4DV1K

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g, bound with streptomycin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
116
structure length
116
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 27
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4dv1K00
2VQFK 3J81O 4CW7B 1XNQK 4DUYK 4X62K 4NXMK 1XMOK 1N32K 4B3MK 4YHHK 4JI4K 3OTOK 4DV6K 1N33K 4JI8K 4LF8K 4JI6K 4B3TK 1XNRK 5LMUK 2UXBK 2UUBK 1N34K 3J7AP 4LFBK 4V19S 3JAMO 3T1HK 1N36K 2E5LK 1IBLK 4DV1K 4GKKK 1FJGK 4DR7K 4B3RK 4DV2K 4JI7K 4DV4K 4K0KK 2F4VK 2HHHK 5LL6Z 4DR3K 5IT9O 4CVNE 4JV5K 4DV0K 1HNXK 4X65K 4LF7K 4OX9K 4DR5K 2UXDK 4LF4K 4DR1K 4NXNK 4B3SK 2UXCK 4DV5K 4LF9K 4DR2K 2UUAK 1HNWK 5IWAK 2UU9K 4KHPK 4AQYK 1HNZK 4DV3K 4LF6K 4DUZK 4X66K 4JI2K 2ZM6K 4JYAK 1XMQK 2UUCK 4JI0K 1HR0K 4LFCK 4DV7K 4JI5K 4JI1K 1I94K 4LFAK 5FLXO 4X64K 4DR6K 5AJ3K 3J7YP 3T1YK 4DR4K 1J5EK 1IBMK 1IBKK 2VQEK 4LF5K 5A2QO 4YY3K 4GKJK 5LMNK 4JI3K 3J80O 5BR8K
chains in the Genus database with same CATH superfamily
1GLDG 5AZJB 2IVPA 3DRRA 1HQEA 4IO8A 4H5NA 3DOKA 1N32K 3HL8A 4JI4K 5KPTA 4BR5A 3UKUB 3O9RA 2G8KA 3OYIA 4LF8K 4B8AB 2QWOA 3JXUA 4YOUA 4R5PA 3WXJA 5FPNA 3SI6A 1W9HA 2ASMA 4FSVA 3S3NA 1SKSA 3F9MA 4V19S 2FBTA 1K8KA 4BGBA 2OTLN 1FJGK 4F3OA 2F8SA 3NE6A 3QEWA 2VWJA 3DI6A 4DU3A 4AM6A 1BGXT 3BGRA 4KI6A 4RW7A 3C7NB 3NF9A 5AQQA 3KJVA 4M3TA 3MXJA 4CGHA 2IVNA 3N4PA 3AARA 4J2AA 4I6MA 3NBPA 3RRGA 3CETA 3C6TA 4HUEA 4DFPA 1NGAA 3ISNC 4ISGA 3KKSA 3G4SN 3WQUA 4JKDA 1WSFA 2DPNA 4GY2B 1C0GA 4KTWA 1D5AA 4RWTA 5AQJA 3CG7A 1L3SA 4CBXA 1X9WA 1L5UA 1HJOA 4FJIA 1R0AA 3CCVN 1I94K 4CZIA 4MLEA 4EZ6A 3MDQA 3J7ZO 3SJJA 3DYAA 3IKMA 4B3OA 1T6DA 1YJ9N 1VSKA 3NF7A 3MCAB 4CBWA 3WNEA 4I2QA 1RTJA 3GG4A 1IBMK 2OANA 4CZJA 1DTQA 3ZSWA 2GV9A 2E1ZA 4FM1A 3D6RA 5EVZA 2GWJA 3U3GA 5GAGP 4FJLA 3LM9A 3U8XA 4CFDA 3ATVA 4YOXA 1T6CA 3FZFA 1X1PA 4RTFD 3CMAN 3ZSZA 1CXUA 4KI4A 3MN5A 2FBXA 2KKZA 3VQ9A 1VQ6N 1NGDA 4FLZA 3KLFA 4E1NA 5EOYA 1UWBA 2GWKA 3E9OA 4CBUA 2YCHA 3RRHA 1J53A 3ZSXA 3EN9A 1Q86O 3QIOA 2X6SA 1U45A 3CFPA 4RCHA 4XH1A 4CD1A 2YHYA 1TKXA 1IJJA 1LWEA 1RDWX 2HF4A 3T1HK 4LSLA 1UA1A 3SMSA 2RHKA 1GLCG 3SYZA 3OBYA 4CGDA 2F4VK 2HHHK 4M42A 1WSGA 2QWRA 2FXUA 3KZBA 5KPZA 3LM2A 1OVQA 1FW6A 1HQUA 1BA0A 1MDUB 4KHWA 2VYPA 3O08A 3TARA 3CMEN 1DGKN 5FDLA 4BQZA 2HHVA 4CZGA 3LANA 4OX9K 3K5LA 2HHUA 4JKFA 3KLIA 2QWNA 1DTTA 3V81A 4FJKA 4TSXA 1B9FA 5K14A 5AZIA 2VWBA 3AO1A 5MLCQ 4DSJA 2YNGA 3CFOA 3SUOA 3WUHA 2P9PA 4RW4A 4R79A 4KHPK 1HNZK 1VQMN 1JL2A 1XC9A 1NOYA 3L2WA 1Z05A 3O80A 4ELTA 2YI1A 3KK7A 4DSFA 3E01A 2GEMA 4LFCK 1GLFO 1L3VA 3VGLA 3FR0A 3HPOA 3MCPA 4H5VA 3QEIA 1DLOA 1WSIA 4CEQA 4KREA 1DEJA 3NHGA 3VETA 4PL7A 4H0YB 2NZTA 5C2FA 1XUPO 3BP8A 3VGMA 4OPHA 4YY3K 1YITN 5AQOA 1VSJA 4FYDA 5KQ8A 3O5BA 3PX6A 3DLGA 1BI4B 3QEVA 2O8CA 1S1XA 4PY5A 5F1XA 3KIOA 3ENBA 5KPRA 2WFBA 5TKYA 1KAZA 4WQ5A 3V6DA 2BTFA 4A59A 3THWB 3HPGA 3VPZA 3P83D 4DTJA 1XQSC 3M8QA 3L2RA 1RTHA 2WONA 2OYQA 2P9KB 3MN7A 1T8EA 4BG9A 4GKKK 3R8EA 4DV1K 5BRHA 4BC2A 4DV4K 1Q82O 4M3ZA 1U04A 2QXLA 3CJCA 4KRFA 3H6EA 3SK3A 3RMBA 2G8IA 4CZMA 4NO7A 4F8RA 1C1CA 3A5OC 4H5TA 3WEEA 2KQ2A 3K9JA 3VEXA 4OJRA 1S5JA 1QQOA 4KH4A 4B8CA 4CEZA 3EYZA 4CGJA 3WXIA 4WFBL 1NKEA 1XC3A 1S1UA 4EP5A 4CEOA 3FFIA 3CYMA 1JLBA 3AAPA 1RTDA 5LJVA 4CHOA 5E26A 3ID6A 3C6HA 1RT1A 1UAXA 1SV5A 4NCGA 3AO2A 2P9NA 4FM2A 1NK5A 1VQKN 3WT0A 1Q7YO 1M90O 4HCBA 3O6WA 3SCXA 3DAWA 3I8DA 3RMCA 4WF9L 4O0IA 3HP6A 1JLCA 3LWLA 3AVFA 2W40A 3U3YA 3QICA 1VAZA 1VSMA 5AJ3K 2E8AA 3QETA 1GLAG 1HUXA 4IFEA 3TSQA 4YFUA 3AV9A 1IBKK 3JS6A 1W0HA 4E89A 5DM6L 1KAYA 2O8FB 2XY6A 2OPSA 5JMVA 2ZJRL 4MDBA 1BUPA 1N8RO 4BC5A 3BZKA 4A5AA 3MEDA 2IS3A 2X74A 3DXMA 4LC9B 3I0RA 5AR0A 5KI6A 4C1NK 4IWVA 2Z1JA 4I9LA 3TPQA 3KD5E 2DY4A 3RWUA 5T7BA 4E7LA 2IGIA 4FJJA 3O3GA 3NMUA 3GE1A 2HB5A 4JK7A 5AQFA 1NWKA 1KTQA 1K9MO 4DQIA 5EX5A 1YI2N 2UUBK 1RDAA 5C24A 3P5JA 1BIZA 4CGFA 4Z4IA 1UA0A 1SS6A 5KGWA 1NLVA 3L8BA 3ZETB 4BRPA 2QWPA 5AQVA 1K6YA 4FJ9A 2AJQA 1D4XA 3TTFA 4J2BA 4F2RA 3KLHA 1TK0A 2Q2RA 1JCFA 3CHWA 4FXDA 2D1KA 1J6ZA 2OPPA 3T7ZA 4BRGA 4CZLA 3MXMA 4CHYA 5FRMA 4X65K 1WBBA 5GADP 4LF7K 2ZE2A 4DR1K 3OYCA 2E20A 3AVCA 3S41A 4FLVA 3OVNA 2QEXN 4CJRA 3D2EB 3SMPA 1HKCA 4QAGA 4CEAA 1N5YA 3UB5A 2XO7A 2B6AA 4A2AA 3OJUA 4I7FA 1YVUA 1NGIA 4IJNA 2XRIA 4AQYK 3VMFB 1NGEA 3I56N 4AHVA 2HNDA 3TI0A 4PHTX 4LH4A 2UYTA 3TAPA 4FJHA 2XY7A 2P9IA 5FROA 2LSNA 2WTUA 3WXLA 3CXCM 4FLUA 1VSHA 4JEPA 2FBYA 3L4IA 2QKKA 4LH5A 2D5RA 4DQPA 4E19A 3VTIA 3HK2A 1T03A 5DM7L 4BE0A 3NGZA 2ATQA 4BDYA 3R9PA 2WBNA 2FSJA 4EHUA 2OA8A 4GKJK 3VQDA 4AF1A 4AHSA 1A5VA 1NMNA 1KD1O 2HBLA 3CJ9A 3NFAA 3DLBA 4JK8A 2QWMA 1U2VB 2PYJA 4DTPA 1KCFA 3R3LA 2GELA 3JYTA 4MDAA 4OPJA 5JS1A 4CZEA 1WAJA 5I42A 4M7YA 2P9LB 4KHNA 4IDKA 1Z6RA 3KKRA 4OLBA 2P5GA 4H0OA 4BE2A 2HW3A 3HXMA 3O4WA 4ILHA 4BQLA 4BC3A 1NG9A 2P9PB 3K5MA 4FM0A 1U47A 4O44A 1MA9B 4CJ3A 2KFNA 4KHUA 4CFCA 4JV5K 1MWKA 4B1XB 2KZMA 4BGAA 1RDUA 3ZT2A 4WE1A 4KB0A 1Q8IA 1BO5O 3LL3A 1EQYA 1XWLA 4LF9K 4B1ZA 3MN6A 5HRRA 4DFKA 1J5OA 3C94A 3DRPA 3DRSA 1RCHA 3HZ6A 3FGUA 4GW6A 1OH8A 3OYGA 2NRHA 3CM6A 5J1EA 2NUBA 3OA9A 4BRFA 3AA4A 4FW1A 5AFUA 4KKOA 3QNOA 2QK9A 4FJ5A 3CCUN 4BWJA 3QMLA 3TAQA 3HPHA 5AQYA 4CJ7A 5B8HA 3D2FA 5CY4A 2A40A 1SQKA 1C1BA 4PA1A 1QSLA 4M63C 4EHTA 3O9TA 3ID8A 3SQ1A 2WOMA 4JD2A 2BGGA 4C1NI 5GIPA 4OGEA 4DR4K 5AQSA 4F3TA 3LPUA 3P1GA 2ASPA 1NGCA 3HSTB 1QHAA 4BVOA 3OYNA 2IVOA 3QBXA 4DMNA 1D8YA 4K41A 4H4OA 5CYQA 3OS2A 3ZLJA 3KLEA 4FJ8A 2NRRA 1IKXA 4YDUC 1JL1A 2ZF5O 2YNFA 4FJGA 1Y64A 1G99A 1VQ7N 1HMVA 4PKGA 1QVGM 1ZBSA 3BF3A 1LV5A 2GBZA 1IKVA 3MECA 3SAHA 3V9XA 1WAFA 4F2SA 4BVPA 1BIUA 2PBDA 3NGYA 2H3GX 1NK7A 3BZCA 4PKIA 1EETA 3VQAA 1F21A 3DXKB 4FWNA 4C8NA 1TL1A 2GUIA 4FWPA 3ZYYX 2F7TA 3JAMO 5E41A 3SQ0A 3G25A 5HRSA 4KV8A 4JI7K 2X6NA 2YNHA 1SL1A 5AQIA 1Q81O 1BQMA 5AQXA 1BISA 5IT9O 1BG3A 4O0JA 5AQUA 1WOQA 5AZJA 2D0CA 3DLEA 1ZXOA 2CH6A 3P31A 2UXDK 1FKOA 1YT3A 4CJFA 3EE9A 1ASWA 3THXB 5AQZA 3HOTA 5C12A 1HLUA 1KXPA 4EP4A 4C8LA 3N4QA 4LY7A 3PV8A 3ASMA 1S72N 1LCUA 3CC7N 2XHBA 1SZ2A 3VQEA 1S6PA 3TU5A 1VQ4N 1VRUA 3AVBA 3WXMB 2FSKA 3WNGA 3LDPA 3D7EO 1B9DA 1QQCA 3S3OA 4DV7K 3K58A 4JI1K 3C6UA 5M1NA 3HT3A 4CIGA 1GOBA 5GIOA 3M8RA 2OZSA 3DLLL 5BN8A 1RT2A 1YJNN 2NRVA 2ZJQL 3ITHA 2Q0UA 4BG8A 2J4RA 2FF3B 1NK8A 2V51B 1TK5A 1NGGA 3SUPA 4FLXA 4QOZB 3VF6A 1HNVA 2E2OA 4CJVA 1GLJO 3G0ZA 4JKGA 5JLHA 4CW7B 1XNQK 1EX4A 1XMOK 4DB3A 2R7YA 2Y1JA 1RNHA 2BUPA 3WQTA 1RT6A 4JS5A 4BRAA 3H08A 3NCIA 1N33K 2F96A 1YIJN 4GVMA 4BR9A 4JNEA 4MO4A 2QTDA 3O9SA 1N34K 4DHYA 4BRIA 1CLQA 3M1FA 2RE2A 1RBSA 4B3RK 1XHZA 2A3ZA 1S1TA 3IUCA 3C65A 4CJSA 3OY9A 1M1KO 1WSHA 2Q36A 4ELVA 1RBVA 4GV6A 1T3VA 2O4GA 3EO3A 2Y1IA 3EZWA 3SPYA 2F9TA 3VQ6A 1EWQA 2P9NB 5AQHA 3CFRA 1XI1A 1RBUA 2I7NA 1E4FT 2ZJPL 4FLTA 1VQ9N 2ZWHA 4J2DA 1J9AA 3QEXA 4DR2K 1KQSM 4CCHA 2PYLA 4OKJA 3O4NA 2FLOA 1I39A 3M6GA 4CHPA 1TUUA 3A5NC 2PZSA 1E3MA 5AQNA 3OYMA 4H0TB 3E1YA 5KQDA 3Q7BA 2ZM6K 4JYAK 1S1VA 2UUCK 3CCSN 1JLAA 2NRZA 4FPAA 1VHXA 1RT4A 3T1AA 4KTQA 1DT9A 1KFDA 4FWOA 2FBVA 3OYLA 4M45A 2VG6A 1JKHA 4IEEA 3H3OB 3LAMA 1KFSA 3PO5A 1K73O 3OBWA 4QCLA 4CZHA 4Q5VA 2CGJA 4E7HA 1FXXA 1QZ6A 3TTCA 2JWLA 3I0SA 1VSFA 1YUWA 1VQPN 4KH6A 5BREA 3H1VX 4IFYA 5LJWA 3HTVA 2PAVA 3RSEA 3HM8A 5AQGA 4ISEA 3UKUA 2VQFK 4E7JA 5KRTA 4ID1A 5C2DA 4KHYA 3VENA 5JVHL 4JKAA 3AVNA 3ZSRA 1BOTO 2XY5A 3CCJN 1H1VA 4BWMA 3VOVA 4J2EA 1NMDA 2IC3A 3VEOA 5J2PA 4OLAA 4B9TA 4CESA 3K0SA 4BROA 4DSIA 3DM2A 3DOLA 4W5OA 1D9DA 4YOYA 3MXIA 1S6QA 3FE1A 4CJEA 2O8EA 4CJ5A 4CK2A 3M8SA 3V1RA 3PSIA 4NLCA 5E84A 1S3XA 4HHTA 4DSLA 2WC9A 4JRPA 1NNEA 1A5WA 5AQTA 4NYNA 4GV9A 1WLJA 3EZ5A 3ZSVA 1G15A 1ZBUA 2QXFA 3V9SA 3QB0A 4DQRA 2E6MA 5HRNA 5HROA 3LP3A 2W6KA 4Y0WA 4FCYA 4ISFA 1NJIO 2KHOA 1LW0A 4ELUA 4O5BA 1RT7A 1RT3A 3HO1A 3MEGA 4DQQA 3ENHA 2V7ZA 3NF6A 1IG8A 1BHLA 2W41A 1O1WA 2XY8A 4DTXA 4C8KA 4FWSA 4E1JA 3TANA 5BPLA 3L4QA 4FK2A 3ZSOA 4DV3K 1QQMA 5CHIA 2KLAA 2ZD1A 1XMQK 4M3XA 3WEEB 1C0MA 1BCOA 1YXQA 4JKEA 2BANA 2HHWA 2E4LA 2QWLA 2EX3A 4A5BA 4N5SA 3HJFA 4FJXA 1JXBA 2PFUA 3ENOA 3T1YK 4KAZA 3JSMA 2CGKA 5ADXH 3W0LA 3MX5A 2P9UB 4C8MA 4CJUA 4AHUA 2NRTA 2QI2A 4DQSA 1WUAA 1SAZA 4B1YB 4CFAA 5BR8K 2AP1A 4FWQA 4Y1CA 2VGMA 3VN5A 3V4IA 5TKWA 4FZXC 2KW4A 1A5XA 1NOZA 1BDGA 4ILJA 1NU0A 4PKHA 2GTDA 5EY4A 3IDHA 2GUPA 2P9LA 1N6QA 1ASUA 5CR4A 3F73A 3TR8A 1GLBG 4G1QA 2P5OA 4CE9A 1BU6O 5LMUK 3THXA 1RILA 3P38A 4UQGA 4E7KA 1U2VA 2A42A 4BRQA 4XH5A 3VQ7A 4Z4GA 1JLFA 4DTNA 3PY8A 4AH9A 2VGNA 4DR7K 4FWRA 4BDPA 3H1QA 1RDDA 4FK0A 2QKBA 3KHYA 3NVMA 1IKWA 3SLCA 1IG9A 3QLHA 4CVNE 2D4WA 3ZT0A 4N47A 2HHSA 3B8AX 4JRQA 2IDOA 5SZTA 2Z1GA 4DV0K 3QERA 2G8UA 3SUNA 3VQ5A 4W5QA 3QEPA 1HPMA 2YHBA 3NGIA 4NXNK 4CEFA 1RDBA 4XH4A 1TKZA 1L3UA 4FOIA 4IOAL 4Z4HA 4N56A 1REVA 1GOAA 1C0TA 2O8FA 3VF4A 4EFHA 3CC4N 4YOWA 1EKEA 1EP4A 3AA2A 2E6LA 3LDNA 3KWGA 3THVA 4BRDA 4OVLA 1HJRA 3DXMB 3U4LA 3SBTA 3L2QA 1W7AA 2OTJN 4DLEA 3QNNA 4Z94A 3CD6N 3EL2A 4ZTJA 5C15A 1HPZA 5AFUH 4NB4A 2P51A 1ATSA 5AQPA 3AVHA 1NJZA 4UY8O 3L3VA 3VF2A 3VA0A 4AHTA 3AO5A 3LZJA 1WNSA 2JGUA 3CPEA 4H0PA 3O3FA 1GLLO 1S22A 3VQCA 4CJPA 3NAEA 5KRSA 1KVBA 3CERA 3SV3A 1OH6A 2G8WA 2BH1A 4L8RB 4NYFA 1WBDA 3FZLA 3RMDA 4EZ9A 3GOIA 3OTOK 1RGIA 1W97L 3OS1A 4H0VB 4Z0UA 4DFMA 3L2UA 1LAWA 4CI6A 2O8CB 3QDKA 1JXEA 5EXWA 4BRCA 4HUGA 4CJWA 4E0DA 1XNRK 3O1BA 3FLCO 3CI5A 3QO9A 5BRDA 5D3GA 4MO5A 5LY3A 1IBLK 2EWSA 4WQ4A 4YOVA 2I7PA 5EU7A 4BR2A 4DR3K 3PIPL 2NRWA 1TV6A 2OCEA 1OH7A 3O1WA 2E2NA 4CF1A 3SBGA 3FZMA 3DWLA 4LF4K 3P4IA 1VSLA 4CGGA 3M8PA 2DFFA 4ID5A 3SZ2A 2O8DA 3HOSA 3EEQA 4CJ4A 2QWQA 1VQ5N 5C25A 4B1WB 4OO1J 1HKGA 4I6MB 4KO0A 5I9EB 1ATRA 2F8TA 3SJHA 4KPYA 1TK8A 3O9QA 1BQNA 1ZYQA 4A2BA 2W6LA 5BPNA 3AVKA 3CJBA 4IOXA 2QA4N 3THWA 4IXCA 4IO9L 5CZ2A 3R6MA 3TSPA 1DKGD 3MK6A 4DR6K 3AY9A 1E4GT 3J7YP 2A1RA 3QIPA 3VEWA 1BA1A 3AO3A 2V52B 3T3FA 1JLGA 3DJCA 3CCRN 3CJ7A 2VQEK 3T19A 1NKBA 2HHTA 5FRNA 1KLNA 5A2QO 4BR0A 4QS8A 4JKGB 1FK9A 1TL3A 5LMNK 2E88A 5JLFA 5DK5A 3J80O 4HCCA 1ILYA 4OGCA 4CHZA 1S9EA 1C0FA 4KFBA 1RT5A 1C1AA 4M3WA 1U6ZA 3AVIA 3O9UA 5AQRA 1NGJA 3KWIA 2G8VA 2NLXA 2ZQBA 3IG1A 4JI6K 3SUQA 1QSYA 4PL8A 3PUFA 3C0BA 1NK6A 1RFQA 3NH2A 4JLHA 3ULEA 1QE1A 4HTLA 4A57A 1TKDA 3J7AP 4LFBK 4CF0A 4FJMA 1S1WA 1FKPA 4HUFA 2E5LK 2DTUA 1C6VA 4PQUA 4DTSA 1EXQA 4NCAA 2YHXA 2O8DB 1MWMA 1KVCA 2O8BA 4JKHA 3P39A 4MFBA 3D2FB 3F9KA 4FW2A 4BRNA 3GBTA 1CZAN 4O4GA 3TAMA 3ZETA 2BDPA 1EO1A 2YV0X 4H5RA 5HRPA 3K57A 1V4SA 1VK0A 3ZSQA 1KAXA 4EAHD 5KGXA 1HNWK 3V9ZA 3R1XA 4WFNL 1TAQA 1RBRA 2G8HA 1B92A 4GVEA 1RDCA 3OW2M 1L3TA 4DS4A 4B9NA 3LAKA 3CCLN 1SL0A 4BR4A 4JI0K 1QHTA 4FL9A 4M3YA 3PX4A 2Q0RA 2P9SA 3T69A 2D0BA 2IIRA 3KVGA 3ATUA 4WYBA 3OYFA 3RSEB 4BR7A 3L2VA 4FJ7A 4NLBA 3IS9A 1TAUA 2HOEA 3K59A 3PSFA 1RTIA 4BE1A 3VQ4A 3F2KA 3VQPA 1CZ9A 1IKYA 3UKRB 4QS9A 3G6EN 4B9LA 4IG3A 4JHDA 4O8UA 3SAFA 3TAEA 4CHQA 4O55A 3HSCA 4ICLA 2OPQA 3LALA 2A6AA 4ILGB 4FK4A 3SAGA 3H45C 3CC2N 1VQNN 5JS2A 2UXBK 3LPTA 4FZYA 2BE2A 2X78A 3IMXA 5H1SQ 4B9SA 2D0PA 4DV2K 5HP1A 1VSEA 2NNWA 1KRPA 4K25A 5HL7L 4FZZA 4DFJA 4H03B 1YTUA 3UIQA 4CJKA 5FPEA 4BY9C 5M1KA 1LWCA 3RR7A 4ZTFA 4YDUA 2HVIA 5SWMA 4JHDB 4MLHA 4DR5K 2D0AA 4JK9A 4DKWA 3AVAA 2A41A 3KK2A 1TGOA 3A5MC 3CQXA 4RW8A 4DTMA 4L3QA 3BY5A 2UUAK 1VQ8N 3AAQA 3CJAA 3A0IX 2CH5A 2A5XA 2P9SB 4FWLA 4CIEA 3B6OA 5DMRA 4FVUA 4ZHRA 4YNQA 4WQ4C 4HTUA 3H3NO 3PLAA 4CIFA 5HBMA 4B1UB 3QESA 3AVLA 3MN9A 1JCGA 5M1QA 3ZSYA 5ELZA 1KLMA 3O3HA 2I5JA 4CZKA 4LFAK 2GX9A 3MWTA 4YOTA 4G9ZA 5M1FA 1TYQB 4K42A 1R59O 4W5NA 3S3MA 3FZHA 3AO4A 4CJTA 4Z4CA 1JLQA 4RW9A 1QZ5A 3K2PA 3O4QA 2YKMA 1NJWA 3SPZA 3QFPA 1NK0A 4BRHA 3IAYA 4Y1DA 3VQ8A 2E2QA 3U6FA 4Z4FA 3IRXA 1Z25A 4NCBA 4B3MK 3MEEA 1YVNA 4GMJB 4DV6K 3UKRA 2KFZA 3G71N 2FF6A 1P90A 4CJQA 3EKUA 1VRTA 4N41A 5FPMA 4HVJA 1ESVA 4KH5A 3KK3A 4I2PA 1ZBLA 3SV4A 4AHRA 4MQ3A 3WNFA 4B1VA 4HWIA 4H8KA 1Q9YA 5C42A 3CCMN 2O4IA 1X3NA 3AGKA 3EY1A 3EE8A 3D2EA 2YHWA 4CEEA 4W5TA 3NH1A 2NRXA 3OYDA 3OYEA 2OPRA 3LDOA 3WNHA 1K8KB 4CEDA 1HNXK 2HNZA 3AA5X 5HOOA 3C7NA 4B3SK 5KTQA 4CJLA 3MX2A 4K43A 3FFKB 1QTMA 3K5NA 1WN7A 4OPKA 1NBWA 3OS0A 2ETJA 2YHAA 3FZKA 1IH7A 4IDHA 4QS7A 2YJFA 3NH0A 2Q3SA 5F2RA 2IAJA 4JI2K 1ATNA 3HVTA 3I55N 2VG5A 4C23A 4CK3A 1TUYA 1W2BM 1NM1A 4JKBA 4BACA 2P9KA 4CFBA 5ADXA 3K9KA 3LDQA 4W5RA 3VEVA 1MU2A 3OYBA 3LDSA 4AILC 1IO2A 1VSIA 4M3RA 4BRLA 2YKNA 1ITGA 4JS4A 3V1OA 3LP0A 3RVCA 1ASVA 3UE5A 3LP1A 4CEBA 3PO4A 3LZIA 3ZEUA 4AHCA 4JKCA 2HVHA 4F9OA 1WSEA 4CERA 1Z26A 3MMVA 2V7YA 2E1YA 3TSUA 3BUZB 4M3UA 4XIUA 1NGFA 1NGHA 4FVMA 2OZMA 3L3UA 1T05A 4JI8K 3CCQN 1SKWA 3NVKA 3ZT1A 2HBKA 4DTOA 3VEZA 4DQ8A 2YJEA 3NF8A 2B4JA 1BWFO 4DF8A 5BRFA 3QINA 1NGBA 2B5JA 4U67L 4IBNA 4CF2A 4Q0BA 1U48A 4BRMA 1X9JA 2PY5A 3CJ1A 1OVYA 4WCEL 4LSNA 1TKTA 3KLGA 3ZX2A 3QBWA 2YNIA 4XEIA 3M5RA 3GDQA 1ZC6A 1OKJA 3L6QA 4FWMA 4RW6A 2W42A 2G8FA 3C95A 4FPBA 2ITMA 3F5TA 2ASOA 5GAHP 4DG1A 2RN2A 4AM7A 4WFAL 4KBOA 3HI0A 4IG0A 3V9WA 5AQWA 4PWDA 1HYSA 3AGRA 3ALYA 4LF6K 1ZBHA 4KHQA 4N76A 4BC4A 5M1OA 1X9MA 1OH5A 3VGKA 1HYZA 4JI5K 2IOCA 4CK1A 4F4KA 2EHGA 3CPWM 1ZBIA 3HYFA 3O8MA 5JICA 2HF3A 1J5EK 4BREA 5CE3A 1HYVA 3TAFA 1CZBA 1BI4A 4LF5K 4U7BA 1WB9A 2AA4A 3IFRA 1V4TA 3LP2A 4K8XA 3E66A 4IOCL 3K5OA 4OKKA 3W3DA 3OYHA 2Q1NA 4IZ9A 1KC8O 4DS5A 3RR8A 2RF2A 4DU4A 1Y97A 2VWKA 3AVJA 1LOTB 1HKBA 3DLRA 1JJ2M 2Z1IA 2HMPA 4YHHK 3ZT3A 3ZEUB 1C0UA 2A1SA 3VQQA 4H5WA 3OJSA 1I3AA 4CZFA 2HHQA 4H0XB 3I8BA 3HVRA 1YJWN 3OYAA 1J54A 5I3UA 4RG8A 2HHXA 4WQ5C 3E9PA 4GNIA 2ZGZA 4A61A 3DXKA 4IJAA 4B08A 1SKRA 2VCPA 1WSJA 3U9ZA 4B9QA 3C6AA 2Q31A 1X9SA 4FOEA 5BN9A 4M41A 1QVFM 5LL6Z 1YF5L 4CGIA 3U9DA 1S9GA 1QQNA 1HNIA 2DFHA 3TWHA 2KZZA 2O8EB 3D45A 4E1MA 2F9WA 1TYQA 5CZ1A 4A62A 3KD1E 4PUOA 4FWKA 1LW2A 2D0OA 1JCEA 2UXCK 3ZCMA 1SL2A 3ZT4A 4B9UA 4H4MA 3SQ4A 3AVMA 2JWKA 1EWRA 3DMJA 5IWAK 3EKSA 3CM5A 3V1QA 2Z1HA 1NKCA 3DLHA 3WXKA 4X66K 2ITGA 3CQYA 4JN4A 3A2FA 5HLFA 1YTAA 1KSPA 3KTQA 3S9HA 3LDLA 2E2PA 4OKEA 3AA3A 4DU1A 4B9VA 5JVGL 4B9MA 2HNYA 4LD0A 2P9UA 2WUSA 4KTZA 4CF9A 4K8ZA 1QS4A 4E3SA 1VQON 3E9LA 4O5FA 1NJXA 2HBMA 1GOCA 1O13A 1VQLN 3CIPA 3ULDA 5AZIB 1UOCA 1XHXA 3J8AA 2CGLA 3SQ2A 5BPMA 3CQ8A 4YORA 4FLWA 2QW9A 4DCHA 3TABA 3PIOL 3HP9A 2QM1A 4I9QA 3J81O 3QFUA 4GV3A 3KK1A 3OYJA 1U4BA 3L0QA 4NXMK 4X62K 4DUYK 2HMIA 5F0XA 5J2MA 5C0YA 4IFVA 1P8ZA 3VERA 4KHSA 2VG7A 4DSKA 4DLGA 1KVAA 5AQLA 3AVGA 3HBTA 3BF1A 3VEYA 3DLKA 4CD3A 3SNNA 4B3TK 3M3ZA 3CF5L 4CHNA 1CXQA 3RMAA 4FO0A 4OPAA 1NK4A 1N36K 3B6PA 1QSSA 4DWIA 2RPIA 3HRGA 3OYKA 4E7IA 3THYA 4KB1A 1LAVA 3D0PA 1BL3A 3H46O 2P1JA 4K0KK 3TTDA 3I33A 3TAGA 3OHRA 3VQBA 1BCMA 1TVRA 4CF8A 1U49A 5J2NA 3RTVA 4JD2B 1Q9XA 5J2QA 2FC0A 2FSNA 1HX1A 3PX0A 4EIAA 2YX6A 5GINA 3HM9A 1Q18A 1VSDA 4DV5K 4DSEA 2DFEA 3VA3A 1NJYA 3ZX0A 3Q7CA 3A5LC 4CECA 5BR9A 3MAQA 4C8OA 4O8KA 2HBJA 1T44A 5FPDA 2RKIA 3A8YA 2ZGYA 2Q97A 5AQMA 5CYMA 2UU9K 3VESA 1LWFA 1HRHA 4BRKA 1X3MA 1YAGA 3NDKA 1K8AO 4DUZK 3THYB 1JLEA 4DF4A 2O8BB 1GLEG 4FLYA 4DTUA 3MWPA 1HR0K 5AQKA 4IEIA 1ZBFA 4IKFA 1IV0A 4BDZA 5FLXO 3VTHA 3ZX3A 5M1PA 4DTRA 2P9IB 3BDPA 4X64K 1D9FA 3GL1A 3CCEN 2KTQA 2JLEA 3ULEB 1SUQA 4Z4EA 5C10A 3LWMA 1NK9A 5GAEP 4M7XA 3G10A 4JI3K 1YHQN 1RBTA 3BEXA 4J8FA 4JAXA 3V9UA 2HSTA 1T7PA 4FJNA
chains in the Genus database with same CATH topology
2VQFK 3J81O 4CW7B 1XNQK 4DUYK 4X62K 4NXMK 1XMOK 1N32K 4B3MK 4YHHK 4JI4K 3OTOK 4DV6K 1N33K 4JI8K 4LF8K 4JI6K 4B3TK 1XNRK 5LMUK 2UXBK 2UUBK 1N34K 3J7AP 4LFBK 4V19S 3JAMO 3T1HK 1N36K 2E5LK 1IBLK 4DV1K 4GKKK 1FJGK 4DR7K 4B3RK 4DV2K 4JI7K 4DV4K 4K0KK 2F4VK 2HHHK 5LL6Z 4DR3K 5IT9O 4CVNE 4JV5K 4DV0K 1HNXK 4X65K 4LF7K 4OX9K 4DR5K 2UXDK 4LF4K 4DR1K 4NXNK 4B3SK 2UXCK 4DV5K 4LF9K 4DR2K 2UUAK 1HNWK 5IWAK 2UU9K 4KHPK 4AQYK 1HNZK 4DV3K 4LF6K 4DUZK 4X66K 4JI2K 2ZM6K 4JYAK 1XMQK 2UUCK 4JI0K 1HR0K 4LFCK 4DV7K 4JI5K 4JI1K 1I94K 4LFAK 5FLXO 4X64K 4DR6K 5AJ3K 3J7YP 3T1YK 4DR4K 1J5EK 1IBMK 1IBKK 2VQEK 4LF5K 5A2QO 4YY3K 4GKJK 5LMNK 4JI3K 3J80O 5BR8K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQF K;  3J81 O;  4CW7 B;  1XNQ K;  4DUY K;  4X62 K;  4NXM K;  1XMO K;  1N32 K;  4B3M K;  4YHH K;  4JI4 K;  3OTO K;  4DV6 K;  1N33 K;  4JI8 K;  4LF8 K;  4JI6 K;  4B3T K;  1XNR K;  5LMU K;  2UXB K;  2UUB K;  1N34 K;  3J7A P;  4LFB K;  4V19 S;  3JAM O;  3T1H K;  1N36 K;  2E5L K;  1IBL K;  4DV1 K;  4GKK K;  1FJG K;  4DR7 K;  4B3R K;  4DV2 K;  4JI7 K;  4DV4 K;  4K0K K;  2F4V K;  2HHH K;  5LL6 Z;  4DR3 K;  5IT9 O;  4CVN E;  4JV5 K;  4DV0 K;  1HNX K;  4X65 K;  4LF7 K;  4OX9 K;  4DR5 K;  2UXD K;  4LF4 K;  4DR1 K;  4NXN K;  4B3S K;  2UXC K;  4DV5 K;  4LF9 K;  4DR2 K;  2UUA K;  1HNW K;  5IWA K;  2UU9 K;  4KHP K;  4AQY K;  1HNZ K;  4DV3 K;  4LF6 K;  4DUZ K;  4X66 K;  4JI2 K;  2ZM6 K;  4JYA K;  1XMQ K;  2UUC K;  4JI0 K;  1HR0 K;  4LFC K;  4DV7 K;  4JI5 K;  4JI1 K;  1I94 K;  4LFA K;  5FLX O;  4X64 K;  4DR6 K;  5AJ3 K;  3J7Y P;  3T1Y K;  4DR4 K;  1J5E K;  1IBM K;  1IBK K;  2VQE K;  4LF5 K;  5A2Q O;  4YY3 K;  4GKJ K;  5LMN K;  4JI3 K;  3J80 O;  5BR8 K; 
#chains in the Genus database with same CATH topology
 1GLD G;  5AZJ B;  2IVP A;  3DRR A;  1HQE A;  4IO8 A;  4H5N A;  3DOK A;  1N32 K;  3HL8 A;  4JI4 K;  5KPT A;  4BR5 A;  3UKU B;  3O9R A;  2G8K A;  3OYI A;  4LF8 K;  4B8A B;  2QWO A;  3JXU A;  4YOU A;  4R5P A;  3WXJ A;  5FPN A;  3SI6 A;  1W9H A;  2ASM A;  4FSV A;  3S3N A;  1SKS A;  3F9M A;  4V19 S;  2FBT A;  1K8K A;  4BGB A;  2OTL N;  1FJG K;  4F3O A;  2F8S A;  3NE6 A;  3QEW A;  2VWJ A;  3DI6 A;  4DU3 A;  4AM6 A;  1BGX T;  3BGR A;  4KI6 A;  4RW7 A;  3C7N B;  3NF9 A;  5AQQ A;  3KJV A;  4M3T A;  3MXJ A;  4CGH A;  2IVN A;  3N4P A;  3AAR A;  4J2A A;  4I6M A;  3NBP A;  3RRG A;  3CET A;  3C6T A;  4HUE A;  4DFP A;  1NGA A;  3ISN C;  4ISG A;  3KKS A;  3G4S N;  3WQU A;  4JKD A;  1WSF A;  2DPN A;  4GY2 B;  1C0G A;  4KTW A;  1D5A A;  4RWT A;  5AQJ A;  3CG7 A;  1L3S A;  4CBX A;  1X9W A;  1L5U A;  1HJO A;  4FJI A;  1R0A A;  3CCV N;  1I94 K;  4CZI A;  4MLE A;  4EZ6 A;  3MDQ A;  3J7Z O;  3SJJ A;  3DYA A;  3IKM A;  4B3O A;  1T6D A;  1YJ9 N;  1VSK A;  3NF7 A;  3MCA B;  4CBW A;  3WNE A;  4I2Q A;  1RTJ A;  3GG4 A;  1IBM K;  2OAN A;  4CZJ A;  1DTQ A;  3ZSW A;  2GV9 A;  2E1Z A;  4FM1 A;  3D6R A;  5EVZ A;  2GWJ A;  3U3G A;  5GAG P;  4FJL A;  3LM9 A;  3U8X A;  4CFD A;  3ATV A;  4YOX A;  1T6C A;  3FZF A;  1X1P A;  4RTF D;  3CMA N;  3ZSZ A;  1CXU A;  4KI4 A;  3MN5 A;  2FBX A;  2KKZ A;  3VQ9 A;  1VQ6 N;  1NGD A;  4FLZ A;  3KLF A;  4E1N A;  5EOY A;  1UWB A;  2GWK A;  3E9O A;  4CBU A;  2YCH A;  3RRH A;  1J53 A;  3ZSX A;  3EN9 A;  1Q86 O;  3QIO A;  2X6S A;  1U45 A;  3CFP A;  4RCH A;  4XH1 A;  4CD1 A;  2YHY A;  1TKX A;  1IJJ A;  1LWE A;  1RDW X;  2HF4 A;  3T1H K;  4LSL A;  1UA1 A;  3SMS A;  2RHK A;  1GLC G;  3SYZ A;  3OBY A;  4CGD A;  2F4V K;  2HHH K;  4M42 A;  1WSG A;  2QWR A;  2FXU A;  3KZB A;  5KPZ A;  3LM2 A;  1OVQ A;  1FW6 A;  1HQU A;  1BA0 A;  1MDU B;  4KHW A;  2VYP A;  3O08 A;  3TAR A;  3CME N;  1DGK N;  5FDL A;  4BQZ A;  2HHV A;  4CZG A;  3LAN A;  4OX9 K;  3K5L A;  2HHU A;  4JKF A;  3KLI A;  2QWN A;  1DTT A;  3V81 A;  4FJK A;  4TSX A;  1B9F A;  5K14 A;  5AZI A;  2VWB A;  3AO1 A;  5MLC Q;  4DSJ A;  2YNG A;  3CFO A;  3SUO A;  3WUH A;  2P9P A;  4RW4 A;  4R79 A;  4KHP K;  1HNZ K;  1VQM N;  1JL2 A;  1XC9 A;  1NOY A;  3L2W A;  1Z05 A;  3O80 A;  4ELT A;  2YI1 A;  3KK7 A;  4DSF A;  3E01 A;  2GEM A;  4LFC K;  1GLF O;  1L3V A;  3VGL A;  3FR0 A;  3HPO A;  3MCP A;  4H5V A;  3QEI A;  1DLO A;  1WSI A;  4CEQ A;  4KRE A;  1DEJ A;  3NHG A;  3VET A;  4PL7 A;  4H0Y B;  2NZT A;  5C2F A;  1XUP O;  3BP8 A;  3VGM A;  4OPH A;  4YY3 K;  1YIT N;  5AQO A;  1VSJ A;  4FYD A;  5KQ8 A;  3O5B A;  3PX6 A;  3DLG A;  1BI4 B;  3QEV A;  2O8C A;  1S1X A;  4PY5 A;  5F1X A;  3KIO A;  3ENB A;  5KPR A;  2WFB A;  5TKY A;  1KAZ A;  4WQ5 A;  3V6D A;  2BTF A;  4A59 A;  3THW B;  3HPG A;  3VPZ A;  3P83 D;  4DTJ A;  1XQS C;  3M8Q A;  3L2R A;  1RTH A;  2WON A;  2OYQ A;  2P9K B;  3MN7 A;  1T8E A;  4BG9 A;  4GKK K;  3R8E A;  4DV1 K;  5BRH A;  4BC2 A;  4DV4 K;  1Q82 O;  4M3Z A;  1U04 A;  2QXL A;  3CJC A;  4KRF A;  3H6E A;  3SK3 A;  3RMB A;  2G8I A;  4CZM A;  4NO7 A;  4F8R A;  1C1C A;  3A5O C;  4H5T A;  3WEE A;  2KQ2 A;  3K9J A;  3VEX A;  4OJR A;  1S5J A;  1QQO A;  4KH4 A;  4B8C A;  4CEZ A;  3EYZ A;  4CGJ A;  3WXI A;  4WFB L;  1NKE A;  1XC3 A;  1S1U A;  4EP5 A;  4CEO A;  3FFI A;  3CYM A;  1JLB A;  3AAP A;  1RTD A;  5LJV A;  4CHO A;  5E26 A;  3ID6 A;  3C6H A;  1RT1 A;  1UAX A;  1SV5 A;  4NCG A;  3AO2 A;  2P9N A;  4FM2 A;  1NK5 A;  1VQK N;  3WT0 A;  1Q7Y O;  1M90 O;  4HCB A;  3O6W A;  3SCX A;  3DAW A;  3I8D A;  3RMC A;  4WF9 L;  4O0I A;  3HP6 A;  1JLC A;  3LWL A;  3AVF A;  2W40 A;  3U3Y A;  3QIC A;  1VAZ A;  1VSM A;  5AJ3 K;  2E8A A;  3QET A;  1GLA G;  1HUX A;  4IFE A;  3TSQ A;  4YFU A;  3AV9 A;  1IBK K;  3JS6 A;  1W0H A;  4E89 A;  5DM6 L;  1KAY A;  2O8F B;  2XY6 A;  2OPS A;  5JMV A;  2ZJR L;  4MDB A;  1BUP A;  1N8R O;  4BC5 A;  3BZK A;  4A5A A;  3MED A;  2IS3 A;  2X74 A;  3DXM A;  4LC9 B;  3I0R A;  5AR0 A;  5KI6 A;  4C1N K;  4IWV A;  2Z1J A;  4I9L A;  3TPQ A;  3KD5 E;  2DY4 A;  3RWU A;  5T7B A;  4E7L A;  2IGI A;  4FJJ A;  3O3G A;  3NMU A;  3GE1 A;  2HB5 A;  4JK7 A;  5AQF A;  1NWK A;  1KTQ A;  1K9M O;  4DQI A;  5EX5 A;  1YI2 N;  2UUB K;  1RDA A;  5C24 A;  3P5J A;  1BIZ A;  4CGF A;  4Z4I A;  1UA0 A;  1SS6 A;  5KGW A;  1NLV A;  3L8B A;  3ZET B;  4BRP A;  2QWP A;  5AQV A;  1K6Y A;  4FJ9 A;  2AJQ A;  1D4X A;  3TTF A;  4J2B A;  4F2R A;  3KLH A;  1TK0 A;  2Q2R A;  1JCF A;  3CHW A;  4FXD A;  2D1K A;  1J6Z A;  2OPP A;  3T7Z A;  4BRG A;  4CZL A;  3MXM A;  4CHY A;  5FRM A;  4X65 K;  1WBB A;  5GAD P;  4LF7 K;  2ZE2 A;  4DR1 K;  3OYC A;  2E20 A;  3AVC A;  3S41 A;  4FLV A;  3OVN A;  2QEX N;  4CJR A;  3D2E B;  3SMP A;  1HKC A;  4QAG A;  4CEA A;  1N5Y A;  3UB5 A;  2XO7 A;  2B6A A;  4A2A A;  3OJU A;  4I7F A;  1YVU A;  1NGI A;  4IJN A;  2XRI A;  4AQY K;  3VMF B;  1NGE A;  3I56 N;  4AHV A;  2HND A;  3TI0 A;  4PHT X;  4LH4 A;  2UYT A;  3TAP A;  4FJH A;  2XY7 A;  2P9I A;  5FRO A;  2LSN A;  2WTU A;  3WXL A;  3CXC M;  4FLU A;  1VSH A;  4JEP A;  2FBY A;  3L4I A;  2QKK A;  4LH5 A;  2D5R A;  4DQP A;  4E19 A;  3VTI A;  3HK2 A;  1T03 A;  5DM7 L;  4BE0 A;  3NGZ A;  2ATQ A;  4BDY A;  3R9P A;  2WBN A;  2FSJ A;  4EHU A;  2OA8 A;  4GKJ K;  3VQD A;  4AF1 A;  4AHS A;  1A5V A;  1NMN A;  1KD1 O;  2HBL A;  3CJ9 A;  3NFA A;  3DLB A;  4JK8 A;  2QWM A;  1U2V B;  2PYJ A;  4DTP A;  1KCF A;  3R3L A;  2GEL A;  3JYT A;  4MDA A;  4OPJ A;  5JS1 A;  4CZE A;  1WAJ A;  5I42 A;  4M7Y A;  2P9L B;  4KHN A;  4IDK A;  1Z6R A;  3KKR A;  4OLB A;  2P5G A;  4H0O A;  4BE2 A;  2HW3 A;  3HXM A;  3O4W A;  4ILH A;  4BQL A;  4BC3 A;  1NG9 A;  2P9P B;  3K5M A;  4FM0 A;  1U47 A;  4O44 A;  1MA9 B;  4CJ3 A;  2KFN A;  4KHU A;  4CFC A;  4JV5 K;  1MWK A;  4B1X B;  2KZM A;  4BGA A;  1RDU A;  3ZT2 A;  4WE1 A;  4KB0 A;  1Q8I A;  1BO5 O;  3LL3 A;  1EQY A;  1XWL A;  4LF9 K;  4B1Z A;  3MN6 A;  5HRR A;  4DFK A;  1J5O A;  3C94 A;  3DRP A;  3DRS A;  1RCH A;  3HZ6 A;  3FGU A;  4GW6 A;  1OH8 A;  3OYG A;  2NRH A;  3CM6 A;  5J1E A;  2NUB A;  3OA9 A;  4BRF A;  3AA4 A;  4FW1 A;  5AFU A;  4KKO A;  3QNO A;  2QK9 A;  4FJ5 A;  3CCU N;  4BWJ A;  3QML A;  3TAQ A;  3HPH A;  5AQY A;  4CJ7 A;  5B8H A;  3D2F A;  5CY4 A;  2A40 A;  1SQK A;  1C1B A;  4PA1 A;  1QSL A;  4M63 C;  4EHT A;  3O9T A;  3ID8 A;  3SQ1 A;  2WOM A;  4JD2 A;  2BGG A;  4C1N I;  5GIP A;  4OGE A;  4DR4 K;  5AQS A;  4F3T A;  3LPU A;  3P1G A;  2ASP A;  1NGC A;  3HST B;  1QHA A;  4BVO A;  3OYN A;  2IVO A;  3QBX A;  4DMN A;  1D8Y A;  4K41 A;  4H4O A;  5CYQ A;  3OS2 A;  3ZLJ A;  3KLE A;  4FJ8 A;  2NRR A;  1IKX A;  4YDU C;  1JL1 A;  2ZF5 O;  2YNF A;  4FJG A;  1Y64 A;  1G99 A;  1VQ7 N;  1HMV A;  4PKG A;  1QVG M;  1ZBS A;  3BF3 A;  1LV5 A;  2GBZ A;  1IKV A;  3MEC A;  3SAH A;  3V9X A;  1WAF A;  4F2S A;  4BVP A;  1BIU A;  2PBD A;  3NGY A;  2H3G X;  1NK7 A;  3BZC A;  4PKI A;  1EET A;  3VQA A;  1F21 A;  3DXK B;  4FWN A;  4C8N A;  1TL1 A;  2GUI A;  4FWP A;  3ZYY X;  2F7T A;  3JAM O;  5E41 A;  3SQ0 A;  3G25 A;  5HRS A;  4KV8 A;  4JI7 K;  2X6N A;  2YNH A;  1SL1 A;  5AQI A;  1Q81 O;  1BQM A;  5AQX A;  1BIS A;  5IT9 O;  1BG3 A;  4O0J A;  5AQU A;  1WOQ A;  5AZJ A;  2D0C A;  3DLE A;  1ZXO A;  2CH6 A;  3P31 A;  2UXD K;  1FKO A;  1YT3 A;  4CJF A;  3EE9 A;  1ASW A;  3THX B;  5AQZ A;  3HOT A;  5C12 A;  1HLU A;  1KXP A;  4EP4 A;  4C8L A;  3N4Q A;  4LY7 A;  3PV8 A;  3ASM A;  1S72 N;  1LCU A;  3CC7 N;  2XHB A;  1SZ2 A;  3VQE A;  1S6P A;  3TU5 A;  1VQ4 N;  1VRU A;  3AVB A;  3WXM B;  2FSK A;  3WNG A;  3LDP A;  3D7E O;  1B9D A;  1QQC A;  3S3O A;  4DV7 K;  3K58 A;  4JI1 K;  3C6U A;  5M1N A;  3HT3 A;  4CIG A;  1GOB A;  5GIO A;  3M8R A;  2OZS A;  3DLL L;  5BN8 A;  1RT2 A;  1YJN N;  2NRV A;  2ZJQ L;  3ITH A;  2Q0U A;  4BG8 A;  2J4R A;  2FF3 B;  1NK8 A;  2V51 B;  1TK5 A;  1NGG A;  3SUP A;  4FLX A;  4QOZ B;  3VF6 A;  1HNV A;  2E2O A;  4CJV A;  1GLJ O;  3G0Z A;  4JKG A;  5JLH A;  4CW7 B;  1XNQ K;  1EX4 A;  1XMO K;  4DB3 A;  2R7Y A;  2Y1J A;  1RNH A;  2BUP A;  3WQT A;  1RT6 A;  4JS5 A;  4BRA A;  3H08 A;  3NCI A;  1N33 K;  2F96 A;  1YIJ N;  4GVM A;  4BR9 A;  4JNE A;  4MO4 A;  2QTD A;  3O9S A;  1N34 K;  4DHY A;  4BRI A;  1CLQ A;  3M1F A;  2RE2 A;  1RBS A;  4B3R K;  1XHZ A;  2A3Z A;  1S1T A;  3IUC A;  3C65 A;  4CJS A;  3OY9 A;  1M1K O;  1WSH A;  2Q36 A;  4ELV A;  1RBV A;  4GV6 A;  1T3V A;  2O4G A;  3EO3 A;  2Y1I A;  3EZW A;  3SPY A;  2F9T A;  3VQ6 A;  1EWQ A;  2P9N B;  5AQH A;  3CFR A;  1XI1 A;  1RBU A;  2I7N A;  1E4F T;  2ZJP L;  4FLT A;  1VQ9 N;  2ZWH A;  4J2D A;  1J9A A;  3QEX A;  4DR2 K;  1KQS M;  4CCH A;  2PYL A;  4OKJ A;  3O4N A;  2FLO A;  1I39 A;  3M6G A;  4CHP A;  1TUU A;  3A5N C;  2PZS A;  1E3M A;  5AQN A;  3OYM A;  4H0T B;  3E1Y A;  5KQD A;  3Q7B A;  2ZM6 K;  4JYA K;  1S1V A;  2UUC K;  3CCS N;  1JLA A;  2NRZ A;  4FPA A;  1VHX A;  1RT4 A;  3T1A A;  4KTQ A;  1DT9 A;  1KFD A;  4FWO A;  2FBV A;  3OYL A;  4M45 A;  2VG6 A;  1JKH A;  4IEE A;  3H3O B;  3LAM A;  1KFS A;  3PO5 A;  1K73 O;  3OBW A;  4QCL A;  4CZH A;  4Q5V A;  2CGJ A;  4E7H A;  1FXX A;  1QZ6 A;  3TTC A;  2JWL A;  3I0S A;  1VSF A;  1YUW A;  1VQP N;  4KH6 A;  5BRE A;  3H1V X;  4IFY A;  5LJW A;  3HTV A;  2PAV A;  3RSE A;  3HM8 A;  5AQG A;  4ISE A;  3UKU A;  2VQF K;  4E7J A;  5KRT A;  4ID1 A;  5C2D A;  4KHY A;  3VEN A;  5JVH L;  4JKA A;  3AVN A;  3ZSR A;  1BOT O;  2XY5 A;  3CCJ N;  1H1V A;  4BWM A;  3VOV A;  4J2E A;  1NMD A;  2IC3 A;  3VEO A;  5J2P A;  4OLA A;  4B9T A;  4CES A;  3K0S A;  4BRO A;  4DSI A;  3DM2 A;  3DOL A;  4W5O A;  1D9D A;  4YOY A;  3MXI A;  1S6Q A;  3FE1 A;  4CJE A;  2O8E A;  4CJ5 A;  4CK2 A;  3M8S A;  3V1R A;  3PSI A;  4NLC A;  5E84 A;  1S3X A;  4HHT A;  4DSL A;  2WC9 A;  4JRP A;  1NNE A;  1A5W A;  5AQT A;  4NYN A;  4GV9 A;  1WLJ A;  3EZ5 A;  3ZSV A;  1G15 A;  1ZBU A;  2QXF A;  3V9S A;  3QB0 A;  4DQR A;  2E6M A;  5HRN A;  5HRO A;  3LP3 A;  2W6K A;  4Y0W A;  4FCY A;  4ISF A;  1NJI O;  2KHO A;  1LW0 A;  4ELU A;  4O5B A;  1RT7 A;  1RT3 A;  3HO1 A;  3MEG A;  4DQQ A;  3ENH A;  2V7Z A;  3NF6 A;  1IG8 A;  1BHL A;  2W41 A;  1O1W A;  2XY8 A;  4DTX A;  4C8K A;  4FWS A;  4E1J A;  3TAN A;  5BPL A;  3L4Q A;  4FK2 A;  3ZSO A;  4DV3 K;  1QQM A;  5CHI A;  2KLA A;  2ZD1 A;  1XMQ K;  4M3X A;  3WEE B;  1C0M A;  1BCO A;  1YXQ A;  4JKE A;  2BAN A;  2HHW A;  2E4L A;  2QWL A;  2EX3 A;  4A5B A;  4N5S A;  3HJF A;  4FJX A;  1JXB A;  2PFU A;  3ENO A;  3T1Y K;  4KAZ A;  3JSM A;  2CGK A;  5ADX H;  3W0L A;  3MX5 A;  2P9U B;  4C8M A;  4CJU A;  4AHU A;  2NRT A;  2QI2 A;  4DQS A;  1WUA A;  1SAZ A;  4B1Y B;  4CFA A;  5BR8 K;  2AP1 A;  4FWQ A;  4Y1C A;  2VGM A;  3VN5 A;  3V4I A;  5TKW A;  4FZX C;  2KW4 A;  1A5X A;  1NOZ A;  1BDG A;  4ILJ A;  1NU0 A;  4PKH A;  2GTD A;  5EY4 A;  3IDH A;  2GUP A;  2P9L A;  1N6Q A;  1ASU A;  5CR4 A;  3F73 A;  3TR8 A;  1GLB G;  4G1Q A;  2P5O A;  4CE9 A;  1BU6 O;  5LMU K;  3THX A;  1RIL A;  3P38 A;  4UQG A;  4E7K A;  1U2V A;  2A42 A;  4BRQ A;  4XH5 A;  3VQ7 A;  4Z4G A;  1JLF A;  4DTN A;  3PY8 A;  4AH9 A;  2VGN A;  4DR7 K;  4FWR A;  4BDP A;  3H1Q A;  1RDD A;  4FK0 A;  2QKB A;  3KHY A;  3NVM A;  1IKW A;  3SLC A;  1IG9 A;  3QLH A;  4CVN E;  2D4W A;  3ZT0 A;  4N47 A;  2HHS A;  3B8A X;  4JRQ A;  2IDO A;  5SZT A;  2Z1G A;  4DV0 K;  3QER A;  2G8U A;  3SUN A;  3VQ5 A;  4W5Q A;  3QEP A;  1HPM A;  2YHB A;  3NGI A;  4NXN K;  4CEF A;  1RDB A;  4XH4 A;  1TKZ A;  1L3U A;  4FOI A;  4IOA L;  4Z4H A;  4N56 A;  1REV A;  1GOA A;  1C0T A;  2O8F A;  3VF4 A;  4EFH A;  3CC4 N;  4YOW A;  1EKE A;  1EP4 A;  3AA2 A;  2E6L A;  3LDN A;  3KWG A;  3THV A;  4BRD A;  4OVL A;  1HJR A;  3DXM B;  3U4L A;  3SBT A;  3L2Q A;  1W7A A;  2OTJ N;  4DLE A;  3QNN A;  4Z94 A;  3CD6 N;  3EL2 A;  4ZTJ A;  5C15 A;  1HPZ A;  5AFU H;  4NB4 A;  2P51 A;  1ATS A;  5AQP A;  3AVH A;  1NJZ A;  4UY8 O;  3L3V A;  3VF2 A;  3VA0 A;  4AHT A;  3AO5 A;  3LZJ A;  1WNS A;  2JGU A;  3CPE A;  4H0P A;  3O3F A;  1GLL O;  1S22 A;  3VQC A;  4CJP A;  3NAE A;  5KRS A;  1KVB A;  3CER A;  3SV3 A;  1OH6 A;  2G8W A;  2BH1 A;  4L8R B;  4NYF A;  1WBD A;  3FZL A;  3RMD A;  4EZ9 A;  3GOI A;  3OTO K;  1RGI A;  1W97 L;  3OS1 A;  4H0V B;  4Z0U A;  4DFM A;  3L2U A;  1LAW A;  4CI6 A;  2O8C B;  3QDK A;  1JXE A;  5EXW A;  4BRC A;  4HUG A;  4CJW A;  4E0D A;  1XNR K;  3O1B A;  3FLC O;  3CI5 A;  3QO9 A;  5BRD A;  5D3G A;  4MO5 A;  5LY3 A;  1IBL K;  2EWS A;  4WQ4 A;  4YOV A;  2I7P A;  5EU7 A;  4BR2 A;  4DR3 K;  3PIP L;  2NRW A;  1TV6 A;  2OCE A;  1OH7 A;  3O1W A;  2E2N A;  4CF1 A;  3SBG A;  3FZM A;  3DWL A;  4LF4 K;  3P4I A;  1VSL A;  4CGG A;  3M8P A;  2DFF A;  4ID5 A;  3SZ2 A;  2O8D A;  3HOS A;  3EEQ A;  4CJ4 A;  2QWQ A;  1VQ5 N;  5C25 A;  4B1W B;  4OO1 J;  1HKG A;  4I6M B;  4KO0 A;  5I9E B;  1ATR A;  2F8T A;  3SJH A;  4KPY A;  1TK8 A;  3O9Q A;  1BQN A;  1ZYQ A;  4A2B A;  2W6L A;  5BPN A;  3AVK A;  3CJB A;  4IOX A;  2QA4 N;  3THW A;  4IXC A;  4IO9 L;  5CZ2 A;  3R6M A;  3TSP A;  1DKG D;  3MK6 A;  4DR6 K;  3AY9 A;  1E4G T;  3J7Y P;  2A1R A;  3QIP A;  3VEW A;  1BA1 A;  3AO3 A;  2V52 B;  3T3F A;  1JLG A;  3DJC A;  3CCR N;  3CJ7 A;  2VQE K;  3T19 A;  1NKB A;  2HHT A;  5FRN A;  1KLN A;  5A2Q O;  4BR0 A;  4QS8 A;  4JKG B;  1FK9 A;  1TL3 A;  5LMN K;  2E88 A;  5JLF A;  5DK5 A;  3J80 O;  4HCC A;  1ILY A;  4OGC A;  4CHZ A;  1S9E A;  1C0F A;  4KFB A;  1RT5 A;  1C1A A;  4M3W A;  1U6Z A;  3AVI A;  3O9U A;  5AQR A;  1NGJ A;  3KWI A;  2G8V A;  2NLX A;  2ZQB A;  3IG1 A;  4JI6 K;  3SUQ A;  1QSY A;  4PL8 A;  3PUF A;  3C0B A;  1NK6 A;  1RFQ A;  3NH2 A;  4JLH A;  3ULE A;  1QE1 A;  4HTL A;  4A57 A;  1TKD A;  3J7A P;  4LFB K;  4CF0 A;  4FJM A;  1S1W A;  1FKP A;  4HUF A;  2E5L K;  2DTU A;  1C6V A;  4PQU A;  4DTS A;  1EXQ A;  4NCA A;  2YHX A;  2O8D B;  1MWM A;  1KVC A;  2O8B A;  4JKH A;  3P39 A;  4MFB A;  3D2F B;  3F9K A;  4FW2 A;  4BRN A;  3GBT A;  1CZA N;  4O4G A;  3TAM A;  3ZET A;  2BDP A;  1EO1 A;  2YV0 X;  4H5R A;  5HRP A;  3K57 A;  1V4S A;  1VK0 A;  3ZSQ A;  1KAX A;  4EAH D;  5KGX A;  1HNW K;  3V9Z A;  3R1X A;  4WFN L;  1TAQ A;  1RBR A;  2G8H A;  1B92 A;  4GVE A;  1RDC A;  3OW2 M;  1L3T A;  4DS4 A;  4B9N A;  3LAK A;  3CCL N;  1SL0 A;  4BR4 A;  4JI0 K;  1QHT A;  4FL9 A;  4M3Y A;  3PX4 A;  2Q0R A;  2P9S A;  3T69 A;  2D0B A;  2IIR A;  3KVG A;  3ATU A;  4WYB A;  3OYF A;  3RSE B;  4BR7 A;  3L2V A;  4FJ7 A;  4NLB A;  3IS9 A;  1TAU A;  2HOE A;  3K59 A;  3PSF A;  1RTI A;  4BE1 A;  3VQ4 A;  3F2K A;  3VQP A;  1CZ9 A;  1IKY A;  3UKR B;  4QS9 A;  3G6E N;  4B9L A;  4IG3 A;  4JHD A;  4O8U A;  3SAF A;  3TAE A;  4CHQ A;  4O55 A;  3HSC A;  4ICL A;  2OPQ A;  3LAL A;  2A6A A;  4ILG B;  4FK4 A;  3SAG A;  3H45 C;  3CC2 N;  1VQN N;  5JS2 A;  2UXB K;  3LPT A;  4FZY A;  2BE2 A;  2X78 A;  3IMX A;  5H1S Q;  4B9S A;  2D0P A;  4DV2 K;  5HP1 A;  1VSE A;  2NNW A;  1KRP A;  4K25 A;  5HL7 L;  4FZZ A;  4DFJ A;  4H03 B;  1YTU A;  3UIQ A;  4CJK A;  5FPE A;  4BY9 C;  5M1K A;  1LWC A;  3RR7 A;  4ZTF A;  4YDU A;  2HVI A;  5SWM A;  4JHD B;  4MLH A;  4DR5 K;  2D0A A;  4JK9 A;  4DKW A;  3AVA A;  2A41 A;  3KK2 A;  1TGO A;  3A5M C;  3CQX A;  4RW8 A;  4DTM A;  4L3Q A;  3BY5 A;  2UUA K;  1VQ8 N;  3AAQ A;  3CJA A;  3A0I X;  2CH5 A;  2A5X A;  2P9S B;  4FWL A;  4CIE A;  3B6O A;  5DMR A;  4FVU A;  4ZHR A;  4YNQ A;  4WQ4 C;  4HTU A;  3H3N O;  3PLA A;  4CIF A;  5HBM A;  4B1U B;  3QES A;  3AVL A;  3MN9 A;  1JCG A;  5M1Q A;  3ZSY A;  5ELZ A;  1KLM A;  3O3H A;  2I5J A;  4CZK A;  4LFA K;  2GX9 A;  3MWT A;  4YOT A;  4G9Z A;  5M1F A;  1TYQ B;  4K42 A;  1R59 O;  4W5N A;  3S3M A;  3FZH A;  3AO4 A;  4CJT A;  4Z4C A;  1JLQ A;  4RW9 A;  1QZ5 A;  3K2P A;  3O4Q A;  2YKM A;  1NJW A;  3SPZ A;  3QFP A;  1NK0 A;  4BRH A;  3IAY A;  4Y1D A;  3VQ8 A;  2E2Q A;  3U6F A;  4Z4F A;  3IRX A;  1Z25 A;  4NCB A;  4B3M K;  3MEE A;  1YVN A;  4GMJ B;  4DV6 K;  3UKR A;  2KFZ A;  3G71 N;  2FF6 A;  1P90 A;  4CJQ A;  3EKU A;  1VRT A;  4N41 A;  5FPM A;  4HVJ A;  1ESV A;  4KH5 A;  3KK3 A;  4I2P A;  1ZBL A;  3SV4 A;  4AHR A;  4MQ3 A;  3WNF A;  4B1V A;  4HWI A;  4H8K A;  1Q9Y A;  5C42 A;  3CCM N;  2O4I A;  1X3N A;  3AGK A;  3EY1 A;  3EE8 A;  3D2E A;  2YHW A;  4CEE A;  4W5T A;  3NH1 A;  2NRX A;  3OYD A;  3OYE A;  2OPR A;  3LDO A;  3WNH A;  1K8K B;  4CED A;  1HNX K;  2HNZ A;  3AA5 X;  5HOO A;  3C7N A;  4B3S K;  5KTQ A;  4CJL A;  3MX2 A;  4K43 A;  3FFK B;  1QTM A;  3K5N A;  1WN7 A;  4OPK A;  1NBW A;  3OS0 A;  2ETJ A;  2YHA A;  3FZK A;  1IH7 A;  4IDH A;  4QS7 A;  2YJF A;  3NH0 A;  2Q3S A;  5F2R A;  2IAJ A;  4JI2 K;  1ATN A;  3HVT A;  3I55 N;  2VG5 A;  4C23 A;  4CK3 A;  1TUY A;  1W2B M;  1NM1 A;  4JKB A;  4BAC A;  2P9K A;  4CFB A;  5ADX A;  3K9K A;  3LDQ A;  4W5R A;  3VEV A;  1MU2 A;  3OYB A;  3LDS A;  4AIL C;  1IO2 A;  1VSI A;  4M3R A;  4BRL A;  2YKN A;  1ITG A;  4JS4 A;  3V1O A;  3LP0 A;  3RVC A;  1ASV A;  3UE5 A;  3LP1 A;  4CEB A;  3PO4 A;  3LZI A;  3ZEU A;  4AHC A;  4JKC A;  2HVH A;  4F9O A;  1WSE A;  4CER A;  1Z26 A;  3MMV A;  2V7Y A;  2E1Y A;  3TSU A;  3BUZ B;  4M3U A;  4XIU A;  1NGF A;  1NGH A;  4FVM A;  2OZM A;  3L3U A;  1T05 A;  4JI8 K;  3CCQ N;  1SKW A;  3NVK A;  3ZT1 A;  2HBK A;  4DTO A;  3VEZ A;  4DQ8 A;  2YJE A;  3NF8 A;  2B4J A;  1BWF O;  4DF8 A;  5BRF A;  3QIN A;  1NGB A;  2B5J A;  4U67 L;  4IBN A;  4CF2 A;  4Q0B A;  1U48 A;  4BRM A;  1X9J A;  2PY5 A;  3CJ1 A;  1OVY A;  4WCE L;  4LSN A;  1TKT A;  3KLG A;  3ZX2 A;  3QBW A;  2YNI A;  4XEI A;  3M5R A;  3GDQ A;  1ZC6 A;  1OKJ A;  3L6Q A;  4FWM A;  4RW6 A;  2W42 A;  2G8F A;  3C95 A;  4FPB A;  2ITM A;  3F5T A;  2ASO A;  5GAH P;  4DG1 A;  2RN2 A;  4AM7 A;  4WFA L;  4KBO A;  3HI0 A;  4IG0 A;  3V9W A;  5AQW A;  4PWD A;  1HYS A;  3AGR A;  3ALY A;  4LF6 K;  1ZBH A;  4KHQ A;  4N76 A;  4BC4 A;  5M1O A;  1X9M A;  1OH5 A;  3VGK A;  1HYZ A;  4JI5 K;  2IOC A;  4CK1 A;  4F4K A;  2EHG A;  3CPW M;  1ZBI A;  3HYF A;  3O8M A;  5JIC A;  2HF3 A;  1J5E K;  4BRE A;  5CE3 A;  1HYV A;  3TAF A;  1CZB A;  1BI4 A;  4LF5 K;  4U7B A;  1WB9 A;  2AA4 A;  3IFR A;  1V4T A;  3LP2 A;  4K8X A;  3E66 A;  4IOC L;  3K5O A;  4OKK A;  3W3D A;  3OYH A;  2Q1N A;  4IZ9 A;  1KC8 O;  4DS5 A;  3RR8 A;  2RF2 A;  4DU4 A;  1Y97 A;  2VWK A;  3AVJ A;  1LOT B;  1HKB A;  3DLR A;  1JJ2 M;  2Z1I A;  2HMP A;  4YHH K;  3ZT3 A;  3ZEU B;  1C0U A;  2A1S A;  3VQQ A;  4H5W A;  3OJS A;  1I3A A;  4CZF A;  2HHQ A;  4H0X B;  3I8B A;  3HVR A;  1YJW N;  3OYA A;  1J54 A;  5I3U A;  4RG8 A;  2HHX A;  4WQ5 C;  3E9P A;  4GNI A;  2ZGZ A;  4A61 A;  3DXK A;  4IJA A;  4B08 A;  1SKR A;  2VCP A;  1WSJ A;  3U9Z A;  4B9Q A;  3C6A A;  2Q31 A;  1X9S A;  4FOE A;  5BN9 A;  4M41 A;  1QVF M;  5LL6 Z;  1YF5 L;  4CGI A;  3U9D A;  1S9G A;  1QQN A;  1HNI A;  2DFH A;  3TWH A;  2KZZ A;  2O8E B;  3D45 A;  4E1M A;  2F9W A;  1TYQ A;  5CZ1 A;  4A62 A;  3KD1 E;  4PUO A;  4FWK A;  1LW2 A;  2D0O A;  1JCE A;  2UXC K;  3ZCM A;  1SL2 A;  3ZT4 A;  4B9U A;  4H4M A;  3SQ4 A;  3AVM A;  2JWK A;  1EWR A;  3DMJ A;  5IWA K;  3EKS A;  3CM5 A;  3V1Q A;  2Z1H A;  1NKC A;  3DLH A;  3WXK A;  4X66 K;  2ITG A;  3CQY A;  4JN4 A;  3A2F A;  5HLF A;  1YTA A;  1KSP A;  3KTQ A;  3S9H A;  3LDL A;  2E2P A;  4OKE A;  3AA3 A;  4DU1 A;  4B9V A;  5JVG L;  4B9M A;  2HNY A;  4LD0 A;  2P9U A;  2WUS A;  4KTZ A;  4CF9 A;  4K8Z A;  1QS4 A;  4E3S A;  1VQO N;  3E9L A;  4O5F A;  1NJX A;  2HBM A;  1GOC A;  1O13 A;  1VQL N;  3CIP A;  3ULD A;  5AZI B;  1UOC A;  1XHX A;  3J8A A;  2CGL A;  3SQ2 A;  5BPM A;  3CQ8 A;  4YOR A;  4FLW A;  2QW9 A;  4DCH A;  3TAB A;  3PIO L;  3HP9 A;  2QM1 A;  4I9Q A;  3J81 O;  3QFU A;  4GV3 A;  3KK1 A;  3OYJ A;  1U4B A;  3L0Q A;  4NXM K;  4X62 K;  4DUY K;  2HMI A;  5F0X A;  5J2M A;  5C0Y A;  4IFV A;  1P8Z A;  3VER A;  4KHS A;  2VG7 A;  4DSK A;  4DLG A;  1KVA A;  5AQL A;  3AVG A;  3HBT A;  3BF1 A;  3VEY A;  3DLK A;  4CD3 A;  3SNN A;  4B3T K;  3M3Z A;  3CF5 L;  4CHN A;  1CXQ A;  3RMA A;  4FO0 A;  4OPA A;  1NK4 A;  1N36 K;  3B6P A;  1QSS A;  4DWI A;  2RPI A;  3HRG A;  3OYK A;  4E7I A;  3THY A;  4KB1 A;  1LAV A;  3D0P A;  1BL3 A;  3H46 O;  2P1J A;  4K0K K;  3TTD A;  3I33 A;  3TAG A;  3OHR A;  3VQB A;  1BCM A;  1TVR A;  4CF8 A;  1U49 A;  5J2N A;  3RTV A;  4JD2 B;  1Q9X A;  5J2Q A;  2FC0 A;  2FSN A;  1HX1 A;  3PX0 A;  4EIA A;  2YX6 A;  5GIN A;  3HM9 A;  1Q18 A;  1VSD A;  4DV5 K;  4DSE A;  2DFE A;  3VA3 A;  1NJY A;  3ZX0 A;  3Q7C A;  3A5L C;  4CEC A;  5BR9 A;  3MAQ A;  4C8O A;  4O8K A;  2HBJ A;  1T44 A;  5FPD A;  2RKI A;  3A8Y A;  2ZGY A;  2Q97 A;  5AQM A;  5CYM A;  2UU9 K;  3VES A;  1LWF A;  1HRH A;  4BRK A;  1X3M A;  1YAG A;  3NDK A;  1K8A O;  4DUZ K;  3THY B;  1JLE A;  4DF4 A;  2O8B B;  1GLE G;  4FLY A;  4DTU A;  3MWP A;  1HR0 K;  5AQK A;  4IEI A;  1ZBF A;  4IKF A;  1IV0 A;  4BDZ A;  5FLX O;  3VTH A;  3ZX3 A;  5M1P A;  4DTR A;  2P9I B;  3BDP A;  4X64 K;  1D9F A;  3GL1 A;  3CCE N;  2KTQ A;  2JLE A;  3ULE B;  1SUQ A;  4Z4E A;  5C10 A;  3LWM A;  1NK9 A;  5GAE P;  4M7X A;  3G10 A;  4JI3 K;  1YHQ N;  1RBT A;  3BEX A;  4J8F A;  4JAX A;  3V9U A;  2HST A;  1T7P A;  4FJN A; 
#chains in the Genus database with same CATH homology
 2VQF K;  3J81 O;  4CW7 B;  1XNQ K;  4DUY K;  4X62 K;  4NXM K;  1XMO K;  1N32 K;  4B3M K;  4YHH K;  4JI4 K;  3OTO K;  4DV6 K;  1N33 K;  4JI8 K;  4LF8 K;  4JI6 K;  4B3T K;  1XNR K;  5LMU K;  2UXB K;  2UUB K;  1N34 K;  3J7A P;  4LFB K;  4V19 S;  3JAM O;  3T1H K;  1N36 K;  2E5L K;  1IBL K;  4DV1 K;  4GKK K;  1FJG K;  4DR7 K;  4B3R K;  4DV2 K;  4JI7 K;  4DV4 K;  4K0K K;  2F4V K;  2HHH K;  5LL6 Z;  4DR3 K;  5IT9 O;  4CVN E;  4JV5 K;  4DV0 K;  1HNX K;  4X65 K;  4LF7 K;  4OX9 K;  4DR5 K;  2UXD K;  4LF4 K;  4DR1 K;  4NXN K;  4B3S K;  2UXC K;  4DV5 K;  4LF9 K;  4DR2 K;  2UUA K;  1HNW K;  5IWA K;  2UU9 K;  4KHP K;  4AQY K;  1HNZ K;  4DV3 K;  4LF6 K;  4DUZ K;  4X66 K;  4JI2 K;  2ZM6 K;  4JYA K;  1XMQ K;  2UUC K;  4JI0 K;  1HR0 K;  4LFC K;  4DV7 K;  4JI5 K;  4JI1 K;  1I94 K;  4LFA K;  5FLX O;  4X64 K;  4DR6 K;  5AJ3 K;  3J7Y P;  3T1Y K;  4DR4 K;  1J5E K;  1IBM K;  1IBK K;  2VQE K;  4LF5 K;  5A2Q O;  4YY3 K;  4GKJ K;  5LMN K;  4JI3 K;  3J80 O;  5BR8 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...