4DUZO

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c, bound with streptomycin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
87
structure length
87
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 31
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4duzO00
4LF5O 4JI7O 4JYAO 1N34O 4LF8O 4DR5O 3J80N 3J81N 4LF9O 5FLXN 4JI4O 1FJGO 1KUQA 4GKKO 4DV3O 2VQEO 4X64O 3T1YO 4JI8O 4DR2O 4DR7O 4DV0O 5BY1A 5IWAO 4X65O 4AQYO 1NS1A 1HNZO 4YY3O 1XNQO 4OPHA 2N74A 4K0KO 1AB3A 1X59A 4DR4O 3OTOO 4LFCO 1IBKO 4GKJO 5LL6Y 4DR1O 4B3TO 2HHHO 3J7AU 5BR8O 1HNWO 2DJVA 4LF6O 2FKXA 1J5EO 4B3MO 1G1XB 4NXNO 5A2QN 1HNXO 2F4VO 4KHPO 1HR0O 1N32O 4B3RO 2VQFO 1XMOO 4DUZO 4JI5O 2ZKOA 2UUCO 2UXDO 2UXCO 1N36O 4DV7O 1AILA 4DR3O 4JI0O 3JAMN 3SDLA 4DR6O 5BXZA 4JI3O 4YHHO 1R6TA 4JI1O 4DUYO 2ZM6O 1N33O 3R66A 1YZBA 1A32A 4LF4O 1I94O 2LW7A 1XEQA 3F5TA 3RT3C 1XNRO 2JRIA 4DV6O 1FKAO 4JI2O 4OPAA 2E5LO 1XMQO 3M8AA 2DOSA 5LMUO 1IBMO 4LFAO 4DV5O 2UU9O 4DV1O 4LF7O 1R1BA 5LMNO 3T1HO 1FYJA 1F7YA 4JV5O 3O65A 5IT9N 2UUBO 2Z0AA 2UXBO 4JI6O 1D2DA 4DV2O 2UUAO 4X62O 4OX9O 5H5NA 1DK1A 4LFBO 4B3SO 4DV4O 4NXMO 1IBLO 4A5UB 4X66O 2AGAA
chains in the Genus database with same CATH superfamily
2Y69C 1N32B 2WLIB 5L3DA 3E8FA 1L1FA 4TT3G 2IJJA 1YI2V 4JI6B 1BS3A 4J9ZB 3CYOA 3HKCA 1ZL8B 5KUKA 1K73W 1WN7A 4BIUA 4W4LA 1JX9A 5E1AC 3X2QC 3CWBH 2B5UA 4HNAB 4YJ3B 4K0KO 2E74B 1Q5OA 2IBZH 1P49A 3OD4A 1EBOA 1K5QA 3A8TA 1SRYA 1TVKB 2PF4E 1N36B 2OTJV 4UB6Z 1FFXB 1FXKA 2OYQA 1EN6A 1M9NA 4I4TA 1SQBH 2GUZA 4JI3B 3VBBA 1LR1A 4JYBA 1Q6IA 3OGCC 4DUZO 4GZRB 1GN2A 2N04A 3HKBA 3L70H 4RWUA 4JI0O 2JEUA 1R73A 5IYZA 2Q0AA 3OR7C 4B08A 3T4DA 1YF2A 3E8GA 1V55B 3BVOA 2WLLA 1WAZA 2LP7A 3E8BA 2N05A 5C8YB 5CA0A 1FAFA 1GO3F 3SJBC 1F4MA 1BGYH 4DV6O 3PJSK 3SGIA 4YY3B 4E2LA 1IBMO 5GONA 2AXTZ 1TGOA 3K57A 1XHZA 4IYIA 3ZN0A 4B7EA 2IJKA 1RM1C 2KSDA 4K8ZA 5IT9N 3ABKB 3WB1A 1Y74B 5LHHA 3CC4V 4DW0A 2UUAO 4X62O 4JI5B 1NKDA 1GK9A 1K7DA 4MW3A 1F23A 2CTRA 2QWQB 2KB1A 2ZINA 4DV4O 4LWSA 2D3OW 3CXCU 4XDKA 3BFRA 2DYSB 3FKSG 1ZAUA 4GX1A 1QLEB 1VQOV 1Q6UA 3GB7C 3J80N 1BCCH 4P9OA 2GBOA 2QSAA 3K58A 4JI4O 4DV3O 5DN6G 5JJJB 3CEIA 3ASOC 3E22A 2AHZA 4MVQA 3SPCA 5IWAO 3ETDA 3E22B 1KECA 2Q6AA 4FLVA 2GTAA 1E1RG 4J7JA 4GUNA 4IGGA 2A9HA 3ZS8C 1M56C 4W4KA 1FFTB 1Q90D 1VMGA 2FB5A 5EIBD 5B66Z 1PNKA 3DSQA 2DYRC 4XBFA 3UT5B 2RCVA 1YVWA 5HFLA 2DWEC 5LXTA 2PUSA 1US6A 3CE2A 1AP6A 5EBMC 1HR0O 2ZM6B 3JD2A 1I94B 3RWRD 3ZN1A 2F23A 2DE0X 2EIJB 4ZBMA 5J2TA 2OTLV 2XASA 3ZIAG 4DV7O 3RYHA 3RBZA 1Q43A 3JAKB 2YIDA 3KCXA 2YIBA 4NKGB 1R3KC 2PGGA 5KHHA 1WA8A 1NVPB 1V54B 1XNRB 1I94O 4X1KB 4JV5B 1H2KA 4BAYA 4WBNB 1JR9A 5EC1C 2HG5C 1VF5B 4IIJA 2FL4A 4Z1VA 2EILB 5L3EA 3ABMC 1HDJA 1N33B 1CPYA 5B1OA 4WBNA 5CBFA 3CC7V 4JV5O 3HKEA 5J2UA 4FLTA 1NBMG 2JJ2G 3BEHA 4PJ0Z 3D36C 1AP5A 5CB4A 1O9GA 2QWRB 3BABA 4B3SO 5EBWC 2HEPA 3CJHA 4FFBB 3UQ8A 4LF8O 3LUTB 3CHXA 3H1KH 4CC6A 3E86A 2YEVB 4MVUA 2Z5UA 4FLXA 4DR2B 4RO2A 4ZKIA 4QIWF 2KQXA 5B1BC 3KZIZ 1H2SB 3FAVB 5B5EZ 3K5MA 4X8AA 1P84F 3W7TA 1Y66A 2UXNA 4DR1O 4GLXA 1J5EO 4PD4F 3WB2A 4NXMB 3MHSC 4PA9A 1KKDA 1P7BA 1N0JA 5B3SC 4KFMA 2YC0A 2CH7B 4TOIA 3JCZA 3OM3B 3HPLC 2UXCO 4P9PA 3SYAA 1OCRB 3W7XA 3UT5A 2KG7B 2XTAA 4DR6O 4LNUA 3JASB 1OCOB 3R66A 1F4NA 1A32A 4I9QA 4LF4O 3OR6C 4NR1A 3TCUA 2JRIA 4UV8A 1FKAO 2UXCB 3CCQV 3M8AA 2DOSA 4OXSA 4DRXA 1M5IA 4JI2B 4FZ0A 2IM9A 3ZMUA 5TISZ 3BHPA 4DR4B 4TUYB 4JZGA 3QTCA 3E2EA 2YSUB 5KA6A 1YJWV 2GUZB 5JVDB 3HKDA 3L71H 2CK3G 2ZIMA 1W0JG 5JJNB 1KKCA 4HAMA 4R7CA 5K1XA 2JJ1G 3K9SA 1LUWA 2EJ7A 2RN9A 2QWPB 2WLMA 1U97A 4CH5A 3JATA 5LOVA 4DV2B 4FZ1A 3G80A 1MMMA 2W0FC 2WLNA 3CS5A 3KG2A 5BY1A 4I4TB 2BOCC 5CBHA 4X65O 4AQYO 3ZRSA 1MG1A 1K3EA 2R9AA 5KMGA 1XNQO 2LGQA 1L8DA 1R3IC 3M7MX 4ABMA 4JGSA 1H2GA 2LFRA 2ATKC 4DK0A 3K08A 3ASNC 2HJDA 1Q81W 5A2QN 4Z1MG 4H33A 1E1QG 2YDEA 1VQLV 1M1KW 2Q67A 1N32O 4MTGA 2IU0A 3TK1A 1JPXA 4DW1A 1QR9A 3WG7C 1HP8A 2E5LB 5KX5B 4JF3A 4U3FH 3JAMN 4PA4A 2D2CB 2ZT9B 4JI1O 4BWAA 2ZM6O 4O4IA 4LF7B 3W7WA 1SA0B 3DC5A 3UM7A 3JSLA 1MNGA 5B1BB 5JQGB 1CXZB 3OE7G 5LYJA 4IL6Z 4H0LB 4D7SA 2QWNB 4JI1B 3APOA 4O2AA 4JI7B 3FB5C 2Q0OC 1JJ2U 4J7ZA 1M57C 4DK1A 4DUZB 1DK1A 4WFEA 2JVDA 2P4VA 4JTCB 3K59A 2FTKA 4X66O 5FNVA 5IYCO 2X7RB 2YXYA 1S5HC 4BW5A 3JD1A 3RYCA 3J81N 1QBZA 1PL0A 2K1EA 3AEIA 4F4LA 3BRCA 5H6RA 2FYUH 2DW4A 3WG7B 1RPOA 1Q6HA 1THZA 3ZHQA 1NS1A 4YY3O 5LA6A 4CH3A 1IBMB 2YXLA 3ZMSA 1Y6XA 1NH2B 2F1MA 5IYBO 3W7SA 3RGBA 4YJ2A 3ZX6A 2ZE8A 4X64B 1YTFB 4I0XA 5C93A 5L3CA 1HNWO 4QE7A 4KUMA 2R9IA 4KHPO 4RUFA 1AJPA 4FVMA 2IH1C 2VQFO 3ETEA 5LBQA 1YIJV 3JAWA 1PNMA 5IJ9B 3CCRV 3SJCC 1EZVH 3TETA 5ITZB 1ZUQA 3FFQA 1JFFA 2HR3A 4KHPB 1PD3A 1WNSA 4YHHB 1AJNA 2F95B 1HW7A 4IHJB 5FPOA 3CCLV 5B1NA 3LSQA 1NVPD 1H8HG 1QU7A 4DV0B 1B06A 2Q9LA 3FAVA 2X6CA 4WFAV 5EC2C 4DR7B 1OCOC 2ZXWC 4MSWC 3F7YC 1FYJA 1Y67A 1W0KG 3CMEV 2P7TC 5IJ0B 1FS0G 4DO2A 3CXHF 4R50A 4DXWA 1B04A 4DV7B 2E75B 4GT1A 3ZHVA 3WFVA 4X9QA 2VQEB 4FM1A 1RSOA 3FB6C 4KP4A 1XDCA 3G4SV 1KUQA 1N4CA 3ICXA 2IJHA 3IGAC 3C90A 2WA4A 1IBLB 1XREA 1VQ9V 1LUVA 1HNXB 4P2ZA 3WB0A 1UJWB 4EB6A 3PN1A 4F6RA 4AILC 4GKJO 3OAAG 5H6QA 4UCRA 4FLZA 2M6YA 2PTMA 1SZTA 2FKXA 1HNZB 3CRMA 1BHBA 3HKDB 1LNQA 3C3SA 3RYFA 4K35A 4J11A 1EZJA 4AHCA 4B3RO 2UUBB 1ENVA 1V54C 4C7UA 4UVAA 1IURA 2WLHA 1BZKA 1K92A 2ETNA 1KP3A 1GM7A 1Y76B 4PA6A 4PA7A 1P7GA 1EN4A 1N33O 4UCVA 4NTYA 2EIMC 3T4ZA 2QDOA 1JJOA 3F5TA 3K9AA 1EN5A 2ITCC 3T1YB 4MVRA 2CGOA 4HBNA 2Q7EA 2E5LO 3STZC 3DXRA 1L0LH 4CH4A 5HFMA 4YIOA 2ADQB 3D3QA 3OUSA 1Y74A 4JTAB 1NR1A 2AZ2A 3G67A 2P6JA 4JI6O 1GAXA 3P32A 2LQTA 5B1AB 2AZ0A 3AG4C 5LMUB 3ZCCA 3ASOB 4WFGA 4JI7O 3CRCA 1N34O 1M90W 1FJGB 5LP6A 3MD0A 2H3OA 5FLXN 2VRZA 3RYIA 5K1PA 1SQFA 3SYQA 4I5SA 4TSFG 1QLEC 1V9PA 4AQYB 2ODMA 4RUEA 2BTQB 3C3TA 4HZ3A 3B09A 3BY6A 1YHQV 1R6NA 1RPRA 1WB8A 3FB8C 1YSCA 1QVGU 3S3WA 1CEZA 3ABKC 1RM1B 5LL6Y 1FFXA 2QEXV 4CS3A 2OCHA 2CTPA 2BTQA 3UKMA 3OMNB 4FLWA 1UPGA 4YXWG 3LNMB 4X1YA 4E4EA 4DR6B 2OT5A 1IXBA 3ML0A 2NNUA 3H1IH 5B3SB 3GWOA 2ZKOA 3K3WA 2UXDO 3SJAC 4NYKA 1WP7A 2F93B 3JATB 5BXZA 1JVMA 1SF9A 2ADPA 2L35A 3JAKA 1XNQB 4J9YB 3E8HA 3E35A 5KHGA 1VIBA 3HKEB 4H13B 1S5LZ 4G27B 4TUYA 2HKOA 3K5LA 4EKWA 4UCSA 1GM8A 4H44B 5KAFZ 1S0VA 2X0LA 4RQEA 2EIKC 2PY5A 1XMOB 5D5QA 1OCCC 3CRRA 3GWKC 5LOVB 4DR7O 4DV5B 1OV9A 4DYLA 3OGIB 2M7WA 2DMXA 4J7KA 1AVMA 5LHGA 3N2KB 4X89A 5LP6B 4J10A 3RYIB 1FD9A 1S77D 4JI8O 1OCZB 2OWOA 1IDSA 1G8MA 2E76B 2CAZC 3ZRWA 4EFBA 5BZBA 4TQDA 3ZEDA 3D3IA 5BMVB 1KB9F 1QLNA 1SKVA 2HJFC 2QKSA 1IBKO 2C2AA 4ZOLA 3L73H 2A06H 1KP2A 4DR3B 3CP1A 2Z3YA 2IH3C 4G28B 1DF5A 4UCUA 2Q7GA 1SC5B 3LSUA 4MW8A 4FLUA 4MVOA 4X62B 1Q86W 3SYCA 4JI5O 1EFRG 3RW0A 3ZRXA 1ZWIC 3K5NA 1NT2B 1K8AW 4L8JA 2YI8A 4ZIBA 5FL7G 2LGWA 4DRXB 1FXKB 3A2FA 3G71V 4WCEV 1WB7A 4JI0B 2VWKA 1R3JC 4I55B 3CSXA 2ZDIA 2P90A 4O4JB 3AG4B 2Y69B 1QCEA 3THOA 1WPBA 1XMQB 2EINC 2V1DA 1GN4A 1XILA 2XAJA 3A0HZ 4TQFA 1FXKC 1URFA 2EULA 2VQFB 5C8YA 4JPRA 2VWJA 5EIBC 1WA8B 1JOYA 1SQXH 5GTHZ 3ZJZA 1YJ9V 1MSWD 2JDIG 3FB7C 5B1AC 2QJ1A 1BMFG 2ILMA 4DV4B 4O2BA 3ZMTA 2QM4A 4CH6A 4DR5O 4LF9O 2Y0PA 2DQ3A 1KYOF 4GKKO 1VF6A 5BR8B 4X64O 4QPJA 3JD4A 1SQQH 4UVCA 1PV0A 4O2BB 3VQWA 1NTZH 2LW1A 2BSKB 3H1LH 3BPZA 1HWYA 4YJ2B 4LF9B 5H9CA 4O4LA 4B3TO 1WLEA 3OMAB 5BR8O 4MVSA 4PELA 5LP6C 4U3JB 3K0DA 2Q4PA 2BE3A 4NXNO 3OW2U 4LNUB 2CTQA 3N2GB 1KBHA 3STLC 2XUMA 1HR0B 1Q7YW 2HHHB 2R70A 5CMUA 1OCZC 1Z5WA 3T1CA 2L6LA 4NXNB 2YICA 4FPPA 3I55V 4UVBA 3CC2V 1WJZA 4CS4A 1VARA 1L0NH 2XAQA 1ZL8A 2PYJA 2KG7A 3ABTA 3H1JH 5H2FZ 1M93A 4EB6B 5DECA 5KHJA 2G38A 4LFAO 2EZPA 5A9GA 4DV1O 2XAFA 1XL4A 1GM9A 2A7WA 1XL6A 1I0HA 4YIPA 1Y4MA 4DV2O 3M99B 2WLLB 5H5NA 3H9VA 4PV1B 4QPKA 3JARB 4NXMO 2BOBC 4X65B 1N0NA 3LNNA 2WWWA 4LF5O 2GV9A 2RMKB 5FNVB 4F6EA 2ZXWB 1OJHA 2YXHA 4X20B 1Q8IA 4F6RB 3T1YO 5CA0B 2NR5A 2P4KA 3AG2B 3AG7A 1VQ6V 1HNZO 3FX7A 2DQ0A 2YUAA 3OEEG 2Q8VA 3OTFA 1KQSU 2IU3A 3BA9A 3CCJV 4LFBB 3DTUB 4O4HA 1NH2D 4B3MO 2LFSA 2QGNA 1ZLZA 1PKXA 3CCSV 2ITDC 3HB3B 1IZ3A 4R8CA 5JCOA 4RAIA 2CDYA 2OCCB 4WFBV 3TGUH 2PI5A 5EZYA 1O9HA 1P4RA 1RFYA 4MT8A 4MTOA 4DR3O 1Q82W 4LF6B 4PI0A 3JALB 3SDLA 4TV9B 3VQVA 3ABLB 1BQZA 1SETA 5LMNB 1G6UA 1SQGA 1FXVA 4QE9A 5KUMA 2AHYA 1XEQA 3RT3C 2XAHA 4D7TA 1MZFA 5LGTA 1MZEA 3QVNA 1NU1H 4JAAA 5IY5C 5LMUO 4X1YB 2WLKA 1SS3A 2F43G 5LMNO 3CX5F 4MS2A 2W0XA 2Y48A 2R72A 4WF9V 5FPRA 4IYHA 1XQ8A 4PDVA 3FYIB 2ZNJA 2H8PC 1VQ4V 4FLYA 3L72H 1Z5VA 1XI1A 2GSMB 3IC9A 5KLVH 2EIMB 4NVPA 3ZRVA 4LFCB 2EIKB 1J95A 3F7VC 4LC1A 2QWOB 4JAVA 5JVDA 1HNWB 3B2EE 1NTKH 3A0RA 1KU9A 2ZE6A 3H01A 2F4VB 2NN4A 1SERA 1XUQA 4ZHQA 1H38A 1AB3A 4LFCO 3G6BA 1D5NA 3J7AU 1BQ0A 2PZSA 3CB2A 1SZXA 3JARA 2WSSG 1TAEA 2DWDC 4TWKA 3UO3A 2EJRA 4X88A 3QO8A 1AR5A 1VF6C 3AG1C 1YJNV 2F4VO 1PNLA 1I7FA 1DLBA 3CMAV 2CE4A 1VQMV 4TV8B 2ZD9A 1AI5A 3GVMA 3CCUV 1N36O 4LH6A 1SQVH 4X66B 4GX0A 3ZHUA 1M4UA 1AR4A 3IAYA 3AK1A 3ABMB 3SPHA 3EHBB 3EFFK 3P3NA 1MABG 1JQ0A 1SQPH 2E3CA 5L3FA 3U0ZA 4LBEC 1NI8A 4ZI7A 1XMQO 1PL4A 4GYCB 1QHTA 2IJIA 2UU9O 2BSKA 1R1BA 5JJEB 1ZSPA 4FIPC 3NR7A 3BCCH 1OZ0A 1I5XA 4PDRA 1PPJH 1K97A 5CBGA 1PM9A 3L74H 1VQNV 2WPDG 3JSNA 2P67A 3CCVV 5F2VO 3UCSC 3MHHC 1IBLO 4P30A 2VS0A 4DV1B 4LF8B 1DF4A 3AG3C 2RQ6A 2UU9B 3JYCA 4JYAO 4O4IB 4PA3A 2QM8A 1G4YB 1RSOB 4I7ZB 3CCEV 3SPIA 4FM2A 4GKJB 2XNDG 3APQA 3B8NA 1GH6A 3ABUA 1AR1B 3QG5A 3SJQC 4ZHQB 4PI2A 2QKAA 3AG2C 3JCUZ 3N2GA 4DR1B 4B3RB 1X59A 1Z2GA 1YCIA 4JAUA 1QQCA 5J9PC 5IDJA 3OMIB 1PP9H 4O4JA 2JGUA 3EVKA 4MVZA 5JH7A 3H1HH 3IFXA 4KXRA 2IW5A 4JZ2A 5LXTB 4I9WA 1YTFD 4IIJB 4U7OA 4EFEA 3FD9A 3ZHRA 4UB8Z 4UFZA 1H8EG 3MAQA 5J2TB 4B3MB 1IVSA 1M57B 4KL1A 4I50A 5CA1A 5EYPB 4MTFA 1WPXA 5L3GA 1COWG 4J42A 5KA5A 4O4HB 4ZI7B 1VEWA 3OFNG 4NTXA 3JAWB 5LA6B 4JI2O 4B3TB 3QF7A 4OX9B 1H2LA 2P5OA 5KAIZ 2BCCH 1KC8W 1MA1A 1K4CC 4DUYB 1GTOA 4IT5A 1S76D 1JFFB 1N34B 1D5AA 3FYEB 2X6BA 1GN3A 1F7YA 2EZOA 2OIGA 3SYPA 4JYCA 2UXBO 4X20A 4WFHA 4GKKB 1AI4A 1W2BU 1QVFU 1BT8A 3R65A 4LF5B 3IJ4A 2JIZG 2V7QG 3B4SA 1CP9A 1ZX3A 4UCOA 4UCTA 3B40A 4MVMA 3RFRA 4A5UB 2R9RB 1N8RW 1NR7A 4Q20A 5IJ9A 4RQFA 3DXRB 2JGDA 2B9ZA 4NTWA 4UUJC 5CB4B 3ETQA 2VQEO 3L9DA 1K5SA 3K06A 4LWSB 4OPHA 4L87A 1EM1A 4UXNA 1JA8A 3X2QB 3RVYA 5IE9A 4DR4O 3B77A 4NB5A 1KMIZ 1YITV 5JCOC 3MDSA 4O2AB 5DEDA 2ZR3A 2Q5ZA 2GDSA 5LGNA 5KX5A 3OUFA 4FFKA 2YI9A 4BR6A 2EIJC 2ZR2A 1VQKV 5IYDO 1YDXA 2EILC 2V4DA 4B7KA 3D36A 2A79B 3ZRWB 1SA0A 3ZMZA 2OCCC 3JD0A 4J41A 3RYHB 5LGUA 1VQ8V 2WLIA 3QO5A 2ARHA 5CA1B 3SR2C 1NJIW 4QGPA 1OCRC 2BTOA 2NLJC 4JI3O 4BIZA 3ABLC 2QE7G 2ZCEA 3RYFB 3B8MA 3UO2A 3WU2Z 2Q68A 1OHHG 3U10A 1S3JA 3HKCB 3KKYA 4CC5A 2PYLA 3IC7A 3TXQA 3AK2A 1IXMA 1Y76A 5JH7B 4DV5O 4OGQB 4TV8A 4K0KB 5EYPA 4HNAA 1TVKA 4YJ3A 5KHKA 2JS3A 2EX3A 4AI8A 2JS5A 1K9MW 3CD6V 2P06A 3OEHG 1H2NA 4JI8B 1M56B 4U7NA 1FPOA 1W59A 4CBCA 2QA4V 1BSMA 4J80A 3DC6A 2ZNIA 2H94A 1I5YA 4BW9A 5CA3A 2ZQMA 3JALA 2ZE7A 1IBKB 1FJGO 2WA3A 2GHYA 4K8XA 3ZMVA 4D6TH 1TUBA 3CPWU 1BE3H 4CZZA 1VQ5V 4FMTA 2K9PA 5KMGB 4EEQA 3K04A 5EK0A 4FM0A 5IY5B 3SPJA 2F66C 2XAGA 4MTXA 3Q4HA 1AROP 1XMOO 2JGDB 2XHBA 1JMKC 2HP8A 3ASNB 5BMVA 2UXDB 4YHHO 2DN9A 2Y0IA 3E83A 5GW7A 4JI4B 2Q73A 2KKWA 2CH7A 4DV3B 3K79A 1T5EA 4N21A 4DV6B 1SESA 2B1IA 1ORQC 1NZ6A 3E89A 1FXHA 3SPGA 4DR5B 4QJFB 3O65A 3RN4A 2Z0AA 1D2DA 1MSDA 2MW2B 3HKBB 4OX9O 1YXBA 2P22C 4X1IA 2X6AA 5AG2A 3AG3B 2UUAB 4JYAB 2Y4TA 3BA8A 3NXSA 1XOUA 5J2UB 2AW9A 3K0GA 4JYYA 3KCYA 3QNEA 2UXBB 3D8CA 1B6QA 4ASUG 4BIOA 2Q7HA 3JD3A 2DYRB 3G6EV 3ETGA 1VQPV 1TUBB 1BHAA 4O4LB 4B3SB 4DV0O 2CGNA 1B3QA 5EBLC 4XDJA 2N74A 5IWAB 2MK3A 3I5DA 1F51A 4X1KA 3LSSA 3LDEA 1Q3EA 1YEWA 4H37A 2HHHO 3LDDA 2QTSA 1VQ7V 3N2KA 3DGEA 4TV9A 2DJVA 4IHJA 4PDMA 1QNMA 3TJTA 3ZHSA 4LH7A 3LDCA 3CCMV 1GRJA 5CN0A 2GTSA 3Q4HB 5E79Z 2Y4UA 3VQXA 1E79G 3CRQA 3CJHB 1BL8A 4FFBA 2WLJA 3CRAA 2ZDIC 2RNBA 1ROPA 3AG1B 2LO1A 4QNHB 2HFEC 4LFAB 1R6TA 1AJQA 1ZTEA 1YZBA 2CUGA 2OIEA 2QKCA 2LW7A 1DGSA 2LJ2A 1AI6A 1XNRO 2HLDG 5EZYB 5D5PA 1TA8A 2ZIOA 1UFIA 2JK5C 4FK5C 2W6IG 1KD1W 4G2KA 3VQYA 2RDCA 3U11A 3ZBHA 5GTIZ 3T1HO 1V55C 1VP7A 1GN6A 2CTWA 3O9OA 2UUBO 5L3BA 1J5EB 2WAMA 1TUEB 2EBOA 4GX5A 4K3AA 4CS2A 2AGAA 4X1IB 3N27A 4UV9A 3T2MA 3T1HB 3P30A 4HYOA 2ZE5A 1XHXA 1NTMH 1VF7A 3HR0A 1K4DC 1S5JA 1R6KA 2A3QA 3RVZA 1WP8A 4DR2O 2QM7A 2QR4A 2QTOA 4N23A 2XOKG 1S72V 3JASA 4GCZA 1R3LC 4LF4B 1X4TA 4WFFA 4R6ZA 1U96A 1AI7A 3RYCB 4GX2A 3L75H 3OTOO 3ZHTA 1I08A 2O57A 1OCCB 4I55A 2UUCB 2UXXA 2XT9A 2YS8A 5ITZA 5IYZB 3SYOA 3I56V 4LF6O 4I0XB 4JTDB 4LR3A 1G1XB 5GONB 3K5OA 5LHIA 3K03A 4XDLA 1HNXO 4I50B 5KHIA 3TXSA 3OTOB 1RP3B 2YIAA 1DTOA 3OT7A 3F5WC 2YIBD 2FMLA 2UUCO 4PHZA 1AILA 4JASA 2Q69A 4Q6GA 5JWPA 1MOFA 2HVJC 3AK3A 4FJCC 2YEVA 4ICGA 4DUYO 4LCUC 3W7UA 4ZOLB 5DM6V 3EXAA 2EINB 3A0BZ 5IJ0A 3S3XA 1GKFA 3VOUA 1IX9A 3BAAA 2PI4A 1NQTA 2JEXA 3QO7A 1XBLA 1H2MA 2W6JG 4OPAA 3P3PA 2A0LA 1QR8A 4LP8A 1JCHA 5JQGA 4Z2WA 4LF7O 4U3JA 1K33A 2RJZA 4PDLA 5LYJB 2B1GA 2DYSC 4LFBO 1K34A 1GMGA 2HVKC
chains in the Genus database with same CATH topology
4LF5O 4JI7O 4JYAO 1N34O 4LF8O 4DR5O 3J80N 3J81N 4LF9O 5FLXN 4JI4O 1FJGO 1KUQA 4GKKO 4DV3O 2VQEO 4X64O 3T1YO 4JI8O 4DR2O 4DR7O 4DV0O 5BY1A 5IWAO 4X65O 4AQYO 1NS1A 1HNZO 4YY3O 1XNQO 4OPHA 2N74A 4K0KO 1AB3A 1X59A 4DR4O 3OTOO 4LFCO 1IBKO 4GKJO 5LL6Y 4DR1O 4B3TO 2HHHO 3J7AU 5BR8O 1HNWO 2DJVA 4LF6O 2FKXA 1J5EO 4B3MO 1G1XB 4NXNO 5A2QN 1HNXO 2F4VO 4KHPO 1HR0O 1N32O 4B3RO 2VQFO 1XMOO 4DUZO 4JI5O 2ZKOA 2UUCO 2UXDO 2UXCO 1N36O 4DV7O 1AILA 4DR3O 4JI0O 3JAMN 3SDLA 4DR6O 5BXZA 4JI3O 4YHHO 1R6TA 4JI1O 4DUYO 2ZM6O 1N33O 3R66A 1YZBA 1A32A 4LF4O 1I94O 2LW7A 1XEQA 3F5TA 3RT3C 1XNRO 2JRIA 4DV6O 1FKAO 4JI2O 4OPAA 2E5LO 1XMQO 3M8AA 2DOSA 5LMUO 1IBMO 4LFAO 4DV5O 2UU9O 4DV1O 4LF7O 1R1BA 5LMNO 3T1HO 1FYJA 1F7YA 4JV5O 3O65A 5IT9N 2UUBO 2Z0AA 2UXBO 4JI6O 1D2DA 4DV2O 2UUAO 4X62O 4OX9O 5H5NA 1DK1A 4LFBO 4B3SO 4DV4O 4NXMO 1IBLO 4A5UB 4X66O 2AGAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF5 O;  4JI7 O;  4JYA O;  1N34 O;  4LF8 O;  4DR5 O;  3J80 N;  3J81 N;  4LF9 O;  5FLX N;  4JI4 O;  1FJG O;  1KUQ A;  4GKK O;  4DV3 O;  2VQE O;  4X64 O;  3T1Y O;  4JI8 O;  4DR2 O;  4DR7 O;  4DV0 O;  5BY1 A;  5IWA O;  4X65 O;  4AQY O;  1NS1 A;  1HNZ O;  4YY3 O;  1XNQ O;  4OPH A;  2N74 A;  4K0K O;  1AB3 A;  1X59 A;  4DR4 O;  3OTO O;  4LFC O;  1IBK O;  4GKJ O;  5LL6 Y;  4DR1 O;  4B3T O;  2HHH O;  3J7A U;  5BR8 O;  1HNW O;  2DJV A;  4LF6 O;  2FKX A;  1J5E O;  4B3M O;  1G1X B;  4NXN O;  5A2Q N;  1HNX O;  2F4V O;  4KHP O;  1HR0 O;  1N32 O;  4B3R O;  2VQF O;  1XMO O;  4DUZ O;  4JI5 O;  2ZKO A;  2UUC O;  2UXD O;  2UXC O;  1N36 O;  4DV7 O;  1AIL A;  4DR3 O;  4JI0 O;  3JAM N;  3SDL A;  4DR6 O;  5BXZ A;  4JI3 O;  4YHH O;  1R6T A;  4JI1 O;  4DUY O;  2ZM6 O;  1N33 O;  3R66 A;  1YZB A;  1A32 A;  4LF4 O;  1I94 O;  2LW7 A;  1XEQ A;  3F5T A;  3RT3 C;  1XNR O;  2JRI A;  4DV6 O;  1FKA O;  4JI2 O;  4OPA A;  2E5L O;  1XMQ O;  3M8A A;  2DOS A;  5LMU O;  1IBM O;  4LFA O;  4DV5 O;  2UU9 O;  4DV1 O;  4LF7 O;  1R1B A;  5LMN O;  3T1H O;  1FYJ A;  1F7Y A;  4JV5 O;  3O65 A;  5IT9 N;  2UUB O;  2Z0A A;  2UXB O;  4JI6 O;  1D2D A;  4DV2 O;  2UUA O;  4X62 O;  4OX9 O;  5H5N A;  1DK1 A;  4LFB O;  4B3S O;  4DV4 O;  4NXM O;  1IBL O;  4A5U B;  4X66 O;  2AGA A; 
#chains in the Genus database with same CATH topology
 2Y69 C;  1N32 B;  2WLI B;  5L3D A;  3E8F A;  1L1F A;  4TT3 G;  2IJJ A;  1YI2 V;  4JI6 B;  1BS3 A;  4J9Z B;  3CYO A;  3HKC A;  1ZL8 B;  5KUK A;  1K73 W;  1WN7 A;  4BIU A;  4W4L A;  1JX9 A;  5E1A C;  3X2Q C;  3CWB H;  2B5U A;  4HNA B;  4YJ3 B;  4K0K O;  2E74 B;  1Q5O A;  2IBZ H;  1P49 A;  3OD4 A;  1EBO A;  1K5Q A;  3A8T A;  1SRY A;  1TVK B;  2PF4 E;  1N36 B;  2OTJ V;  4UB6 Z;  1FFX B;  1FXK A;  2OYQ A;  1EN6 A;  1M9N A;  4I4T A;  1SQB H;  2GUZ A;  4JI3 B;  3VBB A;  1LR1 A;  4JYB A;  1Q6I A;  3OGC C;  4DUZ O;  4GZR B;  1GN2 A;  2N04 A;  3HKB A;  3L70 H;  4RWU A;  4JI0 O;  2JEU A;  1R73 A;  5IYZ A;  2Q0A A;  3OR7 C;  4B08 A;  3T4D A;  1YF2 A;  3E8G A;  1V55 B;  3BVO A;  2WLL A;  1WAZ A;  2LP7 A;  3E8B A;  2N05 A;  5C8Y B;  5CA0 A;  1FAF A;  1GO3 F;  3SJB C;  1F4M A;  1BGY H;  4DV6 O;  3PJS K;  3SGI A;  4YY3 B;  4E2L A;  1IBM O;  5GON A;  2AXT Z;  1TGO A;  3K57 A;  1XHZ A;  4IYI A;  3ZN0 A;  4B7E A;  2IJK A;  1RM1 C;  2KSD A;  4K8Z A;  5IT9 N;  3ABK B;  3WB1 A;  1Y74 B;  5LHH A;  3CC4 V;  4DW0 A;  2UUA O;  4X62 O;  4JI5 B;  1NKD A;  1GK9 A;  1K7D A;  4MW3 A;  1F23 A;  2CTR A;  2QWQ B;  2KB1 A;  2ZIN A;  4DV4 O;  4LWS A;  2D3O W;  3CXC U;  4XDK A;  3BFR A;  2DYS B;  3FKS G;  1ZAU A;  4GX1 A;  1QLE B;  1VQO V;  1Q6U A;  3GB7 C;  3J80 N;  1BCC H;  4P9O A;  2GBO A;  2QSA A;  3K58 A;  4JI4 O;  4DV3 O;  5DN6 G;  5JJJ B;  3CEI A;  3ASO C;  3E22 A;  2AHZ A;  4MVQ A;  3SPC A;  5IWA O;  3ETD A;  3E22 B;  1KEC A;  2Q6A A;  4FLV A;  2GTA A;  1E1R G;  4J7J A;  4GUN A;  4IGG A;  2A9H A;  3ZS8 C;  1M56 C;  4W4K A;  1FFT B;  1Q90 D;  1VMG A;  2FB5 A;  5EIB D;  5B66 Z;  1PNK A;  3DSQ A;  2DYR C;  4XBF A;  3UT5 B;  2RCV A;  1YVW A;  5HFL A;  2DWE C;  5LXT A;  2PUS A;  1US6 A;  3CE2 A;  1AP6 A;  5EBM C;  1HR0 O;  2ZM6 B;  3JD2 A;  1I94 B;  3RWR D;  3ZN1 A;  2F23 A;  2DE0 X;  2EIJ B;  4ZBM A;  5J2T A;  2OTL V;  2XAS A;  3ZIA G;  4DV7 O;  3RYH A;  3RBZ A;  1Q43 A;  3JAK B;  2YID A;  3KCX A;  2YIB A;  4NKG B;  1R3K C;  2PGG A;  5KHH A;  1WA8 A;  1NVP B;  1V54 B;  1XNR B;  1I94 O;  4X1K B;  4JV5 B;  1H2K A;  4BAY A;  4WBN B;  1JR9 A;  5EC1 C;  2HG5 C;  1VF5 B;  4IIJ A;  2FL4 A;  4Z1V A;  2EIL B;  5L3E A;  3ABM C;  1HDJ A;  1N33 B;  1CPY A;  5B1O A;  4WBN A;  5CBF A;  3CC7 V;  4JV5 O;  3HKE A;  5J2U A;  4FLT A;  1NBM G;  2JJ2 G;  3BEH A;  4PJ0 Z;  3D36 C;  1AP5 A;  5CB4 A;  1O9G A;  2QWR B;  3BAB A;  4B3S O;  5EBW C;  2HEP A;  3CJH A;  4FFB B;  3UQ8 A;  4LF8 O;  3LUT B;  3CHX A;  3H1K H;  4CC6 A;  3E86 A;  2YEV B;  4MVU A;  2Z5U A;  4FLX A;  4DR2 B;  4RO2 A;  4ZKI A;  4QIW F;  2KQX A;  5B1B C;  3KZI Z;  1H2S B;  3FAV B;  5B5E Z;  3K5M A;  4X8A A;  1P84 F;  3W7T A;  1Y66 A;  2UXN A;  4DR1 O;  4GLX A;  1J5E O;  4PD4 F;  3WB2 A;  4NXM B;  3MHS C;  4PA9 A;  1KKD A;  1P7B A;  1N0J A;  5B3S C;  4KFM A;  2YC0 A;  2CH7 B;  4TOI A;  3JCZ A;  3OM3 B;  3HPL C;  2UXC O;  4P9P A;  3SYA A;  1OCR B;  3W7X A;  3UT5 A;  2KG7 B;  2XTA A;  4DR6 O;  4LNU A;  3JAS B;  1OCO B;  3R66 A;  1F4N A;  1A32 A;  4I9Q A;  4LF4 O;  3OR6 C;  4NR1 A;  3TCU A;  2JRI A;  4UV8 A;  1FKA O;  2UXC B;  3CCQ V;  3M8A A;  2DOS A;  4OXS A;  4DRX A;  1M5I A;  4JI2 B;  4FZ0 A;  2IM9 A;  3ZMU A;  5TIS Z;  3BHP A;  4DR4 B;  4TUY B;  4JZG A;  3QTC A;  3E2E A;  2YSU B;  5KA6 A;  1YJW V;  2GUZ B;  5JVD B;  3HKD A;  3L71 H;  2CK3 G;  2ZIM A;  1W0J G;  5JJN B;  1KKC A;  4HAM A;  4R7C A;  5K1X A;  2JJ1 G;  3K9S A;  1LUW A;  2EJ7 A;  2RN9 A;  2QWP B;  2WLM A;  1U97 A;  4CH5 A;  3JAT A;  5LOV A;  4DV2 B;  4FZ1 A;  3G80 A;  1MMM A;  2W0F C;  2WLN A;  3CS5 A;  3KG2 A;  5BY1 A;  4I4T B;  2BOC C;  5CBH A;  4X65 O;  4AQY O;  3ZRS A;  1MG1 A;  1K3E A;  2R9A A;  5KMG A;  1XNQ O;  2LGQ A;  1L8D A;  1R3I C;  3M7M X;  4ABM A;  4JGS A;  1H2G A;  2LFR A;  2ATK C;  4DK0 A;  3K08 A;  3ASN C;  2HJD A;  1Q81 W;  5A2Q N;  4Z1M G;  4H33 A;  1E1Q G;  2YDE A;  1VQL V;  1M1K W;  2Q67 A;  1N32 O;  4MTG A;  2IU0 A;  3TK1 A;  1JPX A;  4DW1 A;  1QR9 A;  3WG7 C;  1HP8 A;  2E5L B;  5KX5 B;  4JF3 A;  4U3F H;  3JAM N;  4PA4 A;  2D2C B;  2ZT9 B;  4JI1 O;  4BWA A;  2ZM6 O;  4O4I A;  4LF7 B;  3W7W A;  1SA0 B;  3DC5 A;  3UM7 A;  3JSL A;  1MNG A;  5B1B B;  5JQG B;  1CXZ B;  3OE7 G;  5LYJ A;  4IL6 Z;  4H0L B;  4D7S A;  2QWN B;  4JI1 B;  3APO A;  4O2A A;  4JI7 B;  3FB5 C;  2Q0O C;  1JJ2 U;  4J7Z A;  1M57 C;  4DK1 A;  4DUZ B;  1DK1 A;  4WFE A;  2JVD A;  2P4V A;  4JTC B;  3K59 A;  2FTK A;  4X66 O;  5FNV A;  5IYC O;  2X7R B;  2YXY A;  1S5H C;  4BW5 A;  3JD1 A;  3RYC A;  3J81 N;  1QBZ A;  1PL0 A;  2K1E A;  3AEI A;  4F4L A;  3BRC A;  5H6R A;  2FYU H;  2DW4 A;  3WG7 B;  1RPO A;  1Q6H A;  1THZ A;  3ZHQ A;  1NS1 A;  4YY3 O;  5LA6 A;  4CH3 A;  1IBM B;  2YXL A;  3ZMS A;  1Y6X A;  1NH2 B;  2F1M A;  5IYB O;  3W7S A;  3RGB A;  4YJ2 A;  3ZX6 A;  2ZE8 A;  4X64 B;  1YTF B;  4I0X A;  5C93 A;  5L3C A;  1HNW O;  4QE7 A;  4KUM A;  2R9I A;  4KHP O;  4RUF A;  1AJP A;  4FVM A;  2IH1 C;  2VQF O;  3ETE A;  5LBQ A;  1YIJ V;  3JAW A;  1PNM A;  5IJ9 B;  3CCR V;  3SJC C;  1EZV H;  3TET A;  5ITZ B;  1ZUQ A;  3FFQ A;  1JFF A;  2HR3 A;  4KHP B;  1PD3 A;  1WNS A;  4YHH B;  1AJN A;  2F95 B;  1HW7 A;  4IHJ B;  5FPO A;  3CCL V;  5B1N A;  3LSQ A;  1NVP D;  1H8H G;  1QU7 A;  4DV0 B;  1B06 A;  2Q9L A;  3FAV A;  2X6C A;  4WFA V;  5EC2 C;  4DR7 B;  1OCO C;  2ZXW C;  4MSW C;  3F7Y C;  1FYJ A;  1Y67 A;  1W0K G;  3CME V;  2P7T C;  5IJ0 B;  1FS0 G;  4DO2 A;  3CXH F;  4R50 A;  4DXW A;  1B04 A;  4DV7 B;  2E75 B;  4GT1 A;  3ZHV A;  3WFV A;  4X9Q A;  2VQE B;  4FM1 A;  1RSO A;  3FB6 C;  4KP4 A;  1XDC A;  3G4S V;  1KUQ A;  1N4C A;  3ICX A;  2IJH A;  3IGA C;  3C90 A;  2WA4 A;  1IBL B;  1XRE A;  1VQ9 V;  1LUV A;  1HNX B;  4P2Z A;  3WB0 A;  1UJW B;  4EB6 A;  3PN1 A;  4F6R A;  4AIL C;  4GKJ O;  3OAA G;  5H6Q A;  4UCR A;  4FLZ A;  2M6Y A;  2PTM A;  1SZT A;  2FKX A;  1HNZ B;  3CRM A;  1BHB A;  3HKD B;  1LNQ A;  3C3S A;  3RYF A;  4K35 A;  4J11 A;  1EZJ A;  4AHC A;  4B3R O;  2UUB B;  1ENV A;  1V54 C;  4C7U A;  4UVA A;  1IUR A;  2WLH A;  1BZK A;  1K92 A;  2ETN A;  1KP3 A;  1GM7 A;  1Y76 B;  4PA6 A;  4PA7 A;  1P7G A;  1EN4 A;  1N33 O;  4UCV A;  4NTY A;  2EIM C;  3T4Z A;  2QDO A;  1JJO A;  3F5T A;  3K9A A;  1EN5 A;  2ITC C;  3T1Y B;  4MVR A;  2CGO A;  4HBN A;  2Q7E A;  2E5L O;  3STZ C;  3DXR A;  1L0L H;  4CH4 A;  5HFM A;  4YIO A;  2ADQ B;  3D3Q A;  3OUS A;  1Y74 A;  4JTA B;  1NR1 A;  2AZ2 A;  3G67 A;  2P6J A;  4JI6 O;  1GAX A;  3P32 A;  2LQT A;  5B1A B;  2AZ0 A;  3AG4 C;  5LMU B;  3ZCC A;  3ASO B;  4WFG A;  4JI7 O;  3CRC A;  1N34 O;  1M90 W;  1FJG B;  5LP6 A;  3MD0 A;  2H3O A;  5FLX N;  2VRZ A;  3RYI A;  5K1P A;  1SQF A;  3SYQ A;  4I5S A;  4TSF G;  1QLE C;  1V9P A;  4AQY B;  2ODM A;  4RUE A;  2BTQ B;  3C3T A;  4HZ3 A;  3B09 A;  3BY6 A;  1YHQ V;  1R6N A;  1RPR A;  1WB8 A;  3FB8 C;  1YSC A;  1QVG U;  3S3W A;  1CEZ A;  3ABK C;  1RM1 B;  5LL6 Y;  1FFX A;  2QEX V;  4CS3 A;  2OCH A;  2CTP A;  2BTQ A;  3UKM A;  3OMN B;  4FLW A;  1UPG A;  4YXW G;  3LNM B;  4X1Y A;  4E4E A;  4DR6 B;  2OT5 A;  1IXB A;  3ML0 A;  2NNU A;  3H1I H;  5B3S B;  3GWO A;  2ZKO A;  3K3W A;  2UXD O;  3SJA C;  4NYK A;  1WP7 A;  2F93 B;  3JAT B;  5BXZ A;  1JVM A;  1SF9 A;  2ADP A;  2L35 A;  3JAK A;  1XNQ B;  4J9Y B;  3E8H A;  3E35 A;  5KHG A;  1VIB A;  3HKE B;  4H13 B;  1S5L Z;  4G27 B;  4TUY A;  2HKO A;  3K5L A;  4EKW A;  4UCS A;  1GM8 A;  4H44 B;  5KAF Z;  1S0V A;  2X0L A;  4RQE A;  2EIK C;  2PY5 A;  1XMO B;  5D5Q A;  1OCC C;  3CRR A;  3GWK C;  5LOV B;  4DR7 O;  4DV5 B;  1OV9 A;  4DYL A;  3OGI B;  2M7W A;  2DMX A;  4J7K A;  1AVM A;  5LHG A;  3N2K B;  4X89 A;  5LP6 B;  4J10 A;  3RYI B;  1FD9 A;  1S77 D;  4JI8 O;  1OCZ B;  2OWO A;  1IDS A;  1G8M A;  2E76 B;  2CAZ C;  3ZRW A;  4EFB A;  5BZB A;  4TQD A;  3ZED A;  3D3I A;  5BMV B;  1KB9 F;  1QLN A;  1SKV A;  2HJF C;  2QKS A;  1IBK O;  2C2A A;  4ZOL A;  3L73 H;  2A06 H;  1KP2 A;  4DR3 B;  3CP1 A;  2Z3Y A;  2IH3 C;  4G28 B;  1DF5 A;  4UCU A;  2Q7G A;  1SC5 B;  3LSU A;  4MW8 A;  4FLU A;  4MVO A;  4X62 B;  1Q86 W;  3SYC A;  4JI5 O;  1EFR G;  3RW0 A;  3ZRX A;  1ZWI C;  3K5N A;  1NT2 B;  1K8A W;  4L8J A;  2YI8 A;  4ZIB A;  5FL7 G;  2LGW A;  4DRX B;  1FXK B;  3A2F A;  3G71 V;  4WCE V;  1WB7 A;  4JI0 B;  2VWK A;  1R3J C;  4I55 B;  3CSX A;  2ZDI A;  2P90 A;  4O4J B;  3AG4 B;  2Y69 B;  1QCE A;  3THO A;  1WPB A;  1XMQ B;  2EIN C;  2V1D A;  1GN4 A;  1XIL A;  2XAJ A;  3A0H Z;  4TQF A;  1FXK C;  1URF A;  2EUL A;  2VQF B;  5C8Y A;  4JPR A;  2VWJ A;  5EIB C;  1WA8 B;  1JOY A;  1SQX H;  5GTH Z;  3ZJZ A;  1YJ9 V;  1MSW D;  2JDI G;  3FB7 C;  5B1A C;  2QJ1 A;  1BMF G;  2ILM A;  4DV4 B;  4O2B A;  3ZMT A;  2QM4 A;  4CH6 A;  4DR5 O;  4LF9 O;  2Y0P A;  2DQ3 A;  1KYO F;  4GKK O;  1VF6 A;  5BR8 B;  4X64 O;  4QPJ A;  3JD4 A;  1SQQ H;  4UVC A;  1PV0 A;  4O2B B;  3VQW A;  1NTZ H;  2LW1 A;  2BSK B;  3H1L H;  3BPZ A;  1HWY A;  4YJ2 B;  4LF9 B;  5H9C A;  4O4L A;  4B3T O;  1WLE A;  3OMA B;  5BR8 O;  4MVS A;  4PEL A;  5LP6 C;  4U3J B;  3K0D A;  2Q4P A;  2BE3 A;  4NXN O;  3OW2 U;  4LNU B;  2CTQ A;  3N2G B;  1KBH A;  3STL C;  2XUM A;  1HR0 B;  1Q7Y W;  2HHH B;  2R70 A;  5CMU A;  1OCZ C;  1Z5W A;  3T1C A;  2L6L A;  4NXN B;  2YIC A;  4FPP A;  3I55 V;  4UVB A;  3CC2 V;  1WJZ A;  4CS4 A;  1VAR A;  1L0N H;  2XAQ A;  1ZL8 A;  2PYJ A;  2KG7 A;  3ABT A;  3H1J H;  5H2F Z;  1M93 A;  4EB6 B;  5DEC A;  5KHJ A;  2G38 A;  4LFA O;  2EZP A;  5A9G A;  4DV1 O;  2XAF A;  1XL4 A;  1GM9 A;  2A7W A;  1XL6 A;  1I0H A;  4YIP A;  1Y4M A;  4DV2 O;  3M99 B;  2WLL B;  5H5N A;  3H9V A;  4PV1 B;  4QPK A;  3JAR B;  4NXM O;  2BOB C;  4X65 B;  1N0N A;  3LNN A;  2WWW A;  4LF5 O;  2GV9 A;  2RMK B;  5FNV B;  4F6E A;  2ZXW B;  1OJH A;  2YXH A;  4X20 B;  1Q8I A;  4F6R B;  3T1Y O;  5CA0 B;  2NR5 A;  2P4K A;  3AG2 B;  3AG7 A;  1VQ6 V;  1HNZ O;  3FX7 A;  2DQ0 A;  2YUA A;  3OEE G;  2Q8V A;  3OTF A;  1KQS U;  2IU3 A;  3BA9 A;  3CCJ V;  4LFB B;  3DTU B;  4O4H A;  1NH2 D;  4B3M O;  2LFS A;  2QGN A;  1ZLZ A;  1PKX A;  3CCS V;  2ITD C;  3HB3 B;  1IZ3 A;  4R8C A;  5JCO A;  4RAI A;  2CDY A;  2OCC B;  4WFB V;  3TGU H;  2PI5 A;  5EZY A;  1O9H A;  1P4R A;  1RFY A;  4MT8 A;  4MTO A;  4DR3 O;  1Q82 W;  4LF6 B;  4PI0 A;  3JAL B;  3SDL A;  4TV9 B;  3VQV A;  3ABL B;  1BQZ A;  1SET A;  5LMN B;  1G6U A;  1SQG A;  1FXV A;  4QE9 A;  5KUM A;  2AHY A;  1XEQ A;  3RT3 C;  2XAH A;  4D7T A;  1MZF A;  5LGT A;  1MZE A;  3QVN A;  1NU1 H;  4JAA A;  5IY5 C;  5LMU O;  4X1Y B;  2WLK A;  1SS3 A;  2F43 G;  5LMN O;  3CX5 F;  4MS2 A;  2W0X A;  2Y48 A;  2R72 A;  4WF9 V;  5FPR A;  4IYH A;  1XQ8 A;  4PDV A;  3FYI B;  2ZNJ A;  2H8P C;  1VQ4 V;  4FLY A;  3L72 H;  1Z5V A;  1XI1 A;  2GSM B;  3IC9 A;  5KLV H;  2EIM B;  4NVP A;  3ZRV A;  4LFC B;  2EIK B;  1J95 A;  3F7V C;  4LC1 A;  2QWO B;  4JAV A;  5JVD A;  1HNW B;  3B2E E;  1NTK H;  3A0R A;  1KU9 A;  2ZE6 A;  3H01 A;  2F4V B;  2NN4 A;  1SER A;  1XUQ A;  4ZHQ A;  1H38 A;  1AB3 A;  4LFC O;  3G6B A;  1D5N A;  3J7A U;  1BQ0 A;  2PZS A;  3CB2 A;  1SZX A;  3JAR A;  2WSS G;  1TAE A;  2DWD C;  4TWK A;  3UO3 A;  2EJR A;  4X88 A;  3QO8 A;  1AR5 A;  1VF6 C;  3AG1 C;  1YJN V;  2F4V O;  1PNL A;  1I7F A;  1DLB A;  3CMA V;  2CE4 A;  1VQM V;  4TV8 B;  2ZD9 A;  1AI5 A;  3GVM A;  3CCU V;  1N36 O;  4LH6 A;  1SQV H;  4X66 B;  4GX0 A;  3ZHU A;  1M4U A;  1AR4 A;  3IAY A;  3AK1 A;  3ABM B;  3SPH A;  3EHB B;  3EFF K;  3P3N A;  1MAB G;  1JQ0 A;  1SQP H;  2E3C A;  5L3F A;  3U0Z A;  4LBE C;  1NI8 A;  4ZI7 A;  1XMQ O;  1PL4 A;  4GYC B;  1QHT A;  2IJI A;  2UU9 O;  2BSK A;  1R1B A;  5JJE B;  1ZSP A;  4FIP C;  3NR7 A;  3BCC H;  1OZ0 A;  1I5X A;  4PDR A;  1PPJ H;  1K97 A;  5CBG A;  1PM9 A;  3L74 H;  1VQN V;  2WPD G;  3JSN A;  2P67 A;  3CCV V;  5F2V O;  3UCS C;  3MHH C;  1IBL O;  4P30 A;  2VS0 A;  4DV1 B;  4LF8 B;  1DF4 A;  3AG3 C;  2RQ6 A;  2UU9 B;  3JYC A;  4JYA O;  4O4I B;  4PA3 A;  2QM8 A;  1G4Y B;  1RSO B;  4I7Z B;  3CCE V;  3SPI A;  4FM2 A;  4GKJ B;  2XND G;  3APQ A;  3B8N A;  1GH6 A;  3ABU A;  1AR1 B;  3QG5 A;  3SJQ C;  4ZHQ B;  4PI2 A;  2QKA A;  3AG2 C;  3JCU Z;  3N2G A;  4DR1 B;  4B3R B;  1X59 A;  1Z2G A;  1YCI A;  4JAU A;  1QQC A;  5J9P C;  5IDJ A;  3OMI B;  1PP9 H;  4O4J A;  2JGU A;  3EVK A;  4MVZ A;  5JH7 A;  3H1H H;  3IFX A;  4KXR A;  2IW5 A;  4JZ2 A;  5LXT B;  4I9W A;  1YTF D;  4IIJ B;  4U7O A;  4EFE A;  3FD9 A;  3ZHR A;  4UB8 Z;  4UFZ A;  1H8E G;  3MAQ A;  5J2T B;  4B3M B;  1IVS A;  1M57 B;  4KL1 A;  4I50 A;  5CA1 A;  5EYP B;  4MTF A;  1WPX A;  5L3G A;  1COW G;  4J42 A;  5KA5 A;  4O4H B;  4ZI7 B;  1VEW A;  3OFN G;  4NTX A;  3JAW B;  5LA6 B;  4JI2 O;  4B3T B;  3QF7 A;  4OX9 B;  1H2L A;  2P5O A;  5KAI Z;  2BCC H;  1KC8 W;  1MA1 A;  1K4C C;  4DUY B;  1GTO A;  4IT5 A;  1S76 D;  1JFF B;  1N34 B;  1D5A A;  3FYE B;  2X6B A;  1GN3 A;  1F7Y A;  2EZO A;  2OIG A;  3SYP A;  4JYC A;  2UXB O;  4X20 A;  4WFH A;  4GKK B;  1AI4 A;  1W2B U;  1QVF U;  1BT8 A;  3R65 A;  4LF5 B;  3IJ4 A;  2JIZ G;  2V7Q G;  3B4S A;  1CP9 A;  1ZX3 A;  4UCO A;  4UCT A;  3B40 A;  4MVM A;  3RFR A;  4A5U B;  2R9R B;  1N8R W;  1NR7 A;  4Q20 A;  5IJ9 A;  4RQF A;  3DXR B;  2JGD A;  2B9Z A;  4NTW A;  4UUJ C;  5CB4 B;  3ETQ A;  2VQE O;  3L9D A;  1K5S A;  3K06 A;  4LWS B;  4OPH A;  4L87 A;  1EM1 A;  4UXN A;  1JA8 A;  3X2Q B;  3RVY A;  5IE9 A;  4DR4 O;  3B77 A;  4NB5 A;  1KMI Z;  1YIT V;  5JCO C;  3MDS A;  4O2A B;  5DED A;  2ZR3 A;  2Q5Z A;  2GDS A;  5LGN A;  5KX5 A;  3OUF A;  4FFK A;  2YI9 A;  4BR6 A;  2EIJ C;  2ZR2 A;  1VQK V;  5IYD O;  1YDX A;  2EIL C;  2V4D A;  4B7K A;  3D36 A;  2A79 B;  3ZRW B;  1SA0 A;  3ZMZ A;  2OCC C;  3JD0 A;  4J41 A;  3RYH B;  5LGU A;  1VQ8 V;  2WLI A;  3QO5 A;  2ARH A;  5CA1 B;  3SR2 C;  1NJI W;  4QGP A;  1OCR C;  2BTO A;  2NLJ C;  4JI3 O;  4BIZ A;  3ABL C;  2QE7 G;  2ZCE A;  3RYF B;  3B8M A;  3UO2 A;  3WU2 Z;  2Q68 A;  1OHH G;  3U10 A;  1S3J A;  3HKC B;  3KKY A;  4CC5 A;  2PYL A;  3IC7 A;  3TXQ A;  3AK2 A;  1IXM A;  1Y76 A;  5JH7 B;  4DV5 O;  4OGQ B;  4TV8 A;  4K0K B;  5EYP A;  4HNA A;  1TVK A;  4YJ3 A;  5KHK A;  2JS3 A;  2EX3 A;  4AI8 A;  2JS5 A;  1K9M W;  3CD6 V;  2P06 A;  3OEH G;  1H2N A;  4JI8 B;  1M56 B;  4U7N A;  1FPO A;  1W59 A;  4CBC A;  2QA4 V;  1BSM A;  4J80 A;  3DC6 A;  2ZNI A;  2H94 A;  1I5Y A;  4BW9 A;  5CA3 A;  2ZQM A;  3JAL A;  2ZE7 A;  1IBK B;  1FJG O;  2WA3 A;  2GHY A;  4K8X A;  3ZMV A;  4D6T H;  1TUB A;  3CPW U;  1BE3 H;  4CZZ A;  1VQ5 V;  4FMT A;  2K9P A;  5KMG B;  4EEQ A;  3K04 A;  5EK0 A;  4FM0 A;  5IY5 B;  3SPJ A;  2F66 C;  2XAG A;  4MTX A;  3Q4H A;  1ARO P;  1XMO O;  2JGD B;  2XHB A;  1JMK C;  2HP8 A;  3ASN B;  5BMV A;  2UXD B;  4YHH O;  2DN9 A;  2Y0I A;  3E83 A;  5GW7 A;  4JI4 B;  2Q73 A;  2KKW A;  2CH7 A;  4DV3 B;  3K79 A;  1T5E A;  4N21 A;  4DV6 B;  1SES A;  2B1I A;  1ORQ C;  1NZ6 A;  3E89 A;  1FXH A;  3SPG A;  4DR5 B;  4QJF B;  3O65 A;  3RN4 A;  2Z0A A;  1D2D A;  1MSD A;  2MW2 B;  3HKB B;  4OX9 O;  1YXB A;  2P22 C;  4X1I A;  2X6A A;  5AG2 A;  3AG3 B;  2UUA B;  4JYA B;  2Y4T A;  3BA8 A;  3NXS A;  1XOU A;  5J2U B;  2AW9 A;  3K0G A;  4JYY A;  3KCY A;  3QNE A;  2UXB B;  3D8C A;  1B6Q A;  4ASU G;  4BIO A;  2Q7H A;  3JD3 A;  2DYR B;  3G6E V;  3ETG A;  1VQP V;  1TUB B;  1BHA A;  4O4L B;  4B3S B;  4DV0 O;  2CGN A;  1B3Q A;  5EBL C;  4XDJ A;  2N74 A;  5IWA B;  2MK3 A;  3I5D A;  1F51 A;  4X1K A;  3LSS A;  3LDE A;  1Q3E A;  1YEW A;  4H37 A;  2HHH O;  3LDD A;  2QTS A;  1VQ7 V;  3N2K A;  3DGE A;  4TV9 A;  2DJV A;  4IHJ A;  4PDM A;  1QNM A;  3TJT A;  3ZHS A;  4LH7 A;  3LDC A;  3CCM V;  1GRJ A;  5CN0 A;  2GTS A;  3Q4H B;  5E79 Z;  2Y4U A;  3VQX A;  1E79 G;  3CRQ A;  3CJH B;  1BL8 A;  4FFB A;  2WLJ A;  3CRA A;  2ZDI C;  2RNB A;  1ROP A;  3AG1 B;  2LO1 A;  4QNH B;  2HFE C;  4LFA B;  1R6T A;  1AJQ A;  1ZTE A;  1YZB A;  2CUG A;  2OIE A;  2QKC A;  2LW7 A;  1DGS A;  2LJ2 A;  1AI6 A;  1XNR O;  2HLD G;  5EZY B;  5D5P A;  1TA8 A;  2ZIO A;  1UFI A;  2JK5 C;  4FK5 C;  2W6I G;  1KD1 W;  4G2K A;  3VQY A;  2RDC A;  3U11 A;  3ZBH A;  5GTI Z;  3T1H O;  1V55 C;  1VP7 A;  1GN6 A;  2CTW A;  3O9O A;  2UUB O;  5L3B A;  1J5E B;  2WAM A;  1TUE B;  2EBO A;  4GX5 A;  4K3A A;  4CS2 A;  2AGA A;  4X1I B;  3N27 A;  4UV9 A;  3T2M A;  3T1H B;  3P30 A;  4HYO A;  2ZE5 A;  1XHX A;  1NTM H;  1VF7 A;  3HR0 A;  1K4D C;  1S5J A;  1R6K A;  2A3Q A;  3RVZ A;  1WP8 A;  4DR2 O;  2QM7 A;  2QR4 A;  2QTO A;  4N23 A;  2XOK G;  1S72 V;  3JAS A;  4GCZ A;  1R3L C;  4LF4 B;  1X4T A;  4WFF A;  4R6Z A;  1U96 A;  1AI7 A;  3RYC B;  4GX2 A;  3L75 H;  3OTO O;  3ZHT A;  1I08 A;  2O57 A;  1OCC B;  4I55 A;  2UUC B;  2UXX A;  2XT9 A;  2YS8 A;  5ITZ A;  5IYZ B;  3SYO A;  3I56 V;  4LF6 O;  4I0X B;  4JTD B;  4LR3 A;  1G1X B;  5GON B;  3K5O A;  5LHI A;  3K03 A;  4XDL A;  1HNX O;  4I50 B;  5KHI A;  3TXS A;  3OTO B;  1RP3 B;  2YIA A;  1DTO A;  3OT7 A;  3F5W C;  2YIB D;  2FML A;  2UUC O;  4PHZ A;  1AIL A;  4JAS A;  2Q69 A;  4Q6G A;  5JWP A;  1MOF A;  2HVJ C;  3AK3 A;  4FJC C;  2YEV A;  4ICG A;  4DUY O;  4LCU C;  3W7U A;  4ZOL B;  5DM6 V;  3EXA A;  2EIN B;  3A0B Z;  5IJ0 A;  3S3X A;  1GKF A;  3VOU A;  1IX9 A;  3BAA A;  2PI4 A;  1NQT A;  2JEX A;  3QO7 A;  1XBL A;  1H2M A;  2W6J G;  4OPA A;  3P3P A;  2A0L A;  1QR8 A;  4LP8 A;  1JCH A;  5JQG A;  4Z2W A;  4LF7 O;  4U3J A;  1K33 A;  2RJZ A;  4PDL A;  5LYJ B;  2B1G A;  2DYS C;  4LFB O;  1K34 A;  1GMG A;  2HVK C; 
#chains in the Genus database with same CATH homology
 4LF5 O;  4JI7 O;  4JYA O;  1N34 O;  4LF8 O;  4DR5 O;  3J80 N;  3J81 N;  4LF9 O;  5FLX N;  4JI4 O;  1FJG O;  1KUQ A;  4GKK O;  4DV3 O;  2VQE O;  4X64 O;  3T1Y O;  4JI8 O;  4DR2 O;  4DR7 O;  4DV0 O;  5BY1 A;  5IWA O;  4X65 O;  4AQY O;  1NS1 A;  1HNZ O;  4YY3 O;  1XNQ O;  4OPH A;  2N74 A;  4K0K O;  1AB3 A;  1X59 A;  4DR4 O;  3OTO O;  4LFC O;  1IBK O;  4GKJ O;  5LL6 Y;  4DR1 O;  4B3T O;  2HHH O;  3J7A U;  5BR8 O;  1HNW O;  2DJV A;  4LF6 O;  2FKX A;  1J5E O;  4B3M O;  1G1X B;  4NXN O;  5A2Q N;  1HNX O;  2F4V O;  4KHP O;  1HR0 O;  1N32 O;  4B3R O;  2VQF O;  1XMO O;  4DUZ O;  4JI5 O;  2ZKO A;  2UUC O;  2UXD O;  2UXC O;  1N36 O;  4DV7 O;  1AIL A;  4DR3 O;  4JI0 O;  3JAM N;  3SDL A;  4DR6 O;  5BXZ A;  4JI3 O;  4YHH O;  1R6T A;  4JI1 O;  4DUY O;  2ZM6 O;  1N33 O;  3R66 A;  1YZB A;  1A32 A;  4LF4 O;  1I94 O;  2LW7 A;  1XEQ A;  3F5T A;  3RT3 C;  1XNR O;  2JRI A;  4DV6 O;  1FKA O;  4JI2 O;  4OPA A;  2E5L O;  1XMQ O;  3M8A A;  2DOS A;  5LMU O;  1IBM O;  4LFA O;  4DV5 O;  2UU9 O;  4DV1 O;  4LF7 O;  1R1B A;  5LMN O;  3T1H O;  1FYJ A;  1F7Y A;  4JV5 O;  3O65 A;  5IT9 N;  2UUB O;  2Z0A A;  2UXB O;  4JI6 O;  1D2D A;  4DV2 O;  2UUA O;  4X62 O;  4OX9 O;  5H5N A;  1DK1 A;  4LFB O;  4B3S O;  4DV4 O;  4NXM O;  1IBL O;  4A5U B;  4X66 O;  2AGA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...