4DUZO

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c, bound with streptomycin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
87
structure length
87
Chain Sequence
b'PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 31
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4duzO00
4LF5O 1HR0O 5BR8O 2AGAA 4DUZO 4DV3O 2F4VO 4LF9O 4DR6O 3J81N 1N36O 4NXMO 2VQEO 5BY1A 4JV5O 1XMQO 4JI1O 4NXNO 4DV1O 2N74A 3SDLA 4LFAO 4DR1O 4X62O 4LFCO 2ZKOA 1YZBA 4JI7O 4DV7O 3O65A 4AQYO 4OPAA 1IBKO 1X59A 1AB3A 4DUYO 2Z0AA 2UXCO 2LW7A 4JI2O 1I94O 2UUAO 2VQFO 4JI5O 4OX9O 1F7YA 3J7AU 4OPHA 5LMUO 4B3RO 1J5EO 1XNQO 2E5LO 3T1YO 4GKJO 1A32A 1XEQA 2UUBO 1FYJA 4JYAO 4DV2O 5H5NA 4LF6O 1IBLO 1R6TA 3F5TA 2UU9O 4GKKO 1HNWO 4YHHO 4X66O 4DV0O 4B3SO 1AILA 4A5UB 1KUQA 4DR4O 2DOSA 3RT3C 1HNXO 1HNZO 5LL6Y 2HHHO 1XMOO 2DJVA 4X65O 4JI6O 4DV6O 4X64O 5BXZA 4YY3O 5IWAO 4JI8O 4LF8O 3R66A 1XNRO 5A2QN 4B3MO 3OTOO 4JI0O 4DR3O 4KHPO 5LMNO 4DR2O 3T1HO 4LF7O 1NS1A 4K0KO 4LF4O 1N33O 1D2DA 2UUCO 1FJGO 5IT9N 4DV5O 2FKXA 4JI4O 1IBMO 2ZM6O 2UXDO 4B3TO 1FKAO 1G1XB 3J80N 1R1BA 4DR7O 1DK1A 5FLXN 1N34O 1N32O 4JI3O 4DR5O 4LFBO 2UXBO 2JRIA 3M8AA 3JAMN 4DV4O
chains in the Genus database with same CATH superfamily
3K3WA 2B9ZA 4DUZO 1QHTA 1VQ9V 4QNHB 4YY3B 3G4SV 2JS5A 3TJTA 3SJQC 2WLKA 1V55B 1LUVA 4LCUC 4Z2WA 2ZQMA 3JAKA 1XBLA 2X0LA 5IYZB 1OCZC 3BEHA 1YZBA 4DK0A 2QKAA 4ZKIA 2IJJA 4EFEA 4OPAA 4LF4B 3WB2A 1X59A 3DC6A 4J9ZB 1QU7A 2FMLA 4LWSA 2B1GA 2QWNB 2ZXWC 4FMTA 1DLBA 4FK5C 4NXNB 1G6UA 4IIJB 2XOKG 1JMKC 2RNBA 3ZMZA 4JTAB 1NT2B 3U10A 4I50B 1US6A 4TT3G 2P4VA 3ABKC 5H5NA 1GKFA 1IBLO 2OCHA 4QIWF 5EIBC 5LGNA 4ZOLB 1V54B 1S72V 5DEDA 4MT8A 1AJQA 1SZXA 3E86A 1YHQV 3HKDB 1XOUA 4FLTA 4JI8O 3W7UA 1H2LA 1M90W 3D36A 4UCTA 1M5IA 1R3IC 1EN6A 1I0HA 2ETNA 1SERA 2MW2B 1SQXH 2VWKA 3HR0A 3QG5A 1WNSA 5LMNO 1WLEA 4O4IA 4MVZA 3Q4HB 4GX2A 1RSOA 3HKCA 2NNUA 2HG5C 3R65A 5JH7A 2ITDC 1MSWD 2O57A 3C3SA 3AK1A 2CTQA 5IYCO 1IBLB 3FB5C 4X1KB 1L8DA 2OCCC 3RYHA 3H1HH 2D2CB 2P06A 1KMIZ 1JJOA 2Q4PA 1SETA 4JI8B 4TUYA 1JCHA 1THZA 2R70A 3CMAV 2A06H 2GTAA 1BSMA 4LWSB 4NXMO 2UXBB 5BY1A 3BFRA 3OM3B 3EVKA 2LO1A 2ZKOA 5LMNB 4UB6Z 3VQXA 3ZMTA 4R8CA 1YJ9V 2RJZA 1P7BA 3ZS8C 3KKYA 4KXRA 4J7JA 2XAFA 1JVMA 1GTOA 4FZ1A 5HFLA 5A9GA 1KKCA 4PHZA 4JYBA 4MSWC 5KAFZ 2LW7A 3B8NA 2DYSC 3IC9A 1EZVH 2EULA 1GN3A 3CC7V 1AJNA 2HVJC 4JYYA 5LHGA 1Q82W 1H2GA 4LH7A 1FS0G 3FB8C 1RPRA 1VMGA 3LSSA 3ABMB 3G6BA 3SJCC 1VQKV 2YSUB 4NB5A 3QF7A 2DN9A 1XI1A 1XHZA 3K5LA 2W6JG 3O9OA 3C90A 1ZL8A 2HHHO 2WLIA 2HLDG 3K03A 4NXMB 2E75B 1K3EA 1WJZA 2CTPA 4JTCB 3SR2C 2QJ1A 1RSOB 3HKCB 3CE2A 5D5PA 2KSDA 1E1QG 3CPWU 5ITZA 5JJNB 3ABTA 5KX5A 4RQFA 2JGUA 1M4UA 1NZ6A 1IURA 3JD3A 2L6LA 4NKGB 3B77A 2ZR2A 2LQTA 3SPJA 3RBZA 4K0KO 4R7CA 5LP6C 1S5HC 3RYHB 1I5XA 2QTOA 1L0NH 4AHCA 4FLWA 3G80A 4H33A 2OTLV 2ODMA 2WLMA 3LSQA 4DR5O 2KKWA 3N2GB 1NI8A 5LXTA 4YJ2A 4AI8A 2HHHB 2QM4A 5BR8O 4WBNA 4H37A 4HAMA 4F6RA 4K35A 1K5QA 3ZMVA 4K8ZA 3IJ4A 4UUJC 2OT5A 2IJKA 2X6AA 3W7XA 4PJ0Z 3CWBH 2NLJC 3THOA 5EK0A 2DWEC 4DV7O 2P6JA 3BY6A 3ZX6A 5C8YB 4PDVA 3RWRD 3SPGA 4CS2A 5B1NA 1I94O 4JI5O 2EIMB 2KG7A 2R9IA 2QSAA 1ZL8B 4DR5B 2WLIB 4B3RO 1V54C 1BS3A 1WPBA 3WG7B 2F95B 1VQ6V 1UPGA 2IJIA 1QQCA 2WAMA 4YHHO 3PJSK 5ITZB 2IW5A 3STZC 2ZT9B 4U7NA 1HNXO 1J5EB 3S3WA 5CN0A 3UT5A 4LF8O 3ZMUA 1G8MA 3R66A 5A2QN 3U11A 2HEPA 2PY5A 3ZHVA 2DW4A 3WB0A 3AG4C 1I94B 1NS1A 2A7WA 3FAVA 1KD1W 4JI5B 2ADPA 3B8MA 5LXTB 3OEEG 4YJ2B 1PM9A 1QCEA 2ZM6O 1SKVA 3AG3B 4B3RB 4WBNB 4U7OA 3J80N 5LHHA 1Q6IA 1SQBH 2Z5UA 3ZHSA 1E1RG 1QVFU 4GUNA 4LFBO 1URFA 3ZCCA 5LBQA 3M8AA 5LA6A 4YHHB 4NYKA 2K9PA 1HNXB 4JGSA 2YUAA 2ZNIA 1S3JA 1RP3B 1N34B 4LF8B 2L35A 2ZE7A 3DTUB 2OIGA 1SF9A 4JV5O 2BSKB 2CE4A 5L3FA 1LUWA 2N74A 5EYPA 4PI2A 3H1KH 2CTRA 1AVMA 1VF6C 2Z0AA 5GW7A 3QO5A 4BW5A 2ZM6B 2AZ2A 2JK5C 2XASA 2UUAO 3D36C 3G67A 4KUMA 4PD4F 5IY5C 3OAAG 4WFGA 4LFBB 3CX5F 1VQ7V 1BQ0A 3E8BA 1TVKB 1ZTEA 4ICGA 4PA6A 2UUBO 2H8PC 3UT5B 1LR1A 4DV2O 4LF6O 2FB5A 4UVCA 1E79G 2IBZH 1HNWO 1TGOA 4DV0O 1EZJA 4WFBV 5B66Z 4HNAA 5DM6V 2Q7GA 4LNUA 4QPKA 3CCMV 3VBBA 1HNZO 3RGBA 2GHYA 4UVBA 4JV5B 4O2AA 1WAZA 1OCZB 3FAVB 4MVOA 4X1IB 5EZYA 3FB6C 2VRZA 4H44B 2YI9A 3ZJZA 3RYFA 2LW1A 5IJ0A 4K8XA 3KCYA 4JI6B 1BHBA 2UUAB 5LA6B 1D2DA 4MVSA 4LC1A 2G38A 1IBMO 1L1FA 4B3MB 5LYJB 1HDJA 1VEWA 2OIEA 4DV2B 4WCEV 1YF2A 2UXNA 4LF6B 1VF7A 2JRIA 1HNWB 3QNEA 4DV0B 3JAMN 1H38A 1YIJV 1EBOA 2CAZC 1HNZB 5EYPB 3SPIA 3AK3A 1ZX3A 2XT9A 1Y67A 1Q6HA 2WLJA 3OFNG 3K79A 3ZRWA 2QKCA 1R6NA 5JJEB 1M56C 4FLYA 3D8CA 4O2BB 4OXSA 2AW9A 4LFAO 1JFFA 3P30A 2EBOA 4H0LB 4P9OA 1XQ8A 3OTFA 2LGQA 1FPOA 3B2EE 1NTZH 4Q20A 3ZN0A 3MHSC 1IBMB 2ZIOA 3WG7C 4B08A 1KQSU 3SYAA 1K5SA 4O2AB 3S3XA 3N2KB 2H3OA 4GT1A 5AG2A 3T1YO 4FM1A 1PNLA 5CB4A 2UU9O 3MHHC 2P67A 1AR4A 4FJCC 2LP7A 2RDCA 3RYFB 4EEQA 2DJVA 5GTHZ 1R3JC 4NVPA 3ABUA 1R3KC 1NTKH 4LFAB 4UCVA 5IWAO 1NTMH 1S0VA 3JATA 2Y4TA 2QEXV 4PELA 2EIKB 5KUMA 4IYHA 4O4LA 4CH5A 3H1JH 1FFTB 1JJ2U 1BHAA 1WA8A 2YDEA 3X2QB 1Z5WA 2JIZG 1QLEC 1BZKA 2UUCO 5JQGB 4FFBA 1B6QA 2UXDO 4QE9A 3FX7A 2Q7HA 5CA0B 3OW2U 4MW3A 1NQTA 3T1YB 3TK1A 1IVSA 2PF4E 2JEUA 2UU9B 2WA3A 4JPRA 4QJFB 2B1IA 2BOCC 3W7WA 1OCCB 5CA1A 3LDDA 2N04A 3A0RA 5IWAB 3CC4V 1VIBA 2IU3A 1PPJH 3RW0A 3E8GA 5HFMA 4NXNO 1K97A 1YXBA 2FL4A 3H01A 3CCLV 1W0JG 5L3BA 5H6QA 4BIUA 4YXWG 4AQYO 1QR8A 2UUCB 3DXRB 2UXDB 2RQ6A 1BGYH 1SQPH 2C2AA 3BAAA 4OX9O 3LNNA 3SGIA 1EN5A 3UO3A 4H13B 3SYQA 4Z1MG 2A79B 1XEQA 5KUKA 3ETEA 1M93A 4CH3A 3JATB 5J2TA 4TV8A 2JJ1G 2FTKA 5H6RA 4DR4O 3DSQA 2YEVB 1WA8B 4I55B 4JAUA 4MVUA 4KP4A 1Y76B 3E8FA 4RQEA 1HW7A 1YJNV 1XNRO 4AQYB 1BT8A 5JVDA 4W4LA 3T1HO 3CSXA 4OX9B 5CBFA 5IT9N 1VF6A 4J9YB 1WB7A 1D5AA 1ZUQA 3OD4A 4D7SA 2UXBO 4LF7B 4DR4B 2AXTZ 2QE7G 3K5NA 1LNQA 5E1AC 1DF4A 3PN1A 4D6TH 3CYOA 1SZTA 1IXBA 1XNRB 3FKSG 2Q68A 4WFAV 4G28B 1U97A 1PNKA 2F66C 1Q5OA 1ZSPA 2PYLA 5CA3A 4X20A 1H2MA 3AG4B 5KA6A 3T1HB 5K1XA 4PA3A 1IBKO 4LF9B 3CS5A 3JAKB 2ZDIC 4RWUA 2UXXA 3DC5A 1AP5A 2QKSA 2XAJA 3MD0A 4CS4A 5J2TB 4TV8B 2IH1C 3ICXA 3QO8A 4P9PA 1W2BU 4FIPC 3ZRXA 4OPHA 1PL4A 3K04A 2GUZA 2CTWA 3RN4A 3ZIAG 4NTYA 4WFHA 1K33A 3WU2Z 1F4MA 4X1YA 2EIKC 5EC1C 1NKDA 5JVDB 1CPYA 4JAAA 2V1DA 4AILC 3JSNA 1H2KA 4FVMA 1SQGA 1JA8A 3GB7C 3X2QC 2PUSA 3ZHQA 3HPLC 3H9VA 4X9QA 5J2UA 1B3QA 1IBKB 3JALA 5LOVA 4DO2A 2Z3YA 2P4KA 4UCOA 2ILMA 3ZHTA 3VQWA 3ETGA 1PP9H 2W0FC 5IY5B 1FJGO 1IX9A 4P30A 1G1XB 1M9NA 4IT5A 1FKAO 4O4IB 1Z2GA 3ML0A 1OCCC 5JH7B 1P4RA 3OUFA 4GX0A 3K58A 3JD1A 5LGTA 1VQPV 2EINC 3L71H 2X6BA 1YTFD 3NXSA 4X20B 2BE3A 2M6YA 1GM8A 2QWRB 4J7KA 2JGDA 2EIJC 3W7SA 2W0XA 4DYLA 5CBHA 2EILB 4JI1O 4UXNA 1AI7A 3JYCA 4TUYB 3TCUA 4D7TA 1K7DA 2Q6AA 4LF5B 4DRXA 1SQFA 1ORQC 2GUZB 3O65A 2YI8A 2ZD9A 1YTFB 1FJGB 1QNMA 3ABLB 1B06A 1AP6A 4CZZA 3APQA 1N36B 3ASNB 3L75H 4JI2O 2JVDA 5B1BB 3CCQV 1RM1C 1VQOV 1N0JA 1J5EO 3OGCC 4EB6A 1R73A 1AR1B 4R50A 3ZHRA 4JYCA 1Q3EA 2UXCO 4XBFA 1AILA 3BA9A 3JASA 5LOVB 3E35A 1F51A 1M56B 4TWKA 5LMUB 1L0LH 4JI1B 3TXQA 3FD9A 4CC6A 4IYIA 1SRYA 4IHJA 5EBWC 3EFFK 1COWG 3E89A 1R6KA 1EFRG 5IJ9A 4JI0O 1H8EG 1XL6A 1YITV 4JI2B 4JZGA 1EM1A 5KX5B 1MABG 4DV5O 3K9AA 5JWPA 4UV9A 4PDRA 1K9MW 2RMKB 1N34O 2JGDB 3A0HZ 4TV9A 2X7RB 4CC5A 3CRMA 2LJ2A 4BW9A 2UXCB 5F2VO 2XUMA 1FFXA 4WF9V 3ETQA 4MW8A 4DRXB 2F4VO 1QR9A 2ZINA 1WPXA 4RAIA 1S76D 2PYJA 3E8HA 1GH6A 1AI6A 4F6RB 1PNMA 2QWOB 5L3DA 2YXHA 4JI0B 1QLEB 1Y74A 1R3LC 2CUGA 4RO2A 4LP8A 4DV5B 1GM7A 3VOUA 4UCSA 4JAVA 3JD0A 2VQFO 2QWPB 3JASB 2QM8A 4DR1B 3E83A 5B1AC 4XDLA 1XNQO 1GN6A 1DF5A 2KG7B 5GONA 3I55V 3F7VC 1M57B 1TUEB 3FB7C 4FFKA 4MTOA 2F4VB 3RYIA 4B7KA 2BOBC 4FZ0A 2HJDA 2ZE8A 1Y66A 1AI5A 4JI6O 3KG2A 1PV0A 5DECA 3ZN1A 3APOA 4YIPA 1OV9A 4B3MO 1N4CA 1O9GA 2MK3A 1GAXA 5BMVA 3K5OA 2VQFB 4TOIA 2WSSG 1SQVH 2XAHA 1NH2D 3ASOB 3P32A 1U96A 1JPXA 5EBMC 2ZDIA 1MOFA 3CRAA 3CP1A 1XNQB 4DR7O 3CRCA 3OUSA 2HVKC 4UFZA 3OMAB 5KMGA 3L74H 5H9CA 2YICA 1DTOA 3UM7A 2EILC 4DV4O 1AI4A 2N05A 2Y69B 3KZIZ 3FYEB 1IXMA 5CMUA 1OCRC 1YCIA 4U3JA 4KFMA 3ABLC 3ASNC 4DV1O 2QWQB 3B09A 1SC5B 5B1BC 3SYCA 3CXHF 4J10A 5L3CA 4I7ZB 1K73W 3UCSC 5GONB 3K08A 4DR7B 1H2SB 1P7GA 4DV4B 5JJJB 1D5NA 4I0XA 5KHJA 3H1LH 1VQ4V 2BCCH 4GKKO 5B3SC 1KUQA 5IYDO 2NN4A 5LL6Y 1TA8A 5BMVB 2LGWA 2W6IG 4DV1B 4GKJB 4HNAB 1V9PA 4LNUB 4FLVA 1YJWV 4NTWA 2RCVA 5FNVA 2OWOA 1XUQA 1NBMG 4MTXA 5EZYB 4GZRB 4WFFA 5KMGB 1VQMV 4FLXA 2Q0OC 1O9HA 2V7QG 4EKWA 3MDSA 5IJ0B 1VQ8V 1P84F 2R72A 1ZLZA 3ZRSA 1DK1A 3AG1C 3LDEA 5IYBO 1Q43A 1N32O 1HP8A 2XNDG 3AEIA 4GKKB 2CGNA 1H2NA 1KC8W 2F93B 1Y6XA 2YS8A 3K5MA 3K9SA 3L73H 4TQFA 2FYUH 4DR6O 3J81N 3JD2A 4BIOA 2HJFC 3CJHA 3RYCA 2A3QA 5EC2C 1Q7YW 1UJWB 1KECA 2YIBA 3ZRWB 2Q8VA 2X6CA 3UQ8A 1AB3A 1WP8A 1MZFA 2JDIG 2M7WA 1JFFB 3CCEV 4I0XB 3BVOA 1M57C 4I50A 2CK3G 3U0ZA 2EINB 1N32B 1Q6UA 1K92A 2Y4UA 4B7EA 2E5LO 2E3CA 2WPDG 4ZOLA 3C3TA 1TAEA 2KQXA 3CRQA 4JYAO 3D3QA 2HKOA 1R6TA 3HKBA 2EIJB 4JASA 4A5UB 4WFEA 4NTXA 4DR6B 2JJ2G 5CB4B 1PL0A 4BR6A 4X65O 2ADQB 3QTCA 4JTDB 3ASOC 3T1CA 2Q9LA 1WB8A 2EJRA 2ITCC 1K4DC 3A8TA 2QR4A 2YIBD 4PA9A 1BMFG 4ZIBA 4LF7O 1RM1B 4O4LB 3M99B 4I5SA 3B4SA 4RUFA 1NR1A 1IDSA 3WB1A 2DYRB 3L9DA 4JI4O 4X8AA 4DXWA 3AG7A 2Y69C 4I9WA 1R1BA 2YXYA 4XDJA 2E5LB 2LFSA 5E79Z 4X1KA 5FLXN 3OGIB 4JYAB 4FFBB 4GCZA 2AHZA 4DR2B 1H8HG 3CD6V 4DW0A 4IL6Z 3F7YC 2WWWA 5GTIZ 3CJHB 3OT7A 3TXSA 3RYCB 4FLUA 1I08A 2P22C 1Q8IA 4N21A 1ZWIC 1HR0O 3QO7A 4PDMA 4YJ3A 4L8JA 4BAYA 4X65B 3JSLA 3ETDA 4LF9O 4GX1A 2Q5ZA 2AHYA 3JARA 1WN7A 4L87A 2DQ0A 4XDKA 5CA1B 1MNGA 3OMNB 1HWYA 2Y48A 1S5JA 2GTSA 2VS0A 3WFVA 4DUZB 2EX3A 3AG2C 2ZE5A 3K59A 3LNMB 1KKDA 4K3AA 4PDLA 5KHGA 1AROP 2ZIMA 1W59A 4E4EA 4JI4B 3FYIB 1DGSA 2OYQA 3HKBB 3GVMA 1F7YA 3CXCU 2OTJV 4FLZA 1HR0B 1VARA 3F5TA 1KP3A 3F5WC 2WLLA 5B1OA 4DW1A 4DV6O 3IC7A 2YXLA 2QDOA 3D3IA 3CCJV 3N27A 2XAGA 1AR5A 1M1KW 1Q81W 5BZBA 2IH3C 4I4TA 2JS3A 2F1MA 3ZMSA 2Y0PA 5JCOC 4MTGA 1N8RW 5DN6G 5B1AB 2R9AA 4YIOA 4MVQA 4QPJA 4B3TO 4YJ3B 3N2GA 4GLXA 3I5DA 2DMXA 3JARB 4R6ZA 2P5OA 1YVWA 4C7UA 1Y4MA 3EHBB 2ATKC 1F4NA 1TUBA 2GBOA 1QBZA 4G2KA 1MMMA 4LF5O 2F23A 1UFIA 2Q73A 3SJBC 4DV6B 3P3NA 4Q6GA 5KAIZ 1GN2A 1GN4A 2ZE6A 1JR9A 2Y0IA 1N36O 4EFBA 5B5EZ 2R9RB 4NR1A 3E22A 3B40A 5C8YA 4TSFG 2A9HA 3CC2V 3LSUA 4PI0A 2Q69A 1J95A 3G6EV 1XREA 1QLNA 4B3TB 3GWKC 3UKMA 1VQ5V 1FXKC 1YEWA 3LUTB 2WLNA 4UB8Z 3LDCA 3J7AU 1FXHA 5LMUO 3JD4A 3T2MA 2QTSA 1PKXA 3OEHG 2WLLB 4ZBMA 4J11A 2AZ0A 2PGGA 4F6EA 5K1PA 3MAQA 1OCRB 1B04A 4B3SO 1BL8A 2DOSA 4Z1VA 4I4TB 1XMOO 3OR6C 4X1YB 3W7TA 4QE7A 2Q0AA 3K0DA 2CDYA 3L72H 2DYRC 1V55C 3L70H 2QM7A 1OZ0A 1I7FA 4UV8A 2YIAA 1K4CC 5J2UB 3HKEA 3NR7A 3SPCA 4BIZA 3JALB 4GX5A 1TUBB 2QGNA 1Q86W 5IE9A 1SS3A 3CRRA 2JEXA 4O4JA 1CEZA 2E74B 2Q67A 4X88A 3BCCH 3P3PA 5B3SB 1W0KG 4ASUG 4UCUA 4B3SB 4K0KB 1XILA 4ZI7A 3E22B 3T4ZA 1OHHG 3H1IH 3OE7G 3G71V 2VWJA 3CEIA 1XMOB 2AGAA 1OCOB 1JX9A 2Q7EA 2BSKA 4PA7A 1EN4A 4O4HA 3A0BZ 2DWDC 4QGPA 4MVMA 1XMQO 2WA4A 4LH6A 1VQNV 3SDLA 2PI4A 4DR1O 3CB2A 1WP7A 5KHHA 4BWAA 5IDJA 5BR8B 4MVRA 4LR3A 4JI7O 3UO2A 1F23A 4X89A 1FD9A 4CH4A 3AG1B 2YC0A 1NR7A 3SYOA 3OR7C 1TVKA 4ZHQA 2GSMB 5LHIA 2NR5A 4I9QA 3ZBHA 1GO3F 5KA5A 1GRJA 4HZ3A 4DV7B 1MA1A 5L3EA 2B5UA 2P7TC 2BTOA 4EB6B 4X1IA 2PZSA 1XMQB 3ZRVA 3HKEB 1GM9A 1VF5B 2EJ7A 2ZR3A 4JI7B 2P90A 4O4JB 4PA4A 2LFRA 3M7MX 4DR3O 4KHPO 4IHJB 2GDSA 3JCZA 4GYCB 1N33O 4F4LA 5LYJA 1XL4A 5IJ9B 4ZI7B 4J41A 1XHXA 1KP2A 4O4HB 4UCRA 3HB3B 3K0GA 4JI3O 3KCXA 2IJHA 3CCRV 1SA0A 4LBEC 4FM2A 3ZEDA 5FPRA 1SQQH 4CH6A 3BPZA 4TV9B 4IGGA 3K57A 2ZNJA 3ABMC 1I5YA 4O2BA 1XDCA 1NVPD 1FFXB 2HFEC 4KL1A 2ZCEA 4OGQB 4MTFA 3CCSV 3JAWA 2IM9A 2VQEO 1OJHA 3TGUH 3VQVA 4ZHQB 1KU9A 4DR3B 4KHPB 3CCVV 3QVNA 4MS2A 2H94A 4RUEA 3SPHA 1N33B 1GMGA 2IU0A 2YIDA 1RFYA 1BCCH 3SYPA 1KB9F 1RPOA 3OMIB 5JCOA 3N2KA 1K34A 5EBLC 1VQLV 1SESA 1NVPB 4DK1A 1NH2B 2PTMA 1Y74B 1ZAUA 3JCUZ 1CXZB 4JI3B 1KBHA 3GWOA 3AK2A 4PV1B 1KYOF 1PD3A 5EIBD 1P49A 4UVAA 5H2FZ 2ZXWB 4W4KA 4GKJO 1A32A 3IFXA 1YDXA 4N23A 4X66O 3I56V 1CP9A 4J80A 3RT3C 1YSCA 1ENVA 5L3GA 4FPPA 2VQEB 4J42A 5D5QA 5BXZA 3RYIB 4X64O 3ABKB 3T4DA 1NJIW 2PI5A 3AG2B 1FXVA 2QA4V 2UUBB 3CHXA 4JF3A 3BRCA 5JQGA 3OTOO 1QVGU 2HR3A 2EZOA 3EXAA 5CA0A 1AJPA 5KLVH 4CBCA 1JOYA 1SA0B 4P2ZA 4FM0A 3K06A 4TQDA 3STLC 1OCOC 2EZPA 1FXKA 3SJAC 2A0LA 2EIMC 2K1EA 2ARHA 5FPOA 1S5LZ 3JAWB 4X66B 4G27B 3VQYA 1NU1H 1S77D 1BQZA 3DGEA 2D3OW 1MSDA 4DV3O 2CH7A 5FL7G 4X64B 2BTQA 3RFRA 1X4TA 3RVYA 1VP7A 3BABA 4CS3A 5LP6A 1N0NA 2OCCB 1K8AW 3OTOB 4X62O 3DXRA 4LFCO 4U3JB 2CGOA 2XHBA 5KHIA 3BHPA 3IGAC 4DUYO 3ZHUA 1MZEA 3TETA 4E2LA 4HYOA 2F43G 1BE3H 5IYZA 3E2EA 5LGUA 3CCUV 4J7ZA 1GK9A 4HBNA 4JZ2A 3AG3C 1T5EA 2GV9A 1YI2V 1FYJA 2YEVA 1G4YB 2DYSB 4DV3B 3A2FA 4I55A 4IIJA 1Y76A 2HP8A 3IAYA 2E76B 1JQ0A 4YY3O 4X62B 2WLHA 4LFCB 3CMEV 5C93A 2RN9A 5KHKA 4DUYB 1Z5VA 1FXKB 3FFQA 4DR2O 2XTAA 1Q90D 3HKDA 4LF4O 5TISZ 5FNVB 2XAQA 3BA8A 2DE0X 2FKXA 5CBGA 1MG1A 2CH7B 2KB1A 2V4DA 4U3FH 1ROPA 5J9PC 2BTQB 1FAFA 1IZ3A 3RVZA 2DQ3A 3Q4HA 4ABMA 5LP6B
chains in the Genus database with same CATH topology
4LF5O 1HR0O 5BR8O 2AGAA 4DUZO 4DV3O 2F4VO 4LF9O 4DR6O 3J81N 1N36O 4NXMO 2VQEO 5BY1A 4JV5O 1XMQO 4JI1O 4NXNO 4DV1O 2N74A 3SDLA 4LFAO 4DR1O 4X62O 4LFCO 2ZKOA 1YZBA 4JI7O 4DV7O 3O65A 4AQYO 4OPAA 1IBKO 1X59A 1AB3A 4DUYO 2Z0AA 2UXCO 2LW7A 4JI2O 1I94O 2UUAO 2VQFO 4JI5O 4OX9O 1F7YA 3J7AU 4OPHA 5LMUO 4B3RO 1J5EO 1XNQO 2E5LO 3T1YO 4GKJO 1A32A 1XEQA 2UUBO 1FYJA 4JYAO 4DV2O 5H5NA 4LF6O 1IBLO 1R6TA 3F5TA 2UU9O 4GKKO 1HNWO 4YHHO 4X66O 4DV0O 4B3SO 1AILA 4A5UB 1KUQA 4DR4O 2DOSA 3RT3C 1HNXO 1HNZO 5LL6Y 2HHHO 1XMOO 2DJVA 4X65O 4JI6O 4DV6O 4X64O 5BXZA 4YY3O 5IWAO 4JI8O 4LF8O 3R66A 1XNRO 5A2QN 4B3MO 3OTOO 4JI0O 4DR3O 4KHPO 5LMNO 4DR2O 3T1HO 4LF7O 1NS1A 4K0KO 4LF4O 1N33O 1D2DA 2UUCO 1FJGO 5IT9N 4DV5O 2FKXA 4JI4O 1IBMO 2ZM6O 2UXDO 4B3TO 1FKAO 1G1XB 3J80N 1R1BA 4DR7O 1DK1A 5FLXN 1N34O 1N32O 4JI3O 4DR5O 4LFBO 2UXBO 2JRIA 3M8AA 3JAMN 4DV4O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF5 O;  1HR0 O;  5BR8 O;  2AGA A;  4DUZ O;  4DV3 O;  2F4V O;  4LF9 O;  4DR6 O;  3J81 N;  1N36 O;  4NXM O;  2VQE O;  5BY1 A;  4JV5 O;  1XMQ O;  4JI1 O;  4NXN O;  4DV1 O;  2N74 A;  3SDL A;  4LFA O;  4DR1 O;  4X62 O;  4LFC O;  2ZKO A;  1YZB A;  4JI7 O;  4DV7 O;  3O65 A;  4AQY O;  4OPA A;  1IBK O;  1X59 A;  1AB3 A;  4DUY O;  2Z0A A;  2UXC O;  2LW7 A;  4JI2 O;  1I94 O;  2UUA O;  2VQF O;  4JI5 O;  4OX9 O;  1F7Y A;  3J7A U;  4OPH A;  5LMU O;  4B3R O;  1J5E O;  1XNQ O;  2E5L O;  3T1Y O;  4GKJ O;  1A32 A;  1XEQ A;  2UUB O;  1FYJ A;  4JYA O;  4DV2 O;  5H5N A;  4LF6 O;  1IBL O;  1R6T A;  3F5T A;  2UU9 O;  4GKK O;  1HNW O;  4YHH O;  4X66 O;  4DV0 O;  4B3S O;  1AIL A;  4A5U B;  1KUQ A;  4DR4 O;  2DOS A;  3RT3 C;  1HNX O;  1HNZ O;  5LL6 Y;  2HHH O;  1XMO O;  2DJV A;  4X65 O;  4JI6 O;  4DV6 O;  4X64 O;  5BXZ A;  4YY3 O;  5IWA O;  4JI8 O;  4LF8 O;  3R66 A;  1XNR O;  5A2Q N;  4B3M O;  3OTO O;  4JI0 O;  4DR3 O;  4KHP O;  5LMN O;  4DR2 O;  3T1H O;  4LF7 O;  1NS1 A;  4K0K O;  4LF4 O;  1N33 O;  1D2D A;  2UUC O;  1FJG O;  5IT9 N;  4DV5 O;  2FKX A;  4JI4 O;  1IBM O;  2ZM6 O;  2UXD O;  4B3T O;  1FKA O;  1G1X B;  3J80 N;  1R1B A;  4DR7 O;  1DK1 A;  5FLX N;  1N34 O;  1N32 O;  4JI3 O;  4DR5 O;  4LFB O;  2UXB O;  2JRI A;  3M8A A;  3JAM N;  4DV4 O; 
#chains in the Genus database with same CATH topology
 3K3W A;  2B9Z A;  4DUZ O;  1QHT A;  1VQ9 V;  4QNH B;  4YY3 B;  3G4S V;  2JS5 A;  3TJT A;  3SJQ C;  2WLK A;  1V55 B;  1LUV A;  4LCU C;  4Z2W A;  2ZQM A;  3JAK A;  1XBL A;  2X0L A;  5IYZ B;  1OCZ C;  3BEH A;  1YZB A;  4DK0 A;  2QKA A;  4ZKI A;  2IJJ A;  4EFE A;  4OPA A;  4LF4 B;  3WB2 A;  1X59 A;  3DC6 A;  4J9Z B;  1QU7 A;  2FML A;  4LWS A;  2B1G A;  2QWN B;  2ZXW C;  4FMT A;  1DLB A;  4FK5 C;  4NXN B;  1G6U A;  4IIJ B;  2XOK G;  1JMK C;  2RNB A;  3ZMZ A;  4JTA B;  1NT2 B;  3U10 A;  4I50 B;  1US6 A;  4TT3 G;  2P4V A;  3ABK C;  5H5N A;  1GKF A;  1IBL O;  2OCH A;  4QIW F;  5EIB C;  5LGN A;  4ZOL B;  1V54 B;  1S72 V;  5DED A;  4MT8 A;  1AJQ A;  1SZX A;  3E86 A;  1YHQ V;  3HKD B;  1XOU A;  4FLT A;  4JI8 O;  3W7U A;  1H2L A;  1M90 W;  3D36 A;  4UCT A;  1M5I A;  1R3I C;  1EN6 A;  1I0H A;  2ETN A;  1SER A;  2MW2 B;  1SQX H;  2VWK A;  3HR0 A;  3QG5 A;  1WNS A;  5LMN O;  1WLE A;  4O4I A;  4MVZ A;  3Q4H B;  4GX2 A;  1RSO A;  3HKC A;  2NNU A;  2HG5 C;  3R65 A;  5JH7 A;  2ITD C;  1MSW D;  2O57 A;  3C3S A;  3AK1 A;  2CTQ A;  5IYC O;  1IBL B;  3FB5 C;  4X1K B;  1L8D A;  2OCC C;  3RYH A;  3H1H H;  2D2C B;  2P06 A;  1KMI Z;  1JJO A;  2Q4P A;  1SET A;  4JI8 B;  4TUY A;  1JCH A;  1THZ A;  2R70 A;  3CMA V;  2A06 H;  2GTA A;  1BSM A;  4LWS B;  4NXM O;  2UXB B;  5BY1 A;  3BFR A;  3OM3 B;  3EVK A;  2LO1 A;  2ZKO A;  5LMN B;  4UB6 Z;  3VQX A;  3ZMT A;  4R8C A;  1YJ9 V;  2RJZ A;  1P7B A;  3ZS8 C;  3KKY A;  4KXR A;  4J7J A;  2XAF A;  1JVM A;  1GTO A;  4FZ1 A;  5HFL A;  5A9G A;  1KKC A;  4PHZ A;  4JYB A;  4MSW C;  5KAF Z;  2LW7 A;  3B8N A;  2DYS C;  3IC9 A;  1EZV H;  2EUL A;  1GN3 A;  3CC7 V;  1AJN A;  2HVJ C;  4JYY A;  5LHG A;  1Q82 W;  1H2G A;  4LH7 A;  1FS0 G;  3FB8 C;  1RPR A;  1VMG A;  3LSS A;  3ABM B;  3G6B A;  3SJC C;  1VQK V;  2YSU B;  4NB5 A;  3QF7 A;  2DN9 A;  1XI1 A;  1XHZ A;  3K5L A;  2W6J G;  3O9O A;  3C90 A;  1ZL8 A;  2HHH O;  2WLI A;  2HLD G;  3K03 A;  4NXM B;  2E75 B;  1K3E A;  1WJZ A;  2CTP A;  4JTC B;  3SR2 C;  2QJ1 A;  1RSO B;  3HKC B;  3CE2 A;  5D5P A;  2KSD A;  1E1Q G;  3CPW U;  5ITZ A;  5JJN B;  3ABT A;  5KX5 A;  4RQF A;  2JGU A;  1M4U A;  1NZ6 A;  1IUR A;  3JD3 A;  2L6L A;  4NKG B;  3B77 A;  2ZR2 A;  2LQT A;  3SPJ A;  3RBZ A;  4K0K O;  4R7C A;  5LP6 C;  1S5H C;  3RYH B;  1I5X A;  2QTO A;  1L0N H;  4AHC A;  4FLW A;  3G80 A;  4H33 A;  2OTL V;  2ODM A;  2WLM A;  3LSQ A;  4DR5 O;  2KKW A;  3N2G B;  1NI8 A;  5LXT A;  4YJ2 A;  4AI8 A;  2HHH B;  2QM4 A;  5BR8 O;  4WBN A;  4H37 A;  4HAM A;  4F6R A;  4K35 A;  1K5Q A;  3ZMV A;  4K8Z A;  3IJ4 A;  4UUJ C;  2OT5 A;  2IJK A;  2X6A A;  3W7X A;  4PJ0 Z;  3CWB H;  2NLJ C;  3THO A;  5EK0 A;  2DWE C;  4DV7 O;  2P6J A;  3BY6 A;  3ZX6 A;  5C8Y B;  4PDV A;  3RWR D;  3SPG A;  4CS2 A;  5B1N A;  1I94 O;  4JI5 O;  2EIM B;  2KG7 A;  2R9I A;  2QSA A;  1ZL8 B;  4DR5 B;  2WLI B;  4B3R O;  1V54 C;  1BS3 A;  1WPB A;  3WG7 B;  2F95 B;  1VQ6 V;  1UPG A;  2IJI A;  1QQC A;  2WAM A;  4YHH O;  3PJS K;  5ITZ B;  2IW5 A;  3STZ C;  2ZT9 B;  4U7N A;  1HNX O;  1J5E B;  3S3W A;  5CN0 A;  3UT5 A;  4LF8 O;  3ZMU A;  1G8M A;  3R66 A;  5A2Q N;  3U11 A;  2HEP A;  2PY5 A;  3ZHV A;  2DW4 A;  3WB0 A;  3AG4 C;  1I94 B;  1NS1 A;  2A7W A;  3FAV A;  1KD1 W;  4JI5 B;  2ADP A;  3B8M A;  5LXT B;  3OEE G;  4YJ2 B;  1PM9 A;  1QCE A;  2ZM6 O;  1SKV A;  3AG3 B;  4B3R B;  4WBN B;  4U7O A;  3J80 N;  5LHH A;  1Q6I A;  1SQB H;  2Z5U A;  3ZHS A;  1E1R G;  1QVF U;  4GUN A;  4LFB O;  1URF A;  3ZCC A;  5LBQ A;  3M8A A;  5LA6 A;  4YHH B;  4NYK A;  2K9P A;  1HNX B;  4JGS A;  2YUA A;  2ZNI A;  1S3J A;  1RP3 B;  1N34 B;  4LF8 B;  2L35 A;  2ZE7 A;  3DTU B;  2OIG A;  1SF9 A;  4JV5 O;  2BSK B;  2CE4 A;  5L3F A;  1LUW A;  2N74 A;  5EYP A;  4PI2 A;  3H1K H;  2CTR A;  1AVM A;  1VF6 C;  2Z0A A;  5GW7 A;  3QO5 A;  4BW5 A;  2ZM6 B;  2AZ2 A;  2JK5 C;  2XAS A;  2UUA O;  3D36 C;  3G67 A;  4KUM A;  4PD4 F;  5IY5 C;  3OAA G;  4WFG A;  4LFB B;  3CX5 F;  1VQ7 V;  1BQ0 A;  3E8B A;  1TVK B;  1ZTE A;  4ICG A;  4PA6 A;  2UUB O;  2H8P C;  3UT5 B;  1LR1 A;  4DV2 O;  4LF6 O;  2FB5 A;  4UVC A;  1E79 G;  2IBZ H;  1HNW O;  1TGO A;  4DV0 O;  1EZJ A;  4WFB V;  5B66 Z;  4HNA A;  5DM6 V;  2Q7G A;  4LNU A;  4QPK A;  3CCM V;  3VBB A;  1HNZ O;  3RGB A;  2GHY A;  4UVB A;  4JV5 B;  4O2A A;  1WAZ A;  1OCZ B;  3FAV B;  4MVO A;  4X1I B;  5EZY A;  3FB6 C;  2VRZ A;  4H44 B;  2YI9 A;  3ZJZ A;  3RYF A;  2LW1 A;  5IJ0 A;  4K8X A;  3KCY A;  4JI6 B;  1BHB A;  2UUA B;  5LA6 B;  1D2D A;  4MVS A;  4LC1 A;  2G38 A;  1IBM O;  1L1F A;  4B3M B;  5LYJ B;  1HDJ A;  1VEW A;  2OIE A;  4DV2 B;  4WCE V;  1YF2 A;  2UXN A;  4LF6 B;  1VF7 A;  2JRI A;  1HNW B;  3QNE A;  4DV0 B;  3JAM N;  1H38 A;  1YIJ V;  1EBO A;  2CAZ C;  1HNZ B;  5EYP B;  3SPI A;  3AK3 A;  1ZX3 A;  2XT9 A;  1Y67 A;  1Q6H A;  2WLJ A;  3OFN G;  3K79 A;  3ZRW A;  2QKC A;  1R6N A;  5JJE B;  1M56 C;  4FLY A;  3D8C A;  4O2B B;  4OXS A;  2AW9 A;  4LFA O;  1JFF A;  3P30 A;  2EBO A;  4H0L B;  4P9O A;  1XQ8 A;  3OTF A;  2LGQ A;  1FPO A;  3B2E E;  1NTZ H;  4Q20 A;  3ZN0 A;  3MHS C;  1IBM B;  2ZIO A;  3WG7 C;  4B08 A;  1KQS U;  3SYA A;  1K5S A;  4O2A B;  3S3X A;  3N2K B;  2H3O A;  4GT1 A;  5AG2 A;  3T1Y O;  4FM1 A;  1PNL A;  5CB4 A;  2UU9 O;  3MHH C;  2P67 A;  1AR4 A;  4FJC C;  2LP7 A;  2RDC A;  3RYF B;  4EEQ A;  2DJV A;  5GTH Z;  1R3J C;  4NVP A;  3ABU A;  1R3K C;  1NTK H;  4LFA B;  4UCV A;  5IWA O;  1NTM H;  1S0V A;  3JAT A;  2Y4T A;  2QEX V;  4PEL A;  2EIK B;  5KUM A;  4IYH A;  4O4L A;  4CH5 A;  3H1J H;  1FFT B;  1JJ2 U;  1BHA A;  1WA8 A;  2YDE A;  3X2Q B;  1Z5W A;  2JIZ G;  1QLE C;  1BZK A;  2UUC O;  5JQG B;  4FFB A;  1B6Q A;  2UXD O;  4QE9 A;  3FX7 A;  2Q7H A;  5CA0 B;  3OW2 U;  4MW3 A;  1NQT A;  3T1Y B;  3TK1 A;  1IVS A;  2PF4 E;  2JEU A;  2UU9 B;  2WA3 A;  4JPR A;  4QJF B;  2B1I A;  2BOC C;  3W7W A;  1OCC B;  5CA1 A;  3LDD A;  2N04 A;  3A0R A;  5IWA B;  3CC4 V;  1VIB A;  2IU3 A;  1PPJ H;  3RW0 A;  3E8G A;  5HFM A;  4NXN O;  1K97 A;  1YXB A;  2FL4 A;  3H01 A;  3CCL V;  1W0J G;  5L3B A;  5H6Q A;  4BIU A;  4YXW G;  4AQY O;  1QR8 A;  2UUC B;  3DXR B;  2UXD B;  2RQ6 A;  1BGY H;  1SQP H;  2C2A A;  3BAA A;  4OX9 O;  3LNN A;  3SGI A;  1EN5 A;  3UO3 A;  4H13 B;  3SYQ A;  4Z1M G;  2A79 B;  1XEQ A;  5KUK A;  3ETE A;  1M93 A;  4CH3 A;  3JAT B;  5J2T A;  4TV8 A;  2JJ1 G;  2FTK A;  5H6R A;  4DR4 O;  3DSQ A;  2YEV B;  1WA8 B;  4I55 B;  4JAU A;  4MVU A;  4KP4 A;  1Y76 B;  3E8F A;  4RQE A;  1HW7 A;  1YJN V;  1XNR O;  4AQY B;  1BT8 A;  5JVD A;  4W4L A;  3T1H O;  3CSX A;  4OX9 B;  5CBF A;  5IT9 N;  1VF6 A;  4J9Y B;  1WB7 A;  1D5A A;  1ZUQ A;  3OD4 A;  4D7S A;  2UXB O;  4LF7 B;  4DR4 B;  2AXT Z;  2QE7 G;  3K5N A;  1LNQ A;  5E1A C;  1DF4 A;  3PN1 A;  4D6T H;  3CYO A;  1SZT A;  1IXB A;  1XNR B;  3FKS G;  2Q68 A;  4WFA V;  4G28 B;  1U97 A;  1PNK A;  2F66 C;  1Q5O A;  1ZSP A;  2PYL A;  5CA3 A;  4X20 A;  1H2M A;  3AG4 B;  5KA6 A;  3T1H B;  5K1X A;  4PA3 A;  1IBK O;  4LF9 B;  3CS5 A;  3JAK B;  2ZDI C;  4RWU A;  2UXX A;  3DC5 A;  1AP5 A;  2QKS A;  2XAJ A;  3MD0 A;  4CS4 A;  5J2T B;  4TV8 B;  2IH1 C;  3ICX A;  3QO8 A;  4P9P A;  1W2B U;  4FIP C;  3ZRX A;  4OPH A;  1PL4 A;  3K04 A;  2GUZ A;  2CTW A;  3RN4 A;  3ZIA G;  4NTY A;  4WFH A;  1K33 A;  3WU2 Z;  1F4M A;  4X1Y A;  2EIK C;  5EC1 C;  1NKD A;  5JVD B;  1CPY A;  4JAA A;  2V1D A;  4AIL C;  3JSN A;  1H2K A;  4FVM A;  1SQG A;  1JA8 A;  3GB7 C;  3X2Q C;  2PUS A;  3ZHQ A;  3HPL C;  3H9V A;  4X9Q A;  5J2U A;  1B3Q A;  1IBK B;  3JAL A;  5LOV A;  4DO2 A;  2Z3Y A;  2P4K A;  4UCO A;  2ILM A;  3ZHT A;  3VQW A;  3ETG A;  1PP9 H;  2W0F C;  5IY5 B;  1FJG O;  1IX9 A;  4P30 A;  1G1X B;  1M9N A;  4IT5 A;  1FKA O;  4O4I B;  1Z2G A;  3ML0 A;  1OCC C;  5JH7 B;  1P4R A;  3OUF A;  4GX0 A;  3K58 A;  3JD1 A;  5LGT A;  1VQP V;  2EIN C;  3L71 H;  2X6B A;  1YTF D;  3NXS A;  4X20 B;  2BE3 A;  2M6Y A;  1GM8 A;  2QWR B;  4J7K A;  2JGD A;  2EIJ C;  3W7S A;  2W0X A;  4DYL A;  5CBH A;  2EIL B;  4JI1 O;  4UXN A;  1AI7 A;  3JYC A;  4TUY B;  3TCU A;  4D7T A;  1K7D A;  2Q6A A;  4LF5 B;  4DRX A;  1SQF A;  1ORQ C;  2GUZ B;  3O65 A;  2YI8 A;  2ZD9 A;  1YTF B;  1FJG B;  1QNM A;  3ABL B;  1B06 A;  1AP6 A;  4CZZ A;  3APQ A;  1N36 B;  3ASN B;  3L75 H;  4JI2 O;  2JVD A;  5B1B B;  3CCQ V;  1RM1 C;  1VQO V;  1N0J A;  1J5E O;  3OGC C;  4EB6 A;  1R73 A;  1AR1 B;  4R50 A;  3ZHR A;  4JYC A;  1Q3E A;  2UXC O;  4XBF A;  1AIL A;  3BA9 A;  3JAS A;  5LOV B;  3E35 A;  1F51 A;  1M56 B;  4TWK A;  5LMU B;  1L0L H;  4JI1 B;  3TXQ A;  3FD9 A;  4CC6 A;  4IYI A;  1SRY A;  4IHJ A;  5EBW C;  3EFF K;  1COW G;  3E89 A;  1R6K A;  1EFR G;  5IJ9 A;  4JI0 O;  1H8E G;  1XL6 A;  1YIT V;  4JI2 B;  4JZG A;  1EM1 A;  5KX5 B;  1MAB G;  4DV5 O;  3K9A A;  5JWP A;  4UV9 A;  4PDR A;  1K9M W;  2RMK B;  1N34 O;  2JGD B;  3A0H Z;  4TV9 A;  2X7R B;  4CC5 A;  3CRM A;  2LJ2 A;  4BW9 A;  2UXC B;  5F2V O;  2XUM A;  1FFX A;  4WF9 V;  3ETQ A;  4MW8 A;  4DRX B;  2F4V O;  1QR9 A;  2ZIN A;  1WPX A;  4RAI A;  1S76 D;  2PYJ A;  3E8H A;  1GH6 A;  1AI6 A;  4F6R B;  1PNM A;  2QWO B;  5L3D A;  2YXH A;  4JI0 B;  1QLE B;  1Y74 A;  1R3L C;  2CUG A;  4RO2 A;  4LP8 A;  4DV5 B;  1GM7 A;  3VOU A;  4UCS A;  4JAV A;  3JD0 A;  2VQF O;  2QWP B;  3JAS B;  2QM8 A;  4DR1 B;  3E83 A;  5B1A C;  4XDL A;  1XNQ O;  1GN6 A;  1DF5 A;  2KG7 B;  5GON A;  3I55 V;  3F7V C;  1M57 B;  1TUE B;  3FB7 C;  4FFK A;  4MTO A;  2F4V B;  3RYI A;  4B7K A;  2BOB C;  4FZ0 A;  2HJD A;  2ZE8 A;  1Y66 A;  1AI5 A;  4JI6 O;  3KG2 A;  1PV0 A;  5DEC A;  3ZN1 A;  3APO A;  4YIP A;  1OV9 A;  4B3M O;  1N4C A;  1O9G A;  2MK3 A;  1GAX A;  5BMV A;  3K5O A;  2VQF B;  4TOI A;  2WSS G;  1SQV H;  2XAH A;  1NH2 D;  3ASO B;  3P32 A;  1U96 A;  1JPX A;  5EBM C;  2ZDI A;  1MOF A;  3CRA A;  3CP1 A;  1XNQ B;  4DR7 O;  3CRC A;  3OUS A;  2HVK C;  4UFZ A;  3OMA B;  5KMG A;  3L74 H;  5H9C A;  2YIC A;  1DTO A;  3UM7 A;  2EIL C;  4DV4 O;  1AI4 A;  2N05 A;  2Y69 B;  3KZI Z;  3FYE B;  1IXM A;  5CMU A;  1OCR C;  1YCI A;  4U3J A;  4KFM A;  3ABL C;  3ASN C;  4DV1 O;  2QWQ B;  3B09 A;  1SC5 B;  5B1B C;  3SYC A;  3CXH F;  4J10 A;  5L3C A;  4I7Z B;  1K73 W;  3UCS C;  5GON B;  3K08 A;  4DR7 B;  1H2S B;  1P7G A;  4DV4 B;  5JJJ B;  1D5N A;  4I0X A;  5KHJ A;  3H1L H;  1VQ4 V;  2BCC H;  4GKK O;  5B3S C;  1KUQ A;  5IYD O;  2NN4 A;  5LL6 Y;  1TA8 A;  5BMV B;  2LGW A;  2W6I G;  4DV1 B;  4GKJ B;  4HNA B;  1V9P A;  4LNU B;  4FLV A;  1YJW V;  4NTW A;  2RCV A;  5FNV A;  2OWO A;  1XUQ A;  1NBM G;  4MTX A;  5EZY B;  4GZR B;  4WFF A;  5KMG B;  1VQM V;  4FLX A;  2Q0O C;  1O9H A;  2V7Q G;  4EKW A;  3MDS A;  5IJ0 B;  1VQ8 V;  1P84 F;  2R72 A;  1ZLZ A;  3ZRS A;  1DK1 A;  3AG1 C;  3LDE A;  5IYB O;  1Q43 A;  1N32 O;  1HP8 A;  2XND G;  3AEI A;  4GKK B;  2CGN A;  1H2N A;  1KC8 W;  2F93 B;  1Y6X A;  2YS8 A;  3K5M A;  3K9S A;  3L73 H;  4TQF A;  2FYU H;  4DR6 O;  3J81 N;  3JD2 A;  4BIO A;  2HJF C;  3CJH A;  3RYC A;  2A3Q A;  5EC2 C;  1Q7Y W;  1UJW B;  1KEC A;  2YIB A;  3ZRW B;  2Q8V A;  2X6C A;  3UQ8 A;  1AB3 A;  1WP8 A;  1MZF A;  2JDI G;  2M7W A;  1JFF B;  3CCE V;  4I0X B;  3BVO A;  1M57 C;  4I50 A;  2CK3 G;  3U0Z A;  2EIN B;  1N32 B;  1Q6U A;  1K92 A;  2Y4U A;  4B7E A;  2E5L O;  2E3C A;  2WPD G;  4ZOL A;  3C3T A;  1TAE A;  2KQX A;  3CRQ A;  4JYA O;  3D3Q A;  2HKO A;  1R6T A;  3HKB A;  2EIJ B;  4JAS A;  4A5U B;  4WFE A;  4NTX A;  4DR6 B;  2JJ2 G;  5CB4 B;  1PL0 A;  4BR6 A;  4X65 O;  2ADQ B;  3QTC A;  4JTD B;  3ASO C;  3T1C A;  2Q9L A;  1WB8 A;  2EJR A;  2ITC C;  1K4D C;  3A8T A;  2QR4 A;  2YIB D;  4PA9 A;  1BMF G;  4ZIB A;  4LF7 O;  1RM1 B;  4O4L B;  3M99 B;  4I5S A;  3B4S A;  4RUF A;  1NR1 A;  1IDS A;  3WB1 A;  2DYR B;  3L9D A;  4JI4 O;  4X8A A;  4DXW A;  3AG7 A;  2Y69 C;  4I9W A;  1R1B A;  2YXY A;  4XDJ A;  2E5L B;  2LFS A;  5E79 Z;  4X1K A;  5FLX N;  3OGI B;  4JYA B;  4FFB B;  4GCZ A;  2AHZ A;  4DR2 B;  1H8H G;  3CD6 V;  4DW0 A;  4IL6 Z;  3F7Y C;  2WWW A;  5GTI Z;  3CJH B;  3OT7 A;  3TXS A;  3RYC B;  4FLU A;  1I08 A;  2P22 C;  1Q8I A;  4N21 A;  1ZWI C;  1HR0 O;  3QO7 A;  4PDM A;  4YJ3 A;  4L8J A;  4BAY A;  4X65 B;  3JSL A;  3ETD A;  4LF9 O;  4GX1 A;  2Q5Z A;  2AHY A;  3JAR A;  1WN7 A;  4L87 A;  2DQ0 A;  4XDK A;  5CA1 B;  1MNG A;  3OMN B;  1HWY A;  2Y48 A;  1S5J A;  2GTS A;  2VS0 A;  3WFV A;  4DUZ B;  2EX3 A;  3AG2 C;  2ZE5 A;  3K59 A;  3LNM B;  1KKD A;  4K3A A;  4PDL A;  5KHG A;  1ARO P;  2ZIM A;  1W59 A;  4E4E A;  4JI4 B;  3FYI B;  1DGS A;  2OYQ A;  3HKB B;  3GVM A;  1F7Y A;  3CXC U;  2OTJ V;  4FLZ A;  1HR0 B;  1VAR A;  3F5T A;  1KP3 A;  3F5W C;  2WLL A;  5B1O A;  4DW1 A;  4DV6 O;  3IC7 A;  2YXL A;  2QDO A;  3D3I A;  3CCJ V;  3N27 A;  2XAG A;  1AR5 A;  1M1K W;  1Q81 W;  5BZB A;  2IH3 C;  4I4T A;  2JS3 A;  2F1M A;  3ZMS A;  2Y0P A;  5JCO C;  4MTG A;  1N8R W;  5DN6 G;  5B1A B;  2R9A A;  4YIO A;  4MVQ A;  4QPJ A;  4B3T O;  4YJ3 B;  3N2G A;  4GLX A;  3I5D A;  2DMX A;  3JAR B;  4R6Z A;  2P5O A;  1YVW A;  4C7U A;  1Y4M A;  3EHB B;  2ATK C;  1F4N A;  1TUB A;  2GBO A;  1QBZ A;  4G2K A;  1MMM A;  4LF5 O;  2F23 A;  1UFI A;  2Q73 A;  3SJB C;  4DV6 B;  3P3N A;  4Q6G A;  5KAI Z;  1GN2 A;  1GN4 A;  2ZE6 A;  1JR9 A;  2Y0I A;  1N36 O;  4EFB A;  5B5E Z;  2R9R B;  4NR1 A;  3E22 A;  3B40 A;  5C8Y A;  4TSF G;  2A9H A;  3CC2 V;  3LSU A;  4PI0 A;  2Q69 A;  1J95 A;  3G6E V;  1XRE A;  1QLN A;  4B3T B;  3GWK C;  3UKM A;  1VQ5 V;  1FXK C;  1YEW A;  3LUT B;  2WLN A;  4UB8 Z;  3LDC A;  3J7A U;  1FXH A;  5LMU O;  3JD4 A;  3T2M A;  2QTS A;  1PKX A;  3OEH G;  2WLL B;  4ZBM A;  4J11 A;  2AZ0 A;  2PGG A;  4F6E A;  5K1P A;  3MAQ A;  1OCR B;  1B04 A;  4B3S O;  1BL8 A;  2DOS A;  4Z1V A;  4I4T B;  1XMO O;  3OR6 C;  4X1Y B;  3W7T A;  4QE7 A;  2Q0A A;  3K0D A;  2CDY A;  3L72 H;  2DYR C;  1V55 C;  3L70 H;  2QM7 A;  1OZ0 A;  1I7F A;  4UV8 A;  2YIA A;  1K4C C;  5J2U B;  3HKE A;  3NR7 A;  3SPC A;  4BIZ A;  3JAL B;  4GX5 A;  1TUB B;  2QGN A;  1Q86 W;  5IE9 A;  1SS3 A;  3CRR A;  2JEX A;  4O4J A;  1CEZ A;  2E74 B;  2Q67 A;  4X88 A;  3BCC H;  3P3P A;  5B3S B;  1W0K G;  4ASU G;  4UCU A;  4B3S B;  4K0K B;  1XIL A;  4ZI7 A;  3E22 B;  3T4Z A;  1OHH G;  3H1I H;  3OE7 G;  3G71 V;  2VWJ A;  3CEI A;  1XMO B;  2AGA A;  1OCO B;  1JX9 A;  2Q7E A;  2BSK A;  4PA7 A;  1EN4 A;  4O4H A;  3A0B Z;  2DWD C;  4QGP A;  4MVM A;  1XMQ O;  2WA4 A;  4LH6 A;  1VQN V;  3SDL A;  2PI4 A;  4DR1 O;  3CB2 A;  1WP7 A;  5KHH A;  4BWA A;  5IDJ A;  5BR8 B;  4MVR A;  4LR3 A;  4JI7 O;  3UO2 A;  1F23 A;  4X89 A;  1FD9 A;  4CH4 A;  3AG1 B;  2YC0 A;  1NR7 A;  3SYO A;  3OR7 C;  1TVK A;  4ZHQ A;  2GSM B;  5LHI A;  2NR5 A;  4I9Q A;  3ZBH A;  1GO3 F;  5KA5 A;  1GRJ A;  4HZ3 A;  4DV7 B;  1MA1 A;  5L3E A;  2B5U A;  2P7T C;  2BTO A;  4EB6 B;  4X1I A;  2PZS A;  1XMQ B;  3ZRV A;  3HKE B;  1GM9 A;  1VF5 B;  2EJ7 A;  2ZR3 A;  4JI7 B;  2P90 A;  4O4J B;  4PA4 A;  2LFR A;  3M7M X;  4DR3 O;  4KHP O;  4IHJ B;  2GDS A;  3JCZ A;  4GYC B;  1N33 O;  4F4L A;  5LYJ A;  1XL4 A;  5IJ9 B;  4ZI7 B;  4J41 A;  1XHX A;  1KP2 A;  4O4H B;  4UCR A;  3HB3 B;  3K0G A;  4JI3 O;  3KCX A;  2IJH A;  3CCR V;  1SA0 A;  4LBE C;  4FM2 A;  3ZED A;  5FPR A;  1SQQ H;  4CH6 A;  3BPZ A;  4TV9 B;  4IGG A;  3K57 A;  2ZNJ A;  3ABM C;  1I5Y A;  4O2B A;  1XDC A;  1NVP D;  1FFX B;  2HFE C;  4KL1 A;  2ZCE A;  4OGQ B;  4MTF A;  3CCS V;  3JAW A;  2IM9 A;  2VQE O;  1OJH A;  3TGU H;  3VQV A;  4ZHQ B;  1KU9 A;  4DR3 B;  4KHP B;  3CCV V;  3QVN A;  4MS2 A;  2H94 A;  4RUE A;  3SPH A;  1N33 B;  1GMG A;  2IU0 A;  2YID A;  1RFY A;  1BCC H;  3SYP A;  1KB9 F;  1RPO A;  3OMI B;  5JCO A;  3N2K A;  1K34 A;  5EBL C;  1VQL V;  1SES A;  1NVP B;  4DK1 A;  1NH2 B;  2PTM A;  1Y74 B;  1ZAU A;  3JCU Z;  1CXZ B;  4JI3 B;  1KBH A;  3GWO A;  3AK2 A;  4PV1 B;  1KYO F;  1PD3 A;  5EIB D;  1P49 A;  4UVA A;  5H2F Z;  2ZXW B;  4W4K A;  4GKJ O;  1A32 A;  3IFX A;  1YDX A;  4N23 A;  4X66 O;  3I56 V;  1CP9 A;  4J80 A;  3RT3 C;  1YSC A;  1ENV A;  5L3G A;  4FPP A;  2VQE B;  4J42 A;  5D5Q A;  5BXZ A;  3RYI B;  4X64 O;  3ABK B;  3T4D A;  1NJI W;  2PI5 A;  3AG2 B;  1FXV A;  2QA4 V;  2UUB B;  3CHX A;  4JF3 A;  3BRC A;  5JQG A;  3OTO O;  1QVG U;  2HR3 A;  2EZO A;  3EXA A;  5CA0 A;  1AJP A;  5KLV H;  4CBC A;  1JOY A;  1SA0 B;  4P2Z A;  4FM0 A;  3K06 A;  4TQD A;  3STL C;  1OCO C;  2EZP A;  1FXK A;  3SJA C;  2A0L A;  2EIM C;  2K1E A;  2ARH A;  5FPO A;  1S5L Z;  3JAW B;  4X66 B;  4G27 B;  3VQY A;  1NU1 H;  1S77 D;  1BQZ A;  3DGE A;  2D3O W;  1MSD A;  4DV3 O;  2CH7 A;  5FL7 G;  4X64 B;  2BTQ A;  3RFR A;  1X4T A;  3RVY A;  1VP7 A;  3BAB A;  4CS3 A;  5LP6 A;  1N0N A;  2OCC B;  1K8A W;  3OTO B;  4X62 O;  3DXR A;  4LFC O;  4U3J B;  2CGO A;  2XHB A;  5KHI A;  3BHP A;  3IGA C;  4DUY O;  3ZHU A;  1MZE A;  3TET A;  4E2L A;  4HYO A;  2F43 G;  1BE3 H;  5IYZ A;  3E2E A;  5LGU A;  3CCU V;  4J7Z A;  1GK9 A;  4HBN A;  4JZ2 A;  3AG3 C;  1T5E A;  2GV9 A;  1YI2 V;  1FYJ A;  2YEV A;  1G4Y B;  2DYS B;  4DV3 B;  3A2F A;  4I55 A;  4IIJ A;  1Y76 A;  2HP8 A;  3IAY A;  2E76 B;  1JQ0 A;  4YY3 O;  4X62 B;  2WLH A;  4LFC B;  3CME V;  5C93 A;  2RN9 A;  5KHK A;  4DUY B;  1Z5V A;  1FXK B;  3FFQ A;  4DR2 O;  2XTA A;  1Q90 D;  3HKD A;  4LF4 O;  5TIS Z;  5FNV B;  2XAQ A;  3BA8 A;  2DE0 X;  2FKX A;  5CBG A;  1MG1 A;  2CH7 B;  2KB1 A;  2V4D A;  4U3F H;  1ROP A;  5J9P C;  2BTQ B;  1FAF A;  1IZ3 A;  3RVZ A;  2DQ3 A;  3Q4H A;  4ABM A;  5LP6 B; 
#chains in the Genus database with same CATH homology
 4LF5 O;  1HR0 O;  5BR8 O;  2AGA A;  4DUZ O;  4DV3 O;  2F4V O;  4LF9 O;  4DR6 O;  3J81 N;  1N36 O;  4NXM O;  2VQE O;  5BY1 A;  4JV5 O;  1XMQ O;  4JI1 O;  4NXN O;  4DV1 O;  2N74 A;  3SDL A;  4LFA O;  4DR1 O;  4X62 O;  4LFC O;  2ZKO A;  1YZB A;  4JI7 O;  4DV7 O;  3O65 A;  4AQY O;  4OPA A;  1IBK O;  1X59 A;  1AB3 A;  4DUY O;  2Z0A A;  2UXC O;  2LW7 A;  4JI2 O;  1I94 O;  2UUA O;  2VQF O;  4JI5 O;  4OX9 O;  1F7Y A;  3J7A U;  4OPH A;  5LMU O;  4B3R O;  1J5E O;  1XNQ O;  2E5L O;  3T1Y O;  4GKJ O;  1A32 A;  1XEQ A;  2UUB O;  1FYJ A;  4JYA O;  4DV2 O;  5H5N A;  4LF6 O;  1IBL O;  1R6T A;  3F5T A;  2UU9 O;  4GKK O;  1HNW O;  4YHH O;  4X66 O;  4DV0 O;  4B3S O;  1AIL A;  4A5U B;  1KUQ A;  4DR4 O;  2DOS A;  3RT3 C;  1HNX O;  1HNZ O;  5LL6 Y;  2HHH O;  1XMO O;  2DJV A;  4X65 O;  4JI6 O;  4DV6 O;  4X64 O;  5BXZ A;  4YY3 O;  5IWA O;  4JI8 O;  4LF8 O;  3R66 A;  1XNR O;  5A2Q N;  4B3M O;  3OTO O;  4JI0 O;  4DR3 O;  4KHP O;  5LMN O;  4DR2 O;  3T1H O;  4LF7 O;  1NS1 A;  4K0K O;  4LF4 O;  1N33 O;  1D2D A;  2UUC O;  1FJG O;  5IT9 N;  4DV5 O;  2FKX A;  4JI4 O;  1IBM O;  2ZM6 O;  2UXD O;  4B3T O;  1FKA O;  1G1X B;  3J80 N;  1R1B A;  4DR7 O;  1DK1 A;  5FLX N;  1N34 O;  1N32 O;  4JI3 O;  4DR5 O;  4LFB O;  2UXB O;  2JRI A;  3M8A A;  3JAM N;  4DV4 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...