4DV1D

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g, bound with streptomycin
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
208
structure length
208
Chain Sequence
GRYIGPVCRLCRREGVKLYLKGERCYSPKCAMERRPYPPGQHGQKRARRPSDYAVRLREKQKLRRIYGISERQFRNLFEEASKKKGVTGSVFLGLLESRLDNVVYRLGFAVSRRQARQLVRHGHITVNGRRVDLPSYRVRPGDEIAVAEKSRNLELIRQNLEAMKGRKVGPWLSLDVEGMKGKFLRLPDREDLALPVNEQLVIEFYSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 50
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00163 Ribosomal_S4 Ribosomal protein S4/S9 N-terminal domain
D PF01479 S4 S4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1050.10 Mainly Alpha Orthogonal Bundle Ribosomal Protein S4 Delta 41; Chain A, domain 1 Ribosomal Protein S4 Delta 41; Chain A, domain 1 4dv1D01
3.10.290.10 Alpha Beta Roll Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A RNA-binding S4 domain 4dv1D02
4DUZD 1JH3A 4JV5D 2ISTA 5LMND 4LGTA 4DR6D 4JI0D 4JI6D 4GKKD 3T1HD 4JI1D 5LMUD 2UXDD 3T1YD 4NXMD 2KTLA 3DH3A 2VQED 1KSVA 4DV5D 4X64D 4JI3D 4LF6D 4DV6D 4LF9D 4DV7D 1N32D 2UXCD 4JI7D 2HHHD 4LFCD 4LF5D 4B3MD 4DV1D 5IWAD 4JI5D 4NXND 4KHPD 4LF8D 4YY3D 2E5LD 2ZM6D 4B3TD 4K0KD 4OX9D 1P9KA 4DR5D 1XMOD 1I94D 4DR1D 4JYAD 4LFBD 1KSLA 1H3EA 4B3RD 4DV2D 1XMQD 4X62D 4YHHD 4DV3D 4B3SD 4X66D 1N33D 2UUBD 1IBMD 1XNQD 1C06A 2UUAD 5BR8D 2UUCD 1H3FA 4JI2D 4GKJD 4DV0D 1HR0D 2VQFD 3HP7A 1KSKA 1FJGD 4OUDA 4LF4D 4AQYD 1IBKD 2UU9D 4DR2D 1XNRD 2K6PA 4DR7D 1J5ED 4DUYD 1FKAD 1IBLD 4LFAD 2UXBD 4LF7D 1HNXD 4DV4D 2F4VD 1DM9A 1N34D 1N36D 3KBGA 4JI8D 4JI4D 1C05A 4DR3D 1HNZD 2JANA 4X65D 4DR4D 3OTOD 1VIOA 1HNWD
chains in the Genus database with same CATH superfamily
4DUZD 1JH3A 2ZTBA 4JV5D 2ISTA 5LMND 4LGTA 4DR6D 4JI0D 4JI6D 4GKKD 3T1HD 4JI1D 5LMUD 2UXDD 3T1YD 4NXMD 2KTLA 5FQ2B 2VQED 1KSVA 3DH3A 4DV5D 4X64D 4JI3D 4LF6D 4DV6D 4LF9D 4DV7D 1N32D 2UXCD 4JI7D 2LQ7A 3J81E 2HHHD 4LFCD 4LF5D 5A2QE 4B3MD 4DV1D 5IWAD 4JI5D 4NXND 4KHPD 4LF8D 4YY3D 3CMMA 2E5LD 2ZM6D 3JAME 4B3TD 4K0KD 4OX9D 1P9KA 4DR5D 1XMOD 1I94D 4DR1D 3J80E 1Y8QB 3FN1A 3KYDB 4JYAD 4LFBD 5LL6S 1KSLA 3KYCB 1H3EA 4B3RD 4DV2D 4II3A 1XMQD 4X62D 4YHHD 4DV3D 4B3SD 4X66D 1N33D 2UUBD 1IBMD 1XNQD 4W5VB 3ONGA 1C06A 2UUAD 2I1SA 5KNLA 5BR8D 2UUCD 1H3FA 4JI2D 4GKJD 4DV0D 1HR0D 2VQFD 3HP7A 1KSKA 1FJGD 4OUDA 4LF4D 1Y8XB 4AQYD 1IBKD 4II2A 2UU9D 4DR2D 1XNRD 2K6PA 2NVUB 4DR7D 1Y8RB 1J5ED 5IT9E 4DUYD 1FKAD 1IBLD 4LFAD 2UXBD 4LF7D 1HNXD 4NNJA 4DV4D 2F4VD 1DM9A 1N34D 5FLXE 1N36D 3KBGA 4JI8D 4JI4D 1C05A 4DR3D 1HNZD 2JANA 4X65D 4DR4D 3ONHA 3OTOD 2L3NA 1VIOA 3J7AF 1HNWD
chains in the Genus database with same CATH topology
4DUZD 1JH3A 4JV5D 2ISTA 5LMND 4LGTA 4DR6D 4JI0D 4JI6D 4GKKD 3T1HD 4JI1D 5LMUD 2UXDD 3T1YD 4NXMD 2KTLA 3DH3A 2VQED 1KSVA 4DV5D 4X64D 4JI3D 4LF6D 4DV6D 4LF9D 4DV7D 1N32D 2UXCD 4JI7D 2HHHD 4LFCD 4LF5D 4B3MD 4DV1D 5IWAD 4JI5D 4NXND 4KHPD 4LF8D 4YY3D 2E5LD 2ZM6D 4B3TD 4K0KD 4OX9D 1P9KA 4DR5D 1XMOD 1I94D 4DR1D 4JYAD 4LFBD 1KSLA 1H3EA 4B3RD 4DV2D 1XMQD 4X62D 4YHHD 4DV3D 4B3SD 4X66D 1N33D 2UUBD 1IBMD 1XNQD 1C06A 2UUAD 5BR8D 2UUCD 1H3FA 4JI2D 4GKJD 4DV0D 1HR0D 2VQFD 3HP7A 1KSKA 1FJGD 4OUDA 4LF4D 4AQYD 1IBKD 2UU9D 4DR2D 1XNRD 2K6PA 4DR7D 1J5ED 4DUYD 1FKAD 1IBLD 4LFAD 2UXBD 4LF7D 1HNXD 4DV4D 2F4VD 1DM9A 1N34D 1N36D 3KBGA 4JI8D 4JI4D 1C05A 4DR3D 1HNZD 2JANA 4X65D 4DR4D 3OTOD 2L3NA 1VIOA 1HNWD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DUZ D;  1JH3 A;  4JV5 D;  2IST A;  5LMN D;  4LGT A;  4DR6 D;  4JI0 D;  4JI6 D;  4GKK D;  3T1H D;  4JI1 D;  5LMU D;  2UXD D;  3T1Y D;  4NXM D;  2KTL A;  3DH3 A;  2VQE D;  1KSV A;  4DV5 D;  4X64 D;  4JI3 D;  4LF6 D;  4DV6 D;  4LF9 D;  4DV7 D;  1N32 D;  2UXC D;  4JI7 D;  2HHH D;  4LFC D;  4LF5 D;  4B3M D;  4DV1 D;  5IWA D;  4JI5 D;  4NXN D;  4KHP D;  4LF8 D;  4YY3 D;  2E5L D;  2ZM6 D;  4B3T D;  4K0K D;  4OX9 D;  1P9K A;  4DR5 D;  1XMO D;  1I94 D;  4DR1 D;  4JYA D;  4LFB D;  1KSL A;  1H3E A;  4B3R D;  4DV2 D;  1XMQ D;  4X62 D;  4YHH D;  4DV3 D;  4B3S D;  4X66 D;  1N33 D;  2UUB D;  1IBM D;  1XNQ D;  1C06 A;  2UUA D;  5BR8 D;  2UUC D;  1H3F A;  4JI2 D;  4GKJ D;  4DV0 D;  1HR0 D;  2VQF D;  3HP7 A;  1KSK A;  1FJG D;  4OUD A;  4LF4 D;  4AQY D;  1IBK D;  2UU9 D;  4DR2 D;  1XNR D;  2K6P A;  4DR7 D;  1J5E D;  4DUY D;  1FKA D;  1IBL D;  4LFA D;  2UXB D;  4LF7 D;  1HNX D;  4DV4 D;  2F4V D;  1DM9 A;  1N34 D;  1N36 D;  3KBG A;  4JI8 D;  4JI4 D;  1C05 A;  4DR3 D;  1HNZ D;  2JAN A;  4X65 D;  4DR4 D;  3OTO D;  1VIO A;  1HNW D; 
#chains in the Genus database with same CATH topology
 4DUZ D;  1JH3 A;  2ZTB A;  4JV5 D;  2IST A;  5LMN D;  4LGT A;  4DR6 D;  4JI0 D;  4JI6 D;  4GKK D;  3T1H D;  4JI1 D;  5LMU D;  2UXD D;  3T1Y D;  4NXM D;  2KTL A;  5FQ2 B;  2VQE D;  1KSV A;  3DH3 A;  4DV5 D;  4X64 D;  4JI3 D;  4LF6 D;  4DV6 D;  4LF9 D;  4DV7 D;  1N32 D;  2UXC D;  4JI7 D;  2LQ7 A;  3J81 E;  2HHH D;  4LFC D;  4LF5 D;  5A2Q E;  4B3M D;  4DV1 D;  5IWA D;  4JI5 D;  4NXN D;  4KHP D;  4LF8 D;  4YY3 D;  3CMM A;  2E5L D;  2ZM6 D;  3JAM E;  4B3T D;  4K0K D;  4OX9 D;  1P9K A;  4DR5 D;  1XMO D;  1I94 D;  4DR1 D;  3J80 E;  1Y8Q B;  3FN1 A;  3KYD B;  4JYA D;  4LFB D;  5LL6 S;  1KSL A;  3KYC B;  1H3E A;  4B3R D;  4DV2 D;  4II3 A;  1XMQ D;  4X62 D;  4YHH D;  4DV3 D;  4B3S D;  4X66 D;  1N33 D;  2UUB D;  1IBM D;  1XNQ D;  4W5V B;  3ONG A;  1C06 A;  2UUA D;  2I1S A;  5KNL A;  5BR8 D;  2UUC D;  1H3F A;  4JI2 D;  4GKJ D;  4DV0 D;  1HR0 D;  2VQF D;  3HP7 A;  1KSK A;  1FJG D;  4OUD A;  4LF4 D;  1Y8X B;  4AQY D;  1IBK D;  4II2 A;  2UU9 D;  4DR2 D;  1XNR D;  2K6P A;  2NVU B;  4DR7 D;  1Y8R B;  1J5E D;  5IT9 E;  4DUY D;  1FKA D;  1IBL D;  4LFA D;  2UXB D;  4LF7 D;  1HNX D;  4NNJ A;  4DV4 D;  2F4V D;  1DM9 A;  1N34 D;  5FLX E;  1N36 D;  3KBG A;  4JI8 D;  4JI4 D;  1C05 A;  4DR3 D;  1HNZ D;  2JAN A;  4X65 D;  4DR4 D;  3ONH A;  3OTO D;  2L3N A;  1VIO A;  3J7A F;  1HNW D; 
#chains in the Genus database with same CATH homology
 4DUZ D;  1JH3 A;  4JV5 D;  2IST A;  5LMN D;  4LGT A;  4DR6 D;  4JI0 D;  4JI6 D;  4GKK D;  3T1H D;  4JI1 D;  5LMU D;  2UXD D;  3T1Y D;  4NXM D;  2KTL A;  3DH3 A;  2VQE D;  1KSV A;  4DV5 D;  4X64 D;  4JI3 D;  4LF6 D;  4DV6 D;  4LF9 D;  4DV7 D;  1N32 D;  2UXC D;  4JI7 D;  2HHH D;  4LFC D;  4LF5 D;  4B3M D;  4DV1 D;  5IWA D;  4JI5 D;  4NXN D;  4KHP D;  4LF8 D;  4YY3 D;  2E5L D;  2ZM6 D;  4B3T D;  4K0K D;  4OX9 D;  1P9K A;  4DR5 D;  1XMO D;  1I94 D;  4DR1 D;  4JYA D;  4LFB D;  1KSL A;  1H3E A;  4B3R D;  4DV2 D;  1XMQ D;  4X62 D;  4YHH D;  4DV3 D;  4B3S D;  4X66 D;  1N33 D;  2UUB D;  1IBM D;  1XNQ D;  1C06 A;  2UUA D;  5BR8 D;  2UUC D;  1H3F A;  4JI2 D;  4GKJ D;  4DV0 D;  1HR0 D;  2VQF D;  3HP7 A;  1KSK A;  1FJG D;  4OUD A;  4LF4 D;  4AQY D;  1IBK D;  2UU9 D;  4DR2 D;  1XNR D;  2K6P A;  4DR7 D;  1J5E D;  4DUY D;  1FKA D;  1IBL D;  4LFA D;  2UXB D;  4LF7 D;  1HNX D;  4DV4 D;  2F4V D;  1DM9 A;  1N34 D;  1N36 D;  3KBG A;  4JI8 D;  4JI4 D;  1C05 A;  4DR3 D;  1HNZ D;  2JAN A;  4X65 D;  4DR4 D;  3OTO D;  2L3N A;  1VIO A;  1HNW D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...