0 A;  3ZN0 A;  3OTF A;  3DGE A;  1GTO A;  3T1C A;  5LHG A;  4PHZ A;  2GV9 A;  4R8C A;  1OV9 A;  5AG2 A;  1GRJ A;  3CXH F;  2F93 B;  1YSC A;  4UXN A;  4PDL A;  4CC6 A;  2IH1 C;  1JJ2 U;  4J9Y B;  3MHS C;  1Q81 W;  4IGG A;  3RYH B;  1HDJ A;  3T4D A;  5K1X A;  4QNH B;  3CYO A;  4ZHQ A;  3UCS C;  2CTQ A;  3P30 A;  1JQ0 A;  1NKD A;  3SPC A;  2UXB B;  1VF6 C;  4Z1M G;  4GX1 A;  4YJ3 A;  2CDY A;  2YIB A;  2HR3 A;  4WFF A;  2MK3 A;  1KBH A;  1NR1 A;  2CGO A;  1B06 A;  4QIW F;  4MTG A;  3RYI A;  3RGB A;  4TOI A;  1VQ6 V;  3A2F A;  2LP7 A;  3CME V;  5A9G A;  1QLN A;  1F7Y A;  2Q7H A;  3SPH A;  1PP9 H;  3ZX6 A;  1JCH A;  3CCR V;  3IGA C;  4KFM A;  4DR7 O;  1I5X A;  4DRX A;  1RPO A;  1PV0 A;  1SQX H;  3OE7 G;  4GKJ O;  2LFS A;  4ZOL B;  5IYB O;  2L35 A;  2QM8 A;  1S72 V;  2CTP A;  4LR3 A;  3G4S V;  1TVK B;  2JVD A;  4LFC B;  2JS3 A;  4JF3 A;  4MVR A;  4LF5 B;  1HNZ B;  1LUW A;  4EFB A;  1WPX A;  4KHP B;  1XL6 A;  1WA8 A;  1R3K C;  4MVU A;  2VQE O;  1WLE A;  1KU9 A;  3JSN A;  2EIM C;  5EZY B;  1AB3 A;  1SQV H;  4FM1 A;  3ZMZ A;  1I94 B;  4I9W A;  4IYI A;  5CMU A;  2ZD9 A;  1QVG U;  2VQE B;  4ZOL A;  2E3C A;  2KSD A;  5IJ0 B;  4GKK O;  1AVM A;  3AG4 B;  3H1J H;  4J7Z A;  4DR3 O;  3S3W A;  4OGQ B;  2V1D A;  4GYC B;  2O57 A;  5EC1 C;  3WB1 A;  2QTS A;  1GM8 A;  2YS8 A;  2VQF B;  1JR9 A;  1XMO O;  2LJ2 A;  4LF4 B;  3F7Y C;  5KHK A;  3H1L H;  2YIC A;  4O4L A;  4WFG A;  3H9V A;  4R50 A;  4UVB A;  4JTA B;  5TIS Z;  1PNK A;  4NYK A;  2EIL B;  1D2D A;  1UFI A;  1K9M W;  3JAT B;  1AP6 A;  4DV3 B;  3K79 A;  4IT5 A;  2IJJ A;  1XDC A;  4K0K O;  1HNW O;  4JI4 B;  1FJG B;  4KP4 A;  4O2A A;  1FAF A;  4RQF A;  4ICG A;  3KCY A;  1NH2 B;  4JYB A;  3LDD A;  2H8P C;  4PA4 A;  2DMX A;  3FB6 C;  2EBO A;  2BSK A;  2EIK C;  3JD2 A;  1DTO A;  3GVM A;  2GDS A;  5EBW C;  1ZUQ A;  4MS2 A;  5C8Y A;  2AHY A;  3ABT A;  2IH3 C;  3OMA B;  1H2G A;  3BAA A;  2WLI B;  2FTK A;  4P2Z A;  2UU9 O;  5CB4 B;  2UU9 B;  4PDM A;  1R6N A;  3HR0 A;  2W6I G;  1YVW A;  4YIP A;  3D3I A;  4DXW A;  2QM7 A;  2OWO A;  1GM9 A;  1URF A;  4HBN A;  3F5W C;  1QBZ A;  2B1G A;  1NZ6 A;  1P7B A;  3R66 A;  2LFR A;  3X2Q C;  5BMV B;  1CPY A;  5LL6 Y;  3K59 A;  4IIJ A;  5CA3 A;  1SQP H;  1ORQ C;  1IBK O;  2NLJ C;  4FJC C;  1K73 W;  4DUZ O;  1JOY A;  4R6Z A;  4NXN B;  1XEQ A;  2X0L A;  3CD6 V;  3CC4 V;  1IXB A;  3A8T A;  4JI2 B;  4DK0 A;  2DYR C;  1S3J A;  1K92 A;  2HJF C;  3ZED A;  1S5H C;  2QDO A;  4CS4 A;  1CP9 A;  2Q69 A;  1K3E A;  1M57 B;  2GHY A;  1Y76 B;  4QGP A;  3TJT A;  3T2M A;  1E1R G;  3FFQ A;  4X9Q A;  1QVF U;  2Q0O C;  1GO3 F;  3WG7 B;  1YTF D;  1NR7 A;  1BCC H;  1OCC C;  4MTF A;  1RFY A;  4JI1 O;  2ZIN A;  1YTF B;  1TGO A;  1L1F A;  2ZIM A;  5LHI A;  4BAY A;  1OCO C;  4PI0 A;  3B77 A;  3K5L A;  4LP8 A;  3JAM N;  5JVD A;  2PZS A;  4ZKI A;  4JAA A;  4GX5 A;  1SC5 B;  2QKA A;  3T1H O;  2JK5 C;  3CCV V;  4LBE C;  1OHH G;  3RWR D;  3G67 A;  4RWU A;  5B3S C;  2P4K A;  1KKD A;  4NXN O;  2DOS A;  4F6R B;  1SA0 A;  2NR5 A;  3STZ C;  4CH6 A;  3N2K A;  5KA5 A;  2Q73 A;  4WF9 V;  1OCR C;  5EK0 A;  4YHH O;  3D36 C;  4B7E A;  2Y48 A;  4Z2W A;  4W4K A;  1B04 A;  2RQ6 A;  1SF9 A;  3BVO A;  3CCJ V;  2ODM A;  1VMG A;  1FD9 A;  4X1I A;  3P3N A;  3ZHS A;  2P06 A;  4O4I B;  4UVC A;  1PNM A;  4F6R A;  3N2G A;  3T1Y B;  1EZJ A;  4D7S A;  3OD4 A;  1FKA O;  3N2K B;  3BHP A;  1W0J G;  4L8J A;  3K9S A;  5KHH A;  1U96 A;  2FML A;  4PV1 B;  1HR0 B;  1M5I A;  4AHC A;  3FB8 C;  3SJC C;  4WFA V;  1AR1 B;  4W4L A;  2Q8V A;  4B3S B;  3AK2 A;  4X65 O;  3SPJ A;  4TUY A;  1Q6I A;  3RFR A;  2UUA O;  3OMN B;  3BRC A;  4OPH A;  2CAZ C;  1VQ9 V;  2CGN A;  2ADQ B;  4FLT A;  1X4T A;  3ICX A;  2QWP B;  3E2E A;  3BA9 A;  3JAS B;  3RYH A;  1IX9 A;  2IM9 A;  1VQ4 V;  1GK9 A;  4X62 O;  2N74 A;  3IFX A;  3QO7 A;  1AJQ A;  1H2K A;  5DED A;  3CCU V;  2WWW A;  5IJ0 A;  3ZRW B;  1YJN V;  4TUY B;  1M93 A;  5JH7 A;  1V54 B;  3JAW A;  3DXR A;  3B4S A;  3JAL B;  1H8E G;  2DYS B;  4DR3 B;  3RYI B;  1EM1 A;  2HG5 C;  4JI6 B;  4CBC A;  1J5E B;  3ETE A;  3ABK B;  3SYP A;  1Q43 A;  2R70 A;  3JAS A;  1I08 A;  3AG2 C;  2A0L A;  1VQP V;  2IU3 A;  1FXK C;  5LHH A;  4JZG A;  2XOK G;  2LW7 A;  3BFR A;  1AJN A;  2JRI A;  4JTC B;  3UM7 A;  1LUV A;  4LFA O;  1SES A;  2R72 A;  3K03 A;  1QR9 A;  4H33 A;  4B3M O;  3G6B A;  2BE3 A;  3ZRW A;  4YJ2 A;  3JAT A;  1ZSP A;  5JH7 B;  3L74 H;  4JTD B;  3JAW B;  3TK1 A;  4IHJ A;  4U7O A;  3VQW A;  3ZHR A;  4FMT A;  2WLN A;  1NBM G;  2WAM A;  1GH6 A;  2ZDI C;  2YXY A;  2BSK B;  1ZL8 B;  1HWY A;  1U97 A;  4DR4 B;  3ZHQ A;  1YJ9 V;  3K04 A;  2X6A A;  2LGQ A;  2Q0A A;  5C8Y B;  4DV7 B;  2ZKO A;  2FL4 A;  1I5Y A;  4NTX A;  5CB4 A;  1AR4 A;  1EBO A;  3P32 A;  5HFM A;  4B3T B;  2KG7 A;  3H1K H;  1KYO F;  3CJH A;  1EN4 A;  3CS5 A;  4K0K B;  4X65 B;  2ZCE A;  4DR5 B;  4DV1 O;  3JD3 A;  4O4L B;  3S3X A;  5H5N A;  4DR4 O;  3ABM C;  2D2C B;  2ZT9 B;  4I0X A;  4ABM A;  2ZR2 A;  4FM0 A;  3MD0 A;  1VQ7 V;  1S76 D;  5BY1 A;  4JZ2 A;  1X59 A;  4FLZ A;  1M57 C;  1XQ8 A;  2CUG A;  2GSM B;  3CC7 V;  1QU7 A;  2C2A A;  3QVN A;  1OZ0 A;  2FYU H;  2DN9 A;  3O9O A;  5IT9 N;  1Q7Y W;  2QKC A;  4JI0 B;  2YC0 A;  2ZNI A;  1YIT V;  4YIO A;  4JI1 B;  5CBH A;  2IJH A;  4C7U A;  1US6 A;  4X1K A;  1AJP A;  3RT3 C;  3HKD B;  3VOU A;  1QCE A;  1EFR G;  1SRY A;  4X64 B;  2Q9L A;  4UUJ C;  2RN9 A;  4P9P A;  1IBL O;  4LWS B;  2EIK B;  4DR6 B;  4JAS A;  5E79 Z;  4AIL C;  3K58 A;  1RM1 C;  5LA6 B;  2VWK A;  3SDL A;  3ASN B;  3ETQ A;  1N0J A;  1TUB B;  2W0X A;  4X1K B;  1NS1 A;  3K57 A;  3B2E E;  4DV7 O;  2M7W A;  2ZE7 A;  5FPO A;  4IIJ B;  1NI8 A;  5GON B;  3E89 A;  2Z0A A;  1VQL V;  3AG3 B;  2NNU A;  1YDX A;  1DLB A;  1CEZ A;  1H2L A;  4QPK A;  4QJF B;  1WPB A;  4TV8 B;  2DW4 A;  2NN4 A;  2WA4 A;  2V4D A;  3E8H A;  3U0Z A;  4CH3 A;  1FFX B;  1KB9 F;  1KP3 A;  4J7K A;  3JYC A;  2OCC B;  2HFE C;  1UJW B;  5CA1 B;  3MAQ A;  3EHB B;  3ZBH A;  5LGT A;  2BTQ A;  2F66 C;  4K8Z A;  3CEI A;  2RDC A;  2XAJ A;  1YEW A;  2YDE A;  3HKB A;  1NU1 H;  3B09 A;  1FJG O;  4N23 A;  1BHB A;  5H2F Z;  4FZ1 A;  4AQY B;  1HNX B;  5EBM C;  1PKX A;  1FYJ A;  2EJ7 A;  4O4H A;  5JCO C;  3AK1 A;  4I50 A;  2EIJ C;  2LQT A;  1PPJ H;  5ITZ B;  4E4E A;  1MZF A;  2JGD A;  3ZCC A;  3UQ8 A;  1SZT A;  2ZXW B;  4YHH B;  2F1M A;  2BTQ B;  2F95 B;  4G27 B;  2LO1 A;  1HNW B;  1VQK V;  2HEP A;  2ZM6 B;  3T4Z A;  4B3R O;  4XBF A;  1JPX A;  1D5A A;  4MVS A;  4JI8 O;  4HYO A;  2A79 B;  1VIB A;  1M9N A;  3RVY A;  3CX5 F;  3FYI B;  3ABK C;  4U7N A;  4B08 A;  4I50 B;  2RJZ A;  3SJQ C;  2IW5 A;  3WB2 A;  1BQZ A;  1B3Q A;  2JGD B;  3C90 A;  3RN4 A;  2CK3 G;  2K9P A;  1N36 O;  3G6E V;  1EZV H;  1K5S A;  2CH7 B;  4U3F H;  2UUC O;  2ZE8 A;  5IYD O;  3W7X A;  3AG2 B;  4EEQ A;  4X20 A;  3WFV A;  1BGY H;  1OCO B;  2ZE6 A;  1H2M A;  3ZHU A;  1ZAU A;  1ENV A;  4CH4 A;  2EX3 A;  1O9H A;  4MVO A;  3A0B Z;  1JFF B;  3TGU H;  1SKV A;  3K0G A;  4JI7 B;  3AEI A;  4O4I A;  1Y74 A;  3ZRX A;  3CWB H;  2N05 A;  2A9H A;  2AXT Z;  1OCC B;  5B1N A;  2PYL A;  3JAL A;  1K8A W;  3CCL V;  4BW9 A;  3AG1 C;  1JJO A;  3ZMV A;  4ZBM A;  4DV2 O;  1O9G A;  2E74 B;  2AZ2 A;  3JAK A;  1J5E O;  3UO2 A;  2XUM A;  3W7W A;  1A32 A;  2Q5Z A;  3CP1 A;  3ZMT A;  2R9I A;  2GTA A;  4NB5 A;  4HZ3 A;  1NTK H;  2RCV A;  3OTO B;  5KUK A;  1FS0 G;  5KLV H;  3G71 V;  4OX9 B;  1QQC A;  3VBB A;  5L3F A;  1M1K W;  1I94 O;  3LDE A;  4O2B B;  1MSD A;  3F5T A;  1Q3E A;  3QTC A;  2OCC C;  3U11 A;  4LF6 B;  3BY6 A;  2QR4 A;  3RVZ A;  1TVK A;  1ROP A;  3CE2 A;  1L0L H;  1BHA A;  2WLH A;  4FFK A;  4I4T B;  4LFA B;  3IC7 A;  4XDL A;  5B1O A;  1F4N A;  1W0K G;  3LDC A;  2IJI A;  5IWA O;  1XHZ A;  4JYC A;  3HKE A;  1WA8 B;  4OX9 O;  4UV9 A;  5LGN A;  5EZY A;  3R65 A;  4O2B A;  3WU2 Z;  2DE0 X;  1F51 A;  2WLK A;  2WLJ A;  1DK1 A;  4I0X B;  4LF8 B;  4G28 B;  2ADP A;  2Q67 A;  2UUB O;  2MW2 B;  1WP8 A;  3GWK C;  1G1X B;  4YJ2 B;  4UCT A;  2ZXW C;  3CCQ V;  4I4T A;  2Q68 A;  2M6Y A;  1SER A;  1RSO B;  1XMQ B;  1NTZ H;  2IJK A;  1V54 C;  2P90 A;  5KMG B;  4NTW A;  2PYJ A;  2Y69 B;  3HKE B;  2QTO A;  3KZI Z;  1M90 W;  5BR8 O;  3HKD A;  4QPJ A;  2QKS A;  2ZM6 O;  2Q6A A;  4UB6 Z;  2KB1 A;  2ZNJ A;  4CS3 A;  2BOB C;  2H3O A;  2KQX A;  4TT3 G;  4UCS A;  2DQ3 A;  4J10 A;  1IZ3 A;  1AP5 A;  3K3W A;  5EYP B;  2Y0P A;  3QNE A;  1N34 B;  4H0L B;  3AG7 A;  3T1H B;  1BQ0 A;  2V7Q G;  1W59 A;  3D8C A;  2XAH A;  1RSO A;  5LA6 A;  1COW G;  5LYJ B;  3FB5 C;  4UB8 Z;  1FXH A;  5D5Q A;  1TUB A;  2UXD B;  1WB7 A;  4GKK B;  4JI5 B;  3DSQ A;  4PA9 A;  1JVM A;  2ITC C;  4H44 B;  3CCM V;  2R9R B;  4DV6 O;  3DC6 A;  4FLV A;  4HAM A;  4MSW C;  2IBZ H;  2QGN A;  2PI5 A;  1K4C C;  4JI2 O;  5LOV B;  3OUS A;  3RW0 A;  1WAZ A;  3OEH G;  1NQT A;  5J2T A;  1K7D A;  1P4R A;  1G4Y B;  1MAB G;  1BT8 A;  2B1I A;  4HNA B;  1WB8 A;  4YXW G;  3J81 N;  3CRA A;  2GTS A;  2Z5U A;  2Y4T A;  5E1A C;  4PA3 A;  1S5J A;  1XMQ O;  4JAU A;  2JEX A;  2P7T C;  1H38 A;  1GN4 A;  5LOV A;  5LXT B;  1AR5 A;  1QR8 A;  4DO2 A;  1XNR O;  4LFB B;  1K5Q A;  5B3S B;  5J2T B;  3JAR B;  2OIG A;  1WNS A;  4O4H B;  3T1Y O;  2ATK C;  2CTR A;  3ZJZ A;  1NVP D;  1Q5O A;  4B3S O;  1QNM A;  1NT2 B;  5LMN O;  3W7T A;  2DJV A;  3FKS G;  1YZB A;  3VQX A;  1CXZ B;  4JYA O;  4P30 A;  5EIB C;  4TV8 A;  1VQ8 V;  2JIZ G;  5LXT A;  2JJ1 G;  5LMN B;  1PL4 A;  2OTL V;  3ZS8 C;  1Q90 D;  3B8M A;  1F4M A;  4P9O A;  1FFX A;  4RUE A;  4GLX A;  2EIN B;  1KP2 A;  5CA1 A;  4DW1 A;  2OTJ V;  3RYC A;  4UFZ A;  1QLE C;  5IJ9 B;  1AI4 A;  3OFN G;  3D36 A;  4WFB V;  4PEL A;  4EKW A;  2L6L A;  1V55 B;  2FB5 A;  4JV5 B;  1SZX A;  4FVM A;  1NTM H;  2X6C A;  1BMF G;  4DUY B;  4GT1 A;  1UPG A;  1BL8 A;  1MZE A;  3LNN A;  1JFF A;  3APQ A;  4JYY A;  4DUZ B;  1B6Q A;  3RYC B;  1DGS A;  3SJB C;  5IJ9 A;  1IBL B;  5LMU O;  3NR7 A;  4UV8 A;  2HP8 A;  3ML0 A;  4JI7 O;  3K5N A;  4PJ0 Z;  1GAX A;  3IAY A;  4TQD A;  3M99 B;  1IUR A;  3ZN1 A;  3JAK B;  2YID A;  2K1E A;  3BA8 A;  2XAQ A;  4ZIB A;  3ZHV A;  1FPO A;  1F23 A;  4RAI A;  1EN5 A;  3TXS A;  4MVM A;  3W7S A;  1E1Q G;  4KL1 A;  4LH6 A;  1XRE A;  3ETG A;  3ABL B;  3KCX A;  5EIB D;  2EIM B;  2EZP A;  1ARO P;  2E5L O;  5L3C A;  5JJN B;  5EBL C;  1VAR A;  4X62 B;  1KMI Z;  1AI7 A;  5JWP A;  2DYS C;  4X8A A;  3GB7 C;  4LF5 O;  2AHZ A;  4FLX A;  3CCS V;  1KQS U;  4IYH A;  3SR2 C;  1GMG A;  3E22 B;  5JCO A;  4LCU C;  1MMM A;  2DYR B;  2UUA B;  4JPR A;  4DR7 B;  1VQ5 V;  2QE7 G;  2ZE5 A;  2BOC C;  3ABM B;  1XL4 A;  2Q7E A;  5GTI Z;  2YI9 A;  4DR2 O;  1HR0 O;  1Y67 A;  4MTX A;  5H9C A;  2UXX A;  3CMA V;  1R3J C;  4FFB A;  4KUM A;  4X89 A;  3OEE G;  1OCZ B;  3DXR B;  3DC5 A;  4YJ3 B;  5IDJ A;  5JJJ B;  2HLD G;  1M4U A;  4UCV A;  4D6T H;  3KG2 A;  1PD3 A;  1WN7 A;  2CTW A;  5IY5 C;  1KD1 W;  4JI5 O;  2Q7G A;  2VWJ A;  1VQM V;  2PTM A;  5KAI Z;  4H37 A;  4B3R B;  4DK1 A;  4FFB B;  3EFF K;  3TCU A;  1ZWI C;  4FZ0 A;  4OPA A;  5EYP A;  3SYO A;  1T5E A;  2HHH B;  4NKG B;  4X88 A;  3RBZ A;  1L8D A;  1VF6 A;  1VF7 A;  4IHJ B;  1ZX3 A;  5IYZ A;  1N8R W;  1XNQ O;  3B8N A;  2QWN B;  1XMO B;  2HHH O;  4FK5 C;  4JI3 B;  3OTO O;  1R73 A;  3CXC U;  3N27 A;  5KHG A;  1HNX O;  4LH7 A;  5J2U B;  4LF9 B;  4DV3 O;  4NR1 A;  2UUB B;  1ZL8 A;  1IVS A;  4LNU B;  5FNV B;  4CZZ A;  4I9Q A;  3GWO A;  2JS5 A;  3CHX A;  1RP3 B;  4NXM O;  5A2Q N;  1R3I C;  5L3B A;  3THO A;  4TV9 B;  1PM9 A;  3ZHT A;  2KG7 B;  1N0N A;  3CJH B;  3MHH C;  1S77 D;  1R6T A;  4UVA A;  2P4V A;  2QSA A;  2HKO A;  2F23 A;  5J2U A;  4K8X A;  2ZQM A;  2QWO B;  1HNZ O;  2F43 G;  3JD1 A;  3BCC H;  4LNU A;  5FNV A;  1N33 B;  2QJ1 A;  4PDV A;  1H8H G;  3FYE B;  4PD4 F;  2QWR B;  4UCR A;  5JJE B;  1YI2 V;  1GKF A;  1R6K A;  3OGI B;  1I0H A;  2HVK C;  2A7W A;  2WLL A;  5H6R A;  3OW2 U;  4O2A B;  2DWE C;  3L72 H;  3PN1 A;  4AI8 A;  4PI2 A;  1OJH A;  5L3G A;  4BW5 A;  2Y69 C;  3LSU A;  1Y4M A;  2XAF A;  3SYC A;  1FXK A;  4LWS A;  2FKX A;  2PF4 E;  1P49 A;  1VF5 B;  2XAG A;  1YJW V;  1Q8I A;  4DW0 A;  1BSM A;  2WLI A;  3E35 A;  1GN6 A;  3QF7 A;  5CA0 B;  1G8M A;  4E2L A;  3ZRS A;  4JI3 O;  4X64 O;  2YI8 A;  1JMK C;  3C3T A;  5B1A B;  3NXS A;  3OAA G;  4I55 B;  2UXD O;  4HNA A;  1S5L Z;  5LP6 C;  4JI0 O;  4TWK A;  4DV2 B;  4ZI7 A;  1WP7 A;  3ETD A;  5JQG B;  2DWD C;  4DV4 B;  2B5U A;  3QG5 A;  1KKC A;  4MW3 A;  4DV4 O;  1FXK B;  4GZR B;  5BMV A;  2A3Q A;  1Z5V A;  4X1Y B;  1OCZ C;  3LSQ A;  3UKM A;  3OR7 C;  4EFE A;  4BIZ A;  4RUF A;  4QE7 A;  1PNL A;  1AI6 A;  3E83 A;  1IBM O;  1IBM B;  4BR6 A;  4B3M B;  3ABL C;  5KAF Z;  4NTY A;  1MNG A;  3I56 V;  5IY5 B;  1MG1 A;  3OMI B;  4JAV A;  1P7G A;  3ZRV A;  4CC5 A;  4DR5 O;  3AK3 A;  1K4D C;  4J9Z B;  4DV1 B;  2XTA A;  1HP8 A;  3IJ4 A;  4DUY O;  5IYC O;  4JI6 O;  1RPR A;  4JI8 B;  4LFB O;  3UT5 B;  1XNR B;  3KKY A;  3ASO B;  3LUT B;  3SPG A;  2Q4P A;  3QO8 A;  1Q6H A;  4XDJ A;  1YIJ V;  3EVK A;  3F7V C;  3FB7 C;  2F4V O;  3K0D A;  3K5O A;  1SQG A;  3K9A A;  3J80 N;  1GM7 A;  1JX9 A;  4X66 B;  4PA7 A;  4O4J B;  4H13 B;  1MOF A;  1TAE A;  3OT7 A;  4J11 A;  5ITZ A;  2N04 A;  1TA8 A;  1N33 O;  4WBN A;  1MSW D;  3Q4H B;  3RYF A;  2QM4 A;  5L3E A;  3SPI A;  4CS2 A;  2VQF O;  1SET A;  2Y0I A;  2YEV B;  4TSF G;  1XHX A;  3C3S A;  4CH5 A;  1D5N A;  5FL7 G;  3B40 A;  2XND G;  3CSX A;  2P67 A;  4UCO A;  4AQY O;  3M8A A;  3AG1 B;  4O4J A;  1Q82 W;  3ABU A;  2CE4 A;  5IE9 A;  5LP6 A;  4GUN A;  3E22 A;  3I5D A;  2OCH A;  5CBG A;  1AI5 A;  4WBN B;  1AIL A;  2PI4 A;  2JEU A;  1Q6U A;  3CRR A;  3Q4H A;  3ZIA G;  4WCE V;  4LF9 O;  3CCE V;  1DF5 A;  4EB6 B;  3RYF B;  3CRM A;  2GUZ A;  4MTO A;  1VP7 A;  5J9P C;  1V9P A;  2X7R B;  3A0H Z;  2HVJ C;  5KX5 B;  5CN0 A;  2PY5 A;  1EN6 A;  4TQF A;  4JI4 O;  4DYL A;  1V55 C;  2UXC O;  3I55 V;  3OUF A;  5BR8 B;  1K33 A;  4U3J A;  1M56 B;  1Y74 B;  4WFH A;  4GCZ A;  3ASN C;  5BXZ A;  4X66 O;  3APO A;  2YIA A;  4LF4 O;  5F2V O;  3FX7 A;  5HFL A;  3PJS K;  4YY3 B;  4J41 A;  4EB6 A;  2QWQ B;  2GUZ B;  4RO2 A;  3N2G B;  2E5L B;  2AGA A;  1NVP B;  2E75 B;  3CC2 V;  5KX5 A;  5B1B B; 
#chains in the Genus database with same CATH homology
 4DV6 O;  2LW7 A;  3F5T A;  4DUZ O;  2JRI A;  3J7A U;  4LF8 O;  4LFA O;  4JI8 O;  4YHH O;  4B3M O;  2F4V O;  4JI2 O;  1XEQ A;  4GKK O;  1R1B A;  3J80 N;  5FLX N;  4DR3 O;  3SDL A;  4DR1 O;  1NS1 A;  4LF7 O;  3J81 N;  5IWA O;  4DV7 O;  5LMU O;  1N33 O;  4DV5 O;  1XMO O;  4OX9 O;  4JI5 O;  4JI7 O;  1N34 O;  1FKA O;  4YY3 O;  2Z0A A;  1N36 O;  2FKX A;  1XMQ O;  2VQF O;  2UUC O;  4A5U B;  1KUQ A;  1DK1 A;  2UXB O;  2ZKO A;  2UUB O;  4DR6 O;  1D2D A;  1G1X B;  4OPA A;  1XNR O;  4AQY O;  4JI3 O;  3M8A A;  4X64 O;  4K0K O;  1HNW O;  4X65 O;  3O65 A;  2UUA O;  2UXD O;  3T1Y O;  4OPH A;  1XNQ O;  4JI1 O;  4JI0 O;  2HHH O;  3OTO O;  1AIL A;  4B3S O;  1HNX O;  5BR8 O;  4DV1 O;  4DV3 O;  4DV4 O;  4LF9 O;  2ZM6 O;  1N32 O;  4LFC O;  5LMN O;  4DV0 O;  2DJV A;  4DV2 O;  5H5N A;  1YZB A;  2E5L O;  4DR4 O;  1F7Y A;  1J5E O;  4X62 O;  2N74 A;  4JYA O;  4NXM O;  5BY1 A;  1IBM O;  2UU9 O;  4B3R O;  3JAM N;  5A2Q N;  4DR7 O;  1X59 A;  1FJG O;  4LF5 O;  1A32 A;  4JI4 O;  4GKJ O;  2UXC O;  4DR5 O;  1FYJ A;  5IT9 N;  1R6T A;  3T1H O;  5BXZ A;  4X66 O;  4KHP O;  4DUY O;  4JI6 O;  3RT3 C;  4LF4 O;  3R66 A;  4LF6 O;  4NXN O;  1HNZ O;  2DOS A;  2VQE O;  4LFB O;  5LL6 Y;  4JV5 O;  4B3T O;  2AGA A;  1IBK O;  1IBL O;  1AB3 A;  4DR2 O;  1I94 O;  1HR0 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...