4DUZO

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c, bound with streptomycin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
87
structure length
87
Chain Sequence
b'PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome/antibiotic
publication title A structural basis for streptomycin resistance
rcsb
total genus 31
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4duzO00
4DV1O 4JI0O 4LF8O 3JAMN 4DR4O 5BY1A 4LF7O 5LMUO 4OPAA 1HNWO 5H5NA 1R1BA 1X59A 4DR5O 4LFBO 2UUBO 1F7YA 1XNRO 1N33O 4B3RO 4NXMO 1I94O 4X64O 1D2DA 4DR1O 4JI8O 5A2QN 4GKKO 3M8AA 1XNQO 4JYAO 4DUZO 1FKAO 2JRIA 2VQEO 2DJVA 4DV4O 1FYJA 4DR3O 2ZKOA 3T1YO 4JI4O 4DV3O 1IBKO 1R6TA 4DR7O 3T1HO 4LF4O 5IT9N 4YHHO 2HHHO 4B3TO 2Z0AA 1YZBA 1XMOO 4DV5O 4K0KO 1A32A 1XMQO 1DK1A 2UUAO 4JI5O 4X62O 1XEQA 2VQFO 3RT3C 4X65O 2ZM6O 1N36O 1AB3A 4LF9O 5BXZA 3J7AU 4GKJO 2AGAA 1NS1A 4DR6O 4JI7O 4B3MO 3SDLA 2FKXA 1N34O 3J81N 4A5UB 1IBMO 5LMNO 2UU9O 2F4VO 4DR2O 3F5TA 4JI6O 4DUYO 5LL6Y 5FLXN 3J80N 4X66O 2UXBO 4DV6O 4DV7O 4B3SO 4JV5O 1HNZO 4DV0O 1HNXO 4DV2O 2UUCO 4LFCO 4OPHA 4JI2O 5BR8O 4JI3O 5IWAO 4OX9O 3R66A 4YY3O 4LFAO 1AILA 3O65A 1J5EO 2DOSA 4JI1O 2E5LO 4NXNO 2UXDO 1N32O 1HR0O 1FJGO 2UXCO 2LW7A 1IBLO 4AQYO 4LF5O 1G1XB 4KHPO 2N74A 3OTOO 1KUQA 4LF6O
chains in the Genus database with same CATH superfamily
1N36B 3P32A 4I4TB 3IJ4A 3G4SV 3LSSA 1Q6UA 1HNWO 3FX7A 1X59A 1URFA 2OIEA 2VWKA 2EULA 2YXHA 2UU9B 4NYKA 1H38A 1ZWIC 2Y69B 3L73H 1AI7A 5H6QA 3K79A 1AJQA 5D5PA 4DK0A 4DV0B 4TUYA 2R9IA 2A7WA 1WAZA 5CBHA 2JS5A 3S3XA 4WBNA 4K0KO 3FB6C 3KKYA 5FNVA 4Z1MG 4FMTA 3K5LA 4B3TB 2OYQA 1G8MA 2NR5A 3GB7C 4LF9O 4GKJB 1JOYA 3JD4A 1FAFA 4X1KA 2PTMA 5EBMC 4JI7O 1U96A 2N05A 1I5YA 2ZM6B 1BZKA 4DR2B 2IJIA 2AHZA 5LP6C 2EILB 3G80A 3VOUA 1HW7A 3ZHRA 2UXBB 1MZEA 5B1AB 1GN3A 4AILC 3UO3A 4PDMA 3PN1A 4TQFA 1KU9A 1GO3F 2OCCB 2RN9A 4I4TA 1NI8A 4OPHA 4PA9A 4P9OA 4GT1A 3ZS8C 4H44B 1SRYA 1M56C 4O4JA 3RYFB 1YTFD 3N2KA 4UVBA 1EN5A 3L71H 4IGGA 2Z3YA 2OCCC 5FPRA 3OAAG 4PI2A 1G1XB 4BW5A 2N74A 4JI7B 2EBOA 3OMAB 3JAWB 1R6NA 5CB4B 4YJ3B 4DO2A 5LMUO 4DR6B 2Q67A 3FD9A 2P6JA 4QNHB 1UFIA 1I94B 4ZHQB 3OTFA 4PDVA 1DF5A 5CMUA 4GUNA 3K59A 1XUQA 5LP6A 3H1KH 3H1JH 4JV5B 4D7TA 4DV4B 3T1YB 2ZKOA 1AP6A 3ZMVA 3C90A 3ZMZA 4LF4B 5C93A 4MVUA 2GTAA 3LDCA 4FZ0A 2KG7A 4JI5O 4ZI7B 2IU0A 2YEVB 1SQVH 2EZPA 3RYCA 1AB3A 4B7EA 1SKVA 3CX5F 2GBOA 3WFVA 4DR6O 3RVYA 5LYJB 1P7GA 3JALB 1QU7A 5IYBO 1IBMO 2XAHA 3OMIB 1SQBH 3N2GA 3E89A 3F5TA 2HVJC 2QM7A 2ADQB 1DF4A 5GONA 3HKCA 1Y76B 5BZBA 4DV7O 1I7FA 1TUBA 2LGQA 4GKKB 4FLUA 3GWOA 2ITDC 1SC5B 2DYRC 1K7DA 4W4KA 5CA1B 1WJZA 4UVCA 5J2UA 4DV2B 2E3CA 2CE4A 1QLEC 4MTFA 4NXNO 2B1IA 1VP7A 1NTZH 4JZ2A 3BA9A 3SJBC 4LF5O 2KKWA 4Z1VA 3OTOO 1L1FA 1RSOA 2HR3A 1BSMA 3ZRWA 3CCSV 2KSDA 2CH7A 2F93B 1KKDA 3CP1A 2CTWA 4WF9V 4MTXA 4ZOLB 1WP7A 4GKKO 1H2NA 3ASNC 3OD4A 2VRZA 1VF6C 3VQYA 3FB7C 2P5OA 3EHBB 5GW7A 5B66Z 2DJVA 2QA4V 3HKDB 3K9AA 1M57B 1P7BA 2Y0PA 2Q7GA 3KCYA 5B1NA 4TWKA 3T1CA 1P49A 1WA8A 5JVDA 5K1PA 5KMGB 2CH7B 1EN6A 2QKCA 2KQXA 4NXNB 2ADPA 4DV5O 2PUSA 1D5AA 4FFKA 3ETEA 1BGYH 4KXRA 4UCOA 2UXCB 3RT3C 3CWBH 5A9GA 4Q6GA 2NN4A 5L3DA 2CUGA 2RDCA 1NVPD 4UVAA 3IFXA 1R3KC 3K57A 2KB1A 1QLEB 5H6RA 1N0JA 1YF2A 2XNDG 3T4ZA 3HKCB 1JQ0A 4B3RB 1MZFA 5GONB 1HP8A 3AG1C 4FFBB 1SA0A 1WB7A 2X6AA 4CBCA 2YXLA 4OX9B 4X8AA 3AK2A 3QO7A 2R9AA 5BR8O 2Z5UA 1R3LC 4TUYB 3AG3B 5IYZA 2PI4A 1J5EB 2QR4A 3N2GB 1K8AW 4PELA 4FFBA 3CJHA 1FJGB 4CZZA 3TXQA 2UXCO 3ETQA 3W7UA 5EZYA 4R50A 4YJ2A 4Q20A 4DRXA 3QF7A 3ZBHA 4UCUA 2WA3A 2WLMA 4O4IB 4O4IA 1BL8A 4K0KB 3SYQA 2EIMC 1FFTB 5B1OA 3UQ8A 3S3WA 4B3RO 5LMNB 5D5QA 1S5JA 2WLKA 1RM1B 1FS0G 3APQA 5JCOA 1G4YB 1KYOF 4FM1A 4UV8A 5LHHA 4JYAO 1WPBA 1LUWA 3OR7C 1IXMA 3MHHC 4O4LA 5L3GA 2OTJV 1SQFA 4DV4O 4J80A 4UCSA 1SF9A 2BE3A 1VQKV 3SPCA 1O9HA 1K5SA 2HHHO 2PYJA 2CTRA 4FLXA 1YZBA 3P3PA 5KAIZ 1A32A 4JTAB 4JI1B 3RYIB 4X88A 1FXHA 3CC4V 5LXTA 4KUMA 2FTKA 2ZT9B 3MHSC 3ZHTA 5IY5C 1K33A 2P4VA 2GHYA 2AW9A 4GLXA 1AR4A 1H2LA 2P06A 3J81N 1FD9A 1MSWD 1FFXB 4KP4A 2XT9A 3OR6C 4G28B 4FIPC 3CCMV 1BHAA 2F4VB 1WPXA 1PNKA 4PA7A 5JH7A 3RYIA 2A0LA 1HNZO 1F4NA 2O57A 4IL6Z 4WFFA 3HKDA 2EIMB 3ETGA 4X1KB 1OCCB 4PA6A 1GRJA 2WLHA 4MVOA 3E22A 1CPYA 4LCUC 2W6IG 2LP7A 1NQTA 1XHXA 1OCRC 2H3OA 4JI1O 1RPRA 1N32O 3CJHB 3AEIA 1OCCC 5KHHA 3CRRA 4WCEV 3OUSA 1HR0B 3ZMSA 3BCCH 1T5EA 1KP2A 2EIJB 4JI0O 4QPJA 1D5NA 2ZINA 2UUAB 2EINB 3H1LH 3CXHF 4ZIBA 3UCSC 4LFBO 1CXZB 3M7MX 3STZC 2QSAA 1B04A 1IXBA 1I0HA 3RWRD 3GVMA 4PV1B 3ABLB 3OFNG 2Q6AA 3SJAC 5A2QN 1YDXA 2QM4A 4X1IA 3L75H 4NTXA 1K92A 2M7WA 4OGQB 4DR3O 1E79G 4RAIA 3D8CA 4EFBA 5LYJA 3CHXA 5KHKA 4YHHB 4TQDA 4F6RA 5LGTA 3D36A 1AI4A 2QKSA 2JDIG 1Y76A 4AI8A 1YITV 3X2QB 4O2BA 3ABTA 2PY5A 1FXKA 3T4DA 1NR7A 4UB6Z 5CN0A 1H2GA 1N34O 1PNLA 3CSXA 1WB8A 3QG5A 4NKGB 3IC9A 2Q7EA 1E1RG 1EZJA 2N04A 4DV6O 3ZRVA 3KZIZ 1ZUQA 4WFGA 1I08A 4YY3O 2VQFB 3O9OA 5B1BC 3OTOB 4J9YB 1B3QA 3VBBA 3RYHA 4DV1O 1OV9A 2YIDA 4DR4O 5KUKA 1V54B 3CCEV 3JD2A 3WB2A 4CS2A 3LNMB 3Q4HA 5B3SB 1TA8A 4X66B 3CCQV 2YI8A 1HNWB 4JF3A 1S5HC 2P22C 3LNNA 5ITZA 1V54C 3WU2Z 3K5MA 1B06A 1K4DC 3HB3B 5H9CA 3LSQA 3LSUA 3JALA 3CMAV 4UV9A 4DR7B 1JJOA 2ZR2A 2AZ2A 1EZVH 1UPGA 1DGSA 4KHPB 1WLEA 2Z0AA 1BQZA 1K34A 1P84F 4ZI7A 1I5XA 5BR8B 4X62O 4IIJB 4X1IB 5K1XA 5C8YB 2LFRA 5C8YA 1MABG 3OMNB 4I50A 2LO1A 5LGUA 4HBNA 4BIOA 2Q7HA 2FKXA 2DE0X 1FFXA 4WFBV 2UU9O 4AQYB 2GV9A 2HEPA 4QIWF 3H9VA 3UT5A 4WBNB 1NH2B 4JI8B 4O4HB 2X6CA 4PDRA 2LFSA 2YEVA 4MTGA 4ZHQA 5E79Z 4AHCA 5JQGB 1F4MA 1SQXH 5JCOC 4HNAA 4UB8Z 3HPLC 1U97A 1NZ6A 3I56V 3JD0A 3CRAA 3CS5A 2AXTZ 2Y4UA 4HZ3A 1SERA 4I7ZB 4TV9B 3TCUA 5IWAO 1L0LH 5KA5A 4FLYA 4XDKA 1K4CC 3F7YC 4X62B 1AI5A 1Y74A 5LP6B 1PPJH 2WWWA 4LC1A 5EYPA 4DXWA 4X1YA 3CC2V 3BHPA 1PKXA 3ZRSA 4NB5A 1LNQA 4OXSA 1VQ4V 4DR5B 4NXMO 4L8JA 2ITCC 1VF5B 3JATB 3WG7B 4QE9A 3M8AA 3CPWU 3B77A 2QEXV 4YJ2B 2B9ZA 2V1DA 4FLZA 2RJZA 1MOFA 3K03A 2ZIOA 5L3CA 1F23A 2F66C 1R3IC 3W7WA 1YXBA 4J11A 3DC5A 3SPGA 4PA4A 4R6ZA 2H94A 1MA1A 5IY5B 4XDLA 2HFEC 3ZN1A 4J42A 1KUQA 4CH6A 2EIKB 2QTSA 1FXKB 3JD3A 5BXZA 2ATKC 4L87A 1Q86W 4NR1A 1KQSU 2JVDA 1O9GA 2ZXWC 4K3AA 2F4VO 2JJ2G 4TT3G 1NTKH 4R8CA 1RFYA 3UT5B 3ZMUA 4JI6O 4LF7B 2L35A 1L8DA 3THOA 5LL6Y 4DUYB 5F2VO 5FLXN 1OCOC 4JI0B 2XAGA 2BTOA 2HVKC 2QE7G 3H1IH 2IW5A 1XL4A 4F6EA 3SYAA 2ZXWB 5JJEB 5DEDA 3FAVB 3DXRA 4LFAB 2RNBA 4DUZB 1WA8B 4UXNA 1AILA 3QO5A 1Q90D 4JGSA 3JSNA 2JEXA 2ODMA 2QWPB 1HR0O 4U3JA 4J41A 3A0RA 5IJ0A 4W4LA 1MMMA 3CRMA 3DGEA 3A8TA 3JASB 4FLWA 4N21A 4NTYA 3SJQC 2G38A 4X9QA 1W0JG 4LR3A 4LF8O 3RYHB 4LF5B 1QVGU 2X7RB 4JYYA 1R1BA 1S0VA 2W6JG 1K5QA 3OM3B 3RN4A 3WB1A 1KBHA 4MVZA 4IYIA 3QNEA 1K3EA 3T2MA 1N4CA 4IT5A 5FL7G 1FXVA 3CCRV 1N34B 4ZOLA 5B1BB 4FLTA 3K5OA 2HLDG 1VQ9V 1VEWA 4HAMA 1SETA 1FYJA 3E8GA 3OEEG 3T1YO 4B08A 4DV6B 1JFFA 2XAQA 1ORQC 5JVDB 3WB0A 5J2TB 5IT9N 3T1HB 3ABLC 4LH7A 3ABKB 4UCVA 1R73A 4C7UA 2E5LB 2UXNA 3OEHG 3ASOB 3AG7A 1VQ6V 3MD0A 1NS1A 4GX1A 3JAKA 1VF6A 4J7KA 2ZDIA 1K73W 5DN6G 3CRCA 2YC0A 4JYBA 4RUFA 1M90W 3J80N 4PDLA 3C3TA 2P4KA 4DV1B 2HP8A 2BTQA 3BAAA 1TUBB 3ASOC 5IYCO 2PZSA 4I55A 5IDJA 1JMKC 4LFCO 3K04A 3EVKA 5IJ9A 3G71V 4OX9O 5KHGA 2UUCB 3IGAC 1XREA 3D3IA 1YI2V 3O65A 1W59A 1QR9A 1GN4A 3LDDA 2Y4TA 4RUEA 2XHBA 3NR7A 1Q82W 2XAFA 3UKMA 3BY6A 4DR4B 1SA0B 2YIBA 3AG4C 3JAKB 1TUEB 3JCUZ 1GM9A 3LUTB 1M9NA 4FZ1A 1ZSPA 4RQFA 3ABKC 1N33O 5IYZB 1RP3B 2DWDC 2JIZG 1E1QG 4X64O 3U10A 2JGDA 1IX9A 3RYCB 4LNUB 2Q73A 3A0BZ 4H33A 5L3FA 2LGWA 3AG2B 3FYEB 4JZGA 5LOVB 2QGNA 1R6TA 3HKEB 2PGGA 3HKEA 1QLNA 1JR9A 5HFLA 3CMEV 2EILC 4IHJA 4DV3B 1XMQB 2QTOA 1S5LZ 3AK1A 3AG2C 2HHHB 1VQNV 4LNUA 3A0HZ 3AK3A 1N36O 3OE7G 3EFFK 3RBZA 4TOIA 1WP8A 4UCTA 3FAVA 1EM1A 4DUYO 1IVSA 3CC7V 3CEIA 1QHTA 1SQGA 2PF4E 4EB6A 2QM8A 4B3SO 4JAAA 2X6BA 4R7CA 4X20B 3E8BA 1VARA 4FLVA 5GTIZ 1VQ7V 1GK9A 1R6KA 2OCHA 4JI2O 1JPXA 3TXSA 1AJNA 3TK1A 1M57C 3CXCU 5CA1A 2EX3A 2XAJA 2R9RB 4QGPA 4WFEA 1J5EO 3BABA 1M1KW 3BPZA 1KMIZ 3FYIB 4CS4A 1IZ3A 1ZL8A 3BEHA 3SGIA 3U11A 1FJGO 2LW7A 4MVQA 3OGCC 3U0ZA 2V7QG 1JJ2U 3E2EA 1EFRG 5IYDO 3LDEA 4RO2A 4I50B 3DXRB 1RPOA 5KHIA 2YUAA 3TETA 3ZRXA 2OT5A 2BOBC 2GUZA 1OCRB 5EC1C 4JI3B 2P7TC 2ILMA 3OW2U 4MVSA 4JYAB 1ENVA 4DK1A 1PL0A 5GTHZ 4JPRA 1WNSA 3B4SA 1GAXA 3ASNB 5KX5A 2QWOB 3CCVV 3T1HO 2DQ3A 1OJHA 3ABMB 1V55C 4DR3B 5FPOA 3ZEDA 2KG7B 1KP3A 4H37A 5KMGA 2UUAO 5KA6A 1Y74B 1Z2GA 1S72V 3B8MA 1Q6HA 4GX0A 2QWQB 2GTSA 4G2KA 3ZN0A 4U3FH 4B3MO 2Q0OC 3N2KB 5B1AC 4EKWA 4FJCC 5CBFA 1WN7A 3SYOA 2Y48A 2F23A 4JV5O 4GX2A 3CD6V 3P3NA 2IU3A 4U3JB 1HNZB 5KLVH 1ZAUA 3H1HH 3A2FA 2ZE7A 3DC6A 3B09A 4UUJC 4TV8B 2WLIA 2YIAA 5KUMA 5EIBC 2RCVA 1MSDA 3FFQA 2AZ0A 3G6BA 2CAZC 2EIKC 1MNGA 2FB5A 2Q8VA 4GX5A 4PD4F 2ETNA 3CYOA 4J7JA 4JASA 1H8HG 1SESA 4O2AB 4LWSB 3W7TA 5BY1A 3E35A 1PV0A 4I9QA 4LF6B 1HNXB 1ZTEA 2IM9A 1YJWV 4ICGA 1OCZB 2JJ1G 2RMKB 2DYSB 1OHHG 1VQ8V 2BOCC 4JTCB 5CA0B 1NJIW 2GDSA 4O4HA 1XNQO 2YS8A 3B40A 1S76D 4BWAA 4JTDB 3K06A 3KCXA 2LJ2A 4YHHO 1Y6XA 1SQPH 3CCUV 4LFCB 3OGIB 1DK1A 2NNUA 4X20A 1NTMH 2MW2B 4JAVA 2YXYA 2ZQMA 3IC7A 4FK5C 3ZHSA 3E83A 2CGOA 1M93A 2UXBO 4JI4B 3FKSG 3CRQA 2V4DA 4DR1B 2ZE5A 3MAQA 2UUCO 4KFMA 2WLNA 3L9DA 1KKCA 3L72H 1BMFG 1XI1A 3E8HA 4PA3A 5L3EA 2F95B 1VIBA 1NBMG 2W0FC 4O4JB 2A3QA 1GTOA 2K9PA 1M56B 4O2BB 3ZMTA 4AQYO 1NR1A 2CDYA 1GN2A 5HFMA 3STLC 1UJWB 4LH6A 5JJNB 3D36C 3BRCA 4J9ZB 5LHGA 5LMUB 4X64B 1IDSA 2Q0AA 4XBFA 1W0KG 1ZLZA 1AP5A 3RVZA 4ZBMA 4NTWA 4DR1O 2M6YA 4NXMB 4IIJA 3JASA 2PI5A 2VQEO 1ROPA 2DN9A 3ZCCA 1S77D 3F5WC 4DV3O 4DR7O 2CGNA 1GN6A 3K5NA 4LF4O 3RGBA 4B3TO 1CP9A 5CBGA 3RYFA 1SZTA 3DSQA 1HWYA 4I0XA 2X0LA 4ABMA 5L3BA 5LHIA 2UUBB 2ZM6O 4CC5A 3OUFA 2AGAA 2Q69A 2ZIMA 2XTAA 1G6UA 1SZXA 1VQPV 3OT7A 4MVMA 1CEZA 3AG1B 5LMNO 5B3SC 2ARHA 2GSMB 3W7SA 1Q81W 2ZNJA 3IAYA 1V55B 3I5DA 4MT8A 4JAUA 4U7NA 4DW0A 4G27B 3VQXA 2FMLA 4N23A 4I0XB 4UFZA 3FB5C 3TJTA 1H2SB 5DM6V 3CCJV 1NKDA 4K35A 3QTCA 3I55V 4JI3O 3G6EV 3E22B 5EK0A 2VWJA 1GMGA 2DW4A 3G67A 4FPPA 5J2TA 1YSCA 3JARB 2A06H 4P30A 1XMOB 1PM9A 4LP8A 3SPHA 3FB8C 1XILA 1H8EG 2QKAA 2CK3G 1Q3EA 2ZE6A 4LWSA 3ZX6A 1PL4A 4Z2WA 4CC6A 4TV8A 1YHQV 4JI5B 3CB2A 3D3QA 4DR5O 2WLLB 3ZHVA 4H0LB 2JK5C 1XNRO 2F1MA 4CS3A 4K8XA 4J10A 2Y69C 4ZKIA 5J9PC 1NVPB 1D2DA 1EN4A 4DUZO 1LUVA 3JSLA 4DW1A 2YIBD 5IJ0B 2OTLV 3L74H 4BIZA 3ABMC 2LQTA 1F51A 3N27A 3AG3C 3B2EE 4QE7A 1IURA 1JA8A 4EEQA 1IBKO 3SYCA 5LBQA 3ZJZA 2ZE8A 2F43G 2EINC 4BAYA 3BFRA 1N32B 4RWUA 4IHJB 1XMOO 3QVNA 4LF8B 2GUZB 3NXSA 1MG1A 4O4LB 1AROP 2FYUH 1Q5OA 3M99B 2IJKA 2JEUA 1M5IA 4ASUG 2YSUB 3SDLA 4X65B 1S3JA 2QJ1A 1VQOV 4F6RB 4MW8A 1QBZA 4DV7B 1GM7A 3WG7C 3SPJA 5CA0A 4X66O 2QWNB 4DRXB 2BSKB 1HNXO 1KC8W 4E4EA 3K0DA 4DV2O 5KHJA 4MW3A 5IJ9B 1Y66A 3ML0A 2Q4PA 5EBLC 3ZIAG 4O2AA 3P30A 3JYCA 2WA4A 1GKFA 4LFAO 4QJFB 3TGUH 1AR1B 2Q5ZA 4EB6B 2VS0A 1VQMV 2UXXA 2UXDO 4U7OA 1ZL8B 1XQ8A 4YIPA 1XBLA 2BSKA 2WSSG 5JH7B 3QO8A 2CTPA 4IYHA 2E75B 3ICXA 4LF6O 1K97A 4DV5B 3BA8A 4MS2A 1KD1W 1B6QA 2YICA 4FM0A 5H5NA 3CE2A 5EC2C 4YIOA 2XUMA 3KG2A 2E74B 1BE3H 4JI8O 1NH2D 1YVWA 1Q8IA 1PNMA 5EYPB 4KL1A 3RW0A 2NLJC 3UM7A 1OZ0A 2EZOA 3R65A 4PI0A 2VQEB 3JAWA 5LOVA 1JFFB 4JI4O 4FVMA 2WLIB 2JS3A 1K9MW 2IJJA 1QQCA 2B5UA 4GZRB 2XASA 4P2ZA 2UXDB 1XEQA 3HR0A 4I5SA 5JQGA 4CH4A 3J7AU 4TSFG 2ZNIA 2DQ0A 1RSOB 1TVKA 4D6TH 5KX5B 4LF9B 3C3SA 3VQVA 4FM2A 4UCRA 1QCEA 1OCZC 1THZA 2FL4A 5DECA 2DMXA 1R3JC 4CH5A 4D7SA 4DV0O 2EJRA 2HKOA 5BMVA 1VMGA 2QWRB 2K1EA 4B3SB 3ZRWB 4I55B 4P9PA 2B1GA 1Q7YW 3JCZA 2AHYA 3PJSK 5LA6B 4JI2B 3X2QC 5LA6A 2DOSA 4BW9A 2R70A 2P90A 1YJNV 4MVRA 1N8RW 2HJDA 2A79B 5ITZB 3ABUA 5B5EZ 2L6LA 5EZYB 2MK3A 3APOA 2C2AA 5BMVB 1H2KA 5J2UB 4BR6A 4GCZA 1QVFU 4OPAA 3K58A 2UUBO 1F7YA 4QPKA 1W2BU 1N33B 1Z5VA 4I9WA 1PP9H 3DTUB 2ZCEA 2EIJC 2ZD9A 3E8FA 2JRIA 2RQ6A 1VF7A 1XOUA 2DYSC 2WAMA 2WLJA 3B8NA 2D2CB 1NT2B 1Q6IA 4YJ3A 1JCHA 2BCCH 3CCLV 2LW1A 1OCOB 3SPIA 2WLLA 2BTQB 4LBEC 2Q9LA 1Y67A 1DLBA 3VQWA 2CTQA 1TGOA 4B7KA 1XMQO 1AI6A 3ZHQA 1IBLB 1TVKB 4GKJO 1HDJA 3MDSA 3HKBA 1COWG 2IJHA 1Y4MA 2YDEA 4DYLA 3AG4B 1YIJV 4DR2O 2XOKG 4GYCB 4B3MB 3F7VC 2DYRB 4EFEA 4WFHA 1XDCA 1JX9A 3SJCC 1L0NH 1P4RA 1QNMA 5LXTB 2IBZH 5EIBD 2D3OW 2WPDG 4TV9A 4MSWC 1QR8A 4YY3B 3R66A 3H01A 2Q68A 1NU1H 5KAFZ 1BCCH 3JD1A 1N0NA 1EBOA 2ZDIC 1Z5WA 5AG2A 1SS3A 5IE9A 3EXAA 1VQLV 4MTOA 1VQ5V 1IBLO 2JGDB 1V9PA 3ZHUA 1KB9F 4XDJA 4BIUA 4LFBB 4HNAB 1XNRB 2HJFC 3JAMN 1BQ0A 5TISZ 1SQQH 4JI6B 1RM1C 1YJ9V 4LF7O 1BHBA 2IH3C 4H13B 1M4UA 5EBWC 2JGUA 3GWKC 5FNVB 1BS3A 4J7ZA 1I94O 4X89A 2W0XA 3SR2C 1FKAO 1AJPA 4PHZA 1IBKB 3SYPA 4CH3A 1XNQB 3E86A 1BT8A 2ZR3A 2OIGA 2HG5C 4YXWG 5CA3A 1AR5A 4WFAV 1XL6A 4F4LA 1H2MA 5E1AC 1YCIA 1FXKC 1Q43A 1ZX3A 2OWOA 4K8ZA 2VQFO 4X65O 1JVMA 2QDOA 1AVMA 3K0GA 4JYCA 1XHZA 4A5UB 3L70H 1IBMB 1YEWA 1GH6A 2IH1C 2A9HA 4RQEA 3W7XA 4E2LA 3Q4HB 2Y0IA 2PYLA 5JWPA 4PJ0Z 3UO2A 2YI9A 3JATA 1KECA 3HKBB 4X1YB 1DTOA 5LGNA 2R72A 1US6A 5CB4A 5IWAB 5JJJB 3K08A 4NVPA 1J95A 3RFRA 2E76B 1PD3A 3BVOA 3JARA 1YTFB 2P67A 1FPOA 2DWEC 5H2FZ 3ETDA 3K3WA 2E5LO 1GM8A 1LR1A 3K9SA 1X4TA 4HYOA 1TAEA 2H8PC 4KHPO 2EJ7A
chains in the Genus database with same CATH topology
4DV1O 4JI0O 4LF8O 3JAMN 4DR4O 5BY1A 4LF7O 5LMUO 4OPAA 1HNWO 5H5NA 1R1BA 1X59A 4DR5O 4LFBO 2UUBO 1F7YA 1XNRO 1N33O 4B3RO 4NXMO 1I94O 4X64O 1D2DA 4DR1O 4JI8O 5A2QN 4GKKO 3M8AA 1XNQO 4JYAO 4DUZO 1FKAO 2JRIA 2VQEO 2DJVA 4DV4O 1FYJA 4DR3O 2ZKOA 3T1YO 4JI4O 4DV3O 1IBKO 1R6TA 4DR7O 3T1HO 4LF4O 5IT9N 4YHHO 2HHHO 4B3TO 2Z0AA 1YZBA 1XMOO 4DV5O 4K0KO 1A32A 1XMQO 1DK1A 2UUAO 4JI5O 4X62O 1XEQA 2VQFO 3RT3C 4X65O 2ZM6O 1N36O 1AB3A 4LF9O 5BXZA 3J7AU 4GKJO 2AGAA 1NS1A 4DR6O 4JI7O 4B3MO 3SDLA 2FKXA 1N34O 3J81N 4A5UB 1IBMO 5LMNO 2UU9O 2F4VO 4DR2O 3F5TA 4JI6O 4DUYO 5LL6Y 5FLXN 3J80N 4X66O 2UXBO 4DV6O 4DV7O 4B3SO 4JV5O 1HNZO 4DV0O 1HNXO 4DV2O 2UUCO 4LFCO 4OPHA 4JI2O 5BR8O 4JI3O 5IWAO 4OX9O 3R66A 4YY3O 4LFAO 1AILA 3O65A 1J5EO 2DOSA 4JI1O 2E5LO 4NXNO 2UXDO 1N32O 1HR0O 1FJGO 2UXCO 2LW7A 1IBLO 4AQYO 4LF5O 1G1XB 4KHPO 2N74A 3OTOO 1KUQA 4LF6O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV1 O;  4JI0 O;  4LF8 O;  3JAM N;  4DR4 O;  5BY1 A;  4LF7 O;  5LMU O;  4OPA A;  1HNW O;  5H5N A;  1R1B A;  1X59 A;  4DR5 O;  4LFB O;  2UUB O;  1F7Y A;  1XNR O;  1N33 O;  4B3R O;  4NXM O;  1I94 O;  4X64 O;  1D2D A;  4DR1 O;  4JI8 O;  5A2Q N;  4GKK O;  3M8A A;  1XNQ O;  4JYA O;  4DUZ O;  1FKA O;  2JRI A;  2VQE O;  2DJV A;  4DV4 O;  1FYJ A;  4DR3 O;  2ZKO A;  3T1Y O;  4JI4 O;  4DV3 O;  1IBK O;  1R6T A;  4DR7 O;  3T1H O;  4LF4 O;  5IT9 N;  4YHH O;  2HHH O;  4B3T O;  2Z0A A;  1YZB A;  1XMO O;  4DV5 O;  4K0K O;  1A32 A;  1XMQ O;  1DK1 A;  2UUA O;  4JI5 O;  4X62 O;  1XEQ A;  2VQF O;  3RT3 C;  4X65 O;  2ZM6 O;  1N36 O;  1AB3 A;  4LF9 O;  5BXZ A;  3J7A U;  4GKJ O;  2AGA A;  1NS1 A;  4DR6 O;  4JI7 O;  4B3M O;  3SDL A;  2FKX A;  1N34 O;  3J81 N;  4A5U B;  1IBM O;  5LMN O;  2UU9 O;  2F4V O;  4DR2 O;  3F5T A;  4JI6 O;  4DUY O;  5LL6 Y;  5FLX N;  3J80 N;  4X66 O;  2UXB O;  4DV6 O;  4DV7 O;  4B3S O;  4JV5 O;  1HNZ O;  4DV0 O;  1HNX O;  4DV2 O;  2UUC O;  4LFC O;  4OPH A;  4JI2 O;  5BR8 O;  4JI3 O;  5IWA O;  4OX9 O;  3R66 A;  4YY3 O;  4LFA O;  1AIL A;  3O65 A;  1J5E O;  2DOS A;  4JI1 O;  2E5L O;  4NXN O;  2UXD O;  1N32 O;  1HR0 O;  1FJG O;  2UXC O;  2LW7 A;  1IBL O;  4AQY O;  4LF5 O;  1G1X B;  4KHP O;  2N74 A;  3OTO O;  1KUQ A;  4LF6 O; 
#chains in the Genus database with same CATH topology
 1N36 B;  3P32 A;  4I4T B;  3IJ4 A;  3G4S V;  3LSS A;  1Q6U A;  1HNW O;  3FX7 A;  1X59 A;  1URF A;  2OIE A;  2VWK A;  2EUL A;  2YXH A;  2UU9 B;  4NYK A;  1H38 A;  1ZWI C;  2Y69 B;  3L73 H;  1AI7 A;  5H6Q A;  3K79 A;  1AJQ A;  5D5P A;  4DK0 A;  4DV0 B;  4TUY A;  2R9I A;  2A7W A;  1WAZ A;  5CBH A;  2JS5 A;  3S3X A;  4WBN A;  4K0K O;  3FB6 C;  3KKY A;  5FNV A;  4Z1M G;  4FMT A;  3K5L A;  4B3T B;  2OYQ A;  1G8M A;  2NR5 A;  3GB7 C;  4LF9 O;  4GKJ B;  1JOY A;  3JD4 A;  1FAF A;  4X1K A;  2PTM A;  5EBM C;  4JI7 O;  1U96 A;  2N05 A;  1I5Y A;  2ZM6 B;  1BZK A;  4DR2 B;  2IJI A;  2AHZ A;  5LP6 C;  2EIL B;  3G80 A;  3VOU A;  1HW7 A;  3ZHR A;  2UXB B;  1MZE A;  5B1A B;  1GN3 A;  4AIL C;  3UO3 A;  4PDM A;  3PN1 A;  4TQF A;  1KU9 A;  1GO3 F;  2OCC B;  2RN9 A;  4I4T A;  1NI8 A;  4OPH A;  4PA9 A;  4P9O A;  4GT1 A;  3ZS8 C;  4H44 B;  1SRY A;  1M56 C;  4O4J A;  3RYF B;  1YTF D;  3N2K A;  4UVB A;  1EN5 A;  3L71 H;  4IGG A;  2Z3Y A;  2OCC C;  5FPR A;  3OAA G;  4PI2 A;  1G1X B;  4BW5 A;  2N74 A;  4JI7 B;  2EBO A;  3OMA B;  3JAW B;  1R6N A;  5CB4 B;  4YJ3 B;  4DO2 A;  5LMU O;  4DR6 B;  2Q67 A;  3FD9 A;  2P6J A;  4QNH B;  1UFI A;  1I94 B;  4ZHQ B;  3OTF A;  4PDV A;  1DF5 A;  5CMU A;  4GUN A;  3K59 A;  1XUQ A;  5LP6 A;  3H1K H;  3H1J H;  4JV5 B;  4D7T A;  4DV4 B;  3T1Y B;  2ZKO A;  1AP6 A;  3ZMV A;  3C90 A;  3ZMZ A;  4LF4 B;  5C93 A;  4MVU A;  2GTA A;  3LDC A;  4FZ0 A;  2KG7 A;  4JI5 O;  4ZI7 B;  2IU0 A;  2YEV B;  1SQV H;  2EZP A;  3RYC A;  1AB3 A;  4B7E A;  1SKV A;  3CX5 F;  2GBO A;  3WFV A;  4DR6 O;  3RVY A;  5LYJ B;  1P7G A;  3JAL B;  1QU7 A;  5IYB O;  1IBM O;  2XAH A;  3OMI B;  1SQB H;  3N2G A;  3E89 A;  3F5T A;  2HVJ C;  2QM7 A;  2ADQ B;  1DF4 A;  5GON A;  3HKC A;  1Y76 B;  5BZB A;  4DV7 O;  1I7F A;  1TUB A;  2LGQ A;  4GKK B;  4FLU A;  3GWO A;  2ITD C;  1SC5 B;  2DYR C;  1K7D A;  4W4K A;  5CA1 B;  1WJZ A;  4UVC A;  5J2U A;  4DV2 B;  2E3C A;  2CE4 A;  1QLE C;  4MTF A;  4NXN O;  2B1I A;  1VP7 A;  1NTZ H;  4JZ2 A;  3BA9 A;  3SJB C;  4LF5 O;  2KKW A;  4Z1V A;  3OTO O;  1L1F A;  1RSO A;  2HR3 A;  1BSM A;  3ZRW A;  3CCS V;  2KSD A;  2CH7 A;  2F93 B;  1KKD A;  3CP1 A;  2CTW A;  4WF9 V;  4MTX A;  4ZOL B;  1WP7 A;  4GKK O;  1H2N A;  3ASN C;  3OD4 A;  2VRZ A;  1VF6 C;  3VQY A;  3FB7 C;  2P5O A;  3EHB B;  5GW7 A;  5B66 Z;  2DJV A;  2QA4 V;  3HKD B;  3K9A A;  1M57 B;  1P7B A;  2Y0P A;  2Q7G A;  3KCY A;  5B1N A;  4TWK A;  3T1C A;  1P49 A;  1WA8 A;  5JVD A;  5K1P A;  5KMG B;  2CH7 B;  1EN6 A;  2QKC A;  2KQX A;  4NXN B;  2ADP A;  4DV5 O;  2PUS A;  1D5A A;  4FFK A;  3ETE A;  1BGY H;  4KXR A;  4UCO A;  2UXC B;  3RT3 C;  3CWB H;  5A9G A;  4Q6G A;  2NN4 A;  5L3D A;  2CUG A;  2RDC A;  1NVP D;  4UVA A;  3IFX A;  1R3K C;  3K57 A;  2KB1 A;  1QLE B;  5H6R A;  1N0J A;  1YF2 A;  2XND G;  3T4Z A;  3HKC B;  1JQ0 A;  4B3R B;  1MZF A;  5GON B;  1HP8 A;  3AG1 C;  4FFB B;  1SA0 A;  1WB7 A;  2X6A A;  4CBC A;  2YXL A;  4OX9 B;  4X8A A;  3AK2 A;  3QO7 A;  2R9A A;  5BR8 O;  2Z5U A;  1R3L C;  4TUY B;  3AG3 B;  5IYZ A;  2PI4 A;  1J5E B;  2QR4 A;  3N2G B;  1K8A W;  4PEL A;  4FFB A;  3CJH A;  1FJG B;  4CZZ A;  3TXQ A;  2UXC O;  3ETQ A;  3W7U A;  5EZY A;  4R50 A;  4YJ2 A;  4Q20 A;  4DRX A;  3QF7 A;  3ZBH A;  4UCU A;  2WA3 A;  2WLM A;  4O4I B;  4O4I A;  1BL8 A;  4K0K B;  3SYQ A;  2EIM C;  1FFT B;  5B1O A;  3UQ8 A;  3S3W A;  4B3R O;  5LMN B;  5D5Q A;  1S5J A;  2WLK A;  1RM1 B;  1FS0 G;  3APQ A;  5JCO A;  1G4Y B;  1KYO F;  4FM1 A;  4UV8 A;  5LHH A;  4JYA O;  1WPB A;  1LUW A;  3OR7 C;  1IXM A;  3MHH C;  4O4L A;  5L3G A;  2OTJ V;  1SQF A;  4DV4 O;  4J80 A;  4UCS A;  1SF9 A;  2BE3 A;  1VQK V;  3SPC A;  1O9H A;  1K5S A;  2HHH O;  2PYJ A;  2CTR A;  4FLX A;  1YZB A;  3P3P A;  5KAI Z;  1A32 A;  4JTA B;  4JI1 B;  3RYI B;  4X88 A;  1FXH A;  3CC4 V;  5LXT A;  4KUM A;  2FTK A;  2ZT9 B;  3MHS C;  3ZHT A;  5IY5 C;  1K33 A;  2P4V A;  2GHY A;  2AW9 A;  4GLX A;  1AR4 A;  1H2L A;  2P06 A;  3J81 N;  1FD9 A;  1MSW D;  1FFX B;  4KP4 A;  2XT9 A;  3OR6 C;  4G28 B;  4FIP C;  3CCM V;  1BHA A;  2F4V B;  1WPX A;  1PNK A;  4PA7 A;  5JH7 A;  3RYI A;  2A0L A;  1HNZ O;  1F4N A;  2O57 A;  4IL6 Z;  4WFF A;  3HKD A;  2EIM B;  3ETG A;  4X1K B;  1OCC B;  4PA6 A;  1GRJ A;  2WLH A;  4MVO A;  3E22 A;  1CPY A;  4LCU C;  2W6I G;  2LP7 A;  1NQT A;  1XHX A;  1OCR C;  2H3O A;  4JI1 O;  1RPR A;  1N32 O;  3CJH B;  3AEI A;  1OCC C;  5KHH A;  3CRR A;  4WCE V;  3OUS A;  1HR0 B;  3ZMS A;  3BCC H;  1T5E A;  1KP2 A;  2EIJ B;  4JI0 O;  4QPJ A;  1D5N A;  2ZIN A;  2UUA B;  2EIN B;  3H1L H;  3CXH F;  4ZIB A;  3UCS C;  4LFB O;  1CXZ B;  3M7M X;  3STZ C;  2QSA A;  1B04 A;  1IXB A;  1I0H A;  3RWR D;  3GVM A;  4PV1 B;  3ABL B;  3OFN G;  2Q6A A;  3SJA C;  5A2Q N;  1YDX A;  2QM4 A;  4X1I A;  3L75 H;  4NTX A;  1K92 A;  2M7W A;  4OGQ B;  4DR3 O;  1E79 G;  4RAI A;  3D8C A;  4EFB A;  5LYJ A;  3CHX A;  5KHK A;  4YHH B;  4TQD A;  4F6R A;  5LGT A;  3D36 A;  1AI4 A;  2QKS A;  2JDI G;  1Y76 A;  4AI8 A;  1YIT V;  3X2Q B;  4O2B A;  3ABT A;  2PY5 A;  1FXK A;  3T4D A;  1NR7 A;  4UB6 Z;  5CN0 A;  1H2G A;  1N34 O;  1PNL A;  3CSX A;  1WB8 A;  3QG5 A;  4NKG B;  3IC9 A;  2Q7E A;  1E1R G;  1EZJ A;  2N04 A;  4DV6 O;  3ZRV A;  3KZI Z;  1ZUQ A;  4WFG A;  1I08 A;  4YY3 O;  2VQF B;  3O9O A;  5B1B C;  3OTO B;  4J9Y B;  1B3Q A;  3VBB A;  3RYH A;  4DV1 O;  1OV9 A;  2YID A;  4DR4 O;  5KUK A;  1V54 B;  3CCE V;  3JD2 A;  3WB2 A;  4CS2 A;  3LNM B;  3Q4H A;  5B3S B;  1TA8 A;  4X66 B;  3CCQ V;  2YI8 A;  1HNW B;  4JF3 A;  1S5H C;  2P22 C;  3LNN A;  5ITZ A;  1V54 C;  3WU2 Z;  3K5M A;  1B06 A;  1K4D C;  3HB3 B;  5H9C A;  3LSQ A;  3LSU A;  3JAL A;  3CMA V;  4UV9 A;  4DR7 B;  1JJO A;  2ZR2 A;  2AZ2 A;  1EZV H;  1UPG A;  1DGS A;  4KHP B;  1WLE A;  2Z0A A;  1BQZ A;  1K34 A;  1P84 F;  4ZI7 A;  1I5X A;  5BR8 B;  4X62 O;  4IIJ B;  4X1I B;  5K1X A;  5C8Y B;  2LFR A;  5C8Y A;  1MAB G;  3OMN B;  4I50 A;  2LO1 A;  5LGU A;  4HBN A;  4BIO A;  2Q7H A;  2FKX A;  2DE0 X;  1FFX A;  4WFB V;  2UU9 O;  4AQY B;  2GV9 A;  2HEP A;  4QIW F;  3H9V A;  3UT5 A;  4WBN B;  1NH2 B;  4JI8 B;  4O4H B;  2X6C A;  4PDR A;  2LFS A;  2YEV A;  4MTG A;  4ZHQ A;  5E79 Z;  4AHC A;  5JQG B;  1F4M A;  1SQX H;  5JCO C;  4HNA A;  4UB8 Z;  3HPL C;  1U97 A;  1NZ6 A;  3I56 V;  3JD0 A;  3CRA A;  3CS5 A;  2AXT Z;  2Y4U A;  4HZ3 A;  1SER A;  4I7Z B;  4TV9 B;  3TCU A;  5IWA O;  1L0L H;  5KA5 A;  4FLY A;  4XDK A;  1K4C C;  3F7Y C;  4X62 B;  1AI5 A;  1Y74 A;  5LP6 B;  1PPJ H;  2WWW A;  4LC1 A;  5EYP A;  4DXW A;  4X1Y A;  3CC2 V;  3BHP A;  1PKX A;  3ZRS A;  4NB5 A;  1LNQ A;  4OXS A;  1VQ4 V;  4DR5 B;  4NXM O;  4L8J A;  2ITC C;  1VF5 B;  3JAT B;  3WG7 B;  4QE9 A;  3M8A A;  3CPW U;  3B77 A;  2QEX V;  4YJ2 B;  2B9Z A;  2V1D A;  4FLZ A;  2RJZ A;  1MOF A;  3K03 A;  2ZIO A;  5L3C A;  1F23 A;  2F66 C;  1R3I C;  3W7W A;  1YXB A;  4J11 A;  3DC5 A;  3SPG A;  4PA4 A;  4R6Z A;  2H94 A;  1MA1 A;  5IY5 B;  4XDL A;  2HFE C;  3ZN1 A;  4J42 A;  1KUQ A;  4CH6 A;  2EIK B;  2QTS A;  1FXK B;  3JD3 A;  5BXZ A;  2ATK C;  4L87 A;  1Q86 W;  4NR1 A;  1KQS U;  2JVD A;  1O9G A;  2ZXW C;  4K3A A;  2F4V O;  2JJ2 G;  4TT3 G;  1NTK H;  4R8C A;  1RFY A;  3UT5 B;  3ZMU A;  4JI6 O;  4LF7 B;  2L35 A;  1L8D A;  3THO A;  5LL6 Y;  4DUY B;  5F2V O;  5FLX N;  1OCO C;  4JI0 B;  2XAG A;  2BTO A;  2HVK C;  2QE7 G;  3H1I H;  2IW5 A;  1XL4 A;  4F6E A;  3SYA A;  2ZXW B;  5JJE B;  5DED A;  3FAV B;  3DXR A;  4LFA B;  2RNB A;  4DUZ B;  1WA8 B;  4UXN A;  1AIL A;  3QO5 A;  1Q90 D;  4JGS A;  3JSN A;  2JEX A;  2ODM A;  2QWP B;  1HR0 O;  4U3J A;  4J41 A;  3A0R A;  5IJ0 A;  4W4L A;  1MMM A;  3CRM A;  3DGE A;  3A8T A;  3JAS B;  4FLW A;  4N21 A;  4NTY A;  3SJQ C;  2G38 A;  4X9Q A;  1W0J G;  4LR3 A;  4LF8 O;  3RYH B;  4LF5 B;  1QVG U;  2X7R B;  4JYY A;  1R1B A;  1S0V A;  2W6J G;  1K5Q A;  3OM3 B;  3RN4 A;  3WB1 A;  1KBH A;  4MVZ A;  4IYI A;  3QNE A;  1K3E A;  3T2M A;  1N4C A;  4IT5 A;  5FL7 G;  1FXV A;  3CCR V;  1N34 B;  4ZOL A;  5B1B B;  4FLT A;  3K5O A;  2HLD G;  1VQ9 V;  1VEW A;  4HAM A;  1SET A;  1FYJ A;  3E8G A;  3OEE G;  3T1Y O;  4B08 A;  4DV6 B;  1JFF A;  2XAQ A;  1ORQ C;  5JVD B;  3WB0 A;  5J2T B;  5IT9 N;  3T1H B;  3ABL C;  4LH7 A;  3ABK B;  4UCV A;  1R73 A;  4C7U A;  2E5L B;  2UXN A;  3OEH G;  3ASO B;  3AG7 A;  1VQ6 V;  3MD0 A;  1NS1 A;  4GX1 A;  3JAK A;  1VF6 A;  4J7K A;  2ZDI A;  1K73 W;  5DN6 G;  3CRC A;  2YC0 A;  4JYB A;  4RUF A;  1M90 W;  3J80 N;  4PDL A;  3C3T A;  2P4K A;  4DV1 B;  2HP8 A;  2BTQ A;  3BAA A;  1TUB B;  3ASO C;  5IYC O;  2PZS A;  4I55 A;  5IDJ A;  1JMK C;  4LFC O;  3K04 A;  3EVK A;  5IJ9 A;  3G71 V;  4OX9 O;  5KHG A;  2UUC B;  3IGA C;  1XRE A;  3D3I A;  1YI2 V;  3O65 A;  1W59 A;  1QR9 A;  1GN4 A;  3LDD A;  2Y4T A;  4RUE A;  2XHB A;  3NR7 A;  1Q82 W;  2XAF A;  3UKM A;  3BY6 A;  4DR4 B;  1SA0 B;  2YIB A;  3AG4 C;  3JAK B;  1TUE B;  3JCU Z;  1GM9 A;  3LUT B;  1M9N A;  4FZ1 A;  1ZSP A;  4RQF A;  3ABK C;  1N33 O;  5IYZ B;  1RP3 B;  2DWD C;  2JIZ G;  1E1Q G;  4X64 O;  3U10 A;  2JGD A;  1IX9 A;  3RYC B;  4LNU B;  2Q73 A;  3A0B Z;  4H33 A;  5L3F A;  2LGW A;  3AG2 B;  3FYE B;  4JZG A;  5LOV B;  2QGN A;  1R6T A;  3HKE B;  2PGG A;  3HKE A;  1QLN A;  1JR9 A;  5HFL A;  3CME V;  2EIL C;  4IHJ A;  4DV3 B;  1XMQ B;  2QTO A;  1S5L Z;  3AK1 A;  3AG2 C;  2HHH B;  1VQN V;  4LNU A;  3A0H Z;  3AK3 A;  1N36 O;  3OE7 G;  3EFF K;  3RBZ A;  4TOI A;  1WP8 A;  4UCT A;  3FAV A;  1EM1 A;  4DUY O;  1IVS A;  3CC7 V;  3CEI A;  1QHT A;  1SQG A;  2PF4 E;  4EB6 A;  2QM8 A;  4B3S O;  4JAA A;  2X6B A;  4R7C A;  4X20 B;  3E8B A;  1VAR A;  4FLV A;  5GTI Z;  1VQ7 V;  1GK9 A;  1R6K A;  2OCH A;  4JI2 O;  1JPX A;  3TXS A;  1AJN A;  3TK1 A;  1M57 C;  3CXC U;  5CA1 A;  2EX3 A;  2XAJ A;  2R9R B;  4QGP A;  4WFE A;  1J5E O;  3BAB A;  1M1K W;  3BPZ A;  1KMI Z;  3FYI B;  4CS4 A;  1IZ3 A;  1ZL8 A;  3BEH A;  3SGI A;  3U11 A;  1FJG O;  2LW7 A;  4MVQ A;  3OGC C;  3U0Z A;  2V7Q G;  1JJ2 U;  3E2E A;  1EFR G;  5IYD O;  3LDE A;  4RO2 A;  4I50 B;  3DXR B;  1RPO A;  5KHI A;  2YUA A;  3TET A;  3ZRX A;  2OT5 A;  2BOB C;  2GUZ A;  1OCR B;  5EC1 C;  4JI3 B;  2P7T C;  2ILM A;  3OW2 U;  4MVS A;  4JYA B;  1ENV A;  4DK1 A;  1PL0 A;  5GTH Z;  4JPR A;  1WNS A;  3B4S A;  1GAX A;  3ASN B;  5KX5 A;  2QWO B;  3CCV V;  3T1H O;  2DQ3 A;  1OJH A;  3ABM B;  1V55 C;  4DR3 B;  5FPO A;  3ZED A;  2KG7 B;  1KP3 A;  4H37 A;  5KMG A;  2UUA O;  5KA6 A;  1Y74 B;  1Z2G A;  1S72 V;  3B8M A;  1Q6H A;  4GX0 A;  2QWQ B;  2GTS A;  4G2K A;  3ZN0 A;  4U3F H;  4B3M O;  2Q0O C;  3N2K B;  5B1A C;  4EKW A;  4FJC C;  5CBF A;  1WN7 A;  3SYO A;  2Y48 A;  2F23 A;  4JV5 O;  4GX2 A;  3CD6 V;  3P3N A;  2IU3 A;  4U3J B;  1HNZ B;  5KLV H;  1ZAU A;  3H1H H;  3A2F A;  2ZE7 A;  3DC6 A;  3B09 A;  4UUJ C;  4TV8 B;  2WLI A;  2YIA A;  5KUM A;  5EIB C;  2RCV A;  1MSD A;  3FFQ A;  2AZ0 A;  3G6B A;  2CAZ C;  2EIK C;  1MNG A;  2FB5 A;  2Q8V A;  4GX5 A;  4PD4 F;  2ETN A;  3CYO A;  4J7J A;  4JAS A;  1H8H G;  1SES A;  4O2A B;  4LWS B;  3W7T A;  5BY1 A;  3E35 A;  1PV0 A;  4I9Q A;  4LF6 B;  1HNX B;  1ZTE A;  2IM9 A;  1YJW V;  4ICG A;  1OCZ B;  2JJ1 G;  2RMK B;  2DYS B;  1OHH G;  1VQ8 V;  2BOC C;  4JTC B;  5CA0 B;  1NJI W;  2GDS A;  4O4H A;  1XNQ O;  2YS8 A;  3B40 A;  1S76 D;  4BWA A;  4JTD B;  3K06 A;  3KCX A;  2LJ2 A;  4YHH O;  1Y6X A;  1SQP H;  3CCU V;  4LFC B;  3OGI B;  1DK1 A;  2NNU A;  4X20 A;  1NTM H;  2MW2 B;  4JAV A;  2YXY A;  2ZQM A;  3IC7 A;  4FK5 C;  3ZHS A;  3E83 A;  2CGO A;  1M93 A;  2UXB O;  4JI4 B;  3FKS G;  3CRQ A;  2V4D A;  4DR1 B;  2ZE5 A;  3MAQ A;  2UUC O;  4KFM A;  2WLN A;  3L9D A;  1KKC A;  3L72 H;  1BMF G;  1XI1 A;  3E8H A;  4PA3 A;  5L3E A;  2F95 B;  1VIB A;  1NBM G;  2W0F C;  4O4J B;  2A3Q A;  1GTO A;  2K9P A;  1M56 B;  4O2B B;  3ZMT A;  4AQY O;  1NR1 A;  2CDY A;  1GN2 A;  5HFM A;  3STL C;  1UJW B;  4LH6 A;  5JJN B;  3D36 C;  3BRC A;  4J9Z B;  5LHG A;  5LMU B;  4X64 B;  1IDS A;  2Q0A A;  4XBF A;  1W0K G;  1ZLZ A;  1AP5 A;  3RVZ A;  4ZBM A;  4NTW A;  4DR1 O;  2M6Y A;  4NXM B;  4IIJ A;  3JAS A;  2PI5 A;  2VQE O;  1ROP A;  2DN9 A;  3ZCC A;  1S77 D;  3F5W C;  4DV3 O;  4DR7 O;  2CGN A;  1GN6 A;  3K5N A;  4LF4 O;  3RGB A;  4B3T O;  1CP9 A;  5CBG A;  3RYF A;  1SZT A;  3DSQ A;  1HWY A;  4I0X A;  2X0L A;  4ABM A;  5L3B A;  5LHI A;  2UUB B;  2ZM6 O;  4CC5 A;  3OUF A;  2AGA A;  2Q69 A;  2ZIM A;  2XTA A;  1G6U A;  1SZX A;  1VQP V;  3OT7 A;  4MVM A;  1CEZ A;  3AG1 B;  5LMN O;  5B3S C;  2ARH A;  2GSM B;  3W7S A;  1Q81 W;  2ZNJ A;  3IAY A;  1V55 B;  3I5D A;  4MT8 A;  4JAU A;  4U7N A;  4DW0 A;  4G27 B;  3VQX A;  2FML A;  4N23 A;  4I0X B;  4UFZ A;  3FB5 C;  3TJT A;  1H2S B;  5DM6 V;  3CCJ V;  1NKD A;  4K35 A;  3QTC A;  3I55 V;  4JI3 O;  3G6E V;  3E22 B;  5EK0 A;  2VWJ A;  1GMG A;  2DW4 A;  3G67 A;  4FPP A;  5J2T A;  1YSC A;  3JAR B;  2A06 H;  4P30 A;  1XMO B;  1PM9 A;  4LP8 A;  3SPH A;  3FB8 C;  1XIL A;  1H8E G;  2QKA A;  2CK3 G;  1Q3E A;  2ZE6 A;  4LWS A;  3ZX6 A;  1PL4 A;  4Z2W A;  4CC6 A;  4TV8 A;  1YHQ V;  4JI5 B;  3CB2 A;  3D3Q A;  4DR5 O;  2WLL B;  3ZHV A;  4H0L B;  2JK5 C;  1XNR O;  2F1M A;  4CS3 A;  4K8X A;  4J10 A;  2Y69 C;  4ZKI A;  5J9P C;  1NVP B;  1D2D A;  1EN4 A;  4DUZ O;  1LUV A;  3JSL A;  4DW1 A;  2YIB D;  5IJ0 B;  2OTL V;  3L74 H;  4BIZ A;  3ABM C;  2LQT A;  1F51 A;  3N27 A;  3AG3 C;  3B2E E;  4QE7 A;  1IUR A;  1JA8 A;  4EEQ A;  1IBK O;  3SYC A;  5LBQ A;  3ZJZ A;  2ZE8 A;  2F43 G;  2EIN C;  4BAY A;  3BFR A;  1N32 B;  4RWU A;  4IHJ B;  1XMO O;  3QVN A;  4LF8 B;  2GUZ B;  3NXS A;  1MG1 A;  4O4L B;  1ARO P;  2FYU H;  1Q5O A;  3M99 B;  2IJK A;  2JEU A;  1M5I A;  4ASU G;  2YSU B;  3SDL A;  4X65 B;  1S3J A;  2QJ1 A;  1VQO V;  4F6R B;  4MW8 A;  1QBZ A;  4DV7 B;  1GM7 A;  3WG7 C;  3SPJ A;  5CA0 A;  4X66 O;  2QWN B;  4DRX B;  2BSK B;  1HNX O;  1KC8 W;  4E4E A;  3K0D A;  4DV2 O;  5KHJ A;  4MW3 A;  5IJ9 B;  1Y66 A;  3ML0 A;  2Q4P A;  5EBL C;  3ZIA G;  4O2A A;  3P30 A;  3JYC A;  2WA4 A;  1GKF A;  4LFA O;  4QJF B;  3TGU H;  1AR1 B;  2Q5Z A;  4EB6 B;  2VS0 A;  1VQM V;  2UXX A;  2UXD O;  4U7O A;  1ZL8 B;  1XQ8 A;  4YIP A;  1XBL A;  2BSK A;  2WSS G;  5JH7 B;  3QO8 A;  2CTP A;  4IYH A;  2E75 B;  3ICX A;  4LF6 O;  1K97 A;  4DV5 B;  3BA8 A;  4MS2 A;  1KD1 W;  1B6Q A;  2YIC A;  4FM0 A;  5H5N A;  3CE2 A;  5EC2 C;  4YIO A;  2XUM A;  3KG2 A;  2E74 B;  1BE3 H;  4JI8 O;  1NH2 D;  1YVW A;  1Q8I A;  1PNM A;  5EYP B;  4KL1 A;  3RW0 A;  2NLJ C;  3UM7 A;  1OZ0 A;  2EZO A;  3R65 A;  4PI0 A;  2VQE B;  3JAW A;  5LOV A;  1JFF B;  4JI4 O;  4FVM A;  2WLI B;  2JS3 A;  1K9M W;  2IJJ A;  1QQC A;  2B5U A;  4GZR B;  2XAS A;  4P2Z A;  2UXD B;  1XEQ A;  3HR0 A;  4I5S A;  5JQG A;  4CH4 A;  3J7A U;  4TSF G;  2ZNI A;  2DQ0 A;  1RSO B;  1TVK A;  4D6T H;  5KX5 B;  4LF9 B;  3C3S A;  3VQV A;  4FM2 A;  4UCR A;  1QCE A;  1OCZ C;  1THZ A;  2FL4 A;  5DEC A;  2DMX A;  1R3J C;  4CH5 A;  4D7S A;  4DV0 O;  2EJR A;  2HKO A;  5BMV A;  1VMG A;  2QWR B;  2K1E A;  4B3S B;  3ZRW B;  4I55 B;  4P9P A;  2B1G A;  1Q7Y W;  3JCZ A;  2AHY A;  3PJS K;  5LA6 B;  4JI2 B;  3X2Q C;  5LA6 A;  2DOS A;  4BW9 A;  2R70 A;  2P90 A;  1YJN V;  4MVR A;  1N8R W;  2HJD A;  2A79 B;  5ITZ B;  3ABU A;  5B5E Z;  2L6L A;  5EZY B;  2MK3 A;  3APO A;  2C2A A;  5BMV B;  1H2K A;  5J2U B;  4BR6 A;  4GCZ A;  1QVF U;  4OPA A;  3K58 A;  2UUB O;  1F7Y A;  4QPK A;  1W2B U;  1N33 B;  1Z5V A;  4I9W A;  1PP9 H;  3DTU B;  2ZCE A;  2EIJ C;  2ZD9 A;  3E8F A;  2JRI A;  2RQ6 A;  1VF7 A;  1XOU A;  2DYS C;  2WAM A;  2WLJ A;  3B8N A;  2D2C B;  1NT2 B;  1Q6I A;  4YJ3 A;  1JCH A;  2BCC H;  3CCL V;  2LW1 A;  1OCO B;  3SPI A;  2WLL A;  2BTQ B;  4LBE C;  2Q9L A;  1Y67 A;  1DLB A;  3VQW A;  2CTQ A;  1TGO A;  4B7K A;  1XMQ O;  1AI6 A;  3ZHQ A;  1IBL B;  1TVK B;  4GKJ O;  1HDJ A;  3MDS A;  3HKB A;  1COW G;  2IJH A;  1Y4M A;  2YDE A;  4DYL A;  3AG4 B;  1YIJ V;  4DR2 O;  2XOK G;  4GYC B;  4B3M B;  3F7V C;  2DYR B;  4EFE A;  4WFH A;  1XDC A;  1JX9 A;  3SJC C;  1L0N H;  1P4R A;  1QNM A;  5LXT B;  2IBZ H;  5EIB D;  2D3O W;  2WPD G;  4TV9 A;  4MSW C;  1QR8 A;  4YY3 B;  3R66 A;  3H01 A;  2Q68 A;  1NU1 H;  5KAF Z;  1BCC H;  3JD1 A;  1N0N A;  1EBO A;  2ZDI C;  1Z5W A;  5AG2 A;  1SS3 A;  5IE9 A;  3EXA A;  1VQL V;  4MTO A;  1VQ5 V;  1IBL O;  2JGD B;  1V9P A;  3ZHU A;  1KB9 F;  4XDJ A;  4BIU A;  4LFB B;  4HNA B;  1XNR B;  2HJF C;  3JAM N;  1BQ0 A;  5TIS Z;  1SQQ H;  4JI6 B;  1RM1 C;  1YJ9 V;  4LF7 O;  1BHB A;  2IH3 C;  4H13 B;  1M4U A;  5EBW C;  2JGU A;  3GWK C;  5FNV B;  1BS3 A;  4J7Z A;  1I94 O;  4X89 A;  2W0X A;  3SR2 C;  1FKA O;  1AJP A;  4PHZ A;  1IBK B;  3SYP A;  4CH3 A;  1XNQ B;  3E86 A;  1BT8 A;  2ZR3 A;  2OIG A;  2HG5 C;  4YXW G;  5CA3 A;  1AR5 A;  4WFA V;  1XL6 A;  4F4L A;  1H2M A;  5E1A C;  1YCI A;  1FXK C;  1Q43 A;  1ZX3 A;  2OWO A;  4K8Z A;  2VQF O;  4X65 O;  1JVM A;  2QDO A;  1AVM A;  3K0G A;  4JYC A;  1XHZ A;  4A5U B;  3L70 H;  1IBM B;  1YEW A;  1GH6 A;  2IH1 C;  2A9H A;  4RQE A;  3W7X A;  4E2L A;  3Q4H B;  2Y0I A;  2PYL A;  5JWP A;  4PJ0 Z;  3UO2 A;  2YI9 A;  3JAT A;  1KEC A;  3HKB B;  4X1Y B;  1DTO A;  5LGN A;  2R72 A;  1US6 A;  5CB4 A;  5IWA B;  5JJJ B;  3K08 A;  4NVP A;  1J95 A;  3RFR A;  2E76 B;  1PD3 A;  3BVO A;  3JAR A;  1YTF B;  2P67 A;  1FPO A;  2DWE C;  5H2F Z;  3ETD A;  3K3W A;  2E5L O;  1GM8 A;  1LR1 A;  3K9S A;  1X4T A;  4HYO A;  1TAE A;  2H8P C;  4KHP O;  2EJ7 A; 
#chains in the Genus database with same CATH homology
 4DV1 O;  4JI0 O;  4LF8 O;  3JAM N;  4DR4 O;  5BY1 A;  4LF7 O;  5LMU O;  4OPA A;  1HNW O;  5H5N A;  1R1B A;  1X59 A;  4DR5 O;  4LFB O;  2UUB O;  1F7Y A;  1XNR O;  1N33 O;  4B3R O;  4NXM O;  1I94 O;  4X64 O;  1D2D A;  4DR1 O;  4JI8 O;  5A2Q N;  4GKK O;  3M8A A;  1XNQ O;  4JYA O;  4DUZ O;  1FKA O;  2JRI A;  2VQE O;  2DJV A;  4DV4 O;  1FYJ A;  4DR3 O;  2ZKO A;  3T1Y O;  4JI4 O;  4DV3 O;  1IBK O;  1R6T A;  4DR7 O;  3T1H O;  4LF4 O;  5IT9 N;  4YHH O;  2HHH O;  4B3T O;  2Z0A A;  1YZB A;  1XMO O;  4DV5 O;  4K0K O;  1A32 A;  1XMQ O;  1DK1 A;  2UUA O;  4JI5 O;  4X62 O;  1XEQ A;  2VQF O;  3RT3 C;  4X65 O;  2ZM6 O;  1N36 O;  1AB3 A;  4LF9 O;  5BXZ A;  3J7A U;  4GKJ O;  2AGA A;  1NS1 A;  4DR6 O;  4JI7 O;  4B3M O;  3SDL A;  2FKX A;  1N34 O;  3J81 N;  4A5U B;  1IBM O;  5LMN O;  2UU9 O;  2F4V O;  4DR2 O;  3F5T A;  4JI6 O;  4DUY O;  5LL6 Y;  5FLX N;  3J80 N;  4X66 O;  2UXB O;  4DV6 O;  4DV7 O;  4B3S O;  4JV5 O;  1HNZ O;  4DV0 O;  1HNX O;  4DV2 O;  2UUC O;  4LFC O;  4OPH A;  4JI2 O;  5BR8 O;  4JI3 O;  5IWA O;  4OX9 O;  3R66 A;  4YY3 O;  4LFA O;  1AIL A;  3O65 A;  1J5E O;  2DOS A;  4JI1 O;  2E5L O;  4NXN O;  2UXD O;  1N32 O;  1HR0 O;  1FJG O;  2UXC O;  2LW7 A;  1IBL O;  4AQY O;  4LF5 O;  1G1X B;  4KHP O;  2N74 A;  3OTO O;  1KUQ A;  4LF6 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...