4DV1K

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g, bound with streptomycin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
116
structure length
116
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 27
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4dv1K00
3J7YP 1J5EK 4DUYK 4LFAK 1IBLK 4JI3K 1FJGK 4DV7K 3T1HK 4DV6K 4DV3K 3OTOK 4NXMK 4DR2K 4NXNK 2HHHK 3JAMO 1N36K 5FLXO 4DV5K 4LF5K 4JV5K 1N32K 4LF7K 4LF8K 2UU9K 4KHPK 4X62K 4DR1K 1XMQK 4X65K 2UUBK 4JI2K 4JI8K 4JI5K 4JI1K 4V19S 4DR6K 3J81O 2UXCK 4YY3K 4DV2K 3J7AP 4X66K 2UXDK 5A2QO 2VQEK 4DR5K 4DR4K 2ZM6K 4JI6K 4LF9K 4DV4K 2UUCK 4LFCK 1N34K 4LF4K 1IBKK 1HNXK 1IBMK 4B3TK 4B3RK 4JI4K 4JI0K 5IT9O 5LL6Z 4LFBK 5LMUK 4GKJK 3J80O 4CVNE 4B3MK 1XNRK 4GKKK 4YHHK 4DR3K 1I94K 1XMOK 4JI7K 2VQFK 5AJ3K 4DV1K 2UUAK 2F4VK 4AQYK 1HNWK 1HR0K 1XNQK 4K0KK 1N33K 2UXBK 4DV0K 5BR8K 4DUZK 3T1YK 5LMNK 4DR7K 4LF6K 2E5LK 4X64K 4OX9K 4JYAK 4B3SK 5IWAK 4CW7B 1HNZK
chains in the Genus database with same CATH superfamily
4JD2B 1JLEA 4A57A 4DV7K 2OZSA 1NBWA 5AQKA 2ZJRL 4F2RA 1Q81O 4IXCA 4CJ7A 3P83D 4WQ4C 1RT1A 3F9MA 4NXMK 4OPHA 2FBVA 4L3QA 4XH4A 5CE3A 3VQ8A 1NU0A 4FLXA 1L3SA 3L4IA 4KH5A 1TKXA 3SBGA 3HM9A 1KLNA 2YKMA 3P5JA 1KTQA 4BRCA 4FPAA 3AY9A 1S1UA 2ZJQL 3THXB 4N56A 3TAQA 3NH2A 3AVHA 5A2QO 1ZYQA 5CR4A 3AVNA 5C2DA 3K9KA 4DSFA 3EN9A 4ELUA 1IBMK 2QTDA 4WQ4A 3G25A 4CJLA 2ZD1A 1NK9A 3DMJA 3S3NA 4M41A 3HPHA 3T1AA 4RW7A 2QWRA 4JI7K 4DG1A 3LL3A 3ZYYX 4U67L 3O3HA 1T44A 5ELZA 4DTMA 3T7ZA 4M3XA 4BC4A 4BROA 3TAMA 4F8RA 4RW8A 5ADXA 3MECA 3WXKA 2VWJA 4JK9A 2Q2RA 3HP9A 3TSUA 4CGFA 4CJKA 3V9WA 4CGDA 2F8SA 3I55N 4FLWA 3QO9A 3SYZA 2O8BB 3ZSVA 4DFPA 2W42A 2G8IA 4OGCA 3T69A 3ZETB 4FWSA 3CJCA 3KJVA 2FXUA 3T1HK 3JS6A 2P9LB 2WONA 5AQPA 2KLAA 3L8BA 3SCXA 2UYTA 1J53A 1HPZA 4CZKA 1TKTA 4DSLA 4ZTFA 3O9TA 1SL2A 3SQ0A 1U49A 2YJEA 3H6EA 1WB9A 4CGHA 2QW9A 4CBWA 3CF5L 4IFYA 4B1VA 4CEQA 3NVMA 4KHPK 5KPZA 1K9MO 3AVFA 3WXIA 4CI6A 3LM2A 1GLLO 2YNIA 3K5MA 3ZT2A 4MDAA 4DF4A 1YJWN 4BREA 4NYFA 2O8DB 4MO4A 2O8CB 1VRTA 3VF2A 3VF4A 4BGAA 4C8KA 3D0PA 4FW1A 4OKKA 4FWOA 1HKGA 5J2QA 4I9QA 4B9UA 4BWJA 4BRGA 3WUHA 2JWLA 4Q5VA 3MWPA 1Z6RA 4LFBK 3OS0A 4H5TA 4KI6A 4YHHK 3CD6N 2HBJA 1NGAA 4AF1A 4B1XB 3GE1A 2Q0UA 4O5BA 1Q18A 2HSTA 5M1NA 3OBYA 3S41A 1ATNA 3U4LA 3LDPA 4WYBA 3QEXA 4JD2A 1NJYA 1NGEA 1QHAA 2P9UB 4YOWA 1BIZA 4EAHD 1NK0A 3CCEN 1BIUA 3WQUA 5GIPA 1Q7YO 3GOIA 2CH5A 4CJ4A 4W5NA 3VQBA 4K41A 3H1QA 5AQFA 3KKRA 5BN9A 4BR9A 3SV3A 1N33K 2E20A 2KTQA 1GOBA 4GNIA 3J7ZO 3AARA 3CERA 4B1WB 1SL0A 2X74A 5ADXH 1S1WA 3QFUA 2E8AA 1NK6A 2BE2A 5DM7L 3H46O 3VEVA 5BPLA 3MN6A 3PX6A 2OPSA 3LZIA 3HVRA 3THXA 4FOEA 5FRMA 3DYAA 2W41A 3T3FA 2YHBA 2HF3A 4TSXA 1E4GT 4Y1DA 3R6MA 4B1UB 3C6TA 3VEWA 4H0VB 4OO1J 2WTUA 2VYPA 3ULDA 3IG1A 2VG7A 4DF8A 4CZGA 1U04A 2IIRA 1BA1A 3W3DA 4DTJA 3IMXA 2YHYA 3P39A 1Q86O 1T6CA 3TAFA 1VSFA 4IFVA 4CJFA 5CZ2A 1KC8O 4E89A 4PHTX 1SUQA 5AQZA 1WLJA 5AQNA 1HKBA 3C6AA 4KV8A 4YOVA 2FBTA 1YJNN 3SAGA 1OH6A 3ZSOA 2IDOA 3K59A 3FZMA 3AVAA 4X66K 2HHXA 5AR0A 3S3MA 1IKYA 3NF7A 3ZSYA 4CJVA 2IGIA 1S9GA 4HTLA 3KWIA 3MXIA 1SL1A 4CJPA 3PO5A 2PAVA 4CIFA 1RDDA 1NM1A 4BE1A 2HHQA 1HJRA 5C0YA 2ASPA 3KHYA 4JI4K 4C8OA 2QA4N 2Q31A 4H5RA 4CHQA 4CVNE 3CM5A 1FKPA 4MLEA 3LDNA 2O8BA 2E2NA 1X3NA 4BR0A 4WFAL 3CXCM 4J2BA 2JWKA 3P4IA 4DU1A 3ZETA 5GINA 1DLOA 3MCAB 4FWMA 3TU5A 2P9LA 1LV5A 2P1JA 4Z4IA 5DM6L 4KI4A 1VQ4N 3K5LA 5CY4A 1S1XA 5LJWA 3F73A 1XNQK 3CPEA 3MX2A 2NRZA 3ZSXA 1S1TA 3SMPA 3H3OB 4CD3A 2PYJA 3JYTA 4DFKA 2W6LA 1G99A 1EWRA 4I2PA 4DB3A 3TANA 4B3SK 5IWAK 3D2FB 3LP2A 4E7HA 1J6ZA 3QNNA 4EZ9A 2O8DA 1C6VA 1KVAA 3RRHA 2O8CA 2X6SA 1HNZK 3I0SA 4B9QA 3QINA 2P5OA 4JK8A 1OH7A 4Q0BA 3OYBA 3EZ5A 3SBTA 1TAQA 2VG6A 5JLFA 1UA1A 4L8RB 3P38A 4BVPA 1KXPA 3U9DA 4A5BA 4FCYA 4FZXC 3J8AA 3AO4A 2F8TA 3HBTA 4KO0A 3AVLA 5FLXO 4DV5K 3SV4A 3O3FA 1BOTO 3UE5A 1LWEA 1CZBA 2RKIA 4LF8K 3FZFA 5GAHP 3OYLA 1RTDA 2G8WA 3NGZA 2I7NA 3CJ7A 4CIGA 4FJ9A 4JI8K 4V19S 4W5RA 4NO7A 2P9SB 1ZBFA 1WN7A 3KIOA 3BGRA 4DR4K 5AFUA 1YIJN 1BUPA 2P9NB 1JCGA 4O55A 4CEAA 1H1VA 3TAGA 3BUZB 1HMVA 4DTPA 2XY6A 2O4GA 4B3RK 1S72N 3O4QA 3QNOA 1RT2A 4FXDA 3L6QA 3AAQA 5LMUK 3S3OA 1WBDA 1XNRK 3QEPA 4AHSA 2Y1JA 1S5JA 3ZSWA 4DSJA 3DLEA 2E6LA 4DQSA 5KQ8A 3AVIA 3ZLJA 4CECA 1KSPA 4WFBL 1QE1A 4BG8A 4JKFA 3I8BA 1TL1A 3RVCA 3AO3A 4CGIA 3KTQA 3BY5A 3BZCA 2YHWA 1B9DA 3CM6A 3IUCA 2DPNA 4K0KK 3SAHA 4M45A 3U8XA 2OZMA 2IOCA 1DT9A 1HPMA 1QS4A 1S9EA 4RCHA 5AZIB 4KTZA 4KHUA 1LW2A 3A5NC 4XH5A 4X64K 4FZZA 2FSKA 4JK7A 1LAWA 3DWLA 4AM6A 1BDGA 4OPKA 3NBPA 1VSJA 1OH8A 3MDQA 1KD1O 1ATSA 2GUPA 5I42A 3RTVA 5LJVA 5E84A 2EHGA 3O1BA 3LM9A 4M3TA 4BACA 1VQ5N 3TAEA 2QK9A 2DFEA 1QQCA 4DR2K 4CFDA 3PIPL 1HLUA 2DTUA 3SI6A 1BHLA 4B9TA 2D4WA 4JKCA 3WXLA 4GMJB 2D0BA 3OYHA 1ZBLA 1YTUA 3I33A 4DR6K 1JCFA 1XQSC 4NLCA 4CGJA 1SS6A 4CZMA 3V9SA 2UXDK 4DS5A 3HI0A 5CYQA 2UUCK 3DXKB 1EWQA 3CCLN 5JLHA 4CJQA 2FSJA 2A5XA 2G8HA 1BCMA 3B6PA 1XC3A 2IC3A 1QZ5A 3AVMA 3C6UA 2YX6A 3RR7A 3V9XA 4I2QA 1UA0A 1IO2A 3DOKA 1TV6A 3PV8A 2AA4A 5AFUH 4FJJA 5T7BA 1YTAA 1VSLA 4C1NI 4A2AA 2E1YA 4IO9L 4F3OA 3QEWA 3D2FA 4KHWA 2HW3A 4XEIA 2D5RA 1WAJA 1SAZA 3TI0A 4DHYA 3FZKA 5FPMA 1BL3A 1C0FA 1RBSA 4DV1K 2EWSA 2O8FB 1XUPO 1QHTA 1X9JA 4CF1A 4BRHA 1MU2A 3FGUA 3HTVA 1RBRA 2HVIA 4OJRA 4KFBA 2Q0RA 4FVMA 2OTLN 3BP8A 3T19A 4DV0K 4E3SA 1TK5A 1MDUB 2UXBK 2HHUA 3VTIA 4LSNA 4PKHA 5J1EA 3VQ5A 1RT7A 3RR8A 3ITHA 3R3LA 5HRSA 3EE9A 1DTTA 5C10A 4H0TB 1OVYA 1JXBA 3HT3A 2P9SA 4FWKA 4CZEA 4CW7B 4YFUA 4RTFD 4BWMA 2HBMA 2OCEA 4B3OA 1J5EK 4WF9L 4Z94A 3EKSA 3VQPA 4KTWA 4OPAA 3CCRN 1D9FA 2E2OA 3OYAA 4M63C 4RW6A 1GLDG 2VWKA 1JLBA 2HHHK 1TKDA 1RT3A 1W0HA 2NRWA 2G8FA 2ETJA 4I7FA 4BE0A 1M1KO 5CHIA 2HOEA 3FFIA 4JS5A 4IZ9A 3U9ZA 4BRDA 3KZBA 4B9SA 1WBBA 2AJQA 2QI2A 5KI6A 4FLUA 4DV2K 3V1QA 4JKBA 5F2RA 4FJXA 4EIAA 3ATUA 4W5OA 4CF9A 4QS7A 4BY9C 3O3GA 3CCQN 4LF4K 4C8LA 1FW6A 1EKEA 4CHYA 4O44A 2E2PA 4M3YA 3FZHA 4N5SA 3ZT3A 1NKEA 4CZJA 4AHCA 2P9PB 4E7IA 1NG9A 5AZIA 3OA9A 4OLAA 3V4IA 1I39A 5KQDA 4E0DA 2A41A 2GTDA 5JS1A 3HSTB 1TYQB 3WNFA 4IO8A 2GV9A 3K2PA 3UIQA 4KHQA 2UUAK 2F4VK 1NK8A 1X1PA 3CHWA 3QEIA 4DTUA 4BDYA 1ZBIA 4H5NA 4IG0A 4HUFA 4YDUA 1DGKN 1NGDA 1ZBSA 4A5AA 2Q1NA 1UWBA 3WNEA 1BISA 1QSLA 3VEZA 1GOAA 1NGIA 3T1YK 3AVGA 3OHRA 4DR7K 1FKOA 1Q82O 4H0XB 4IFEA 2NRXA 4E1JA 3AA4A 4F9OA 4GVEA 3KD1E 3P1GA 3SMSA 4CZLA 1VQ6N 3G10A 4CZIA 3DXKA 1IBLK 4JI3K 4BR7A 4DV6K 3VGMA 3QDKA 1W97L 3THWA 1VSEA 3SNNA 5EOYA 2G8KA 3VQDA 2F9WA 2Q97A 1P8ZA 4KRFA 4R79A 3CFPA 1YT3A 2H3GX 4H0OA 3SQ4A 3RMAA 3AAPA 2GWKA 2O8FA 1IKVA 3Q7CA 3O08A 3PSIA 4K25A 3C7NB 4CFAA 2YCHA 3O9SA 1IV0A 5AQYA 2VCPA 4Y1CA 4LFCK 4M3UA 2FBXA 2V7ZA 4CEDA 4YNQA 2D0OA 1ZC6A 1VQ7N 1EXQA 5DK5A 3I8DA 1E4FT 3CPWM 3VA3A 4MQ3A 4CIEA 1SKWA 1KCFA 3K5NA 2Z1HA 2IVNA 1B92A 3AVKA 4KBOA 4DU3A 2ZQBA 2HF4A 5J2MA 2NNWA 4CEFA 1QQMA 4DR3K 2X78A 5HRPA 1L3VA 3KLEA 1QTMA 4JRPA 2D1KA 2HNDA 2ZE2A 3M1FA 5AZJB 4O5FA 3NE6A 1V4TA 2VG5A 1G15A 3OJUA 3H1VX 3ISNC 4PY5A 1JL1A 3M8SA 4YOTA 2HHSA 4AHTA 1MWMA 5AQWA 3CC4N 3IDHA 3GL1A 2W40A 4CFBA 2P9IB 3CFOA 3FFKB 3OY9A 3FR0A 4JAXA 1X3MA 3MEDA 3UKUB 5AQSA 1Q9XA 4WE1A 3CQ8A 3ZT0A 2XY7A 2OYQA 1XI1A 2Y1IA 4CEEA 4BRNA 4FOIA 3UB5A 3AGKA 3A0IX 2FSNA 5KPRA 2ASMA 2O8EB 2KZMA 4FWNA 5M1OA 4M3ZA 4DQ8A 3AVCA 3NF6A 4FSVA 3I0RA 4DKWA 4CHZA 3TPQA 4I6MB 4FJLA 3KLHA 1ZBHA 3TABA 3PX4A 2P9PA 3VEYA 3VQCA 3KLGA 1VSMA 4B1YB 1JXEA 5BPNA 5KPTA 1HYSA 3A2FA 2ZWHA 1N6QA 3CETA 1VQ8N 2P9KB 4QAGA 2UUBK 1TYQA 1NGHA 4JI2K 3VTHA 4JI1K 1L3TA 3DRPA 2UXCK 3M5RA 1RT6A 2D0PA 3VGLA 1I3AA 3NDKA 4CD1A 3HPGA 3MK6A 3O9RA 2ZGYA 2IS3A 2WBNA 4FJ8A 3L2VA 1JJ2M 3NVKA 3ULEB 3OYFA 4MFBA 3CCMN 3RWUA 4JNEA 3CCUN 3VEXA 1N8RO 4KREA 4GKJK 4O0IA 3AA2A 4FJNA 4B3MK 3HPOA 2KFNA 3NFAA 1XHZA 3H08A 1BO5O 1NGFA 4JS4A 1BU6O 4WFNL 4DLEA 3HYFA 4H03B 4CCHA 1QSSA 4N41A 2G8UA 2F7TA 1KQSM 3N4PA 4FLVA 4CHPA 2ZJPL 2BTFA 2A42A 4KTQA 3DM2A 3KK3A 1TUUA 2QWOA 2Z1GA 2GWJA 4BC3A 4O8UA 1HNWK 5TKWA 1C0UA 2OPQA 3AO1A 4E7LA 2HNZA 1RBUA 1CLQA 4MDBA 4H5VA 5BR8K 1Q8IA 1XWLA 3LDSA 4B8AB 2PY5A 1KVCA 5FPDA 1CXUA 1QVFM 4HHTA 4JYAK 4DQQA 1NWKA 1Z05A 3KK2A 3CQXA 4IDHA 3ATVA 2YJFA 5BRHA 2V52B 3C7NA 1EP4A 4DSEA 3P31A 3IFRA 4BDPA 3ZSQA 4CERA 3NF9A 5C12A 5J2PA 5GIOA 4RW4A 3EKUA 3DLGA 2QWLA 4WCEL 4F4KA 1YXQA 5JICA 2YI1A 1R59O 3KKSA 5E41A 3E1YA 4I9LA 2HBLA 4A2BA 2VGNA 4BRFA 3QMLA 1FK9A 3JAMO 1TK0A 4K8XA 2YNGA 1IH7A 4PA1A 1T6DA 3C94A 1XMQK 4FJ7A 5AZJA 3A5LC 5AQUA 1NKCA 4CBXA 2GBZA 1GOCA 3F5TA 4DQIA 4BR4A 4KHSA 2HBKA 4DS4A 2P51A 3VETA 1NOZA 3ZT4A 2ZM6K 4K8ZA 4LF9K 3UKRB 2CGJA 3DOLA 4FM0A 4B9NA 1XHXA 2WFBA 4NCGA 4IDKA 3WEEA 3K57A 2P9IA 3LAKA 4DQPA 2GEMA 4FJHA 1B9FA 4ZTJA 3ZSRA 3O80A 3UKUA 4KH6A 5BR9A 1TAUA 1D9DA 2E1ZA 4N47A 4B9LA 3O5BA 2AP1A 4BRKA 1RT4A 4OLBA 5AQIA 2LSNA 4H0PA 4YORA 4GV6A 1LWCA 3PLAA 2RN2A 3VQ9A 2O8EA 3IAYA 3N4QA 4A61A 3A8YA 3DXMB 3TWHA 3K5OA 3VQEA 1WNSA 3PIOL 2O4IA 4ILHA 1KAYA 1HNVA 4I6MA 2BDPA 4AHUA 5EX5A 5M1KA 4DU4A 1NJXA 4JHDB 3QIPA 4EZ6A 4IJNA 3M6GA 2PZSA 4K42A 2CH6A 1YJ9N 4ELTA 3L2QA 3C6HA 4EP4A 4DUZK 3G4SN 1YI2N 3QB0A 2P9KA 4NYNA 3TTDA 3TAPA 4OX9K 4BDZA 3TTFA 2OPPA 1NKBA 2XY8A 4QS9A 2A1RA 1VSKA 5FPEA 3PY8A 3ZSZA 3K9JA 1YVNA 4CZHA 1OVQA 4JKGA 5JVGL 3ULEA 1C0GA 2FF6A 1O1WA 4ILGB 1VQMN 3VN5A 3BDPA 4ISFA 3OYCA 4LF5K 3ZX2A 1RDCA 2GUIA 1SV5A 5AQQA 1XC9A 3DLHA 4DR1K 4IBNA 1JKHA 1E3MA 1Q9YA 3HOSA 4GV9A 3RSEB 4IKFA 3CJ9A 5AQOA 3MX5A 3J81O 2DY4A 1NGBA 4CFCA 1HJOA 3M8PA 4Z4CA 3CIPA 2BUPA 2PFUA 1N34K 2W6KA 3OYMA 5BREA 3TARA 2HMIA 4NCAA 4B3TK 1KVBA 1NMNA 2YKNA 3RMCA 4G1QA 4B1ZA 3NH1A 1S22A 3B6OA 2FF3B 4CJUA 3LDQA 5C25A 4FWRA 3SPYA 1TVRA 3HSCA 1U48A 3V6DA 4NCBA 4JRQA 4HUEA 3DLRA 4J2EA 3K0SA 3SK3A 1VQPN 1VRUA 1GLJO 2ITMA 3HL8A 3M8QA 4XH1A 4KAZA 4FL9A 5LY3A 2HHWA 3G0ZA 4CEZA 1IKWA 4FLYA 2WUSA 4FWLA 4PKIA 4EHUA 5EVZA 1IG8A 2RE2A 3F9KA 3THWB 4FK4A 2CGLA 3NGIA 1HR0K 2KZZA 3BEXA 3HO1A 2NUBA 1NNEA 3QLHA 2XO7A 1S6PA 3LPTA 4ISGA 3QESA 1RDBA 4BR2A 4BQLA 1NK5A 1RILA 1SZ2A 2E4LA 4IWVA 3UKRA 3LP3A 2QM1A 3LAMA 3MWTA 3CJ1A 4EP5A 4C23A 3LANA 4CJWA 3LWMA 3LWLA 3ZEUB 2FBYA 3R8EA 3OS1A 3QERA 4Z4GA 4CJ3A 3QETA 1VQ9N 1D8YA 1ITGA 3MN5A 1T7PA 3PUFA 2HHTA 5HLFA 1EETA 3D2EB 4B9MA 4FZYA 1LCUA 1S6QA 4CESA 4PL8A 5CZ1A 3DXMA 1VSIA 1YUWA 4YOYA 4ID1A 5J2NA 3DJCA 4FO0A 4M7XA 4DMNA 4JHDA 5D3GA 1HX1A 1A5VA 3NH0A 1ASVA 1VAZA 1KAZA 2PBDA 2B4JA 1GLFO 4JKEA 1VQKN 3NMUA 4DSIA 1NGGA 2J4RA 1GLCG 4BQZA 1I94K 3O1WA 3ID6A 5KGXA 2IAJA 5JVHL 3MEEA 3ID8A 3LALA 4PQUA 3EL2A 3BZKA 4YDUC 1VSHA 2I5JA 1C0MA 5GAEP 3HZ6A 3FZLA 2Z1IA 1J54A 4BRAA 4WQ5C 4AM7A 1DEJA 4CK3A 3VOVA 1WSFA 2NLXA 2WC9A 3VEOA 4BRMA 4H4MA 3CG7A 4FK2A 3LP1A 3R9PA 1WAFA 4BC2A 1MA9B 3OBWA 3MEGA 5C2FA 2ZGZA 3RSEA 4FYDA 3HOTA 4CJ5A 2BGGA 3M3ZA 3PSFA 1Z26A 4IOCL 3KLIA 4DCHA 3SAFA 2HVHA 1KRPA 3KVGA 1KFDA 2RF2A 4LFAK 3MMVA 4FJMA 2HMPA 3DRRA 3KK7A 3NHGA 5AQXA 3AV9A 4U7BA 4DV3K 1Y97A 4WQ5A 2QXFA 1NMDA 5KGWA 3KD5E 4FJGA 3QBWA 3SPZA 1RT5A 3JXUA 1HQUA 2R7YA 1YITN 3ZX3A 4BRPA 3ZCMA 3OYGA 2V51B 4C8NA 5M1PA 1S3XA 5GADP 5AQVA 2NRRA 3TTCA 1C0TA 1S1VA 3J7AP 3ENHA 3OW2M 1FXXA 3EZWA 2OANA 4ZHRA 2VQEK 4H0YB 3O9UA 5AQJA 4DV4K 3CMEN 1IBKK 3O8MA 4OKJA 4CF0A 5KTQA 1QQOA 3AO5A 4Z0UA 3CCSN 3D45A 1MWKA 3J80O 1YF5L 1K8KB 3DLKA 3D6RA 3OS2A 4DTXA 2E6MA 1DTQA 2ASOA 2ATQA 3NGYA 2A40A 1BI4B 3LPUA 1YAGA 1RBVA 2YHAA 4RW9A 5HP1A 3W0LA 1ASWA 4MLHA 3C95A 3V1RA 3HP6A 3M8RA 2E88A 4NLBA 4H8KA 1K73O 1LOTB 4KPYA 3R1XA 3A5MC 3OYNA 4BGBA 3RMDA 3DI6A 1BQMA 1RDWX 3VQAA 4AQYK 3FLCO 3SZ2A 4W5QA 3ZEUA 1NJZA 4H4OA 3ALYA 2BANA 4XIUA 1T8EA 4HVJA 1WSJA 1REVA 4M3RA 3AO2A 1T3VA 3VA0A 2GX9A 3D2EA 4A62A 4F2SA 4FWQA 1M90O 4CZFA 4OKEA 2XRIA 2IVPA 3VENA 1L3UA 1ESVA 5H1SQ 2A6AA 2KFZA 4FM1A 3VESA 1F21A 3DLLL 5K14A 3KK1A 3U3GA 3WEEB 4MO5A 2IVOA 3V1OA 4Z4FA 4Y0WA 3GBTA 1IKXA 3MXMA 5EXWA 4DQRA 4A59A 3F2KA 3VF6A 5SZTA 4W5TA 1OH5A 2RHKA 4CBUA 1WUAA 4GW6A 4JV5K 3IRXA 4CF2A 1U45A 2UU9K 4J2AA 1HYVA 3CQYA 4FWPA 4BE2A 3BF3A 3O9QA 3VGKA 2Q3SA 3QBXA 4JKAA 1JLQA 4JKDA 4CJSA 4YY3K 4QCLA 3SUQA 4RG8A 3VQ4A 1J9AA 4JI6K 4LY7A 4BRIA 1C1CA 2B5JA 2JGUA 3E66A 3QIOA 1DKGD 1NJWA 1QVGM 1RDUA 2QWNA 1VHXA 5I9EB 3VMFB 5M1QA 1KAXA 1IJJA 3HK2A 2V7YA 4CF8A 2YHXA 4PUOA 2ZF5O 1BGXT 4H5WA 4CJEA 1L5UA 2JLEA 3S9HA 5F0XA 1JLCA 1Y64A 1VQON 5B8HA 2QWPA 3MCPA 1BQNA 4JN4A 3VQQA 3ASMA 2VQFK 4IOAL 3OJSA 2KKZA 3CC7N 1CZ9A 2KHOA 4JKGB 4FPBA 4CHOA 4IG3A 3CCJN 4FLTA 4E1MA 5C42A 3L4QA 4M42A 4HCCA 1U47A 4DWIA 3CJBA 5FPNA 4BRQA 3HVTA 3ZX0A 5HL7L 3MXJA 5I3UA 4BG9A 5AQTA 4AH9A 5LMNK 4HCBA 4LF6K 1W2BM 3C65A 3O6WA 3GDQA 5F1XA 1EX4A 1WOQA 3ENBA 5BN8A 4DTNA 3SLCA 3L3UA 5M1FA 5BRDA 3WQTA 4CHNA 3CC2N 4HWIA 1EQYA 5EY4A 5HOOA 3J7YP 1GLAG 1CXQA 3THVA 3IKMA 4FVUA 5FRNA 2KQ2A 1HNIA 3PX0A 1T05A 1ZXOA 3O4WA 3LP0A 5JS2A 4DLGA 1T03A 4KB0A 3OYKA 1W7AA 2YNHA 3WNGA 1K8KA 1JLAA 4BRLA 1N36K 4DFJA 1J5OA 3E9LA 3AVBA 5AQRA 1BI4A 1N5YA 5JMVA 4KHNA 4X65K 3G6EN 4JI5K 4QS8A 5AQMA 2A1SA 3OYJA 3THYB 2HB5A 3NCIA 2G8VA 1SQKA 4LH4A 3SUNA 1RBTA 4E7KA 4ICLA 2KW4A 4CK2A 1VSDA 1LWFA 1QZ6A 1C1AA 2DFHA 4ID5A 5GAGP 3DRSA 5BRFA 1HQEA 4JI0K 5CYMA 5LL6Z 4ISEA 2F96A 4YOXA 1SKRA 1WSIA 4GKKK 1WSEA 2GELA 1X9SA 3GG4A 3WXJA 4YOUA 1TUYA 3K58A 1TKZA 2QWMA 3AVJA 4CE9A 2EX3A 2XY5A 4KH4A 5KRSA 4OPJA 2RPIA 2A3ZA 1UAXA 2PYLA 1CZAN 4QOZB 3TR8A 4BR5A 5E26A 3LDLA 3QEVA 2E2QA 4CK1A 4PWDA 1HYZA 1RTIA 5AQHA 4CJTA 2QKKA 3IS9A 2NRHA 4O4GA 2E5LK 4F3TA 3A5OC 2HHVA 4FM2A 3O4NA 2I7PA 3EE8A 4M7YA 4NB4A 3CI5A 4PL7A 3V9ZA 5HBMA 1NGCA 1UOCA 3EO3A 3B8AX 1BA0A 1D5AA 4FW2A 1YVUA 1VQNN 4DUYK 1ATRA 1QSYA 3OYIA 1LW0A 5SWMA 4AILC 2P9UA 3AGRA 4GV3A 1U2VB 3OTOK 1X9MA 4CEOA 1HRHA 1OKJA 1JL2A 5HRRA 3EEQA 4NXNK 1HUXA 2YNFA 2HNYA 4C1NK 3SUOA 3EY1A 1WSGA 3HM8A 4DSKA 4EFHA 3OYDA 4LC9B 4AHRA 5C24A 3PO4A 3G71N 1VK0A 3KWGA 3V81A 3TSQA 2NRTA 3TSPA 1EO1A 4LSLA 1BCOA 1KFSA 4B08A 2X6NA 1VQLN 1O13A 4DR5K 3NF8A 3QFPA 3U6FA 4ELVA 3DLBA 1ILYA 1BWFO 3QICA 1RDAA 4Z4EA 1HNXK 5KRTA 3E01A 1RTHA 1TL3A 4KB1A 3L3VA 5MLCQ 1NGJA 4R5PA 1TGOA 2NZTA 3FE1A 3V9UA 1U4BA 2CGKA 3LDOA 1RFQA 3L0QA 4LD0A 2OA8A 4HTUA 3RMBA 4AHVA 1XMOK 3H45C 1BG3A 5AJ3K 1A5WA 2WOMA 4OGEA 4UY8O 4G9ZA 1U6ZA 3EYZA 2YV0X 4KKOA 4GY2B 1LAVA 2NRVA 4KHYA 3L2WA 3SQ1A 3C0BA 5FDLA 1HKCA 3MN7A 4J2DA 1A5XA 3SJHA 4RWTA 4PKGA 5HROA 2OPRA 3THYA 1RTJA 4EHTA 2QEXN 4C8MA 3WT0A 5C15A 4FK0A 3JSMA 1FJGK 2QKBA 2VGMA 4BVOA 1WSHA 3KLFA 4LH5A 4FLZA 3ENOA 3VERA 1W9HA 4DTSA 4CJRA 1NOYA 3RRGA 4O0JA 3D7EO 1C1BA 2XHBA 1ZBUA 4HUGA 3E9PA 4B8CA 1N32K 4LF7K 4O8KA 4X62K 3HJFA 4IJAA 4JKHA 4B9VA 3SQ2A 1TK8A 2F9TA 4E1NA 1D4XA 1KLMA 1QQNA 1K6YA 3CJAA 4E7JA 3H3NO 2OTJN 3WNHA 3L2UA 2Z1JA 3VQ6A 3I56N 3CFRA 1YHQN 3VQ7A 3AA5X 3HXMA 1NJIO 1V4SA 3SJJA 4JLHA 2D0AA 3E9OA 3NAEA 3OYEA 3U3YA 5DMRA 5IT9O 5AQGA 5FROA 4K43A 1NK4A 1IG9A 3VPZA 2P5GA 4DTRA 1NLVA 3Q7BA 4Z4HA 2ITGA 4IEIA 1RNHA 2DFFA 2Q36A 1P90A 4UQGA 2VWBA 1ASUA 5AQLA 3MAQA 4J8FA 3WXMB 5HRNA 2QXLA 1GLBG 2FLOA 1JLFA 2FC0A 3OVNA 1JLGA 4OVLA 3CMAN 1RGIA 4GVMA 4BC5A 1X9WA 1U2VA 1RCHA 1GLEG 2P9NA 3SUPA 3BF1A 4E19A 2B6AA 4FJ5A 4DTOA 3ZT1A 2BH1A 4CGGA 1NK7A 2D0CA 3CYMA 4DFMA 3DAWA 1R0AA 4M3WA 3MN9A 3AA3A 4IOXA 3L2RA 1K8AO 3CCVN 1Z25A 4FJKA 1SKSA 3LZJA 5TKYA 1JCEA 5BPMA 5EU7A 4IEEA 4ILJA 4N76A 4JEPA 3HRGA 4FJIA 2QWQA 4CEBA
chains in the Genus database with same CATH topology
3J7YP 1J5EK 4DUYK 4LFAK 1IBLK 4JI3K 1FJGK 4DV7K 3T1HK 4DV6K 4DV3K 3OTOK 4NXMK 4DR2K 4NXNK 2HHHK 3JAMO 1N36K 5FLXO 4DV5K 4LF5K 4JV5K 1N32K 4LF7K 4LF8K 2UU9K 4KHPK 4X62K 4DR1K 1XMQK 4X65K 2UUBK 4JI2K 4JI8K 4JI5K 4JI1K 4V19S 4DR6K 3J81O 2UXCK 4YY3K 4DV2K 3J7AP 4X66K 2UXDK 5A2QO 2VQEK 4DR5K 4DR4K 2ZM6K 4JI6K 4LF9K 4DV4K 2UUCK 4LFCK 1N34K 4LF4K 1IBKK 1HNXK 1IBMK 4B3TK 4B3RK 4JI4K 4JI0K 5IT9O 5LL6Z 4LFBK 5LMUK 4GKJK 3J80O 4CVNE 4B3MK 1XNRK 4GKKK 4YHHK 4DR3K 1I94K 1XMOK 4JI7K 2VQFK 5AJ3K 4DV1K 2UUAK 2F4VK 4AQYK 1HNWK 1HR0K 1XNQK 4K0KK 1N33K 2UXBK 4DV0K 5BR8K 4DUZK 3T1YK 5LMNK 4DR7K 4LF6K 2E5LK 4X64K 4OX9K 4JYAK 4B3SK 5IWAK 4CW7B 1HNZK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7Y P;  1J5E K;  4DUY K;  4LFA K;  1IBL K;  4JI3 K;  1FJG K;  4DV7 K;  3T1H K;  4DV6 K;  4DV3 K;  3OTO K;  4NXM K;  4DR2 K;  4NXN K;  2HHH K;  3JAM O;  1N36 K;  5FLX O;  4DV5 K;  4LF5 K;  4JV5 K;  1N32 K;  4LF7 K;  4LF8 K;  2UU9 K;  4KHP K;  4X62 K;  4DR1 K;  1XMQ K;  4X65 K;  2UUB K;  4JI2 K;  4JI8 K;  4JI5 K;  4JI1 K;  4V19 S;  4DR6 K;  3J81 O;  2UXC K;  4YY3 K;  4DV2 K;  3J7A P;  4X66 K;  2UXD K;  5A2Q O;  2VQE K;  4DR5 K;  4DR4 K;  2ZM6 K;  4JI6 K;  4LF9 K;  4DV4 K;  2UUC K;  4LFC K;  1N34 K;  4LF4 K;  1IBK K;  1HNX K;  1IBM K;  4B3T K;  4B3R K;  4JI4 K;  4JI0 K;  5IT9 O;  5LL6 Z;  4LFB K;  5LMU K;  4GKJ K;  3J80 O;  4CVN E;  4B3M K;  1XNR K;  4GKK K;  4YHH K;  4DR3 K;  1I94 K;  1XMO K;  4JI7 K;  2VQF K;  5AJ3 K;  4DV1 K;  2UUA K;  2F4V K;  4AQY K;  1HNW K;  1HR0 K;  1XNQ K;  4K0K K;  1N33 K;  2UXB K;  4DV0 K;  5BR8 K;  4DUZ K;  3T1Y K;  5LMN K;  4DR7 K;  4LF6 K;  2E5L K;  4X64 K;  4OX9 K;  4JYA K;  4B3S K;  5IWA K;  4CW7 B;  1HNZ K; 
#chains in the Genus database with same CATH topology
 4JD2 B;  1JLE A;  4A57 A;  4DV7 K;  2OZS A;  1NBW A;  5AQK A;  2ZJR L;  4F2R A;  1Q81 O;  4IXC A;  4CJ7 A;  3P83 D;  4WQ4 C;  1RT1 A;  3F9M A;  4NXM K;  4OPH A;  2FBV A;  4L3Q A;  4XH4 A;  5CE3 A;  3VQ8 A;  1NU0 A;  4FLX A;  1L3S A;  3L4I A;  4KH5 A;  1TKX A;  3SBG A;  3HM9 A;  1KLN A;  2YKM A;  3P5J A;  1KTQ A;  4BRC A;  4FPA A;  3AY9 A;  1S1U A;  2ZJQ L;  3THX B;  4N56 A;  3TAQ A;  3NH2 A;  3AVH A;  5A2Q O;  1ZYQ A;  5CR4 A;  3AVN A;  5C2D A;  3K9K A;  4DSF A;  3EN9 A;  4ELU A;  1IBM K;  2QTD A;  4WQ4 A;  3G25 A;  4CJL A;  2ZD1 A;  1NK9 A;  3DMJ A;  3S3N A;  4M41 A;  3HPH A;  3T1A A;  4RW7 A;  2QWR A;  4JI7 K;  4DG1 A;  3LL3 A;  3ZYY X;  4U67 L;  3O3H A;  1T44 A;  5ELZ A;  4DTM A;  3T7Z A;  4M3X A;  4BC4 A;  4BRO A;  3TAM A;  4F8R A;  4RW8 A;  5ADX A;  3MEC A;  3WXK A;  2VWJ A;  4JK9 A;  2Q2R A;  3HP9 A;  3TSU A;  4CGF A;  4CJK A;  3V9W A;  4CGD A;  2F8S A;  3I55 N;  4FLW A;  3QO9 A;  3SYZ A;  2O8B B;  3ZSV A;  4DFP A;  2W42 A;  2G8I A;  4OGC A;  3T69 A;  3ZET B;  4FWS A;  3CJC A;  3KJV A;  2FXU A;  3T1H K;  3JS6 A;  2P9L B;  2WON A;  5AQP A;  2KLA A;  3L8B A;  3SCX A;  2UYT A;  1J53 A;  1HPZ A;  4CZK A;  1TKT A;  4DSL A;  4ZTF A;  3O9T A;  1SL2 A;  3SQ0 A;  1U49 A;  2YJE A;  3H6E A;  1WB9 A;  4CGH A;  2QW9 A;  4CBW A;  3CF5 L;  4IFY A;  4B1V A;  4CEQ A;  3NVM A;  4KHP K;  5KPZ A;  1K9M O;  3AVF A;  3WXI A;  4CI6 A;  3LM2 A;  1GLL O;  2YNI A;  3K5M A;  3ZT2 A;  4MDA A;  4DF4 A;  1YJW N;  4BRE A;  4NYF A;  2O8D B;  4MO4 A;  2O8C B;  1VRT A;  3VF2 A;  3VF4 A;  4BGA A;  4C8K A;  3D0P A;  4FW1 A;  4OKK A;  4FWO A;  1HKG A;  5J2Q A;  4I9Q A;  4B9U A;  4BWJ A;  4BRG A;  3WUH A;  2JWL A;  4Q5V A;  3MWP A;  1Z6R A;  4LFB K;  3OS0 A;  4H5T A;  4KI6 A;  4YHH K;  3CD6 N;  2HBJ A;  1NGA A;  4AF1 A;  4B1X B;  3GE1 A;  2Q0U A;  4O5B A;  1Q18 A;  2HST A;  5M1N A;  3OBY A;  3S41 A;  1ATN A;  3U4L A;  3LDP A;  4WYB A;  3QEX A;  4JD2 A;  1NJY A;  1NGE A;  1QHA A;  2P9U B;  4YOW A;  1BIZ A;  4EAH D;  1NK0 A;  3CCE N;  1BIU A;  3WQU A;  5GIP A;  1Q7Y O;  3GOI A;  2CH5 A;  4CJ4 A;  4W5N A;  3VQB A;  4K41 A;  3H1Q A;  5AQF A;  3KKR A;  5BN9 A;  4BR9 A;  3SV3 A;  1N33 K;  2E20 A;  2KTQ A;  1GOB A;  4GNI A;  3J7Z O;  3AAR A;  3CER A;  4B1W B;  1SL0 A;  2X74 A;  5ADX H;  1S1W A;  3QFU A;  2E8A A;  1NK6 A;  2BE2 A;  5DM7 L;  3H46 O;  3VEV A;  5BPL A;  3MN6 A;  3PX6 A;  2OPS A;  3LZI A;  3HVR A;  3THX A;  4FOE A;  5FRM A;  3DYA A;  2W41 A;  3T3F A;  2YHB A;  2HF3 A;  4TSX A;  1E4G T;  4Y1D A;  3R6M A;  4B1U B;  3C6T A;  3VEW A;  4H0V B;  4OO1 J;  2WTU A;  2VYP A;  3ULD A;  3IG1 A;  2VG7 A;  4DF8 A;  4CZG A;  1U04 A;  2IIR A;  1BA1 A;  3W3D A;  4DTJ A;  3IMX A;  2YHY A;  3P39 A;  1Q86 O;  1T6C A;  3TAF A;  1VSF A;  4IFV A;  4CJF A;  5CZ2 A;  1KC8 O;  4E89 A;  4PHT X;  1SUQ A;  5AQZ A;  1WLJ A;  5AQN A;  1HKB A;  3C6A A;  4KV8 A;  4YOV A;  2FBT A;  1YJN N;  3SAG A;  1OH6 A;  3ZSO A;  2IDO A;  3K59 A;  3FZM A;  3AVA A;  4X66 K;  2HHX A;  5AR0 A;  3S3M A;  1IKY A;  3NF7 A;  3ZSY A;  4CJV A;  2IGI A;  1S9G A;  4HTL A;  3KWI A;  3MXI A;  1SL1 A;  4CJP A;  3PO5 A;  2PAV A;  4CIF A;  1RDD A;  1NM1 A;  4BE1 A;  2HHQ A;  1HJR A;  5C0Y A;  2ASP A;  3KHY A;  4JI4 K;  4C8O A;  2QA4 N;  2Q31 A;  4H5R A;  4CHQ A;  4CVN E;  3CM5 A;  1FKP A;  4MLE A;  3LDN A;  2O8B A;  2E2N A;  1X3N A;  4BR0 A;  4WFA L;  3CXC M;  4J2B A;  2JWK A;  3P4I A;  4DU1 A;  3ZET A;  5GIN A;  1DLO A;  3MCA B;  4FWM A;  3TU5 A;  2P9L A;  1LV5 A;  2P1J A;  4Z4I A;  5DM6 L;  4KI4 A;  1VQ4 N;  3K5L A;  5CY4 A;  1S1X A;  5LJW A;  3F73 A;  1XNQ K;  3CPE A;  3MX2 A;  2NRZ A;  3ZSX A;  1S1T A;  3SMP A;  3H3O B;  4CD3 A;  2PYJ A;  3JYT A;  4DFK A;  2W6L A;  1G99 A;  1EWR A;  4I2P A;  4DB3 A;  3TAN A;  4B3S K;  5IWA K;  3D2F B;  3LP2 A;  4E7H A;  1J6Z A;  3QNN A;  4EZ9 A;  2O8D A;  1C6V A;  1KVA A;  3RRH A;  2O8C A;  2X6S A;  1HNZ K;  3I0S A;  4B9Q A;  3QIN A;  2P5O A;  4JK8 A;  1OH7 A;  4Q0B A;  3OYB A;  3EZ5 A;  3SBT A;  1TAQ A;  2VG6 A;  5JLF A;  1UA1 A;  4L8R B;  3P38 A;  4BVP A;  1KXP A;  3U9D A;  4A5B A;  4FCY A;  4FZX C;  3J8A A;  3AO4 A;  2F8T A;  3HBT A;  4KO0 A;  3AVL A;  5FLX O;  4DV5 K;  3SV4 A;  3O3F A;  1BOT O;  3UE5 A;  1LWE A;  1CZB A;  2RKI A;  4LF8 K;  3FZF A;  5GAH P;  3OYL A;  1RTD A;  2G8W A;  3NGZ A;  2I7N A;  3CJ7 A;  4CIG A;  4FJ9 A;  4JI8 K;  4V19 S;  4W5R A;  4NO7 A;  2P9S B;  1ZBF A;  1WN7 A;  3KIO A;  3BGR A;  4DR4 K;  5AFU A;  1YIJ N;  1BUP A;  2P9N B;  1JCG A;  4O55 A;  4CEA A;  1H1V A;  3TAG A;  3BUZ B;  1HMV A;  4DTP A;  2XY6 A;  2O4G A;  4B3R K;  1S72 N;  3O4Q A;  3QNO A;  1RT2 A;  4FXD A;  3L6Q A;  3AAQ A;  5LMU K;  3S3O A;  1WBD A;  1XNR K;  3QEP A;  4AHS A;  2Y1J A;  1S5J A;  3ZSW A;  4DSJ A;  3DLE A;  2E6L A;  4DQS A;  5KQ8 A;  3AVI A;  3ZLJ A;  4CEC A;  1KSP A;  4WFB L;  1QE1 A;  4BG8 A;  4JKF A;  3I8B A;  1TL1 A;  3RVC A;  3AO3 A;  4CGI A;  3KTQ A;  3BY5 A;  3BZC A;  2YHW A;  1B9D A;  3CM6 A;  3IUC A;  2DPN A;  4K0K K;  3SAH A;  4M45 A;  3U8X A;  2OZM A;  2IOC A;  1DT9 A;  1HPM A;  1QS4 A;  1S9E A;  4RCH A;  5AZI B;  4KTZ A;  4KHU A;  1LW2 A;  3A5N C;  4XH5 A;  4X64 K;  4FZZ A;  2FSK A;  4JK7 A;  1LAW A;  3DWL A;  4AM6 A;  1BDG A;  4OPK A;  3NBP A;  1VSJ A;  1OH8 A;  3MDQ A;  1KD1 O;  1ATS A;  2GUP A;  5I42 A;  3RTV A;  5LJV A;  5E84 A;  2EHG A;  3O1B A;  3LM9 A;  4M3T A;  4BAC A;  1VQ5 N;  3TAE A;  2QK9 A;  2DFE A;  1QQC A;  4DR2 K;  4CFD A;  3PIP L;  1HLU A;  2DTU A;  3SI6 A;  1BHL A;  4B9T A;  2D4W A;  4JKC A;  3WXL A;  4GMJ B;  2D0B A;  3OYH A;  1ZBL A;  1YTU A;  3I33 A;  4DR6 K;  1JCF A;  1XQS C;  4NLC A;  4CGJ A;  1SS6 A;  4CZM A;  3V9S A;  2UXD K;  4DS5 A;  3HI0 A;  5CYQ A;  2UUC K;  3DXK B;  1EWQ A;  3CCL N;  5JLH A;  4CJQ A;  2FSJ A;  2A5X A;  2G8H A;  1BCM A;  3B6P A;  1XC3 A;  2IC3 A;  1QZ5 A;  3AVM A;  3C6U A;  2YX6 A;  3RR7 A;  3V9X A;  4I2Q A;  1UA0 A;  1IO2 A;  3DOK A;  1TV6 A;  3PV8 A;  2AA4 A;  5AFU H;  4FJJ A;  5T7B A;  1YTA A;  1VSL A;  4C1N I;  4A2A A;  2E1Y A;  4IO9 L;  4F3O A;  3QEW A;  3D2F A;  4KHW A;  2HW3 A;  4XEI A;  2D5R A;  1WAJ A;  1SAZ A;  3TI0 A;  4DHY A;  3FZK A;  5FPM A;  1BL3 A;  1C0F A;  1RBS A;  4DV1 K;  2EWS A;  2O8F B;  1XUP O;  1QHT A;  1X9J A;  4CF1 A;  4BRH A;  1MU2 A;  3FGU A;  3HTV A;  1RBR A;  2HVI A;  4OJR A;  4KFB A;  2Q0R A;  4FVM A;  2OTL N;  3BP8 A;  3T19 A;  4DV0 K;  4E3S A;  1TK5 A;  1MDU B;  2UXB K;  2HHU A;  3VTI A;  4LSN A;  4PKH A;  5J1E A;  3VQ5 A;  1RT7 A;  3RR8 A;  3ITH A;  3R3L A;  5HRS A;  3EE9 A;  1DTT A;  5C10 A;  4H0T B;  1OVY A;  1JXB A;  3HT3 A;  2P9S A;  4FWK A;  4CZE A;  4CW7 B;  4YFU A;  4RTF D;  4BWM A;  2HBM A;  2OCE A;  4B3O A;  1J5E K;  4WF9 L;  4Z94 A;  3EKS A;  3VQP A;  4KTW A;  4OPA A;  3CCR N;  1D9F A;  2E2O A;  3OYA A;  4M63 C;  4RW6 A;  1GLD G;  2VWK A;  1JLB A;  2HHH K;  1TKD A;  1RT3 A;  1W0H A;  2NRW A;  2G8F A;  2ETJ A;  4I7F A;  4BE0 A;  1M1K O;  5CHI A;  2HOE A;  3FFI A;  4JS5 A;  4IZ9 A;  3U9Z A;  4BRD A;  3KZB A;  4B9S A;  1WBB A;  2AJQ A;  2QI2 A;  5KI6 A;  4FLU A;  4DV2 K;  3V1Q A;  4JKB A;  5F2R A;  4FJX A;  4EIA A;  3ATU A;  4W5O A;  4CF9 A;  4QS7 A;  4BY9 C;  3O3G A;  3CCQ N;  4LF4 K;  4C8L A;  1FW6 A;  1EKE A;  4CHY A;  4O44 A;  2E2P A;  4M3Y A;  3FZH A;  4N5S A;  3ZT3 A;  1NKE A;  4CZJ A;  4AHC A;  2P9P B;  4E7I A;  1NG9 A;  5AZI A;  3OA9 A;  4OLA A;  3V4I A;  1I39 A;  5KQD A;  4E0D A;  2A41 A;  2GTD A;  5JS1 A;  3HST B;  1TYQ B;  3WNF A;  4IO8 A;  2GV9 A;  3K2P A;  3UIQ A;  4KHQ A;  2UUA K;  2F4V K;  1NK8 A;  1X1P A;  3CHW A;  3QEI A;  4DTU A;  4BDY A;  1ZBI A;  4H5N A;  4IG0 A;  4HUF A;  4YDU A;  1DGK N;  1NGD A;  1ZBS A;  4A5A A;  2Q1N A;  1UWB A;  3WNE A;  1BIS A;  1QSL A;  3VEZ A;  1GOA A;  1NGI A;  3T1Y K;  3AVG A;  3OHR A;  4DR7 K;  1FKO A;  1Q82 O;  4H0X B;  4IFE A;  2NRX A;  4E1J A;  3AA4 A;  4F9O A;  4GVE A;  3KD1 E;  3P1G A;  3SMS A;  4CZL A;  1VQ6 N;  3G10 A;  4CZI A;  3DXK A;  1IBL K;  4JI3 K;  4BR7 A;  4DV6 K;  3VGM A;  3QDK A;  1W97 L;  3THW A;  1VSE A;  3SNN A;  5EOY A;  2G8K A;  3VQD A;  2F9W A;  2Q97 A;  1P8Z A;  4KRF A;  4R79 A;  3CFP A;  1YT3 A;  2H3G X;  4H0O A;  3SQ4 A;  3RMA A;  3AAP A;  2GWK A;  2O8F A;  1IKV A;  3Q7C A;  3O08 A;  3PSI A;  4K25 A;  3C7N B;  4CFA A;  2YCH A;  3O9S A;  1IV0 A;  5AQY A;  2VCP A;  4Y1C A;  4LFC K;  4M3U A;  2FBX A;  2V7Z A;  4CED A;  4YNQ A;  2D0O A;  1ZC6 A;  1VQ7 N;  1EXQ A;  5DK5 A;  3I8D A;  1E4F T;  3CPW M;  3VA3 A;  4MQ3 A;  4CIE A;  1SKW A;  1KCF A;  3K5N A;  2Z1H A;  2IVN A;  1B92 A;  3AVK A;  4KBO A;  4DU3 A;  2ZQB A;  2HF4 A;  5J2M A;  2NNW A;  4CEF A;  1QQM A;  4DR3 K;  2X78 A;  5HRP A;  1L3V A;  3KLE A;  1QTM A;  4JRP A;  2D1K A;  2HND A;  2ZE2 A;  3M1F A;  5AZJ B;  4O5F A;  3NE6 A;  1V4T A;  2VG5 A;  1G15 A;  3OJU A;  3H1V X;  3ISN C;  4PY5 A;  1JL1 A;  3M8S A;  4YOT A;  2HHS A;  4AHT A;  1MWM A;  5AQW A;  3CC4 N;  3IDH A;  3GL1 A;  2W40 A;  4CFB A;  2P9I B;  3CFO A;  3FFK B;  3OY9 A;  3FR0 A;  4JAX A;  1X3M A;  3MED A;  3UKU B;  5AQS A;  1Q9X A;  4WE1 A;  3CQ8 A;  3ZT0 A;  2XY7 A;  2OYQ A;  1XI1 A;  2Y1I A;  4CEE A;  4BRN A;  4FOI A;  3UB5 A;  3AGK A;  3A0I X;  2FSN A;  5KPR A;  2ASM A;  2O8E B;  2KZM A;  4FWN A;  5M1O A;  4M3Z A;  4DQ8 A;  3AVC A;  3NF6 A;  4FSV A;  3I0R A;  4DKW A;  4CHZ A;  3TPQ A;  4I6M B;  4FJL A;  3KLH A;  1ZBH A;  3TAB A;  3PX4 A;  2P9P A;  3VEY A;  3VQC A;  3KLG A;  1VSM A;  4B1Y B;  1JXE A;  5BPN A;  5KPT A;  1HYS A;  3A2F A;  2ZWH A;  1N6Q A;  3CET A;  1VQ8 N;  2P9K B;  4QAG A;  2UUB K;  1TYQ A;  1NGH A;  4JI2 K;  3VTH A;  4JI1 K;  1L3T A;  3DRP A;  2UXC K;  3M5R A;  1RT6 A;  2D0P A;  3VGL A;  1I3A A;  3NDK A;  4CD1 A;  3HPG A;  3MK6 A;  3O9R A;  2ZGY A;  2IS3 A;  2WBN A;  4FJ8 A;  3L2V A;  1JJ2 M;  3NVK A;  3ULE B;  3OYF A;  4MFB A;  3CCM N;  3RWU A;  4JNE A;  3CCU N;  3VEX A;  1N8R O;  4KRE A;  4GKJ K;  4O0I A;  3AA2 A;  4FJN A;  4B3M K;  3HPO A;  2KFN A;  3NFA A;  1XHZ A;  3H08 A;  1BO5 O;  1NGF A;  4JS4 A;  1BU6 O;  4WFN L;  4DLE A;  3HYF A;  4H03 B;  4CCH A;  1QSS A;  4N41 A;  2G8U A;  2F7T A;  1KQS M;  3N4P A;  4FLV A;  4CHP A;  2ZJP L;  2BTF A;  2A42 A;  4KTQ A;  3DM2 A;  3KK3 A;  1TUU A;  2QWO A;  2Z1G A;  2GWJ A;  4BC3 A;  4O8U A;  1HNW K;  5TKW A;  1C0U A;  2OPQ A;  3AO1 A;  4E7L A;  2HNZ A;  1RBU A;  1CLQ A;  4MDB A;  4H5V A;  5BR8 K;  1Q8I A;  1XWL A;  3LDS A;  4B8A B;  2PY5 A;  1KVC A;  5FPD A;  1CXU A;  1QVF M;  4HHT A;  4JYA K;  4DQQ A;  1NWK A;  1Z05 A;  3KK2 A;  3CQX A;  4IDH A;  3ATV A;  2YJF A;  5BRH A;  2V52 B;  3C7N A;  1EP4 A;  4DSE A;  3P31 A;  3IFR A;  4BDP A;  3ZSQ A;  4CER A;  3NF9 A;  5C12 A;  5J2P A;  5GIO A;  4RW4 A;  3EKU A;  3DLG A;  2QWL A;  4WCE L;  4F4K A;  1YXQ A;  5JIC A;  2YI1 A;  1R59 O;  3KKS A;  5E41 A;  3E1Y A;  4I9L A;  2HBL A;  4A2B A;  2VGN A;  4BRF A;  3QML A;  1FK9 A;  3JAM O;  1TK0 A;  4K8X A;  2YNG A;  1IH7 A;  4PA1 A;  1T6D A;  3C94 A;  1XMQ K;  4FJ7 A;  5AZJ A;  3A5L C;  5AQU A;  1NKC A;  4CBX A;  2GBZ A;  1GOC A;  3F5T A;  4DQI A;  4BR4 A;  4KHS A;  2HBK A;  4DS4 A;  2P51 A;  3VET A;  1NOZ A;  3ZT4 A;  2ZM6 K;  4K8Z A;  4LF9 K;  3UKR B;  2CGJ A;  3DOL A;  4FM0 A;  4B9N A;  1XHX A;  2WFB A;  4NCG A;  4IDK A;  3WEE A;  3K57 A;  2P9I A;  3LAK A;  4DQP A;  2GEM A;  4FJH A;  1B9F A;  4ZTJ A;  3ZSR A;  3O80 A;  3UKU A;  4KH6 A;  5BR9 A;  1TAU A;  1D9D A;  2E1Z A;  4N47 A;  4B9L A;  3O5B A;  2AP1 A;  4BRK A;  1RT4 A;  4OLB A;  5AQI A;  2LSN A;  4H0P A;  4YOR A;  4GV6 A;  1LWC A;  3PLA A;  2RN2 A;  3VQ9 A;  2O8E A;  3IAY A;  3N4Q A;  4A61 A;  3A8Y A;  3DXM B;  3TWH A;  3K5O A;  3VQE A;  1WNS A;  3PIO L;  2O4I A;  4ILH A;  1KAY A;  1HNV A;  4I6M A;  2BDP A;  4AHU A;  5EX5 A;  5M1K A;  4DU4 A;  1NJX A;  4JHD B;  3QIP A;  4EZ6 A;  4IJN A;  3M6G A;  2PZS A;  4K42 A;  2CH6 A;  1YJ9 N;  4ELT A;  3L2Q A;  3C6H A;  4EP4 A;  4DUZ K;  3G4S N;  1YI2 N;  3QB0 A;  2P9K A;  4NYN A;  3TTD A;  3TAP A;  4OX9 K;  4BDZ A;  3TTF A;  2OPP A;  1NKB A;  2XY8 A;  4QS9 A;  2A1R A;  1VSK A;  5FPE A;  3PY8 A;  3ZSZ A;  3K9J A;  1YVN A;  4CZH A;  1OVQ A;  4JKG A;  5JVG L;  3ULE A;  1C0G A;  2FF6 A;  1O1W A;  4ILG B;  1VQM N;  3VN5 A;  3BDP A;  4ISF A;  3OYC A;  4LF5 K;  3ZX2 A;  1RDC A;  2GUI A;  1SV5 A;  5AQQ A;  1XC9 A;  3DLH A;  4DR1 K;  4IBN A;  1JKH A;  1E3M A;  1Q9Y A;  3HOS A;  4GV9 A;  3RSE B;  4IKF A;  3CJ9 A;  5AQO A;  3MX5 A;  3J81 O;  2DY4 A;  1NGB A;  4CFC A;  1HJO A;  3M8P A;  4Z4C A;  3CIP A;  2BUP A;  2PFU A;  1N34 K;  2W6K A;  3OYM A;  5BRE A;  3TAR A;  2HMI A;  4NCA A;  4B3T K;  1KVB A;  1NMN A;  2YKN A;  3RMC A;  4G1Q A;  4B1Z A;  3NH1 A;  1S22 A;  3B6O A;  2FF3 B;  4CJU A;  3LDQ A;  5C25 A;  4FWR A;  3SPY A;  1TVR A;  3HSC A;  1U48 A;  3V6D A;  4NCB A;  4JRQ A;  4HUE A;  3DLR A;  4J2E A;  3K0S A;  3SK3 A;  1VQP N;  1VRU A;  1GLJ O;  2ITM A;  3HL8 A;  3M8Q A;  4XH1 A;  4KAZ A;  4FL9 A;  5LY3 A;  2HHW A;  3G0Z A;  4CEZ A;  1IKW A;  4FLY A;  2WUS A;  4FWL A;  4PKI A;  4EHU A;  5EVZ A;  1IG8 A;  2RE2 A;  3F9K A;  3THW B;  4FK4 A;  2CGL A;  3NGI A;  1HR0 K;  2KZZ A;  3BEX A;  3HO1 A;  2NUB A;  1NNE A;  3QLH A;  2XO7 A;  1S6P A;  3LPT A;  4ISG A;  3QES A;  1RDB A;  4BR2 A;  4BQL A;  1NK5 A;  1RIL A;  1SZ2 A;  2E4L A;  4IWV A;  3UKR A;  3LP3 A;  2QM1 A;  3LAM A;  3MWT A;  3CJ1 A;  4EP5 A;  4C23 A;  3LAN A;  4CJW A;  3LWM A;  3LWL A;  3ZEU B;  2FBY A;  3R8E A;  3OS1 A;  3QER A;  4Z4G A;  4CJ3 A;  3QET A;  1VQ9 N;  1D8Y A;  1ITG A;  3MN5 A;  1T7P A;  3PUF A;  2HHT A;  5HLF A;  1EET A;  3D2E B;  4B9M A;  4FZY A;  1LCU A;  1S6Q A;  4CES A;  4PL8 A;  5CZ1 A;  3DXM A;  1VSI A;  1YUW A;  4YOY A;  4ID1 A;  5J2N A;  3DJC A;  4FO0 A;  4M7X A;  4DMN A;  4JHD A;  5D3G A;  1HX1 A;  1A5V A;  3NH0 A;  1ASV A;  1VAZ A;  1KAZ A;  2PBD A;  2B4J A;  1GLF O;  4JKE A;  1VQK N;  3NMU A;  4DSI A;  1NGG A;  2J4R A;  1GLC G;  4BQZ A;  1I94 K;  3O1W A;  3ID6 A;  5KGX A;  2IAJ A;  5JVH L;  3MEE A;  3ID8 A;  3LAL A;  4PQU A;  3EL2 A;  3BZK A;  4YDU C;  1VSH A;  2I5J A;  1C0M A;  5GAE P;  3HZ6 A;  3FZL A;  2Z1I A;  1J54 A;  4BRA A;  4WQ5 C;  4AM7 A;  1DEJ A;  4CK3 A;  3VOV A;  1WSF A;  2NLX A;  2WC9 A;  3VEO A;  4BRM A;  4H4M A;  3CG7 A;  4FK2 A;  3LP1 A;  3R9P A;  1WAF A;  4BC2 A;  1MA9 B;  3OBW A;  3MEG A;  5C2F A;  2ZGZ A;  3RSE A;  4FYD A;  3HOT A;  4CJ5 A;  2BGG A;  3M3Z A;  3PSF A;  1Z26 A;  4IOC L;  3KLI A;  4DCH A;  3SAF A;  2HVH A;  1KRP A;  3KVG A;  1KFD A;  2RF2 A;  4LFA K;  3MMV A;  4FJM A;  2HMP A;  3DRR A;  3KK7 A;  3NHG A;  5AQX A;  3AV9 A;  4U7B A;  4DV3 K;  1Y97 A;  4WQ5 A;  2QXF A;  1NMD A;  5KGW A;  3KD5 E;  4FJG A;  3QBW A;  3SPZ A;  1RT5 A;  3JXU A;  1HQU A;  2R7Y A;  1YIT N;  3ZX3 A;  4BRP A;  3ZCM A;  3OYG A;  2V51 B;  4C8N A;  5M1P A;  1S3X A;  5GAD P;  5AQV A;  2NRR A;  3TTC A;  1C0T A;  1S1V A;  3J7A P;  3ENH A;  3OW2 M;  1FXX A;  3EZW A;  2OAN A;  4ZHR A;  2VQE K;  4H0Y B;  3O9U A;  5AQJ A;  4DV4 K;  3CME N;  1IBK K;  3O8M A;  4OKJ A;  4CF0 A;  5KTQ A;  1QQO A;  3AO5 A;  4Z0U A;  3CCS N;  3D45 A;  1MWK A;  3J80 O;  1YF5 L;  1K8K B;  3DLK A;  3D6R A;  3OS2 A;  4DTX A;  2E6M A;  1DTQ A;  2ASO A;  2ATQ A;  3NGY A;  2A40 A;  1BI4 B;  3LPU A;  1YAG A;  1RBV A;  2YHA A;  4RW9 A;  5HP1 A;  3W0L A;  1ASW A;  4MLH A;  3C95 A;  3V1R A;  3HP6 A;  3M8R A;  2E88 A;  4NLB A;  4H8K A;  1K73 O;  1LOT B;  4KPY A;  3R1X A;  3A5M C;  3OYN A;  4BGB A;  3RMD A;  3DI6 A;  1BQM A;  1RDW X;  3VQA A;  4AQY K;  3FLC O;  3SZ2 A;  4W5Q A;  3ZEU A;  1NJZ A;  4H4O A;  3ALY A;  2BAN A;  4XIU A;  1T8E A;  4HVJ A;  1WSJ A;  1REV A;  4M3R A;  3AO2 A;  1T3V A;  3VA0 A;  2GX9 A;  3D2E A;  4A62 A;  4F2S A;  4FWQ A;  1M90 O;  4CZF A;  4OKE A;  2XRI A;  2IVP A;  3VEN A;  1L3U A;  1ESV A;  5H1S Q;  2A6A A;  2KFZ A;  4FM1 A;  3VES A;  1F21 A;  3DLL L;  5K14 A;  3KK1 A;  3U3G A;  3WEE B;  4MO5 A;  2IVO A;  3V1O A;  4Z4F A;  4Y0W A;  3GBT A;  1IKX A;  3MXM A;  5EXW A;  4DQR A;  4A59 A;  3F2K A;  3VF6 A;  5SZT A;  4W5T A;  1OH5 A;  2RHK A;  4CBU A;  1WUA A;  4GW6 A;  4JV5 K;  3IRX A;  4CF2 A;  1U45 A;  2UU9 K;  4J2A A;  1HYV A;  3CQY A;  4FWP A;  4BE2 A;  3BF3 A;  3O9Q A;  3VGK A;  2Q3S A;  3QBX A;  4JKA A;  1JLQ A;  4JKD A;  4CJS A;  4YY3 K;  4QCL A;  3SUQ A;  4RG8 A;  3VQ4 A;  1J9A A;  4JI6 K;  4LY7 A;  4BRI A;  1C1C A;  2B5J A;  2JGU A;  3E66 A;  3QIO A;  1DKG D;  1NJW A;  1QVG M;  1RDU A;  2QWN A;  1VHX A;  5I9E B;  3VMF B;  5M1Q A;  1KAX A;  1IJJ A;  3HK2 A;  2V7Y A;  4CF8 A;  2YHX A;  4PUO A;  2ZF5 O;  1BGX T;  4H5W A;  4CJE A;  1L5U A;  2JLE A;  3S9H A;  5F0X A;  1JLC A;  1Y64 A;  1VQO N;  5B8H A;  2QWP A;  3MCP A;  1BQN A;  4JN4 A;  3VQQ A;  3ASM A;  2VQF K;  4IOA L;  3OJS A;  2KKZ A;  3CC7 N;  1CZ9 A;  2KHO A;  4JKG B;  4FPB A;  4CHO A;  4IG3 A;  3CCJ N;  4FLT A;  4E1M A;  5C42 A;  3L4Q A;  4M42 A;  4HCC A;  1U47 A;  4DWI A;  3CJB A;  5FPN A;  4BRQ A;  3HVT A;  3ZX0 A;  5HL7 L;  3MXJ A;  5I3U A;  4BG9 A;  5AQT A;  4AH9 A;  5LMN K;  4HCB A;  4LF6 K;  1W2B M;  3C65 A;  3O6W A;  3GDQ A;  5F1X A;  1EX4 A;  1WOQ A;  3ENB A;  5BN8 A;  4DTN A;  3SLC A;  3L3U A;  5M1F A;  5BRD A;  3WQT A;  4CHN A;  3CC2 N;  4HWI A;  1EQY A;  5EY4 A;  5HOO A;  3J7Y P;  1GLA G;  1CXQ A;  3THV A;  3IKM A;  4FVU A;  5FRN A;  2KQ2 A;  1HNI A;  3PX0 A;  1T05 A;  1ZXO A;  3O4W A;  3LP0 A;  5JS2 A;  4DLG A;  1T03 A;  4KB0 A;  3OYK A;  1W7A A;  2YNH A;  3WNG A;  1K8K A;  1JLA A;  4BRL A;  1N36 K;  4DFJ A;  1J5O A;  3E9L A;  3AVB A;  5AQR A;  1BI4 A;  1N5Y A;  5JMV A;  4KHN A;  4X65 K;  3G6E N;  4JI5 K;  4QS8 A;  5AQM A;  2A1S A;  3OYJ A;  3THY B;  2HB5 A;  3NCI A;  2G8V A;  1SQK A;  4LH4 A;  3SUN A;  1RBT A;  4E7K A;  4ICL A;  2KW4 A;  4CK2 A;  1VSD A;  1LWF A;  1QZ6 A;  1C1A A;  2DFH A;  4ID5 A;  5GAG P;  3DRS A;  5BRF A;  1HQE A;  4JI0 K;  5CYM A;  5LL6 Z;  4ISE A;  2F96 A;  4YOX A;  1SKR A;  1WSI A;  4GKK K;  1WSE A;  2GEL A;  1X9S A;  3GG4 A;  3WXJ A;  4YOU A;  1TUY A;  3K58 A;  1TKZ A;  2QWM A;  3AVJ A;  4CE9 A;  2EX3 A;  2XY5 A;  4KH4 A;  5KRS A;  4OPJ A;  2RPI A;  2A3Z A;  1UAX A;  2PYL A;  1CZA N;  4QOZ B;  3TR8 A;  4BR5 A;  5E26 A;  3LDL A;  3QEV A;  2E2Q A;  4CK1 A;  4PWD A;  1HYZ A;  1RTI A;  5AQH A;  4CJT A;  2QKK A;  3IS9 A;  2NRH A;  4O4G A;  2E5L K;  4F3T A;  3A5O C;  2HHV A;  4FM2 A;  3O4N A;  2I7P A;  3EE8 A;  4M7Y A;  4NB4 A;  3CI5 A;  4PL7 A;  3V9Z A;  5HBM A;  1NGC A;  1UOC A;  3EO3 A;  3B8A X;  1BA0 A;  1D5A A;  4FW2 A;  1YVU A;  1VQN N;  4DUY K;  1ATR A;  1QSY A;  3OYI A;  1LW0 A;  5SWM A;  4AIL C;  2P9U A;  3AGR A;  4GV3 A;  1U2V B;  3OTO K;  1X9M A;  4CEO A;  1HRH A;  1OKJ A;  1JL2 A;  5HRR A;  3EEQ A;  4NXN K;  1HUX A;  2YNF A;  2HNY A;  4C1N K;  3SUO A;  3EY1 A;  1WSG A;  3HM8 A;  4DSK A;  4EFH A;  3OYD A;  4LC9 B;  4AHR A;  5C24 A;  3PO4 A;  3G71 N;  1VK0 A;  3KWG A;  3V81 A;  3TSQ A;  2NRT A;  3TSP A;  1EO1 A;  4LSL A;  1BCO A;  1KFS A;  4B08 A;  2X6N A;  1VQL N;  1O13 A;  4DR5 K;  3NF8 A;  3QFP A;  3U6F A;  4ELV A;  3DLB A;  1ILY A;  1BWF O;  3QIC A;  1RDA A;  4Z4E A;  1HNX K;  5KRT A;  3E01 A;  1RTH A;  1TL3 A;  4KB1 A;  3L3V A;  5MLC Q;  1NGJ A;  4R5P A;  1TGO A;  2NZT A;  3FE1 A;  3V9U A;  1U4B A;  2CGK A;  3LDO A;  1RFQ A;  3L0Q A;  4LD0 A;  2OA8 A;  4HTU A;  3RMB A;  4AHV A;  1XMO K;  3H45 C;  1BG3 A;  5AJ3 K;  1A5W A;  2WOM A;  4OGE A;  4UY8 O;  4G9Z A;  1U6Z A;  3EYZ A;  2YV0 X;  4KKO A;  4GY2 B;  1LAV A;  2NRV A;  4KHY A;  3L2W A;  3SQ1 A;  3C0B A;  5FDL A;  1HKC A;  3MN7 A;  4J2D A;  1A5X A;  3SJH A;  4RWT A;  4PKG A;  5HRO A;  2OPR A;  3THY A;  1RTJ A;  4EHT A;  2QEX N;  4C8M A;  3WT0 A;  5C15 A;  4FK0 A;  3JSM A;  1FJG K;  2QKB A;  2VGM A;  4BVO A;  1WSH A;  3KLF A;  4LH5 A;  4FLZ A;  3ENO A;  3VER A;  1W9H A;  4DTS A;  4CJR A;  1NOY A;  3RRG A;  4O0J A;  3D7E O;  1C1B A;  2XHB A;  1ZBU A;  4HUG A;  3E9P A;  4B8C A;  1N32 K;  4LF7 K;  4O8K A;  4X62 K;  3HJF A;  4IJA A;  4JKH A;  4B9V A;  3SQ2 A;  1TK8 A;  2F9T A;  4E1N A;  1D4X A;  1KLM A;  1QQN A;  1K6Y A;  3CJA A;  4E7J A;  3H3N O;  2OTJ N;  3WNH A;  3L2U A;  2Z1J A;  3VQ6 A;  3I56 N;  3CFR A;  1YHQ N;  3VQ7 A;  3AA5 X;  3HXM A;  1NJI O;  1V4S A;  3SJJ A;  4JLH A;  2D0A A;  3E9O A;  3NAE A;  3OYE A;  3U3Y A;  5DMR A;  5IT9 O;  5AQG A;  5FRO A;  4K43 A;  1NK4 A;  1IG9 A;  3VPZ A;  2P5G A;  4DTR A;  1NLV A;  3Q7B A;  4Z4H A;  2ITG A;  4IEI A;  1RNH A;  2DFF A;  2Q36 A;  1P90 A;  4UQG A;  2VWB A;  1ASU A;  5AQL A;  3MAQ A;  4J8F A;  3WXM B;  5HRN A;  2QXL A;  1GLB G;  2FLO A;  1JLF A;  2FC0 A;  3OVN A;  1JLG A;  4OVL A;  3CMA N;  1RGI A;  4GVM A;  4BC5 A;  1X9W A;  1U2V A;  1RCH A;  1GLE G;  2P9N A;  3SUP A;  3BF1 A;  4E19 A;  2B6A A;  4FJ5 A;  4DTO A;  3ZT1 A;  2BH1 A;  4CGG A;  1NK7 A;  2D0C A;  3CYM A;  4DFM A;  3DAW A;  1R0A A;  4M3W A;  3MN9 A;  3AA3 A;  4IOX A;  3L2R A;  1K8A O;  3CCV N;  1Z25 A;  4FJK A;  1SKS A;  3LZJ A;  5TKY A;  1JCE A;  5BPM A;  5EU7 A;  4IEE A;  4ILJ A;  4N76 A;  4JEP A;  3HRG A;  4FJI A;  2QWQ A;  4CEB A; 
#chains in the Genus database with same CATH homology
 3J7Y P;  1J5E K;  4DUY K;  4LFA K;  1IBL K;  4JI3 K;  1FJG K;  4DV7 K;  3T1H K;  4DV6 K;  4DV3 K;  3OTO K;  4NXM K;  4DR2 K;  4NXN K;  2HHH K;  3JAM O;  1N36 K;  5FLX O;  4DV5 K;  4LF5 K;  4JV5 K;  1N32 K;  4LF7 K;  4LF8 K;  2UU9 K;  4KHP K;  4X62 K;  4DR1 K;  1XMQ K;  4X65 K;  2UUB K;  4JI2 K;  4JI8 K;  4JI5 K;  4JI1 K;  4V19 S;  4DR6 K;  3J81 O;  2UXC K;  4YY3 K;  4DV2 K;  3J7A P;  4X66 K;  2UXD K;  5A2Q O;  2VQE K;  4DR5 K;  4DR4 K;  2ZM6 K;  4JI6 K;  4LF9 K;  4DV4 K;  2UUC K;  4LFC K;  1N34 K;  4LF4 K;  1IBK K;  1HNX K;  1IBM K;  4B3T K;  4B3R K;  4JI4 K;  4JI0 K;  5IT9 O;  5LL6 Z;  4LFB K;  5LMU K;  4GKJ K;  3J80 O;  4CVN E;  4B3M K;  1XNR K;  4GKK K;  4YHH K;  4DR3 K;  1I94 K;  1XMO K;  4JI7 K;  2VQF K;  5AJ3 K;  4DV1 K;  2UUA K;  2F4V K;  4AQY K;  1HNW K;  1HR0 K;  1XNQ K;  4K0K K;  1N33 K;  2UXB K;  4DV0 K;  5BR8 K;  4DUZ K;  3T1Y K;  5LMN K;  4DR7 K;  4LF6 K;  2E5L K;  4X64 K;  4OX9 K;  4JYA K;  4B3S K;  5IWA K;  4CW7 B;  1HNZ K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...