4DV1K

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g, bound with streptomycin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
116
structure length
116
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 27
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4dv1K00
4LFBK 2UXDK 4JV5K 2VQEK 1J5EK 4DR1K 1N34K 1XMQK 3T1YK 5A2QO 4DV2K 4DV3K 4LF4K 4KHPK 4JI0K 1IBKK 4GKJK 4JI5K 5BR8K 1N36K 2VQFK 4DR4K 1I94K 4JI3K 3OTOK 4V19S 2UU9K 4JYAK 1HNZK 4OX9K 4DR6K 4DV5K 1HNXK 4YHHK 3J81O 4JI1K 4NXMK 4LF7K 5LMNK 4DUYK 4X64K 4AQYK 4X66K 4B3MK 4B3TK 1XNRK 4DR3K 5LMUK 4LFAK 1HNWK 4DR5K 4YY3K 4X65K 1N33K 4X62K 4LF6K 3J80O 1IBMK 3J7AP 1N32K 5FLXO 4DV7K 4JI8K 4JI2K 5LL6Z 2UUAK 4LFCK 4DV4K 2UXCK 2UXBK 2UUBK 1IBLK 4CW7B 4DV1K 5AJ3K 4GKKK 4LF8K 5IT9O 2F4VK 4B3RK 2UUCK 2ZM6K 4DV6K 3T1HK 4NXNK 4DR7K 1XMOK 1FJGK 4DR2K 4CVNE 5IWAK 1XNQK 1HR0K 4JI7K 4JI6K 2HHHK 4DV0K 4K0KK 4JI4K 3J7YP 3JAMO 4B3SK 4LF5K 4LF9K 2E5LK 4DUZK
chains in the Genus database with same CATH superfamily
4O0IA 4BC2A 2HBLA 4AILC 1X3NA 3KJVA 2PBDA 1YAGA 2FBYA 3OYFA 4JV5K 3AO2A 1G15A 3WNHA 2E1YA 1YI2N 4JK7A 1TUUA 3QIOA 4Z4HA 4DQIA 4EZ6A 4K43A 1LCUA 5J1EA 1X1PA 2A5XA 4CK3A 3OA9A 1NGBA 1T05A 2QWOA 3EKSA 1N36K 3HL8A 4CEAA 1SL0A 1VQ9N 4CJSA 4YORA 2BGGA 1VSDA 1HKCA 3FZKA 4JKHA 4FSVA 4BDZA 2VG5A 4JKAA 3M6GA 2HVHA 2V7ZA 1HNXK 3L4IA 1J6ZA 3VEVA 3TWHA 4WCEL 2FC0A 4HVJA 1NK5A 4OJRA 5LMUK 1KAXA 3BY5A 4FWMA 1KVCA 5KRTA 4KKOA 4OO1J 4CD3A 4XH1A 1K73O 3O4QA 4W5RA 1R0AA 4BGBA 4DQQA 3AVFA 4DV7K 4JI8K 1ZBHA 5CZ2A 2HHSA 2NRTA 4PQUA 4LFCK 4FJIA 2X78A 4CEDA 2UXBK 2A3ZA 3CPEA 5AJ3K 2YHAA 5HROA 2F4VK 3VQQA 3TSQA 1HUXA 1NGCA 1RT5A 3DRPA 1LAVA 3P1GA 3RWUA 4IJNA 5E84A 3NMUA 1EETA 1C0TA 4KH6A 3MDQA 3K9KA 1GOCA 3VF6A 3ZT3A 1C0GA 2B4JA 3AA5X 1HLUA 3V1QA 4H0TB 4DFMA 2Q0UA 4DSFA 4I2PA 4BQLA 3CCEN 4KB1A 2EX3A 1WBBA 4CJFA 4KREA 5AZJB 2V7YA 1HJRA 3LP0A 3CCRN 4DUZK 3WNGA 1SAZA 4LFBK 1T7PA 3A5LC 5HLFA 5KRSA 4AHUA 2VQEK 3KVGA 2QEXN 1EO1A 3M1FA 3QEXA 1VAZA 3ATUA 4I6MB 4CZGA 4A57A 2W41A 4FWPA 2G8WA 4U7BA 1J9AA 4WYBA 4CZEA 4FJGA 3PV8A 4ICLA 1VQ8N 4CECA 5AQHA 3A5MC 4BC5A 1TK8A 3D2EA 1RT2A 1I94K 1YVUA 2RKIA 3EZ5A 2OPPA 2HSTA 1X9JA 1A5WA 1T6CA 5HP1A 3CC2N 4JS4A 1HNZK 2JWKA 4DQ8A 3CJ7A 3O9QA 4WFBL 2RN2A 1YJWN 3OYIA 4LF7K 2JWLA 2GWKA 2P9LA 1XNRK 3JS6A 3VEYA 1KD1O 5AQSA 2FSJA 3EYZA 2Q1NA 4Q0BA 3LAKA 2P9NB 4DTOA 4OKEA 1NK4A 4FLZA 1IKYA 1UA0A 1NKEA 1JLBA 4BR4A 1S1VA 1M1KO 1BGXT 3LAMA 3OYEA 4DF8A 2UUBK 3ZX0A 3DRSA 4DHYA 5ADXH 3DI6A 1HYSA 4IWVA 3ATVA 1RTJA 2RPIA 3B6PA 1VSIA 4MLEA 3QNOA 2ASPA 5JLFA 2KFNA 4K42A 1HQEA 2I7NA 4OPAA 1XMOK 3QFUA 2O8CB 4FM2A 3PLAA 4H5TA 1TK5A 1QZ6A 4QS8A 1JCFA 1V4TA 2CGJA 4KHYA 1GOBA 2O8BB 3JYTA 3L2RA 3CJBA 2A40A 3SAFA 4Q5VA 2Q36A 5GIOA 4L8RB 2YNIA 4LF9K 4Z4FA 2HB5A 4DFKA 2ZQBA 1U04A 1Z05A 4WFAL 1TAQA 4CGIA 1JXEA 1L5UA 2UXDK 4LD0A 1DGKN 1NLVA 3O3GA 1HPMA 4DR1K 3T3FA 1UOCA 4JKFA 1WBDA 1VSKA 3HZ6A 4J2DA 3O4NA 3OYHA 4M42A 1I39A 1RFQA 3H1QA 2RE2A 3I56N 2P9IA 2FLOA 5GAEP 3SQ4A 3TABA 4JS5A 2XRIA 3ZSVA 4CJPA 1ZBSA 3VN5A 2DFEA 3LPTA 3ULEA 4H0OA 3ZEUB 3V6DA 4DSLA 5J2NA 3PO5A 3UB5A 4GVEA 4V19S 3MEDA 1YT3A 2W6LA 2XY5A 1WSJA 4DR6K 2Q2RA 2XHBA 1UA1A 4KBOA 3VOVA 4JI1K 4B1UB 2DFHA 4NB4A 1R59O 3O1WA 2P51A 2ZGZA 3K5OA 3SAGA 1Y97A 1IG8A 2A6AA 4IOAL 5AQZA 4YY3K 2X74A 3M8RA 3NH0A 1Q18A 5AQWA 1N33K 5C15A 4PL7A 3NE6A 3J80O 4PL8A 1IBMK 3FE1A 3K0SA 2VGNA 1WUAA 1JKHA 3F73A 2GEMA 1IBLK 4Z4CA 2KZMA 4ELTA 4FLTA 2E4LA 3N4QA 4ZTFA 1VSMA 3OJUA 4KAZA 1FKPA 1NK9A 1Z26A 5AQYA 1L3SA 1L3TA 5AZJA 4B9QA 3AO5A 3CCVN 5CYMA 1SUQA 3IG1A 3RMAA 1JL1A 4BROA 1S9EA 1XHZA 3QESA 4DU3A 4DU1A 3SAHA 4N41A 3AARA 3AA4A 2YV0X 4MDBA 3S3NA 3HO1A 1EKEA 4I6MA 3VQ9A 4A62A 4AM7A 4OKKA 3KTQA 5AQGA 4FCYA 3WUHA 1KFSA 4IBNA 4LSLA 3NH2A 1MDUB 3NF7A 1SS6A 4DQPA 1T6DA 3W0LA 1KQSM 2VWKA 4PHTX 4KI4A 1S3XA 1VQON 1RBUA 4FJJA 4KH4A 1NMNA 3OYBA 4KO0A 2ATQA 5HOOA 4ID5A 4KHSA 3MN5A 1U4BA 3V1RA 3BEXA 1J5EK 3WQTA 1YHQN 5LJVA 1WN7A 3F9KA 1MU2A 3AVLA 4FM1A 1QHAA 3U3GA 3K57A 3WT0A 1SL1A 1IBKK 3EL2A 4FPBA 4GKJK 4B9MA 3DXKB 2P9NA 3LWMA 1YIJN 3DOLA 1A5XA 4Z0UA 2B5JA 3TU5A 3KK1A 4FJ7A 2KHOA 2QWPA 2HW3A 3T19A 3AAPA 2XY6A 4BGAA 3ZSOA 2D1KA 4FWNA 1RDUA 2PYLA 1T44A 3ALYA 4NCGA 1NNEA 3NAEA 4ID1A 4BWMA 1CZAN 2BANA 1WB9A 4JKBA 4LSNA 2F8TA 3SJHA 1RT3A 5KPZA 4FJMA 4CHZA 5BRHA 5LL6Z 1RNHA 3IS9A 3HJFA 4GV9A 3GBTA 4FOIA 4M3RA 2O8BA 3J8AA 4CD1A 1T3VA 2YHBA 3IUCA 3H08A 2UYTA 4QS9A 4E7KA 5JS2A 3PO4A 4DV6K 3C65A 3CJCA 3V1OA 2PFUA 4Z4GA 3TSUA 3MXJA 5EXWA 1BA0A 3A5NC 2HHUA 3KKSA 3U8XA 4DFJA 3LPUA 1RTDA 3PX0A 3SMSA 3HM9A 4CI6A 4DV0K 4B08A 1SV5A 4CF0A 3F2KA 3ZEUA 1T8EA 4FJXA 3HK2A 1KVBA 3U6FA 1OH7A 2KFZA 3AA3A 3OS0A 4MDAA 2WOMA 3NGYA 3VEXA 3T69A 2IVOA 3P83D 4JRPA 3VF4A 4DSJA 4M3XA 2OA8A 4N56A 3LP2A 3BF3A 4RW4A 3C95A 3BZKA 4JI0K 5DMRA 4E1MA 1MWKA 2QWQA 3QETA 3DRRA 4DB3A 3O4WA 2DTUA 1QE1A 3ISNC 1LV5A 4K8XA 5KGWA 3SUOA 3GDQA 3SLCA 3DLEA 2ITMA 4BR0A 1SKRA 4O5BA 3KLGA 3NGIA 5C42A 2H3GX 3CCJN 4AHTA 4CGHA 2IC3A 2HHVA 3VPZA 4Z4EA 1QSLA 3EE9A 5E41A 1NJYA 4E1NA 3MX5A 3LDLA 4W5QA 2G8IA 3PUFA 4FWRA 4CJRA 2CH6A 1EWRA 1F21A 4JN4A 4CF9A 2OZMA 4BREA 4YDUA 5C24A 4DTXA 4IKFA 2ZJPL 4BDYA 3E9OA 3HBTA 3OYLA 2Y1JA 1QS4A 1WSEA 4JKGA 5CR4A 3SK3A 4WFNL 4B3RK 1QHTA 2PAVA 2HNYA 4KHUA 4IEEA 2WBNA 1WLJA 2P9PB 1RDDA 4A5BA 3K5NA 4O55A 4CESA 3FLCO 3UE5A 1QZ5A 4CJEA 4CFBA 3ZSYA 2QWLA 1ZYQA 4M3TA 5J2QA 4RG8A 4JI4K 5GIPA 1TL3A 4I9LA 1JL2A 4FWLA 2E2OA 3LDSA 4DCHA 3U9ZA 3QERA 1GOAA 1WAJA 2ASMA 3CERA 3VQBA 4CBUA 4FZXC 4EAHD 3ZETB 4KHNA 1VQLN 5KTQA 3WEEB 4DTSA 5ELZA 3SUQA 4R5PA 2E2NA 3LP3A 4DV2K 4IG0A 4C8NA 3DAWA 2Q3SA 4CFAA 4Z94A 5M1OA 4ILHA 5FRNA 3O9UA 3ZSRA 3RSEB 3VQ4A 1NBWA 3EZWA 3G71N 3HT3A 4HCBA 3L3VA 4B1YB 1RDBA 4CHOA 4F8RA 3EEQA 1NOZA 3MXMA 4GV6A 2GV9A 1BL3A 2HMIA 3K5LA 4FLYA 1SL2A 5GAHP 4E3SA 1IKWA 2QK9A 3VTHA 4BC4A 1NGDA 2KLAA 4B3TK 2E2PA 2F96A 4X66K 1JJ2M 3A2FA 2HBKA 4F3OA 4H0VB 3C6TA 2NRVA 3GE1A 4DR5K 3IFRA 3SPZA 1RBSA 4X65K 4H0YB 5DM6L 4X62K 3HSTB 4LF6K 4FLVA 3H6EA 1BU6O 2VWJA 1B92A 1BISA 4CGFA 4DSIA 3F9MA 3WXKA 1TVRA 3JSMA 4KV8A 3DYAA 3KWIA 4KTZA 4DLGA 4BY9C 4FVUA 4CERA 4PKIA 3U3YA 4BRFA 1KVAA 4NLBA 3TAQA 4CJKA 3PIPL 4JEPA 1VQ7N 5AQPA 1BA1A 5HRPA 4Y1DA 3PY8A 3ENHA 4N76A 2NNWA 2FSKA 4DR2K 2ZF5O 5I9EB 1U47A 3H3OB 1N6QA 1QTMA 3G6EN 1HRHA 1RTIA 4OGCA 4C1NK 3PX4A 3LL3A 2ZGYA 3VQPA 4RCHA 3AVCA 3P31A 4O0JA 2FSNA 1RDCA 4F2RA 4JRQA 1LAWA 3OBYA 2YI1A 3QBXA 4GY2B 3VGLA 3QEVA 1XC9A 2PZSA 4JKDA 1JLAA 4DTMA 4H4MA 2JLEA 4CIGA 2IGIA 4AHSA 1XC3A 1KCFA 3C6AA 3CG7A 5AQVA 5BRDA 5AQFA 3FR0A 5JICA 4IG3A 2W40A 3CXCM 4WE1A 4BE2A 1L3VA 4J2AA 2VQFK 4M3YA 1NK7A 3DM2A 4O5FA 3V9WA 5KPTA 4LH5A 1XUPO 2GUIA 2UU9K 3QEPA 1BCMA 1EP4A 3SUNA 3QDKA 3SV4A 4E7LA 1W2BM 1QSSA 1FW6A 4FLWA 5AFUA 4N5SA 1ZBFA 3SPYA 1HYVA 3DLRA 1NGHA 1QQCA 4KHQA 3J7ZO 5AQOA 4A2BA 4FK0A 5C2DA 4DR3K 1E3MA 1NGGA 3TI0A 3CPWM 4CEFA 4I7FA 3VENA 5HL7L 4BRNA 4K41A 4B1ZA 2HMPA 4BRGA 3C0BA 2G8FA 2FF6A 4ISEA 4IFYA 3JXUA 3LP1A 2YHYA 5AZIB 5BR9A 2YNFA 3S41A 4CZHA 5BPLA 3O08A 2GWJA 3AVGA 5M1KA 4LF8K 3A8YA 2PY5A 3SNNA 3VGMA 1DEJA 4FM0A 2FBXA 2IS3A 2V52B 2Z1JA 5MLCQ 3CYMA 5LJWA 2DY4A 3OYCA 4FPAA 5CE3A 3MECA 2OPQA 1NGJA 3UKUB 2ETJA 3E66A 1OH8A 3MAQA 1CXUA 1RCHA 3O3FA 4BE0A 3P5JA 4K8ZA 1Q7YO 1VRTA 5CYQA 2A41A 4CZLA 3NFAA 4RW7A 2WC9A 2OTLN 5BREA 2B6AA 4OPKA 1T03A 3ZLJA 1TL1A 4BRPA 4NCAA 3ENBA 4JKEA 2OPRA 3QICA 3I55N 4MFBA 3VA3A 4KFBA 3NCIA 4C8KA 4DS4A 3CHWA 2NRXA 4ILGB 3LWLA 2X6NA 1VQPN 3O80A 5BR8K 1EXQA 5E26A 3OJSA 3NVMA 3AVBA 3MWTA 4FJLA 4H5WA 3KWGA 1YTAA 2YKMA 1YXQA 3KLHA 1C1AA 3R3LA 1ASUA 3AO4A 4DFPA 1NG9A 2NRWA 1RDAA 1X9MA 1YITN 5BN9A 3IKMA 5FDLA 2P1JA 4Z4IA 3CFOA 4XH5A 2YHWA 3CM6A 1YF5L 4E19A 3AVNA 4UQGA 4O44A 3KK3A 4LFAK 3OBWA 1VRUA 1YVNA 4AF1A 4H5VA 2KZZA 5CHIA 3CM5A 2RF2A 5FPDA 4CEZA 1OH6A 1SKWA 3U9DA 3ZX3A 4DLEA 4U67L 4DSEA 4CZFA 4XH4A 1HPZA 1Q82O 4PY5A 3SJJA 4BRKA 3HXMA 4UY8O 3IMXA 2QXLA 1NK6A 4GW6A 3OYDA 5EX5A 3HI0A 3P4IA 4CIFA 4J2BA 4MO4A 1W97L 4KHWA 1TYQB 4FO0A 2QWRA 2HNDA 3BDPA 4W5NA 5GADP 4YNQA 3NVKA 4OPHA 5JVGL 4IOXA 3LDNA 2ZD1A 2XY7A 1FJGK 5AR0A 3GOIA 5IWAK 4JI7K 3MN7A 3ULDA 4CJQA 3SUPA 4W5OA 3QBWA 4JLHA 1SQKA 2E8AA 3VQAA 2R7YA 1TUYA 4BRLA 3CCSN 4HTUA 4LF5K 5HRNA 1GLAG 3WXMB 4CJUA 5KGXA 3L8BA 5HRRA 3V9UA 4HTLA 1ATNA 3TAGA 1X9WA 3M5RA 1S9GA 2O8DB 4FWSA 2HHXA 4CJ5A 3LZJA 4B9NA 1N34K 1JLGA 2ZWHA 1XMQK 4PWDA 4H4OA 1NJWA 5CZ1A 4CEEA 4B3OA 1VSEA 4LF4K 4JD2B 5B8HA 3SI6A 2IIRA 5TKWA 1YJNN 4JI5K 2VWBA 1WSFA 4PUOA 3OYAA 2D0OA 1NK8A 4WQ5A 1S6PA 3ZSQA 5LY3A 3ZYYX 4CZJA 1WSGA 1OVQA 5AZIA 4CGDA 1S1TA 2Q0RA 4FJ8A 4F3TA 1DTQA 1FKOA 3H46O 1K8KB 1ATSA 1S1UA 2D0CA 3E9LA 5M1FA 3SMPA 1WOQA 3KLFA 1JLCA 2NRZA 3DJCA 4DUYK 4X64K 4B3MK 1KSPA 4ISGA 1E4GT 3C7NB 5AQRA 3OYKA 3L2QA 1IJJA 3UKUA 1XI1A 1HMVA 1LWEA 3NDKA 1EQYA 1KLMA 1TK0A 2QW9A 2VCPA 2HVIA 4WQ5C 3VEOA 1BOTO 2Z1IA 3CJ9A 5F1XA 1K9MO 4Y0WA 3R8EA 4NYFA 3CD6N 4BRCA 4DV1K 2AA4A 3CMEN 4FZZA 3SQ0A 3K5MA 3DLLL 1LOTB 5T7BA 1TAUA 1J5OA 4WQ4C 1NJZA 3HYFA 4IFEA 3V9SA 1RT1A 1EX4A 3M8PA 2O8CA 3SCXA 3CETA 3TAPA 3T7ZA 2GUPA 4CF1A 4FL9A 4K0KK 3H45C 1BQMA 3J7YP 3JAMO 1B9DA 3HPGA 1S6QA 1C0UA 4YOXA 5HBMA 4NCBA 3DLKA 3NGZA 3QB0A 3NH1A 1KAZA 3I8DA 1CLQA 4CJ3A 4OVLA 2W6KA 3I33A 2FF3B 1TKXA 4DF4A 4PA1A 4FVMA 3DLBA 4QS7A 2IDOA 5ADXA 3UKRB 3R9PA 3VQ7A 2GX9A 2D0AA 4FWOA 5J2PA 4F9OA 4B9VA 3AGRA 2FBTA 4YOWA 1HQUA 2OCEA 2HF4A 3AGKA 3S3MA 3CCLN 3SBGA 3TTDA 4AHVA 3R1XA 1CZBA 3TARA 2NRHA 3WNEA 4DV5K 1S5JA 5EU7A 1D9FA 4IO9L 1HNVA 4E7JA 3QIPA 3DXMB 5KI6A 4DTPA 1TYQA 3M8SA 3WNFA 1HNWK 4FWKA 4XEIA 1VSHA 5KQ8A 3CCMN 4CZMA 4CIEA 3M8QA 3O1BA 3TAMA 4DTRA 3TPQA 4HUFA 3ENOA 1U49A 5BRFA 3K59A 4B9TA 4FJ5A 1ZBLA 3RMDA 2G8KA 2IOCA 4MO5A 3HVRA 4BRQA 1TV6A 4FLXA 4F4KA 1VSJA 3KD5E 2UUCK 1JCGA 2VG7A 3QO9A 4IEIA 3KHYA 5AQQA 3C6HA 5C25A 1YJ9N 3HSCA 3I0RA 1ZXOA 4BDPA 1L3UA 1JLFA 4HUEA 1GLLO 3L2VA 2HOEA 2NZTA 4GMJB 1XNQK 3OY9A 3KLIA 2NLXA 3UIQA 3CQXA 4JD2A 2BDPA 2YJEA 4CJ7A 1NKCA 3SQ2A 2W42A 3OYJA 2QWMA 4MQ3A 4CBXA 4JKCA 4IDKA 3HOSA 4KH5A 1Q81O 3HP9A 3L3UA 3I8BA 2CGLA 4G9ZA 4BRMA 4IOCL 4YOYA 1DTTA 4DMNA 1S1WA 4CEQA 3ID6A 3KLEA 4CFDA 2Z1GA 4AHCA 1NWKA 1ILYA 3MCPA 3THWB 3CC7N 4DG1A 3OW2M 1FXXA 4JAXA 4O4GA 4NO7A 4JK8A 1VK0A 3L6QA 4ZTJA 3C7NA 1TKZA 1RDWX 3U4LA 4DV3K 4DSKA 3DXKA 4RTFD 1HJOA 1DKGD 1NK0A 3BGRA 3PX6A 4FLUA 2FXUA 1NJIO 1JXBA 3G10A 4C1NI 3RMBA 4HUGA 2CH5A 3MEEA 3HM8A 5HRSA 4CF8A 4NXMK 4AQYK 3A5OC 5AQUA 3S3OA 4QAGA 1NGIA 3Q7BA 4C23A 4ELUA 3KKRA 4BG8A 2RHKA 1EWQA 5AQXA 3B8AX 3S9HA 4I2QA 4NLCA 5KPRA 4BRAA 2XO7A 3R6MA 3MN9A 1XWLA 5C10A 3ZSWA 5IT9O 2WONA 3AVJA 3K58A 4BR7A 1NGAA 4CHQA 3DOKA 4Y1CA 3I0SA 5C0YA 3ID8A 4XIUA 4CK1A 3RTVA 3OVNA 3CI5A 5JMVA 3FZMA 3B6OA 1MWMA 2F7TA 1RT7A 4H03B 1BIZA 3LDPA 4FYDA 3O3HA 3L0QA 4FZYA 4C8MA 3UKRA 3AVIA 4HCCA 2AP1A 3L4QA 3HRGA 3FFIA 4IZ9A 3D0PA 4M7XA 2O8EB 3HOTA 1Z6RA 2QKKA 1D4XA 3FZHA 3LM2A 3PSFA 4CBWA 4H0XB 4M45A 3MMVA 1KRPA 4A61A 4BC3A 1XQSC 4HWIA 2GTDA 4M7YA 4KI6A 1IG9A 2ZJQL 5GINA 3E1YA 1DT9A 3O6WA 3T1AA 3VQCA 4FJHA 3V9XA 3DXMA 1GLCG 3O9SA 1C1CA 2P9IB 3NBPA 2WFBA 2YX6A 3D6RA 4L3QA 4OGEA 1KAYA 4BG9A 4O8UA 4K25A 3ULEB 5FRMA 3LZIA 2G8HA 4CGGA 2ZJRL 3IDHA 1ITGA 3BZCA 5EY4A 4FK4A 2QM1A 5JLHA 1BHLA 4AM6A 5C2FA 4OX9K 1GLEG 1O1WA 3NF6A 1RBVA 3RRHA 4FWQA 3TAFA 2BUPA 1DLOA 3LALA 1XHXA 5EOYA 1W7AA 1N8RO 2WTUA 4E7HA 4FW1A 2F8SA 4LH4A 4M3UA 2VG6A 5EVZA 1N32K 3G4SN 4QOZB 1IKVA 3ZSXA 1SZ2A 2UUAK 4OLAA 5SWMA 1K6YA 3THXB 2HBMA 3Q7CA 3HP6A 3QLHA 2D4WA 3EY1A 3NF8A 3RR7A 4W5TA 4KTQA 1VSLA 3OS2A 4B9SA 3VGKA 1U6ZA 2G8UA 2I5JA 2X6SA 1REVA 3M3ZA 3BUZB 4BR9A 4EIAA 4DQSA 2P9PA 5DK5A 3HPOA 3KK2A 1WSIA 3GL1A 4DR7K 4AHRA 4CZIA 5D3GA 4IDHA 1WSHA 3TR8A 3CCUN 3H1VX 3THWA 2NRRA 2OYQA 1BI4B 2HHWA 4OPJA 2DPNA 1G99A 1KXPA 3BF1A 4M3WA 4ELVA 3AVKA 4H5NA 2E2QA 4E89A 5F0XA 1Q9XA 4B3SK 4FW2A 3TSPA 2ITGA 3VEWA 4CEBA 4ZHRA 3VMFB 5AQKA 4BE1A 3AVHA 4GVMA 3ZETA 3SV3A 1J53A 1P90A 3WEEA 3VERA 3THYB 1IH7A 4CJLA 3MCAB 3T1YK 2PYJA 2YNHA 3SZ2A 3ZSZA 5KQDA 2J4RA 2Z1HA 3RSEA 3MN6A 3ITHA 3K9JA 1UWBA 1TGOA 1RBRA 3PSIA 3OTOK 4B1WB 1GLBG 2HNZA 3DMJA 4JNEA 2Q97A 5M1NA 4FJNA 1Q9YA 1Z25A 4FK2A 2QXFA 3VESA 4G1QA 2QWNA 4YHHK 3J81O 3CC4N 1GLFO 4LY7A 1NOYA 1NGEA 2Y1IA 3SQ1A 3VQDA 1KTQA 2HBJA 4CHNA 1W0HA 4CHYA 3HVTA 4RW6A 1VHXA 4M41A 5JS1A 4H8KA 1V4SA 3CQYA 1IKXA 2VGMA 5C12A 3AV9A 2UXCK 3PIOL 3KIOA 1SKSA 1D5AA 3O9TA 4CJTA 3CF5L 3WXLA 5BPMA 4WF9L 5BN8A 4FJ9A 3P38A 1W9HA 4EZ9A 3TANA 4B8CA 2O8EA 1NM1A 4R79A 2ZM6K 3SBTA 4YOTA 1JCEA 4NXNK 1Q86O 1LWFA 4EFHA 5I3UA 3QMLA 1HYZA 3RMCA 3ZT1A 3H3NO 2YCHA 1X3MA 2G8VA 2YNGA 2A1SA 4CVNE 3THVA 3O5BA 1HR0K 1OVYA 4JI6K 1ASVA 2QTDA 2IAJA 3G25A 4A59A 4JHDB 3BP8A 4IO8A 5TKYA 3RRGA 3L2WA 3P39A 4IXCA 1VQKN 1ESVA 4DTNA 4IFVA 5H1SQ 4DS5A 4EHUA 3EKUA 1WAFA 1O13A 1BCOA 3AVMA 3EE8A 5AQJA 4OLBA 2KTQA 3IRXA 1KFDA 1BDGA 2P9UB 1H1VA 4B9UA 5A2QO 3KK7A 4IJAA 3CFPA 1HX1A 4KHPK 3ZT0A 1U45A 4OKJA 1X9SA 1ZBUA 2QKBA 4NYNA 4DR4K 3FZFA 1U2VB 3MWPA 3CCQN 3V81A 4E1JA 3THXA 4JYAK 4BQZA 3VQEA 1QVGM 3QEIA 2WUSA 5AQNA 5FPMA 1VQ4N 1HKBA 4FJKA 3LDOA 1QVFM 3EN9A 3TTFA 2ASOA 3LDQA 4YOUA 5LMNK 4MLHA 3OHRA 1ZBIA 1ATRA 4M63C 1BQNA 1JLEA 3AVAA 3A0IX 3V4IA 3J7AP 1IV0A 3HTVA 1QQOA 5FLXO 1S1XA 4E0DA 4CZKA 4JI2K 4B8AB 3D45A 5GAGP 3WXJA 1GLJO 4DTUA 1P8ZA 1BI4A 1OH5A 1CZ9A 4LC9B 2XY8A 2O4GA 4GKKK 4KRFA 3FZLA 4WQ4A 3D2FB 4JKGB 2EWSA 4BVOA 4CEOA 3CFRA 2Q31A 2P9KB 1NGFA 3NHGA 3T1HK 4A5AA 2E6LA 1NKBA 3GG4A 3VA0A 2YJFA 2HF3A 4KB0A 3F5TA 1BUPA 1RBTA 4CFCA 4CGJA 3THYA 4DKWA 2OZSA 3WQUA 3OYGA 4JK9A 1JLQA 4EHTA 1C6VA 2O4IA 3N4PA 2O8FB 3RVCA 3EO3A 4F2SA 1RT6A 1YUWA 1D9DA 3LANA 1RGIA 2GELA 3VQ6A 3ZT2A 4CJVA 4B9LA 1A5VA 4H5RA 2KQ2A 1C0MA 4BACA 3AAQA 4H0PA 2P9SB 4BVPA 1NJXA 3AO1A 4DTJA 1VQNN 1E4FT 2BE2A 4FOEA 4KTWA 2KW4A 2OANA 3CQ8A 3QEWA 2F9WA 1S22A 4J2EA 2QA4N 3DLGA 3ZT4A 1LW0A 1VQ5N 3DLHA 4JI3K 4C8OA 2BTFA 3ASMA 3D7EO 1KC8O 2OPSA 4PKGA 4EP4A 3VQ8A 1S72N 3ZCMA 1VQ6N 2E20A 1MA9B 1UAXA 2E1ZA 1TKDA 2D5RA 4CHPA 4TSXA 3IAYA 3QNNA 5J2MA 4QCLA 4CK2A 4J8FA 3MXIA 4PKHA 1LW2A 1U48A 4RW9A 4DU4A 5AQLA 4JHDA 3AY9A 3ZX2A 4CW7B 4RW8A 2D0PA 3HPHA 1Y64A 1NU0A 1Q8IA 1YTUA 4CJWA 4YOVA 3W3DA 4BRDA 1QQNA 5AQIA 3VF2A 1ASWA 3CJAA 4BRHA 5CY4A 2P5GA 4RWTA 3OYMA 2KKZA 3TTCA 3E9PA 3MX2A 5M1PA 2E88A 5BPNA 5AFUH 2IVNA 2P9UA 2F9TA 3RR8A 1RILA 4CF2A 1BG3A 2HHHK 4FXDA 1B9FA 4KPYA 4E7IA 3QINA 4DQRA 1I3AA 2D0BA 3OYNA 3MK6A 2A1RA 2E5LK 2YHXA 3FFKB 4YFUA 1U2VA 1VQMN 3G0ZA 2O8DA 2QI2A 3LM9A 3AO3A 2DFFA 1TKTA 3L2UA 4AH9A 4I9QA 1ZC6A 4GNIA 1C1BA 5M1QA 1QQMA 1LWCA 2GBZA 3CMAN 4HHTA 4B1VA 2V51B 1QSYA 4BRIA 4BR2A 2E6MA 3KD1E 3SYZA 3WXIA 2YKNA 2I7PA 3MEGA 1FK9A 5FPEA 1HKGA 1GLDG 4ISFA 2ZE2A 1BWFO 1BIUA 5FPNA 3FGUA 1IO2A 3NF9A 1K8KA 2EHGA 2LSNA 3QFPA 2VYPA 5FROA 4GV3A 3C6UA 3D2FA 4CE9A 4O8KA 1WNSA 5DM7L 4C8LA 2AJQA 4B1XB 2OTJN 3E01A 5AQMA 3C94A 2P9KA 1M90O 1N5YA 4CCHA 4DWIA 3VQ5A 2HHTA 1HNIA 3DWLA 3D2EB 4EP5A 2NUBA 1RTHA 1C0FA 2FBVA 1BO5O 4DV4K 2IVPA 4YDUC 2BH1A 3K2PA 2O8FA 3AA2A 2CGKA 4A2AA 2HHQA 3O8MA 1CXQA 3CJ1A 4ILJA 1K8AO 1NMDA 3KZBA 2A42A 2P9LB 4CJ4A 1D8YA 4M3ZA 3TAEA 3VTIA 3VETA 1J54A 1OKJA 3CIPA 5JVHL 5SZTA 2P9SA 4BR5A 1KLNA 3VEZA 4N47A 1VSFA 2P5OA 5AQTA 3O9RA 5F2RA 2JGUA 4BWJA 3OS1A 3V9ZA 5K14A 5I42A 1RT4A
chains in the Genus database with same CATH topology
4LFBK 2UXDK 4JV5K 2VQEK 1J5EK 4DR1K 1N34K 1XMQK 3T1YK 5A2QO 4DV2K 4DV3K 4LF4K 4KHPK 4JI0K 1IBKK 4GKJK 4JI5K 5BR8K 1N36K 2VQFK 4DR4K 1I94K 4JI3K 3OTOK 4V19S 2UU9K 4JYAK 1HNZK 4OX9K 4DR6K 4DV5K 1HNXK 4YHHK 3J81O 4JI1K 4NXMK 4LF7K 5LMNK 4DUYK 4X64K 4AQYK 4X66K 4B3MK 4B3TK 1XNRK 4DR3K 5LMUK 4LFAK 1HNWK 4DR5K 4YY3K 4X65K 1N33K 4X62K 4LF6K 3J80O 1IBMK 3J7AP 1N32K 5FLXO 4DV7K 4JI8K 4JI2K 5LL6Z 2UUAK 4LFCK 4DV4K 2UXCK 2UXBK 2UUBK 1IBLK 4CW7B 4DV1K 5AJ3K 4GKKK 4LF8K 5IT9O 2F4VK 4B3RK 2UUCK 2ZM6K 4DV6K 3T1HK 4NXNK 4DR7K 1XMOK 1FJGK 4DR2K 4CVNE 5IWAK 1XNQK 1HR0K 4JI7K 4JI6K 2HHHK 4DV0K 4K0KK 4JI4K 3J7YP 3JAMO 4B3SK 4LF5K 4LF9K 2E5LK 4DUZK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFB K;  2UXD K;  4JV5 K;  2VQE K;  1J5E K;  4DR1 K;  1N34 K;  1XMQ K;  3T1Y K;  5A2Q O;  4DV2 K;  4DV3 K;  4LF4 K;  4KHP K;  4JI0 K;  1IBK K;  4GKJ K;  4JI5 K;  5BR8 K;  1N36 K;  2VQF K;  4DR4 K;  1I94 K;  4JI3 K;  3OTO K;  4V19 S;  2UU9 K;  4JYA K;  1HNZ K;  4OX9 K;  4DR6 K;  4DV5 K;  1HNX K;  4YHH K;  3J81 O;  4JI1 K;  4NXM K;  4LF7 K;  5LMN K;  4DUY K;  4X64 K;  4AQY K;  4X66 K;  4B3M K;  4B3T K;  1XNR K;  4DR3 K;  5LMU K;  4LFA K;  1HNW K;  4DR5 K;  4YY3 K;  4X65 K;  1N33 K;  4X62 K;  4LF6 K;  3J80 O;  1IBM K;  3J7A P;  1N32 K;  5FLX O;  4DV7 K;  4JI8 K;  4JI2 K;  5LL6 Z;  2UUA K;  4LFC K;  4DV4 K;  2UXC K;  2UXB K;  2UUB K;  1IBL K;  4CW7 B;  4DV1 K;  5AJ3 K;  4GKK K;  4LF8 K;  5IT9 O;  2F4V K;  4B3R K;  2UUC K;  2ZM6 K;  4DV6 K;  3T1H K;  4NXN K;  4DR7 K;  1XMO K;  1FJG K;  4DR2 K;  4CVN E;  5IWA K;  1XNQ K;  1HR0 K;  4JI7 K;  4JI6 K;  2HHH K;  4DV0 K;  4K0K K;  4JI4 K;  3J7Y P;  3JAM O;  4B3S K;  4LF5 K;  4LF9 K;  2E5L K;  4DUZ K; 
#chains in the Genus database with same CATH topology
 4O0I A;  4BC2 A;  2HBL A;  4AIL C;  1X3N A;  3KJV A;  2PBD A;  1YAG A;  2FBY A;  3OYF A;  4JV5 K;  3AO2 A;  1G15 A;  3WNH A;  2E1Y A;  1YI2 N;  4JK7 A;  1TUU A;  3QIO A;  4Z4H A;  4DQI A;  4EZ6 A;  4K43 A;  1LCU A;  5J1E A;  1X1P A;  2A5X A;  4CK3 A;  3OA9 A;  1NGB A;  1T05 A;  2QWO A;  3EKS A;  1N36 K;  3HL8 A;  4CEA A;  1SL0 A;  1VQ9 N;  4CJS A;  4YOR A;  2BGG A;  1VSD A;  1HKC A;  3FZK A;  4JKH A;  4FSV A;  4BDZ A;  2VG5 A;  4JKA A;  3M6G A;  2HVH A;  2V7Z A;  1HNX K;  3L4I A;  1J6Z A;  3VEV A;  3TWH A;  4WCE L;  2FC0 A;  4HVJ A;  1NK5 A;  4OJR A;  5LMU K;  1KAX A;  3BY5 A;  4FWM A;  1KVC A;  5KRT A;  4KKO A;  4OO1 J;  4CD3 A;  4XH1 A;  1K73 O;  3O4Q A;  4W5R A;  1R0A A;  4BGB A;  4DQQ A;  3AVF A;  4DV7 K;  4JI8 K;  1ZBH A;  5CZ2 A;  2HHS A;  2NRT A;  4PQU A;  4LFC K;  4FJI A;  2X78 A;  4CED A;  2UXB K;  2A3Z A;  3CPE A;  5AJ3 K;  2YHA A;  5HRO A;  2F4V K;  3VQQ A;  3TSQ A;  1HUX A;  1NGC A;  1RT5 A;  3DRP A;  1LAV A;  3P1G A;  3RWU A;  4IJN A;  5E84 A;  3NMU A;  1EET A;  1C0T A;  4KH6 A;  3MDQ A;  3K9K A;  1GOC A;  3VF6 A;  3ZT3 A;  1C0G A;  2B4J A;  3AA5 X;  1HLU A;  3V1Q A;  4H0T B;  4DFM A;  2Q0U A;  4DSF A;  4I2P A;  4BQL A;  3CCE N;  4KB1 A;  2EX3 A;  1WBB A;  4CJF A;  4KRE A;  5AZJ B;  2V7Y A;  1HJR A;  3LP0 A;  3CCR N;  4DUZ K;  3WNG A;  1SAZ A;  4LFB K;  1T7P A;  3A5L C;  5HLF A;  5KRS A;  4AHU A;  2VQE K;  3KVG A;  2QEX N;  1EO1 A;  3M1F A;  3QEX A;  1VAZ A;  3ATU A;  4I6M B;  4CZG A;  4A57 A;  2W41 A;  4FWP A;  2G8W A;  4U7B A;  1J9A A;  4WYB A;  4CZE A;  4FJG A;  3PV8 A;  4ICL A;  1VQ8 N;  4CEC A;  5AQH A;  3A5M C;  4BC5 A;  1TK8 A;  3D2E A;  1RT2 A;  1I94 K;  1YVU A;  2RKI A;  3EZ5 A;  2OPP A;  2HST A;  1X9J A;  1A5W A;  1T6C A;  5HP1 A;  3CC2 N;  4JS4 A;  1HNZ K;  2JWK A;  4DQ8 A;  3CJ7 A;  3O9Q A;  4WFB L;  2RN2 A;  1YJW N;  3OYI A;  4LF7 K;  2JWL A;  2GWK A;  2P9L A;  1XNR K;  3JS6 A;  3VEY A;  1KD1 O;  5AQS A;  2FSJ A;  3EYZ A;  2Q1N A;  4Q0B A;  3LAK A;  2P9N B;  4DTO A;  4OKE A;  1NK4 A;  4FLZ A;  1IKY A;  1UA0 A;  1NKE A;  1JLB A;  4BR4 A;  1S1V A;  1M1K O;  1BGX T;  3LAM A;  3OYE A;  4DF8 A;  2UUB K;  3ZX0 A;  3DRS A;  4DHY A;  5ADX H;  3DI6 A;  1HYS A;  4IWV A;  3ATV A;  1RTJ A;  2RPI A;  3B6P A;  1VSI A;  4MLE A;  3QNO A;  2ASP A;  5JLF A;  2KFN A;  4K42 A;  1HQE A;  2I7N A;  4OPA A;  1XMO K;  3QFU A;  2O8C B;  4FM2 A;  3PLA A;  4H5T A;  1TK5 A;  1QZ6 A;  4QS8 A;  1JCF A;  1V4T A;  2CGJ A;  4KHY A;  1GOB A;  2O8B B;  3JYT A;  3L2R A;  3CJB A;  2A40 A;  3SAF A;  4Q5V A;  2Q36 A;  5GIO A;  4L8R B;  2YNI A;  4LF9 K;  4Z4F A;  2HB5 A;  4DFK A;  2ZQB A;  1U04 A;  1Z05 A;  4WFA L;  1TAQ A;  4CGI A;  1JXE A;  1L5U A;  2UXD K;  4LD0 A;  1DGK N;  1NLV A;  3O3G A;  1HPM A;  4DR1 K;  3T3F A;  1UOC A;  4JKF A;  1WBD A;  1VSK A;  3HZ6 A;  4J2D A;  3O4N A;  3OYH A;  4M42 A;  1I39 A;  1RFQ A;  3H1Q A;  2RE2 A;  3I56 N;  2P9I A;  2FLO A;  5GAE P;  3SQ4 A;  3TAB A;  4JS5 A;  2XRI A;  3ZSV A;  4CJP A;  1ZBS A;  3VN5 A;  2DFE A;  3LPT A;  3ULE A;  4H0O A;  3ZEU B;  3V6D A;  4DSL A;  5J2N A;  3PO5 A;  3UB5 A;  4GVE A;  4V19 S;  3MED A;  1YT3 A;  2W6L A;  2XY5 A;  1WSJ A;  4DR6 K;  2Q2R A;  2XHB A;  1UA1 A;  4KBO A;  3VOV A;  4JI1 K;  4B1U B;  2DFH A;  4NB4 A;  1R59 O;  3O1W A;  2P51 A;  2ZGZ A;  3K5O A;  3SAG A;  1Y97 A;  1IG8 A;  2A6A A;  4IOA L;  5AQZ A;  4YY3 K;  2X74 A;  3M8R A;  3NH0 A;  1Q18 A;  5AQW A;  1N33 K;  5C15 A;  4PL7 A;  3NE6 A;  3J80 O;  4PL8 A;  1IBM K;  3FE1 A;  3K0S A;  2VGN A;  1WUA A;  1JKH A;  3F73 A;  2GEM A;  1IBL K;  4Z4C A;  2KZM A;  4ELT A;  4FLT A;  2E4L A;  3N4Q A;  4ZTF A;  1VSM A;  3OJU A;  4KAZ A;  1FKP A;  1NK9 A;  1Z26 A;  5AQY A;  1L3S A;  1L3T A;  5AZJ A;  4B9Q A;  3AO5 A;  3CCV N;  5CYM A;  1SUQ A;  3IG1 A;  3RMA A;  1JL1 A;  4BRO A;  1S9E A;  1XHZ A;  3QES A;  4DU3 A;  4DU1 A;  3SAH A;  4N41 A;  3AAR A;  3AA4 A;  2YV0 X;  4MDB A;  3S3N A;  3HO1 A;  1EKE A;  4I6M A;  3VQ9 A;  4A62 A;  4AM7 A;  4OKK A;  3KTQ A;  5AQG A;  4FCY A;  3WUH A;  1KFS A;  4IBN A;  4LSL A;  3NH2 A;  1MDU B;  3NF7 A;  1SS6 A;  4DQP A;  1T6D A;  3W0L A;  1KQS M;  2VWK A;  4PHT X;  4KI4 A;  1S3X A;  1VQO N;  1RBU A;  4FJJ A;  4KH4 A;  1NMN A;  3OYB A;  4KO0 A;  2ATQ A;  5HOO A;  4ID5 A;  4KHS A;  3MN5 A;  1U4B A;  3V1R A;  3BEX A;  1J5E K;  3WQT A;  1YHQ N;  5LJV A;  1WN7 A;  3F9K A;  1MU2 A;  3AVL A;  4FM1 A;  1QHA A;  3U3G A;  3K57 A;  3WT0 A;  1SL1 A;  1IBK K;  3EL2 A;  4FPB A;  4GKJ K;  4B9M A;  3DXK B;  2P9N A;  3LWM A;  1YIJ N;  3DOL A;  1A5X A;  4Z0U A;  2B5J A;  3TU5 A;  3KK1 A;  4FJ7 A;  2KHO A;  2QWP A;  2HW3 A;  3T19 A;  3AAP A;  2XY6 A;  4BGA A;  3ZSO A;  2D1K A;  4FWN A;  1RDU A;  2PYL A;  1T44 A;  3ALY A;  4NCG A;  1NNE A;  3NAE A;  4ID1 A;  4BWM A;  1CZA N;  2BAN A;  1WB9 A;  4JKB A;  4LSN A;  2F8T A;  3SJH A;  1RT3 A;  5KPZ A;  4FJM A;  4CHZ A;  5BRH A;  5LL6 Z;  1RNH A;  3IS9 A;  3HJF A;  4GV9 A;  3GBT A;  4FOI A;  4M3R A;  2O8B A;  3J8A A;  4CD1 A;  1T3V A;  2YHB A;  3IUC A;  3H08 A;  2UYT A;  4QS9 A;  4E7K A;  5JS2 A;  3PO4 A;  4DV6 K;  3C65 A;  3CJC A;  3V1O A;  2PFU A;  4Z4G A;  3TSU A;  3MXJ A;  5EXW A;  1BA0 A;  3A5N C;  2HHU A;  3KKS A;  3U8X A;  4DFJ A;  3LPU A;  1RTD A;  3PX0 A;  3SMS A;  3HM9 A;  4CI6 A;  4DV0 K;  4B08 A;  1SV5 A;  4CF0 A;  3F2K A;  3ZEU A;  1T8E A;  4FJX A;  3HK2 A;  1KVB A;  3U6F A;  1OH7 A;  2KFZ A;  3AA3 A;  3OS0 A;  4MDA A;  2WOM A;  3NGY A;  3VEX A;  3T69 A;  2IVO A;  3P83 D;  4JRP A;  3VF4 A;  4DSJ A;  4M3X A;  2OA8 A;  4N56 A;  3LP2 A;  3BF3 A;  4RW4 A;  3C95 A;  3BZK A;  4JI0 K;  5DMR A;  4E1M A;  1MWK A;  2QWQ A;  3QET A;  3DRR A;  4DB3 A;  3O4W A;  2DTU A;  1QE1 A;  3ISN C;  1LV5 A;  4K8X A;  5KGW A;  3SUO A;  3GDQ A;  3SLC A;  3DLE A;  2ITM A;  4BR0 A;  1SKR A;  4O5B A;  3KLG A;  3NGI A;  5C42 A;  2H3G X;  3CCJ N;  4AHT A;  4CGH A;  2IC3 A;  2HHV A;  3VPZ A;  4Z4E A;  1QSL A;  3EE9 A;  5E41 A;  1NJY A;  4E1N A;  3MX5 A;  3LDL A;  4W5Q A;  2G8I A;  3PUF A;  4FWR A;  4CJR A;  2CH6 A;  1EWR A;  1F21 A;  4JN4 A;  4CF9 A;  2OZM A;  4BRE A;  4YDU A;  5C24 A;  4DTX A;  4IKF A;  2ZJP L;  4BDY A;  3E9O A;  3HBT A;  3OYL A;  2Y1J A;  1QS4 A;  1WSE A;  4JKG A;  5CR4 A;  3SK3 A;  4WFN L;  4B3R K;  1QHT A;  2PAV A;  2HNY A;  4KHU A;  4IEE A;  2WBN A;  1WLJ A;  2P9P B;  1RDD A;  4A5B A;  3K5N A;  4O55 A;  4CES A;  3FLC O;  3UE5 A;  1QZ5 A;  4CJE A;  4CFB A;  3ZSY A;  2QWL A;  1ZYQ A;  4M3T A;  5J2Q A;  4RG8 A;  4JI4 K;  5GIP A;  1TL3 A;  4I9L A;  1JL2 A;  4FWL A;  2E2O A;  3LDS A;  4DCH A;  3U9Z A;  3QER A;  1GOA A;  1WAJ A;  2ASM A;  3CER A;  3VQB A;  4CBU A;  4FZX C;  4EAH D;  3ZET B;  4KHN A;  1VQL N;  5KTQ A;  3WEE B;  4DTS A;  5ELZ A;  3SUQ A;  4R5P A;  2E2N A;  3LP3 A;  4DV2 K;  4IG0 A;  4C8N A;  3DAW A;  2Q3S A;  4CFA A;  4Z94 A;  5M1O A;  4ILH A;  5FRN A;  3O9U A;  3ZSR A;  3RSE B;  3VQ4 A;  1NBW A;  3EZW A;  3G71 N;  3HT3 A;  4HCB A;  3L3V A;  4B1Y B;  1RDB A;  4CHO A;  4F8R A;  3EEQ A;  1NOZ A;  3MXM A;  4GV6 A;  2GV9 A;  1BL3 A;  2HMI A;  3K5L A;  4FLY A;  1SL2 A;  5GAH P;  4E3S A;  1IKW A;  2QK9 A;  3VTH A;  4BC4 A;  1NGD A;  2KLA A;  4B3T K;  2E2P A;  2F96 A;  4X66 K;  1JJ2 M;  3A2F A;  2HBK A;  4F3O A;  4H0V B;  3C6T A;  2NRV A;  3GE1 A;  4DR5 K;  3IFR A;  3SPZ A;  1RBS A;  4X65 K;  4H0Y B;  5DM6 L;  4X62 K;  3HST B;  4LF6 K;  4FLV A;  3H6E A;  1BU6 O;  2VWJ A;  1B92 A;  1BIS A;  4CGF A;  4DSI A;  3F9M A;  3WXK A;  1TVR A;  3JSM A;  4KV8 A;  3DYA A;  3KWI A;  4KTZ A;  4DLG A;  4BY9 C;  4FVU A;  4CER A;  4PKI A;  3U3Y A;  4BRF A;  1KVA A;  4NLB A;  3TAQ A;  4CJK A;  3PIP L;  4JEP A;  1VQ7 N;  5AQP A;  1BA1 A;  5HRP A;  4Y1D A;  3PY8 A;  3ENH A;  4N76 A;  2NNW A;  2FSK A;  4DR2 K;  2ZF5 O;  5I9E B;  1U47 A;  3H3O B;  1N6Q A;  1QTM A;  3G6E N;  1HRH A;  1RTI A;  4OGC A;  4C1N K;  3PX4 A;  3LL3 A;  2ZGY A;  3VQP A;  4RCH A;  3AVC A;  3P31 A;  4O0J A;  2FSN A;  1RDC A;  4F2R A;  4JRQ A;  1LAW A;  3OBY A;  2YI1 A;  3QBX A;  4GY2 B;  3VGL A;  3QEV A;  1XC9 A;  2PZS A;  4JKD A;  1JLA A;  4DTM A;  4H4M A;  2JLE A;  4CIG A;  2IGI A;  4AHS A;  1XC3 A;  1KCF A;  3C6A A;  3CG7 A;  5AQV A;  5BRD A;  5AQF A;  3FR0 A;  5JIC A;  4IG3 A;  2W40 A;  3CXC M;  4WE1 A;  4BE2 A;  1L3V A;  4J2A A;  2VQF K;  4M3Y A;  1NK7 A;  3DM2 A;  4O5F A;  3V9W A;  5KPT A;  4LH5 A;  1XUP O;  2GUI A;  2UU9 K;  3QEP A;  1BCM A;  1EP4 A;  3SUN A;  3QDK A;  3SV4 A;  4E7L A;  1W2B M;  1QSS A;  1FW6 A;  4FLW A;  5AFU A;  4N5S A;  1ZBF A;  3SPY A;  1HYV A;  3DLR A;  1NGH A;  1QQC A;  4KHQ A;  3J7Z O;  5AQO A;  4A2B A;  4FK0 A;  5C2D A;  4DR3 K;  1E3M A;  1NGG A;  3TI0 A;  3CPW M;  4CEF A;  4I7F A;  3VEN A;  5HL7 L;  4BRN A;  4K41 A;  4B1Z A;  2HMP A;  4BRG A;  3C0B A;  2G8F A;  2FF6 A;  4ISE A;  4IFY A;  3JXU A;  3LP1 A;  2YHY A;  5AZI B;  5BR9 A;  2YNF A;  3S41 A;  4CZH A;  5BPL A;  3O08 A;  2GWJ A;  3AVG A;  5M1K A;  4LF8 K;  3A8Y A;  2PY5 A;  3SNN A;  3VGM A;  1DEJ A;  4FM0 A;  2FBX A;  2IS3 A;  2V52 B;  2Z1J A;  5MLC Q;  3CYM A;  5LJW A;  2DY4 A;  3OYC A;  4FPA A;  5CE3 A;  3MEC A;  2OPQ A;  1NGJ A;  3UKU B;  2ETJ A;  3E66 A;  1OH8 A;  3MAQ A;  1CXU A;  1RCH A;  3O3F A;  4BE0 A;  3P5J A;  4K8Z A;  1Q7Y O;  1VRT A;  5CYQ A;  2A41 A;  4CZL A;  3NFA A;  4RW7 A;  2WC9 A;  2OTL N;  5BRE A;  2B6A A;  4OPK A;  1T03 A;  3ZLJ A;  1TL1 A;  4BRP A;  4NCA A;  3ENB A;  4JKE A;  2OPR A;  3QIC A;  3I55 N;  4MFB A;  3VA3 A;  4KFB A;  3NCI A;  4C8K A;  4DS4 A;  3CHW A;  2NRX A;  4ILG B;  3LWL A;  2X6N A;  1VQP N;  3O80 A;  5BR8 K;  1EXQ A;  5E26 A;  3OJS A;  3NVM A;  3AVB A;  3MWT A;  4FJL A;  4H5W A;  3KWG A;  1YTA A;  2YKM A;  1YXQ A;  3KLH A;  1C1A A;  3R3L A;  1ASU A;  3AO4 A;  4DFP A;  1NG9 A;  2NRW A;  1RDA A;  1X9M A;  1YIT N;  5BN9 A;  3IKM A;  5FDL A;  2P1J A;  4Z4I A;  3CFO A;  4XH5 A;  2YHW A;  3CM6 A;  1YF5 L;  4E19 A;  3AVN A;  4UQG A;  4O44 A;  3KK3 A;  4LFA K;  3OBW A;  1VRU A;  1YVN A;  4AF1 A;  4H5V A;  2KZZ A;  5CHI A;  3CM5 A;  2RF2 A;  5FPD A;  4CEZ A;  1OH6 A;  1SKW A;  3U9D A;  3ZX3 A;  4DLE A;  4U67 L;  4DSE A;  4CZF A;  4XH4 A;  1HPZ A;  1Q82 O;  4PY5 A;  3SJJ A;  4BRK A;  3HXM A;  4UY8 O;  3IMX A;  2QXL A;  1NK6 A;  4GW6 A;  3OYD A;  5EX5 A;  3HI0 A;  3P4I A;  4CIF A;  4J2B A;  4MO4 A;  1W97 L;  4KHW A;  1TYQ B;  4FO0 A;  2QWR A;  2HND A;  3BDP A;  4W5N A;  5GAD P;  4YNQ A;  3NVK A;  4OPH A;  5JVG L;  4IOX A;  3LDN A;  2ZD1 A;  2XY7 A;  1FJG K;  5AR0 A;  3GOI A;  5IWA K;  4JI7 K;  3MN7 A;  3ULD A;  4CJQ A;  3SUP A;  4W5O A;  3QBW A;  4JLH A;  1SQK A;  2E8A A;  3VQA A;  2R7Y A;  1TUY A;  4BRL A;  3CCS N;  4HTU A;  4LF5 K;  5HRN A;  1GLA G;  3WXM B;  4CJU A;  5KGX A;  3L8B A;  5HRR A;  3V9U A;  4HTL A;  1ATN A;  3TAG A;  1X9W A;  3M5R A;  1S9G A;  2O8D B;  4FWS A;  2HHX A;  4CJ5 A;  3LZJ A;  4B9N A;  1N34 K;  1JLG A;  2ZWH A;  1XMQ K;  4PWD A;  4H4O A;  1NJW A;  5CZ1 A;  4CEE A;  4B3O A;  1VSE A;  4LF4 K;  4JD2 B;  5B8H A;  3SI6 A;  2IIR A;  5TKW A;  1YJN N;  4JI5 K;  2VWB A;  1WSF A;  4PUO A;  3OYA A;  2D0O A;  1NK8 A;  4WQ5 A;  1S6P A;  3ZSQ A;  5LY3 A;  3ZYY X;  4CZJ A;  1WSG A;  1OVQ A;  5AZI A;  4CGD A;  1S1T A;  2Q0R A;  4FJ8 A;  4F3T A;  1DTQ A;  1FKO A;  3H46 O;  1K8K B;  1ATS A;  1S1U A;  2D0C A;  3E9L A;  5M1F A;  3SMP A;  1WOQ A;  3KLF A;  1JLC A;  2NRZ A;  3DJC A;  4DUY K;  4X64 K;  4B3M K;  1KSP A;  4ISG A;  1E4G T;  3C7N B;  5AQR A;  3OYK A;  3L2Q A;  1IJJ A;  3UKU A;  1XI1 A;  1HMV A;  1LWE A;  3NDK A;  1EQY A;  1KLM A;  1TK0 A;  2QW9 A;  2VCP A;  2HVI A;  4WQ5 C;  3VEO A;  1BOT O;  2Z1I A;  3CJ9 A;  5F1X A;  1K9M O;  4Y0W A;  3R8E A;  4NYF A;  3CD6 N;  4BRC A;  4DV1 K;  2AA4 A;  3CME N;  4FZZ A;  3SQ0 A;  3K5M A;  3DLL L;  1LOT B;  5T7B A;  1TAU A;  1J5O A;  4WQ4 C;  1NJZ A;  3HYF A;  4IFE A;  3V9S A;  1RT1 A;  1EX4 A;  3M8P A;  2O8C A;  3SCX A;  3CET A;  3TAP A;  3T7Z A;  2GUP A;  4CF1 A;  4FL9 A;  4K0K K;  3H45 C;  1BQM A;  3J7Y P;  3JAM O;  1B9D A;  3HPG A;  1S6Q A;  1C0U A;  4YOX A;  5HBM A;  4NCB A;  3DLK A;  3NGZ A;  3QB0 A;  3NH1 A;  1KAZ A;  3I8D A;  1CLQ A;  4CJ3 A;  4OVL A;  2W6K A;  3I33 A;  2FF3 B;  1TKX A;  4DF4 A;  4PA1 A;  4FVM A;  3DLB A;  4QS7 A;  2IDO A;  5ADX A;  3UKR B;  3R9P A;  3VQ7 A;  2GX9 A;  2D0A A;  4FWO A;  5J2P A;  4F9O A;  4B9V A;  3AGR A;  2FBT A;  4YOW A;  1HQU A;  2OCE A;  2HF4 A;  3AGK A;  3S3M A;  3CCL N;  3SBG A;  3TTD A;  4AHV A;  3R1X A;  1CZB A;  3TAR A;  2NRH A;  3WNE A;  4DV5 K;  1S5J A;  5EU7 A;  1D9F A;  4IO9 L;  1HNV A;  4E7J A;  3QIP A;  3DXM B;  5KI6 A;  4DTP A;  1TYQ A;  3M8S A;  3WNF A;  1HNW K;  4FWK A;  4XEI A;  1VSH A;  5KQ8 A;  3CCM N;  4CZM A;  4CIE A;  3M8Q A;  3O1B A;  3TAM A;  4DTR A;  3TPQ A;  4HUF A;  3ENO A;  1U49 A;  5BRF A;  3K59 A;  4B9T A;  4FJ5 A;  1ZBL A;  3RMD A;  2G8K A;  2IOC A;  4MO5 A;  3HVR A;  4BRQ A;  1TV6 A;  4FLX A;  4F4K A;  1VSJ A;  3KD5 E;  2UUC K;  1JCG A;  2VG7 A;  3QO9 A;  4IEI A;  3KHY A;  5AQQ A;  3C6H A;  5C25 A;  1YJ9 N;  3HSC A;  3I0R A;  1ZXO A;  4BDP A;  1L3U A;  1JLF A;  4HUE A;  1GLL O;  3L2V A;  2HOE A;  2NZT A;  4GMJ B;  1XNQ K;  3OY9 A;  3KLI A;  2NLX A;  3UIQ A;  3CQX A;  4JD2 A;  2BDP A;  2YJE A;  4CJ7 A;  1NKC A;  3SQ2 A;  2W42 A;  3OYJ A;  2QWM A;  4MQ3 A;  4CBX A;  4JKC A;  4IDK A;  3HOS A;  4KH5 A;  1Q81 O;  3HP9 A;  3L3U A;  3I8B A;  2CGL A;  4G9Z A;  4BRM A;  4IOC L;  4YOY A;  1DTT A;  4DMN A;  1S1W A;  4CEQ A;  3ID6 A;  3KLE A;  4CFD A;  2Z1G A;  4AHC A;  1NWK A;  1ILY A;  3MCP A;  3THW B;  3CC7 N;  4DG1 A;  3OW2 M;  1FXX A;  4JAX A;  4O4G A;  4NO7 A;  4JK8 A;  1VK0 A;  3L6Q A;  4ZTJ A;  3C7N A;  1TKZ A;  1RDW X;  3U4L A;  4DV3 K;  4DSK A;  3DXK A;  4RTF D;  1HJO A;  1DKG D;  1NK0 A;  3BGR A;  3PX6 A;  4FLU A;  2FXU A;  1NJI O;  1JXB A;  3G10 A;  4C1N I;  3RMB A;  4HUG A;  2CH5 A;  3MEE A;  3HM8 A;  5HRS A;  4CF8 A;  4NXM K;  4AQY K;  3A5O C;  5AQU A;  3S3O A;  4QAG A;  1NGI A;  3Q7B A;  4C23 A;  4ELU A;  3KKR A;  4BG8 A;  2RHK A;  1EWQ A;  5AQX A;  3B8A X;  3S9H A;  4I2Q A;  4NLC A;  5KPR A;  4BRA A;  2XO7 A;  3R6M A;  3MN9 A;  1XWL A;  5C10 A;  3ZSW A;  5IT9 O;  2WON A;  3AVJ A;  3K58 A;  4BR7 A;  1NGA A;  4CHQ A;  3DOK A;  4Y1C A;  3I0S A;  5C0Y A;  3ID8 A;  4XIU A;  4CK1 A;  3RTV A;  3OVN A;  3CI5 A;  5JMV A;  3FZM A;  3B6O A;  1MWM A;  2F7T A;  1RT7 A;  4H03 B;  1BIZ A;  3LDP A;  4FYD A;  3O3H A;  3L0Q A;  4FZY A;  4C8M A;  3UKR A;  3AVI A;  4HCC A;  2AP1 A;  3L4Q A;  3HRG A;  3FFI A;  4IZ9 A;  3D0P A;  4M7X A;  2O8E B;  3HOT A;  1Z6R A;  2QKK A;  1D4X A;  3FZH A;  3LM2 A;  3PSF A;  4CBW A;  4H0X B;  4M45 A;  3MMV A;  1KRP A;  4A61 A;  4BC3 A;  1XQS C;  4HWI A;  2GTD A;  4M7Y A;  4KI6 A;  1IG9 A;  2ZJQ L;  5GIN A;  3E1Y A;  1DT9 A;  3O6W A;  3T1A A;  3VQC A;  4FJH A;  3V9X A;  3DXM A;  1GLC G;  3O9S A;  1C1C A;  2P9I B;  3NBP A;  2WFB A;  2YX6 A;  3D6R A;  4L3Q A;  4OGE A;  1KAY A;  4BG9 A;  4O8U A;  4K25 A;  3ULE B;  5FRM A;  3LZI A;  2G8H A;  4CGG A;  2ZJR L;  3IDH A;  1ITG A;  3BZC A;  5EY4 A;  4FK4 A;  2QM1 A;  5JLH A;  1BHL A;  4AM6 A;  5C2F A;  4OX9 K;  1GLE G;  1O1W A;  3NF6 A;  1RBV A;  3RRH A;  4FWQ A;  3TAF A;  2BUP A;  1DLO A;  3LAL A;  1XHX A;  5EOY A;  1W7A A;  1N8R O;  2WTU A;  4E7H A;  4FW1 A;  2F8S A;  4LH4 A;  4M3U A;  2VG6 A;  5EVZ A;  1N32 K;  3G4S N;  4QOZ B;  1IKV A;  3ZSX A;  1SZ2 A;  2UUA K;  4OLA A;  5SWM A;  1K6Y A;  3THX B;  2HBM A;  3Q7C A;  3HP6 A;  3QLH A;  2D4W A;  3EY1 A;  3NF8 A;  3RR7 A;  4W5T A;  4KTQ A;  1VSL A;  3OS2 A;  4B9S A;  3VGK A;  1U6Z A;  2G8U A;  2I5J A;  2X6S A;  1REV A;  3M3Z A;  3BUZ B;  4BR9 A;  4EIA A;  4DQS A;  2P9P A;  5DK5 A;  3HPO A;  3KK2 A;  1WSI A;  3GL1 A;  4DR7 K;  4AHR A;  4CZI A;  5D3G A;  4IDH A;  1WSH A;  3TR8 A;  3CCU N;  3H1V X;  3THW A;  2NRR A;  2OYQ A;  1BI4 B;  2HHW A;  4OPJ A;  2DPN A;  1G99 A;  1KXP A;  3BF1 A;  4M3W A;  4ELV A;  3AVK A;  4H5N A;  2E2Q A;  4E89 A;  5F0X A;  1Q9X A;  4B3S K;  4FW2 A;  3TSP A;  2ITG A;  3VEW A;  4CEB A;  4ZHR A;  3VMF B;  5AQK A;  4BE1 A;  3AVH A;  4GVM A;  3ZET A;  3SV3 A;  1J53 A;  1P90 A;  3WEE A;  3VER A;  3THY B;  1IH7 A;  4CJL A;  3MCA B;  3T1Y K;  2PYJ A;  2YNH A;  3SZ2 A;  3ZSZ A;  5KQD A;  2J4R A;  2Z1H A;  3RSE A;  3MN6 A;  3ITH A;  3K9J A;  1UWB A;  1TGO A;  1RBR A;  3PSI A;  3OTO K;  4B1W B;  1GLB G;  2HNZ A;  3DMJ A;  4JNE A;  2Q97 A;  5M1N A;  4FJN A;  1Q9Y A;  1Z25 A;  4FK2 A;  2QXF A;  3VES A;  4G1Q A;  2QWN A;  4YHH K;  3J81 O;  3CC4 N;  1GLF O;  4LY7 A;  1NOY A;  1NGE A;  2Y1I A;  3SQ1 A;  3VQD A;  1KTQ A;  2HBJ A;  4CHN A;  1W0H A;  4CHY A;  3HVT A;  4RW6 A;  1VHX A;  4M41 A;  5JS1 A;  4H8K A;  1V4S A;  3CQY A;  1IKX A;  2VGM A;  5C12 A;  3AV9 A;  2UXC K;  3PIO L;  3KIO A;  1SKS A;  1D5A A;  3O9T A;  4CJT A;  3CF5 L;  3WXL A;  5BPM A;  4WF9 L;  5BN8 A;  4FJ9 A;  3P38 A;  1W9H A;  4EZ9 A;  3TAN A;  4B8C A;  2O8E A;  1NM1 A;  4R79 A;  2ZM6 K;  3SBT A;  4YOT A;  1JCE A;  4NXN K;  1Q86 O;  1LWF A;  4EFH A;  5I3U A;  3QML A;  1HYZ A;  3RMC A;  3ZT1 A;  3H3N O;  2YCH A;  1X3M A;  2G8V A;  2YNG A;  2A1S A;  4CVN E;  3THV A;  3O5B A;  1HR0 K;  1OVY A;  4JI6 K;  1ASV A;  2QTD A;  2IAJ A;  3G25 A;  4A59 A;  4JHD B;  3BP8 A;  4IO8 A;  5TKY A;  3RRG A;  3L2W A;  3P39 A;  4IXC A;  1VQK N;  1ESV A;  4DTN A;  4IFV A;  5H1S Q;  4DS5 A;  4EHU A;  3EKU A;  1WAF A;  1O13 A;  1BCO A;  3AVM A;  3EE8 A;  5AQJ A;  4OLB A;  2KTQ A;  3IRX A;  1KFD A;  1BDG A;  2P9U B;  1H1V A;  4B9U A;  5A2Q O;  3KK7 A;  4IJA A;  3CFP A;  1HX1 A;  4KHP K;  3ZT0 A;  1U45 A;  4OKJ A;  1X9S A;  1ZBU A;  2QKB A;  4NYN A;  4DR4 K;  3FZF A;  1U2V B;  3MWP A;  3CCQ N;  3V81 A;  4E1J A;  3THX A;  4JYA K;  4BQZ A;  3VQE A;  1QVG M;  3QEI A;  2WUS A;  5AQN A;  5FPM A;  1VQ4 N;  1HKB A;  4FJK A;  3LDO A;  1QVF M;  3EN9 A;  3TTF A;  2ASO A;  3LDQ A;  4YOU A;  5LMN K;  4MLH A;  3OHR A;  1ZBI A;  1ATR A;  4M63 C;  1BQN A;  1JLE A;  3AVA A;  3A0I X;  3V4I A;  3J7A P;  1IV0 A;  3HTV A;  1QQO A;  5FLX O;  1S1X A;  4E0D A;  4CZK A;  4JI2 K;  4B8A B;  3D45 A;  5GAG P;  3WXJ A;  1GLJ O;  4DTU A;  1P8Z A;  1BI4 A;  1OH5 A;  1CZ9 A;  4LC9 B;  2XY8 A;  2O4G A;  4GKK K;  4KRF A;  3FZL A;  4WQ4 A;  3D2F B;  4JKG B;  2EWS A;  4BVO A;  4CEO A;  3CFR A;  2Q31 A;  2P9K B;  1NGF A;  3NHG A;  3T1H K;  4A5A A;  2E6L A;  1NKB A;  3GG4 A;  3VA0 A;  2YJF A;  2HF3 A;  4KB0 A;  3F5T A;  1BUP A;  1RBT A;  4CFC A;  4CGJ A;  3THY A;  4DKW A;  2OZS A;  3WQU A;  3OYG A;  4JK9 A;  1JLQ A;  4EHT A;  1C6V A;  2O4I A;  3N4P A;  2O8F B;  3RVC A;  3EO3 A;  4F2S A;  1RT6 A;  1YUW A;  1D9D A;  3LAN A;  1RGI A;  2GEL A;  3VQ6 A;  3ZT2 A;  4CJV A;  4B9L A;  1A5V A;  4H5R A;  2KQ2 A;  1C0M A;  4BAC A;  3AAQ A;  4H0P A;  2P9S B;  4BVP A;  1NJX A;  3AO1 A;  4DTJ A;  1VQN N;  1E4F T;  2BE2 A;  4FOE A;  4KTW A;  2KW4 A;  2OAN A;  3CQ8 A;  3QEW A;  2F9W A;  1S22 A;  4J2E A;  2QA4 N;  3DLG A;  3ZT4 A;  1LW0 A;  1VQ5 N;  3DLH A;  4JI3 K;  4C8O A;  2BTF A;  3ASM A;  3D7E O;  1KC8 O;  2OPS A;  4PKG A;  4EP4 A;  3VQ8 A;  1S72 N;  3ZCM A;  1VQ6 N;  2E20 A;  1MA9 B;  1UAX A;  2E1Z A;  1TKD A;  2D5R A;  4CHP A;  4TSX A;  3IAY A;  3QNN A;  5J2M A;  4QCL A;  4CK2 A;  4J8F A;  3MXI A;  4PKH A;  1LW2 A;  1U48 A;  4RW9 A;  4DU4 A;  5AQL A;  4JHD A;  3AY9 A;  3ZX2 A;  4CW7 B;  4RW8 A;  2D0P A;  3HPH A;  1Y64 A;  1NU0 A;  1Q8I A;  1YTU A;  4CJW A;  4YOV A;  3W3D A;  4BRD A;  1QQN A;  5AQI A;  3VF2 A;  1ASW A;  3CJA A;  4BRH A;  5CY4 A;  2P5G A;  4RWT A;  3OYM A;  2KKZ A;  3TTC A;  3E9P A;  3MX2 A;  5M1P A;  2E88 A;  5BPN A;  5AFU H;  2IVN A;  2P9U A;  2F9T A;  3RR8 A;  1RIL A;  4CF2 A;  1BG3 A;  2HHH K;  4FXD A;  1B9F A;  4KPY A;  4E7I A;  3QIN A;  4DQR A;  1I3A A;  2D0B A;  3OYN A;  3MK6 A;  2A1R A;  2E5L K;  2YHX A;  3FFK B;  4YFU A;  1U2V A;  1VQM N;  3G0Z A;  2O8D A;  2QI2 A;  3LM9 A;  3AO3 A;  2DFF A;  1TKT A;  3L2U A;  4AH9 A;  4I9Q A;  1ZC6 A;  4GNI A;  1C1B A;  5M1Q A;  1QQM A;  1LWC A;  2GBZ A;  3CMA N;  4HHT A;  4B1V A;  2V51 B;  1QSY A;  4BRI A;  4BR2 A;  2E6M A;  3KD1 E;  3SYZ A;  3WXI A;  2YKN A;  2I7P A;  3MEG A;  1FK9 A;  5FPE A;  1HKG A;  1GLD G;  4ISF A;  2ZE2 A;  1BWF O;  1BIU A;  5FPN A;  3FGU A;  1IO2 A;  3NF9 A;  1K8K A;  2EHG A;  2LSN A;  3QFP A;  2VYP A;  5FRO A;  4GV3 A;  3C6U A;  3D2F A;  4CE9 A;  4O8K A;  1WNS A;  5DM7 L;  4C8L A;  2AJQ A;  4B1X B;  2OTJ N;  3E01 A;  5AQM A;  3C94 A;  2P9K A;  1M90 O;  1N5Y A;  4CCH A;  4DWI A;  3VQ5 A;  2HHT A;  1HNI A;  3DWL A;  3D2E B;  4EP5 A;  2NUB A;  1RTH A;  1C0F A;  2FBV A;  1BO5 O;  4DV4 K;  2IVP A;  4YDU C;  2BH1 A;  3K2P A;  2O8F A;  3AA2 A;  2CGK A;  4A2A A;  2HHQ A;  3O8M A;  1CXQ A;  3CJ1 A;  4ILJ A;  1K8A O;  1NMD A;  3KZB A;  2A42 A;  2P9L B;  4CJ4 A;  1D8Y A;  4M3Z A;  3TAE A;  3VTI A;  3VET A;  1J54 A;  1OKJ A;  3CIP A;  5JVH L;  5SZT A;  2P9S A;  4BR5 A;  1KLN A;  3VEZ A;  4N47 A;  1VSF A;  2P5O A;  5AQT A;  3O9R A;  5F2R A;  2JGU A;  4BWJ A;  3OS1 A;  3V9Z A;  5K14 A;  5I42 A;  1RT4 A; 
#chains in the Genus database with same CATH homology
 4LFB K;  2UXD K;  4JV5 K;  2VQE K;  1J5E K;  4DR1 K;  1N34 K;  1XMQ K;  3T1Y K;  5A2Q O;  4DV2 K;  4DV3 K;  4LF4 K;  4KHP K;  4JI0 K;  1IBK K;  4GKJ K;  4JI5 K;  5BR8 K;  1N36 K;  2VQF K;  4DR4 K;  1I94 K;  4JI3 K;  3OTO K;  4V19 S;  2UU9 K;  4JYA K;  1HNZ K;  4OX9 K;  4DR6 K;  4DV5 K;  1HNX K;  4YHH K;  3J81 O;  4JI1 K;  4NXM K;  4LF7 K;  5LMN K;  4DUY K;  4X64 K;  4AQY K;  4X66 K;  4B3M K;  4B3T K;  1XNR K;  4DR3 K;  5LMU K;  4LFA K;  1HNW K;  4DR5 K;  4YY3 K;  4X65 K;  1N33 K;  4X62 K;  4LF6 K;  3J80 O;  1IBM K;  3J7A P;  1N32 K;  5FLX O;  4DV7 K;  4JI8 K;  4JI2 K;  5LL6 Z;  2UUA K;  4LFC K;  4DV4 K;  2UXC K;  2UXB K;  2UUB K;  1IBL K;  4CW7 B;  4DV1 K;  5AJ3 K;  4GKK K;  4LF8 K;  5IT9 O;  2F4V K;  4B3R K;  2UUC K;  2ZM6 K;  4DV6 K;  3T1H K;  4NXN K;  4DR7 K;  1XMO K;  1FJG K;  4DR2 K;  4CVN E;  5IWA K;  1XNQ K;  1HR0 K;  4JI7 K;  4JI6 K;  2HHH K;  4DV0 K;  4K0K K;  4JI4 K;  3J7Y P;  3JAM O;  4B3S K;  4LF5 K;  4LF9 K;  2E5L K;  4DUZ K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...