4DV1O

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g, bound with streptomycin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
87
structure length
87
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 31
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4dv1O00
3T1HO 4DV4O 2UU9O 4B3TO 1F7YA 3J80N 4X66O 1N33O 1HNWO 1R1BA 3JAMN 4A5UB 4JI8O 2F4VO 3T1YO 2VQFO 1XMOO 4LFAO 1AILA 1I94O 1G1XB 4KHPO 4LF8O 5H5NA 4AQYO 4LF5O 4LF9O 4K0KO 5IWAO 2UXDO 1IBLO 4DR2O 3SDLA 4DV2O 3J7AU 4OX9O 1DK1A 4DR5O 4JI1O 4LFCO 2UUBO 1FYJA 2HHHO 3OTOO 4DUZO 4DV5O 3RT3C 1XEQA 1YZBA 1HR0O 2DOSA 3M8AA 5LMUO 4YY3O 4DUYO 1XNQO 1AB3A 1IBMO 4DR6O 4DV3O 1XNRO 3F5TA 1N34O 4DR4O 4JI3O 4NXNO 4X62O 1N36O 2E5LO 2UUAO 1X59A 4JI0O 2VQEO 4LF6O 1KUQA 4OPAA 1FJGO 1HNXO 4DV7O 2LW7A 5BY1A 5BXZA 2AGAA 4X65O 2DJVA 4DR3O 4JI6O 5FLXN 5LMNO 4B3SO 4JI2O 1D2DA 4GKJO 1J5EO 4DV1O 2UUCO 1NS1A 4NXMO 4JI5O 2UXBO 4B3MO 4X64O 4DR1O 1HNZO 1R6TA 1FKAO 2ZKOA 2N74A 4B3RO 4DV0O 2FKXA 3R66A 4LF4O 4LF7O 4DR7O 4JI7O 5A2QN 4DV6O 4LFBO 5BR8O 4JYAO 1A32A 1IBKO 2ZM6O 1XMQO 5IT9N 5LL6Y 3J81N 4YHHO 4GKKO 2Z0AA 2UXCO 3O65A 2JRIA 1N32O 4OPHA 4JV5O 4JI4O
chains in the Genus database with same CATH superfamily
4K35A 1YITV 4LCUC 3AG3C 5BZBA 4GKJB 4K8XA 2YIBD 3GWKC 3SJBC 1R73A 2YIDA 3ZS8C 3WFVA 1AR5A 1K33A 3JD1A 1R1BA 3HKBA 3IC7A 1SQVH 1PL0A 1VMGA 3K03A 3ZBHA 2ZT9B 2W0XA 5LMNB 3PJSK 3AG1C 3CEIA 3CMEV 1XHXA 2ODMA 3BHPA 3ETEA 2IU0A 5KUMA 2YEVA 1B06A 5IYDO 3DC5A 4X1KB 1XUQA 1UFIA 3TK1A 1GN2A 1XNQB 1HNZB 1CP9A 2R9RB 3UO2A 1NJIW 3LNMB 1Y6XA 4DV5B 1TVKA 4FLYA 3CRRA 1IBKB 3K9AA 3U0ZA 4DV3O 1SZTA 1MSDA 1QVGU 2XOKG 1M4UA 1V55C 4IYHA 5L3GA 1BGYH 3CC7V 2HEPA 5FNVA 4BR6A 3KCXA 3ICXA 2PGGA 4FJCC 2EIKB 4JI6O 5LMNO 2WLJA 1VF7A 3ML0A 3TXQA 1DGSA 2DQ3A 1NS1A 4MVUA 5JVDB 2ZCEA 1HNZO 4DR6B 2FB5A 3VQXA 4DV6O 4FLUA 3AG4C 1SQGA 4CH5A 2EIJC 5LP6A 1ZLZA 4MVRA 3SYCA 4OX9B 3P3PA 4GKKO 4FZ0A 1BMFG 2X0LA 4FM1A 3BABA 5JQGB 2UXCO 1TUEB 3BVOA 4YJ3B 3CD6V 1M56B 5EZYB 4KFMA 2UU9O 2B1GA 5GTIZ 1IX9A 3ZHRA 1KB9F 3HB3B 3HPLC 1XQ8A 3SJQC 3JAMN 3RYCA 2WLMA 2DYRC 5DN6G 3K5LA 2KSDA 1NTMH 4MVOA 4QIWF 3PN1A 1H2MA 1ZTEA 2KB1A 4AQYO 2PZSA 4LF9O 4X1YA 5IJ9A 4PA9A 4DV2O 4X1KA 1QHTA 3ABMC 2QJ1A 1KC8W 4X65B 4YY3B 4TSFG 5K1XA 4EFBA 3H01A 5B1BB 3C3TA 4WF9V 2RDCA 1TVKB 2E76B 1AB3A 3JSLA 5GONA 2BTQA 4CS2A 2ZDIC 3KKYA 2WPDG 4TOIA 2VWKA 1BE3H 5JCOC 2LW7A 4BIZA 5H6RA 4B3MB 2UXBB 2P7TC 5GTHZ 4I55A 2CE4A 3K79A 3MHHC 4PA4A 4LWSB 2WWWA 2YICA 4EFEA 1QLEB 4MVSA 2JK5C 2NN4A 3LSSA 4P2ZA 4DR1O 2EZPA 2QWQB 4DR7O 5B1NA 4DW0A 2VQFB 4MVMA 4TT3G 3RW0A 1K9MW 3SPIA 2Q9LA 1FPOA 2LO1A 3ABLB 4YJ3A 4LF7B 1N4CA 5JH7A 4CC6A 1U96A 1ENVA 4DR4B 3CRQA 1IURA 3KCYA 2FMLA 4ZI7B 4JI7B 3K04A 3F7VC 5B3SC 2DN9A 3G67A 3QTCA 3ABUA 2W6IG 3RGBA 4G27B 1K4CC 1YHQV 2VQFO 1XMOO 2B5UA 1KYOF 4X62B 4G28B 1TAEA 4N23A 1LNQA 2A79B 3ZRVA 1HDJA 3OR7C 4CH3A 1SQFA 4IHJA 4LFBB 1YCIA 4DRXA 4GX5A 3JARA 1DK1A 4DR5O 3CCVV 2XHBA 2Q0AA 1MNGA 2OCCC 4J11A 3E35A 1SESA 1WB7A 3MD0A 4MTGA 1D5AA 2Q73A 3CRMA 3H1LH 3K57A 4PELA 4UCVA 2RJZA 1R3JC 3GWOA 1N34O 2NNUA 2EIMB 1GM7A 4EEQA 5D5QA 1K3EA 1U97A 3MHSC 1K73W 4I55B 2ZE6A 3FD9A 2PYJA 4PI2A 1P84F 2QWNB 4LR3A 4X88A 5EBWC 4DV1O 3FYIB 2UUCO 4GKKB 5ITZA 5LP6C 2N74A 3E8HA 1GTOA 5LOVA 4LF6B 4DW1A 3ABLC 4W4KA 2RN9A 4JYBA 5JJJB 3DTUB 1BT8A 2F95B 4JYAO 3AG1B 2Y4UA 4X1YB 5EK0A 5HFLA 1JCHA 5IJ9B 5DECA 1YI2V 5BMVB 4FZ1A 5EIBC 4YHHB 3APQA 3L9DA 4WFGA 3D3IA 1SA0B 3I56V 2IJIA 4O4HB 1QLEC 3LSQA 4P30A 4JI0B 3AG2B 5B1AB 2AXTZ 1YDXA 3DXRB 3RBZA 4EKWA 1KD1W 5KHGA 2OT5A 4PHZA 4MSWC 1K5SA 4WFBV 1QCEA 1OCCB 2F23A 3APOA 1Q5OA 4RO2A 2LW1A 4LWSA 3OGCC 5JWPA 4CH4A 1EM1A 3C3SA 3ZRSA 2ETNA 2VRZA 5B1BC 3CRCA 4FMTA 1GH6A 2OIEA 2QGNA 3W7SA 3CE2A 4LFCO 1PM9A 2HHHO 3N2KB 3OTOO 4I50A 5EC1C 2Y0PA 1HR0O 3UT5B 1XNQO 2OWOA 1N8RW 2AW9A 1GM8A 5J2TB 4NXNO 4E2LA 3SPGA 5JH7B 1JOYA 3BA8A 4UXNA 1WJZA 4OPAA 2HVKC 2RNBA 4I9WA 4U3JB 1AR1B 4ZI7A 1YTFB 2UUCB 1XBLA 2QWPB 3JASB 4N21A 3ZHTA 3MAQA 1YXBA 4F6RB 1TGOA 5GW7A 1EZVH 1PKXA 4MTFA 3OEHG 5D5PA 1B04A 2XAHA 1X4TA 3OW2U 4LF7O 4WBNB 3F5WC 2ILMA 3X2QB 1GM9A 2UU9B 1BSMA 1NR7A 1E1RG 5EC2C 1R3IC 2ZE5A 4FLWA 2M7WA 5IY5B 5LP6B 1KKCA 2PTMA 5JJNB 3I55V 4B08A 4DXWA 1WB8A 1VQ9V 1S3JA 3ZHQA 2L6LA 2LGQA 1AI5A 1EZJA 3JD3A 2QDOA 4DV4O 1RM1C 1FD9A 2EULA 2F1MA 4YJ2B 5LBQA 4JASA 2O57A 2QKAA 2JGDB 4JTCB 5H9CA 3CCJV 3RYIB 2YXLA 2ZE7A 2BE3A 1N32B 2UXCB 1D5NA 1XMOB 1KKDA 2F93B 1BL8A 1G1XB 5JCOA 4J80A 5H5NA 3S3XA 1WA8A 3BFRA 1SS3A 3ZRWA 5IYCO 1VQMV 2P4KA 1IBLO 5L3FA 4JAUA 1KBHA 3N2KA 4DUYB 4YIOA 1PNMA 5IE9A 4GZRB 4X1IA 1H2NA 4DV2B 3JD0A 2P06A 1YZBA 3ZHUA 4NXNB 1K5QA 1H8HG 4JAVA 4R7CA 4TQFA 1OJHA 5LGNA 3K9SA 2QA4V 4J41A 1I0HA 2HLDG 3QO5A 4JI0O 3B4SA 2WLLB 1S72V 4U3JA 5BXZA 1Q90D 1VQNV 1NTKH 2HR3A 2IJKA 2GTAA 3OUSA 3EVKA 2EZOA 3WU2Z 3Q4HB 5CA0A 5KA6A 1J5EO 2XT9A 3VBBA 3FFQA 2UXBO 4B3MO 1HNXB 4FIPC 1KMIZ 2H94A 5BR8O 3CMAV 1Y76B 1N33B 4RUEA 1NR1A 3QO7A 3ZX6A 2LFSA 4ZIBA 1IDSA 4JTAB 1XOUA 4NKGB 3T1HO 3WB0A 1J5EB 2GSMB 4HAMA 1IBLB 1NU1H 4JI8B 2F4VB 4O4LB 4O2AB 2G38A 2XAFA 4O2BB 4UCTA 4FLZA 3RYIA 3BEHA 3FX7A 3T4ZA 2MW2B 4GYCB 3WB2A 1VQ7V 2RQ6A 1OCRC 3B8NA 2E75B 1N0NA 1IZ3A 1NI8A 2Y48A 3B77A 3JASA 2P6JA 3JAWB 1UJWB 3K0GA 2AZ0A 4I0XA 4K0KO 1BHAA 1I94B 1JQ0A 1M57B 2Q5ZA 3UM7A 5IYBO 1VQPV 3OMNB 1NKDA 4IGGA 2KG7B 1L1FA 4B7KA 3THOA 3WG7B 2ZNIA 2R9IA 1AP5A 1K4DC 4HYOA 2DMXA 2BTOA 2YSUB 1THZA 4CBCA 1K97A 1B3QA 4PDVA 2AGAA 1KP3A 3CCUV 5CA1A 1BZKA 2EX3A 1WP8A 3ZN1A 2JEXA 3TXSA 4GX1A 1R6TA 1FKAO 4B3RO 3OFNG 4BW5A 3R66A 3KZIZ 3FB8C 3CS5A 4UV9A 4KHPB 5BR8B 1VF6A 4WFAV 5LHGA 4J9ZB 1WA8B 5KHJA 1EN5A 1IBKO 4I0XB 3HKDB 4NB5A 1URFA 3JALA 1GN3A 4JF3A 1M9NA 4DR1B 1FJGB 1W0KG 5LHHA 2H3OA 2BCCH 2JRIA 1BS3A 2IH3C 3JYCA 2DYSB 2LGWA 3U10A 2N04A 3RYFA 1WNSA 4J42A 1PV0A 4TQDA 1NVPD 4D6TH 3TGUH 3ETGA 4FM0A 4R6ZA 3CC2V 2YIBA 5KMGB 2ZNJA 4UUJC 1VF5B 3HKCB 1EN4A 2CDYA 4PD4F 4LF8O 4JV5B 5IYZB 2OYQA 4U7OA 2F66C 1IXMA 4JGSA 2QE7G 3SDLA 1JR9A 2YC0A 3CWBH 3OUFA 4Z1VA 2Y0IA 1M56C 1JX9A 1S5LZ 5J2UA 2QTSA 3RT3C 3E89A 4F6EA 1H38A 2JDIG 3JALB 1FFXA 3OGIB 2XUMA 3ZHVA 1GK9A 2E5LO 1SRYA 3NR7A 1AROP 5F2VO 2EILB 4JI3B 4LH6A 1K7DA 3A2FA 4XDLA 4X65O 4CS3A 2AHYA 1NBMG 1P7GA 4H0LB 2M6YA 1H8EG 1OCZC 3M7MX 2KKWA 1HW7A 1XNRB 1M5IA 3SPJA 4OXSA 1QLNA 1GN6A 1S0VA 1KECA 4LNUB 3RYCB 5B1AC 3SYOA 1I5YA 4B7EA 3N2GA 4PI0A 3HKDA 1Y67A 2N05A 4O4JB 1PNLA 4DRXB 1M57C 5A9GA 1K92A 1N34B 3VQWA 5B3SB 4LF8B 4JV5O 3T2MA 3M99B 4FFBA 2NR5A 1RSOB 5LHIA 4ZOLA 4YJ2A 1N36B 3JD4A 2UUAB 1FFXB 2ADPA 4ZHQB 4DV3B 4I4TB 2JGDA 1Q43A 1SQQH 2OIGA 3AG4B 2K1EA 4MT8A 1AILA 1YTFD 3SYAA 4DV0B 4TV9A 3CRAA 3AK1A 5KUKA 4DR7B 3TCUA 2ADQB 4X8AA 3LSUA 4PDMA 2QKCA 2Q69A 1HP8A 4UVBA 4D7SA 1V54C 3SGIA 4DV5O 1US6A 1WP7A 4UCOA 2E74B 3UO3A 3T1YB 2JS3A 2ZINA 1MA1A 4DUYO 3D8CA 1GKFA 2Q67A 5KAFZ 5JVDA 5BMVA 2ZXWB 2A9HA 4DR4O 2D3OW 2BOBC 2VQEO 3DGEA 4JI6B 3HKEB 1M93A 4L8JA 4MVQA 4ICGA 4DR3O 5J9PC 3RYFB 4HBNA 2LQTA 3X2QC 4I4TA 3IAYA 4NYKA 4B3RB 1FXHA 4QPKA 4QGPA 2ZM6B 2DW4A 2FYUH 1CXZB 3N2GB 4H13B 1YVWA 2R70A 1MMMA 4JI2B 4DUZB 1WN7A 3RYHA 3HR0A 3JATA 4J7KA 2V7QG 2CTRA 1JMKC 5ITZB 2Z0AA 2JEUA 4HZ3A 2BOCC 4KL1A 5LOVB 2AZ2A 4FPPA 3SYQA 4DR5B 1WPXA 4I50B 2QM8A 3CHXA 4MTXA 2NLJC 1RP3B 1R6KA 1XI1A 3FB6C 1Z5VA 3T1HB 5J2TA 1S5HC 3B8MA 3FB7C 2RMKB 3JAKB 4JI8O 2F4VO 2PYLA 3BY6A 1Q8IA 2QM7A 1I94O 2Q68A 2P67A 3CB2A 4PA3A 2YXHA 3G6BA 5KX5A 1VQKV 1OHHG 1COWG 1AVMA 1PPJH 1VP7A 5CN0A 1FXKA 2UXNA 4IYIA 2ITDC 2PF4E 1Q6UA 2ZDIA 2GUZB 3E22A 3A8TA 2CTWA 2KG7A 3ETQA 4DV4B 3ABKC 1DF4A 3ZRXA 2A0LA 4X66B 3JATB 1VQ8V 1YEWA 2WLKA 3K5NA 3HKEA 3L73H 4DR3B 2VS0A 2L35A 1G6UA 1XREA 4JPRA 4P9PA 1GMGA 5FLXN 1HR0B 3ZMZA 3K59A 1FXKC 4BIOA 1E1QG 4WFEA 2JIZG 2XAGA 2Q6AA 1ROPA 2UUBB 4DV0O 1VEWA 1OCRB 4CZZA 3TETA 1S77D 1NH2B 1SF9A 4RUFA 1A32A 3D36C 3FAVB 4DK1A 4GT1A 4QE7A 1Y66A 2W0FC 1RPOA 3DSQA 4DR2B 1SQBH 5EBMC 4NTWA 5EYPA 4E4EA 2ZQMA 3LNNA 2EIJB 3JD2A 2GUZA 4DV7B 1FS0G 1BQZA 1CPYA 3ZMTA 2P4VA 4B3TO 2HJFC 1XHZA 3RVZA 4RQFA 3VQVA 4LC1A 1NQTA 3LDCA 2ZXWC 2IJJA 3G6EV 4P9OA 3ASOB 2UXDB 2JGUA 1SQPH 3ZHSA 3ASNB 3OAAG 1SERA 2EILC 2XNDG 4JZ2A 3ZCCA 2VQEB 1ZX3A 2X7RB 4GLXA 1Q82W 1L8DA 3L75H 3F7YC 4PA6A 1N0JA 1XILA 2KQXA 3KG2A 4X89A 5CBFA 1W2BU 4QPJA 3QVNA 2WLNA 2DOSA 2JJ2G 3A0RA 3E8FA 1QQCA 4JAAA 2QSAA 4NVPA 1ZWIC 1XNRO 3P32A 3CCEV 1MSWD 3CCMV 1MOFA 2GBOA 1K8AW 3OMIB 2DQ0A 5KAIZ 4I9QA 3OMAB 5E79Z 4B3SO 3QG5A 2YI9A 1Y74A 4CS4A 2Q8VA 5KHKA 3JCUZ 3K08A 2XAJA 2EIMC 4BIUA 3ZMSA 5L3BA 3CJHA 5LGUA 3L74H 3CX5F 2ARHA 1I7FA 3EFFK 5FPOA 5IWAB 5FNVB 3NXSA 3ZIAG 3ZRWB 4RQEA 3UKMA 4YHHO 1I08A 1BHBA 5EYPB 3G80A 2Y69B 4BAYA 4Z2WA 3JSNA 5LGTA 3ZN0A 4FFBB 1Y76A 4L87A 2Z5UA 3BRCA 1NH2D 3H1KH 1TUBA 1ORQC 3AG7A 3H1IH 1L0NH 2CGOA 3RVYA 3IGAC 1BQ0A 1AI4A 4LFAO 1VQLV 2P5OA 4DV6B 1H2KA 3CCLV 4KHPO 3H9VA 4H33A 5IWAO 4JYCA 3VOUA 3OT7A 1M1KW 2YS8A 2PY5A 3AEIA 3J7AU 2DYRB 2B9ZA 4PV1B 5KHIA 4C7UA 4O4IA 4JI1O 1XL6A 3WG7C 1H2LA 2V4DA 1WAZA 4IIJA 4LH7A 3L70H 3OTFA 3P30A 1DLBA 4DO2A 1F4NA 5CA3A 4NXMB 2RCVA 1K34A 4WBNA 2WLIB 4IL6Z 4J7ZA 4GCZA 3K5OA 2JJ1G 2EJ7A 4O4LA 1P4RA 4O2BA 4CC5A 3E8BA 4OGQB 1D2DA 4GKJO 3FKSG 5GONB 3AK2A 4UCSA 4UB6Z 4X64O 5LA6B 4DK0A 2IU3A 1VQ5V 2FKXA 3D3QA 3UQ8A 4JZGA 5DM6V 4Q20A 4J10A 4PDRA 4FLVA 4PDLA 2P90A 5IYZA 2OTLV 3T4DA 2ZM6O 1W0JG 5C8YB 3GVMA 3G71V 4XDKA 5CA1B 3AG2C 5FL7G 2JVDA 5H2FZ 1V55B 5KLVH 4K0KB 1FXVA 3CCRV 1AR4A 3ABTA 3SR2C 2H8PC 4JYYA 4WCEV 4FLTA 4QE9A 4B3TB 1AJPA 3K58A 1LUWA 1GAXA 1VQ4V 1RFYA 4G2KA 4A5UB 3RN4A 4J7JA 4AHCA 2A3QA 4K8ZA 5CBHA 4FFKA 4MW8A 5CMUA 1FFTB 2Z3YA 2WLHA 4O4IB 4OX9O 3CJHB 1JFFA 4QNHB 4LNUA 1XMQB 4LFCB 4R8CA 2WLLA 2ZD9A 5IDJA 1XEQA 3HKCA 2ZIOA 3M8AA 3Q4HA 4AILC 3D36A 4TV8B 5C8YA 4IHJB 4DR6O 2IW5A 3F5TA 1N36O 2UUAO 1X59A 3IFXA 1XDCA 1FJGO 2JS5A 4AQYB 5BY1A 4MTOA 1BCCH 3E86A 1TUBB 5K1PA 1JPXA 2YEVB 3OE7G 4GX0A 3SJCC 4PJ0Z 1AJQA 4LF4O 2IH1C 5KMGA 3IJ4A 1SKVA 5CB4A 1RM1B 3E83A 3FAVA 2FTKA 3QNEA 3VQYA 2WA4A 1VF6C 4X20B 5IY5C 4BW9A 1N32O 4OPHA 1S76D 5J2UB 4FLXA 2QKSA 4UVAA 1DTOA 4NR1A 3FYEB 1SC5B 2E5LB 1S5JA 1OV9A 1SETA 2QTOA 5B1OA 2DWDC 1P49A 2WLIA 4H37A 2Q4PA 4LFAB 2V1DA 2GHYA 2ATKC 5KA5A 2CGNA 1PD3A 3FB5C 1SA0A 3CCSV 2CAZC 1PP9H 1QR8A 3W7TA 1VARA 1G8MA 3I5DA 1O9GA 2C2AA 4AI8A 3U11A 4LF5O 2PUSA 1ZUQA 4ZOLB 3DXRA 2YIAA 1J95A 2UXDO 3STZC 1GO3F 4DR2O 1EBOA 2OCCB 4JI4B 3L71H 1YF2A 4JI1B 1FYJA 2CTPA 3OM3B 1GN4A 2F43G 1NZ6A 2X6AA 4Q6GA 1ZSPA 1G4YB 4TV8A 4FK5C 4TV9B 5LXTB 2HHHB 3LUTB 4TWKA 4O4JA 4U7NA 4NTXA 4MS2A 4X62O 1Q6IA 2HG5C 4CH6A 1I5XA 3H1JH 1HNXO 1LUVA 2YI8A 1NVPB 2EJRA 3QO8A 4UB8Z 3AK3A 5LMUB 1E79G 3UT5A 1VQ6V 1AP6A 1OCOB 1WLEA 1XL4A 2EIKC 2ZKOA 3JAKA 5L3EA 4ABMA 1H2GA 2BSKA 3K0DA 3RWRD 1KP2A 1EFRG 1XMQO 1MG1A 1F4MA 3R65A 4W4LA 2W6JG 4RWUA 4X20A 1Z5WA 3O65A 2ZR2A 4H44B 5CBGA 4JI4O 2HJDA 4JYAB 5C93A 3ZMVA 5IJ0B 2OCHA 4B3SB 1FAFA 4BWAA 4KUMA 3OD4A 3RYHB 2WAMA 4UV8A 1R3KC 3JARB 1GRJA 1HNWO 4LP8A 3O9OA 1IBMB 4DV1B 4X9QA 1Q81W 5JJEB 5L3DA 1YJWV 1YIJV 1H2SB 2ZE8A 1T5EA 5KHHA 3W7XA 2B1IA 2IJHA 2DWEC 2GV9A 3DC6A 1CEZA 1R6NA 1F51A 2HP8A 3B09A 1YJNV 3ETDA 1LR1A 5H6QA 2A7WA 5CB4B 4DUZO 4JTDB 1Q6HA 3ABMB 4KP4A 1AI7A 2Y69C 4YXWG 5LXTA 4O4HA 5KX5B 4LF4B 1JVMA 4WFFA 1IBMO 2D2CB 4ZKIA 4JI3O 1TA8A 2WSSG 1JJOA 1QR9A 3LDDA 4TUYB 1KUQA 2PI4A 3IC9A 1HNWB 1Z2GA 2DJVA 5IJ0A 3A0BZ 5LYJA 4JI2O 3SPHA 4I7ZB 4LBEC 4NXMO 3W7WA 5LA6A 4JI7O 4EB6B 2CUGA 5HFMA 1NT2B 5A2QN 1MZFA 2VWJA 1YJ9V 2Q0OC 1RSOA 1QNMA 4Z1MG 3ZMUA 1NTZH 4LFBO 4PA7A 3OTOB 2P22C 2EINC 2WA3A 3K3WA 4ZHQA 3CXCU 1FXKB 1Q86W 3AG3B 2YXYA 2ZR3A 4KXRA 1OZ0A 2ZIMA 1YSCA 1Q7YW 4QJFB 5EZYA 1KU9A 4JI5B 1WPBA 3E22B 1VQOV 3MDSA 3K06A 2A06H 3RFRA 2R72A 3C90A 4R50A 3JCZA 3J80N 3ASNC 5EBLC 4J9YB 3ZEDA 4XBFA 1SZXA 1QU7A 1IXBA 1AI6A 2Y4TA 5LYJB 2UXXA 1JA8A 2QWOB 1MABG 2CH7B 1PNKA 1EN6A 2YDEA 3SYPA 4LF9B 4I5SA 2BSKB 1JFFB 2GTSA 4EB6A 2DE0X 3T1CA 3EHBB 2EBOA 3E2EA 4MW3A 3JAWA 4YY3O 3OEEG 2IM9A 5L3CA 2PI5A 2XASA 3S3WA 3HKBB 2CK3G 1Y4MA 3B40A 1UPGA 3L72H 4DV7O 3CC4V 2YUAA 1M90W 2AHZA 1QBZA 2K9PA 2Q7GA 4NTYA 5FPRA 3K5MA 1V9PA 2DYSC 1Q3EA 4XDJA 1B6QA 3B2EE 1KQSU 4U3FH 5E1AC 1VIBA 2E3CA 4X1IB 1DF5A 3A0HZ 1ZL8A 2XTAA 3LDEA 4RAIA 4F4LA 4D7TA 1OCZB 2XAQA 3H1HH 3J81N 3ABKB 2CH7A 2LP7A 4UCUA 5DEDA 4WFHA 3BA9A 1MZEA 3E8GA 2LJ2A 4X64B 1RPRA 1L0LH 4HNAB 5AG2A 2HFEC 2R9AA 3CXHF 1R3LC 1HWYA 4DYLA 4F6RA 3SPCA 1SQXH 1F7YA 4UVCA 3OR6C 4X66O 3UCSC 1N33O 4FVMA 3CP1A 3GB7C 2OTJV 4TUYA 3T1YO 2GDSA 4UCRA 3CYOA 4UFZA 3G4SV 1V54B 3WB1A 1W59A 1Y74B 2QWRB 1IVSA 2HKOA 3P3NA 4K3AA 3TJTA 5EIBD 4IT5A 3STLC 4LF5B 3QF7A 2UUBO 5JQGA 2Q7HA 5B5EZ 2IBZH 1P7BA 3EXAA 4GX2A 2Q7EA 2X6BA 2FL4A 5LMUO 2X6CA 5CA0B 3BPZA 5TISZ 5B66Z 2EINB 2LFRA 2CTQA 3SJAC 2HVJC 3BAAA 1OCOC 4LF6O 3CCQV 3CSXA 3CPWU 4IIJB 1F23A 2ITCC 4JI5O 4YIPA 2QR4A 4FM2A 1ZL8B 4ASUG 4MVZA 1JJ2U 1QVFU 1AJNA 3W7UA 4ZBMA 1OCCC 4O2AA 4GUNA 2QEXV 5IT9N 5LL6Y 3ASOC 2BTQB 3BCCH 1PL4A 2MK3A 1O9HA 2QM4A 3N27A 1ZAUA 3ZJZA 4HNAA
chains in the Genus database with same CATH topology
3T1HO 4DV4O 2UU9O 4B3TO 1F7YA 3J80N 4X66O 1N33O 1HNWO 1R1BA 3JAMN 4A5UB 4JI8O 2F4VO 3T1YO 2VQFO 1XMOO 4LFAO 1AILA 1I94O 1G1XB 4KHPO 4LF8O 5H5NA 4AQYO 4LF5O 4LF9O 4K0KO 5IWAO 2UXDO 1IBLO 4DR2O 3SDLA 4DV2O 3J7AU 4OX9O 1DK1A 4DR5O 4JI1O 4LFCO 2UUBO 1FYJA 2HHHO 3OTOO 4DUZO 4DV5O 3RT3C 1XEQA 1YZBA 1HR0O 2DOSA 3M8AA 5LMUO 4YY3O 4DUYO 1XNQO 1AB3A 1IBMO 4DR6O 4DV3O 1XNRO 3F5TA 1N34O 4DR4O 4JI3O 4NXNO 4X62O 1N36O 2E5LO 2UUAO 1X59A 4JI0O 2VQEO 4LF6O 1KUQA 4OPAA 1FJGO 1HNXO 4DV7O 2LW7A 5BY1A 5BXZA 2AGAA 4X65O 2DJVA 4DR3O 4JI6O 5FLXN 5LMNO 4B3SO 4JI2O 1D2DA 4GKJO 1J5EO 4DV1O 2UUCO 1NS1A 4NXMO 4JI5O 2UXBO 4B3MO 4X64O 4DR1O 1HNZO 1R6TA 1FKAO 2ZKOA 2N74A 4B3RO 4DV0O 2FKXA 3R66A 4LF4O 4LF7O 4DR7O 4JI7O 5A2QN 4DV6O 4LFBO 5BR8O 4JYAO 1A32A 1IBKO 2ZM6O 1XMQO 5IT9N 5LL6Y 3J81N 4YHHO 4GKKO 2Z0AA 2UXCO 3O65A 2JRIA 1N32O 4OPHA 4JV5O 4JI4O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1H O;  4DV4 O;  2UU9 O;  4B3T O;  1F7Y A;  3J80 N;  4X66 O;  1N33 O;  1HNW O;  1R1B A;  3JAM N;  4A5U B;  4JI8 O;  2F4V O;  3T1Y O;  2VQF O;  1XMO O;  4LFA O;  1AIL A;  1I94 O;  1G1X B;  4KHP O;  4LF8 O;  5H5N A;  4AQY O;  4LF5 O;  4LF9 O;  4K0K O;  5IWA O;  2UXD O;  1IBL O;  4DR2 O;  3SDL A;  4DV2 O;  3J7A U;  4OX9 O;  1DK1 A;  4DR5 O;  4JI1 O;  4LFC O;  2UUB O;  1FYJ A;  2HHH O;  3OTO O;  4DUZ O;  4DV5 O;  3RT3 C;  1XEQ A;  1YZB A;  1HR0 O;  2DOS A;  3M8A A;  5LMU O;  4YY3 O;  4DUY O;  1XNQ O;  1AB3 A;  1IBM O;  4DR6 O;  4DV3 O;  1XNR O;  3F5T A;  1N34 O;  4DR4 O;  4JI3 O;  4NXN O;  4X62 O;  1N36 O;  2E5L O;  2UUA O;  1X59 A;  4JI0 O;  2VQE O;  4LF6 O;  1KUQ A;  4OPA A;  1FJG O;  1HNX O;  4DV7 O;  2LW7 A;  5BY1 A;  5BXZ A;  2AGA A;  4X65 O;  2DJV A;  4DR3 O;  4JI6 O;  5FLX N;  5LMN O;  4B3S O;  4JI2 O;  1D2D A;  4GKJ O;  1J5E O;  4DV1 O;  2UUC O;  1NS1 A;  4NXM O;  4JI5 O;  2UXB O;  4B3M O;  4X64 O;  4DR1 O;  1HNZ O;  1R6T A;  1FKA O;  2ZKO A;  2N74 A;  4B3R O;  4DV0 O;  2FKX A;  3R66 A;  4LF4 O;  4LF7 O;  4DR7 O;  4JI7 O;  5A2Q N;  4DV6 O;  4LFB O;  5BR8 O;  4JYA O;  1A32 A;  1IBK O;  2ZM6 O;  1XMQ O;  5IT9 N;  5LL6 Y;  3J81 N;  4YHH O;  4GKK O;  2Z0A A;  2UXC O;  3O65 A;  2JRI A;  1N32 O;  4OPH A;  4JV5 O;  4JI4 O; 
#chains in the Genus database with same CATH topology
 4K35 A;  1YIT V;  4LCU C;  3AG3 C;  5BZB A;  4GKJ B;  4K8X A;  2YIB D;  3GWK C;  3SJB C;  1R73 A;  2YID A;  3ZS8 C;  3WFV A;  1AR5 A;  1K33 A;  3JD1 A;  1R1B A;  3HKB A;  3IC7 A;  1SQV H;  1PL0 A;  1VMG A;  3K03 A;  3ZBH A;  2ZT9 B;  2W0X A;  5LMN B;  3PJS K;  3AG1 C;  3CEI A;  3CME V;  1XHX A;  2ODM A;  3BHP A;  3ETE A;  2IU0 A;  5KUM A;  2YEV A;  1B06 A;  5IYD O;  3DC5 A;  4X1K B;  1XUQ A;  1UFI A;  3TK1 A;  1GN2 A;  1XNQ B;  1HNZ B;  1CP9 A;  2R9R B;  3UO2 A;  1NJI W;  3LNM B;  1Y6X A;  4DV5 B;  1TVK A;  4FLY A;  3CRR A;  1IBK B;  3K9A A;  3U0Z A;  4DV3 O;  1SZT A;  1MSD A;  1QVG U;  2XOK G;  1M4U A;  1V55 C;  4IYH A;  5L3G A;  1BGY H;  3CC7 V;  2HEP A;  5FNV A;  4BR6 A;  3KCX A;  3ICX A;  2PGG A;  4FJC C;  2EIK B;  4JI6 O;  5LMN O;  2WLJ A;  1VF7 A;  3ML0 A;  3TXQ A;  1DGS A;  2DQ3 A;  1NS1 A;  4MVU A;  5JVD B;  2ZCE A;  1HNZ O;  4DR6 B;  2FB5 A;  3VQX A;  4DV6 O;  4FLU A;  3AG4 C;  1SQG A;  4CH5 A;  2EIJ C;  5LP6 A;  1ZLZ A;  4MVR A;  3SYC A;  4OX9 B;  3P3P A;  4GKK O;  4FZ0 A;  1BMF G;  2X0L A;  4FM1 A;  3BAB A;  5JQG B;  2UXC O;  1TUE B;  3BVO A;  4YJ3 B;  3CD6 V;  1M56 B;  5EZY B;  4KFM A;  2UU9 O;  2B1G A;  5GTI Z;  1IX9 A;  3ZHR A;  1KB9 F;  3HB3 B;  3HPL C;  1XQ8 A;  3SJQ C;  3JAM N;  3RYC A;  2WLM A;  2DYR C;  5DN6 G;  3K5L A;  2KSD A;  1NTM H;  4MVO A;  4QIW F;  3PN1 A;  1H2M A;  1ZTE A;  2KB1 A;  4AQY O;  2PZS A;  4LF9 O;  4X1Y A;  5IJ9 A;  4PA9 A;  4DV2 O;  4X1K A;  1QHT A;  3ABM C;  2QJ1 A;  1KC8 W;  4X65 B;  4YY3 B;  4TSF G;  5K1X A;  4EFB A;  3H01 A;  5B1B B;  3C3T A;  4WF9 V;  2RDC A;  1TVK B;  2E76 B;  1AB3 A;  3JSL A;  5GON A;  2BTQ A;  4CS2 A;  2ZDI C;  3KKY A;  2WPD G;  4TOI A;  2VWK A;  1BE3 H;  5JCO C;  2LW7 A;  4BIZ A;  5H6R A;  4B3M B;  2UXB B;  2P7T C;  5GTH Z;  4I55 A;  2CE4 A;  3K79 A;  3MHH C;  4PA4 A;  4LWS B;  2WWW A;  2YIC A;  4EFE A;  1QLE B;  4MVS A;  2JK5 C;  2NN4 A;  3LSS A;  4P2Z A;  4DR1 O;  2EZP A;  2QWQ B;  4DR7 O;  5B1N A;  4DW0 A;  2VQF B;  4MVM A;  4TT3 G;  3RW0 A;  1K9M W;  3SPI A;  2Q9L A;  1FPO A;  2LO1 A;  3ABL B;  4YJ3 A;  4LF7 B;  1N4C A;  5JH7 A;  4CC6 A;  1U96 A;  1ENV A;  4DR4 B;  3CRQ A;  1IUR A;  3KCY A;  2FML A;  4ZI7 B;  4JI7 B;  3K04 A;  3F7V C;  5B3S C;  2DN9 A;  3G67 A;  3QTC A;  3ABU A;  2W6I G;  3RGB A;  4G27 B;  1K4C C;  1YHQ V;  2VQF O;  1XMO O;  2B5U A;  1KYO F;  4X62 B;  4G28 B;  1TAE A;  4N23 A;  1LNQ A;  2A79 B;  3ZRV A;  1HDJ A;  3OR7 C;  4CH3 A;  1SQF A;  4IHJ A;  4LFB B;  1YCI A;  4DRX A;  4GX5 A;  3JAR A;  1DK1 A;  4DR5 O;  3CCV V;  2XHB A;  2Q0A A;  1MNG A;  2OCC C;  4J11 A;  3E35 A;  1SES A;  1WB7 A;  3MD0 A;  4MTG A;  1D5A A;  2Q73 A;  3CRM A;  3H1L H;  3K57 A;  4PEL A;  4UCV A;  2RJZ A;  1R3J C;  3GWO A;  1N34 O;  2NNU A;  2EIM B;  1GM7 A;  4EEQ A;  5D5Q A;  1K3E A;  1U97 A;  3MHS C;  1K73 W;  4I55 B;  2ZE6 A;  3FD9 A;  2PYJ A;  4PI2 A;  1P84 F;  2QWN B;  4LR3 A;  4X88 A;  5EBW C;  4DV1 O;  3FYI B;  2UUC O;  4GKK B;  5ITZ A;  5LP6 C;  2N74 A;  3E8H A;  1GTO A;  5LOV A;  4LF6 B;  4DW1 A;  3ABL C;  4W4K A;  2RN9 A;  4JYB A;  5JJJ B;  3DTU B;  1BT8 A;  2F95 B;  4JYA O;  3AG1 B;  2Y4U A;  4X1Y B;  5EK0 A;  5HFL A;  1JCH A;  5IJ9 B;  5DEC A;  1YI2 V;  5BMV B;  4FZ1 A;  5EIB C;  4YHH B;  3APQ A;  3L9D A;  4WFG A;  3D3I A;  1SA0 B;  3I56 V;  2IJI A;  4O4H B;  1QLE C;  3LSQ A;  4P30 A;  4JI0 B;  3AG2 B;  5B1A B;  2AXT Z;  1YDX A;  3DXR B;  3RBZ A;  4EKW A;  1KD1 W;  5KHG A;  2OT5 A;  4PHZ A;  4MSW C;  1K5S A;  4WFB V;  1QCE A;  1OCC B;  2F23 A;  3APO A;  1Q5O A;  4RO2 A;  2LW1 A;  4LWS A;  3OGC C;  5JWP A;  4CH4 A;  1EM1 A;  3C3S A;  3ZRS A;  2ETN A;  2VRZ A;  5B1B C;  3CRC A;  4FMT A;  1GH6 A;  2OIE A;  2QGN A;  3W7S A;  3CE2 A;  4LFC O;  1PM9 A;  2HHH O;  3N2K B;  3OTO O;  4I50 A;  5EC1 C;  2Y0P A;  1HR0 O;  3UT5 B;  1XNQ O;  2OWO A;  1N8R W;  2AW9 A;  1GM8 A;  5J2T B;  4NXN O;  4E2L A;  3SPG A;  5JH7 B;  1JOY A;  3BA8 A;  4UXN A;  1WJZ A;  4OPA A;  2HVK C;  2RNB A;  4I9W A;  4U3J B;  1AR1 B;  4ZI7 A;  1YTF B;  2UUC B;  1XBL A;  2QWP B;  3JAS B;  4N21 A;  3ZHT A;  3MAQ A;  1YXB A;  4F6R B;  1TGO A;  5GW7 A;  1EZV H;  1PKX A;  4MTF A;  3OEH G;  5D5P A;  1B04 A;  2XAH A;  1X4T A;  3OW2 U;  4LF7 O;  4WBN B;  3F5W C;  2ILM A;  3X2Q B;  1GM9 A;  2UU9 B;  1BSM A;  1NR7 A;  1E1R G;  5EC2 C;  1R3I C;  2ZE5 A;  4FLW A;  2M7W A;  5IY5 B;  5LP6 B;  1KKC A;  2PTM A;  5JJN B;  3I55 V;  4B08 A;  4DXW A;  1WB8 A;  1VQ9 V;  1S3J A;  3ZHQ A;  2L6L A;  2LGQ A;  1AI5 A;  1EZJ A;  3JD3 A;  2QDO A;  4DV4 O;  1RM1 C;  1FD9 A;  2EUL A;  2F1M A;  4YJ2 B;  5LBQ A;  4JAS A;  2O57 A;  2QKA A;  2JGD B;  4JTC B;  5H9C A;  3CCJ V;  3RYI B;  2YXL A;  2ZE7 A;  2BE3 A;  1N32 B;  2UXC B;  1D5N A;  1XMO B;  1KKD A;  2F93 B;  1BL8 A;  1G1X B;  5JCO A;  4J80 A;  5H5N A;  3S3X A;  1WA8 A;  3BFR A;  1SS3 A;  3ZRW A;  5IYC O;  1VQM V;  2P4K A;  1IBL O;  5L3F A;  4JAU A;  1KBH A;  3N2K A;  4DUY B;  4YIO A;  1PNM A;  5IE9 A;  4GZR B;  4X1I A;  1H2N A;  4DV2 B;  3JD0 A;  2P06 A;  1YZB A;  3ZHU A;  4NXN B;  1K5Q A;  1H8H G;  4JAV A;  4R7C A;  4TQF A;  1OJH A;  5LGN A;  3K9S A;  2QA4 V;  4J41 A;  1I0H A;  2HLD G;  3QO5 A;  4JI0 O;  3B4S A;  2WLL B;  1S72 V;  4U3J A;  5BXZ A;  1Q90 D;  1VQN V;  1NTK H;  2HR3 A;  2IJK A;  2GTA A;  3OUS A;  3EVK A;  2EZO A;  3WU2 Z;  3Q4H B;  5CA0 A;  5KA6 A;  1J5E O;  2XT9 A;  3VBB A;  3FFQ A;  2UXB O;  4B3M O;  1HNX B;  4FIP C;  1KMI Z;  2H94 A;  5BR8 O;  3CMA V;  1Y76 B;  1N33 B;  4RUE A;  1NR1 A;  3QO7 A;  3ZX6 A;  2LFS A;  4ZIB A;  1IDS A;  4JTA B;  1XOU A;  4NKG B;  3T1H O;  3WB0 A;  1J5E B;  2GSM B;  4HAM A;  1IBL B;  1NU1 H;  4JI8 B;  2F4V B;  4O4L B;  4O2A B;  2G38 A;  2XAF A;  4O2B B;  4UCT A;  4FLZ A;  3RYI A;  3BEH A;  3FX7 A;  3T4Z A;  2MW2 B;  4GYC B;  3WB2 A;  1VQ7 V;  2RQ6 A;  1OCR C;  3B8N A;  2E75 B;  1N0N A;  1IZ3 A;  1NI8 A;  2Y48 A;  3B77 A;  3JAS A;  2P6J A;  3JAW B;  1UJW B;  3K0G A;  2AZ0 A;  4I0X A;  4K0K O;  1BHA A;  1I94 B;  1JQ0 A;  1M57 B;  2Q5Z A;  3UM7 A;  5IYB O;  1VQP V;  3OMN B;  1NKD A;  4IGG A;  2KG7 B;  1L1F A;  4B7K A;  3THO A;  3WG7 B;  2ZNI A;  2R9I A;  1AP5 A;  1K4D C;  4HYO A;  2DMX A;  2BTO A;  2YSU B;  1THZ A;  4CBC A;  1K97 A;  1B3Q A;  4PDV A;  2AGA A;  1KP3 A;  3CCU V;  5CA1 A;  1BZK A;  2EX3 A;  1WP8 A;  3ZN1 A;  2JEX A;  3TXS A;  4GX1 A;  1R6T A;  1FKA O;  4B3R O;  3OFN G;  4BW5 A;  3R66 A;  3KZI Z;  3FB8 C;  3CS5 A;  4UV9 A;  4KHP B;  5BR8 B;  1VF6 A;  4WFA V;  5LHG A;  4J9Z B;  1WA8 B;  5KHJ A;  1EN5 A;  1IBK O;  4I0X B;  3HKD B;  4NB5 A;  1URF A;  3JAL A;  1GN3 A;  4JF3 A;  1M9N A;  4DR1 B;  1FJG B;  1W0K G;  5LHH A;  2H3O A;  2BCC H;  2JRI A;  1BS3 A;  2IH3 C;  3JYC A;  2DYS B;  2LGW A;  3U10 A;  2N04 A;  3RYF A;  1WNS A;  4J42 A;  1PV0 A;  4TQD A;  1NVP D;  4D6T H;  3TGU H;  3ETG A;  4FM0 A;  4R6Z A;  3CC2 V;  2YIB A;  5KMG B;  2ZNJ A;  4UUJ C;  1VF5 B;  3HKC B;  1EN4 A;  2CDY A;  4PD4 F;  4LF8 O;  4JV5 B;  5IYZ B;  2OYQ A;  4U7O A;  2F66 C;  1IXM A;  4JGS A;  2QE7 G;  3SDL A;  1JR9 A;  2YC0 A;  3CWB H;  3OUF A;  4Z1V A;  2Y0I A;  1M56 C;  1JX9 A;  1S5L Z;  5J2U A;  2QTS A;  3RT3 C;  3E89 A;  4F6E A;  1H38 A;  2JDI G;  3JAL B;  1FFX A;  3OGI B;  2XUM A;  3ZHV A;  1GK9 A;  2E5L O;  1SRY A;  3NR7 A;  1ARO P;  5F2V O;  2EIL B;  4JI3 B;  4LH6 A;  1K7D A;  3A2F A;  4XDL A;  4X65 O;  4CS3 A;  2AHY A;  1NBM G;  1P7G A;  4H0L B;  2M6Y A;  1H8E G;  1OCZ C;  3M7M X;  2KKW A;  1HW7 A;  1XNR B;  1M5I A;  3SPJ A;  4OXS A;  1QLN A;  1GN6 A;  1S0V A;  1KEC A;  4LNU B;  3RYC B;  5B1A C;  3SYO A;  1I5Y A;  4B7E A;  3N2G A;  4PI0 A;  3HKD A;  1Y67 A;  2N05 A;  4O4J B;  1PNL A;  4DRX B;  1M57 C;  5A9G A;  1K92 A;  1N34 B;  3VQW A;  5B3S B;  4LF8 B;  4JV5 O;  3T2M A;  3M99 B;  4FFB A;  2NR5 A;  1RSO B;  5LHI A;  4ZOL A;  4YJ2 A;  1N36 B;  3JD4 A;  2UUA B;  1FFX B;  2ADP A;  4ZHQ B;  4DV3 B;  4I4T B;  2JGD A;  1Q43 A;  1SQQ H;  2OIG A;  3AG4 B;  2K1E A;  4MT8 A;  1AIL A;  1YTF D;  3SYA A;  4DV0 B;  4TV9 A;  3CRA A;  3AK1 A;  5KUK A;  4DR7 B;  3TCU A;  2ADQ B;  4X8A A;  3LSU A;  4PDM A;  2QKC A;  2Q69 A;  1HP8 A;  4UVB A;  4D7S A;  1V54 C;  3SGI A;  4DV5 O;  1US6 A;  1WP7 A;  4UCO A;  2E74 B;  3UO3 A;  3T1Y B;  2JS3 A;  2ZIN A;  1MA1 A;  4DUY O;  3D8C A;  1GKF A;  2Q67 A;  5KAF Z;  5JVD A;  5BMV A;  2ZXW B;  2A9H A;  4DR4 O;  2D3O W;  2BOB C;  2VQE O;  3DGE A;  4JI6 B;  3HKE B;  1M93 A;  4L8J A;  4MVQ A;  4ICG A;  4DR3 O;  5J9P C;  3RYF B;  4HBN A;  2LQT A;  3X2Q C;  4I4T A;  3IAY A;  4NYK A;  4B3R B;  1FXH A;  4QPK A;  4QGP A;  2ZM6 B;  2DW4 A;  2FYU H;  1CXZ B;  3N2G B;  4H13 B;  1YVW A;  2R70 A;  1MMM A;  4JI2 B;  4DUZ B;  1WN7 A;  3RYH A;  3HR0 A;  3JAT A;  4J7K A;  2V7Q G;  2CTR A;  1JMK C;  5ITZ B;  2Z0A A;  2JEU A;  4HZ3 A;  2BOC C;  4KL1 A;  5LOV B;  2AZ2 A;  4FPP A;  3SYQ A;  4DR5 B;  1WPX A;  4I50 B;  2QM8 A;  3CHX A;  4MTX A;  2NLJ C;  1RP3 B;  1R6K A;  1XI1 A;  3FB6 C;  1Z5V A;  3T1H B;  5J2T A;  1S5H C;  3B8M A;  3FB7 C;  2RMK B;  3JAK B;  4JI8 O;  2F4V O;  2PYL A;  3BY6 A;  1Q8I A;  2QM7 A;  1I94 O;  2Q68 A;  2P67 A;  3CB2 A;  4PA3 A;  2YXH A;  3G6B A;  5KX5 A;  1VQK V;  1OHH G;  1COW G;  1AVM A;  1PPJ H;  1VP7 A;  5CN0 A;  1FXK A;  2UXN A;  4IYI A;  2ITD C;  2PF4 E;  1Q6U A;  2ZDI A;  2GUZ B;  3E22 A;  3A8T A;  2CTW A;  2KG7 A;  3ETQ A;  4DV4 B;  3ABK C;  1DF4 A;  3ZRX A;  2A0L A;  4X66 B;  3JAT B;  1VQ8 V;  1YEW A;  2WLK A;  3K5N A;  3HKE A;  3L73 H;  4DR3 B;  2VS0 A;  2L35 A;  1G6U A;  1XRE A;  4JPR A;  4P9P A;  1GMG A;  5FLX N;  1HR0 B;  3ZMZ A;  3K59 A;  1FXK C;  4BIO A;  1E1Q G;  4WFE A;  2JIZ G;  2XAG A;  2Q6A A;  1ROP A;  2UUB B;  4DV0 O;  1VEW A;  1OCR B;  4CZZ A;  3TET A;  1S77 D;  1NH2 B;  1SF9 A;  4RUF A;  1A32 A;  3D36 C;  3FAV B;  4DK1 A;  4GT1 A;  4QE7 A;  1Y66 A;  2W0F C;  1RPO A;  3DSQ A;  4DR2 B;  1SQB H;  5EBM C;  4NTW A;  5EYP A;  4E4E A;  2ZQM A;  3LNN A;  2EIJ B;  3JD2 A;  2GUZ A;  4DV7 B;  1FS0 G;  1BQZ A;  1CPY A;  3ZMT A;  2P4V A;  4B3T O;  2HJF C;  1XHZ A;  3RVZ A;  4RQF A;  3VQV A;  4LC1 A;  1NQT A;  3LDC A;  2ZXW C;  2IJJ A;  3G6E V;  4P9O A;  3ASO B;  2UXD B;  2JGU A;  1SQP H;  3ZHS A;  3ASN B;  3OAA G;  1SER A;  2EIL C;  2XND G;  4JZ2 A;  3ZCC A;  2VQE B;  1ZX3 A;  2X7R B;  4GLX A;  1Q82 W;  1L8D A;  3L75 H;  3F7Y C;  4PA6 A;  1N0J A;  1XIL A;  2KQX A;  3KG2 A;  4X89 A;  5CBF A;  1W2B U;  4QPJ A;  3QVN A;  2WLN A;  2DOS A;  2JJ2 G;  3A0R A;  3E8F A;  1QQC A;  4JAA A;  2QSA A;  4NVP A;  1ZWI C;  1XNR O;  3P32 A;  3CCE V;  1MSW D;  3CCM V;  1MOF A;  2GBO A;  1K8A W;  3OMI B;  2DQ0 A;  5KAI Z;  4I9Q A;  3OMA B;  5E79 Z;  4B3S O;  3QG5 A;  2YI9 A;  1Y74 A;  4CS4 A;  2Q8V A;  5KHK A;  3JCU Z;  3K08 A;  2XAJ A;  2EIM C;  4BIU A;  3ZMS A;  5L3B A;  3CJH A;  5LGU A;  3L74 H;  3CX5 F;  2ARH A;  1I7F A;  3EFF K;  5FPO A;  5IWA B;  5FNV B;  3NXS A;  3ZIA G;  3ZRW B;  4RQE A;  3UKM A;  4YHH O;  1I08 A;  1BHB A;  5EYP B;  3G80 A;  2Y69 B;  4BAY A;  4Z2W A;  3JSN A;  5LGT A;  3ZN0 A;  4FFB B;  1Y76 A;  4L87 A;  2Z5U A;  3BRC A;  1NH2 D;  3H1K H;  1TUB A;  1ORQ C;  3AG7 A;  3H1I H;  1L0N H;  2CGO A;  3RVY A;  3IGA C;  1BQ0 A;  1AI4 A;  4LFA O;  1VQL V;  2P5O A;  4DV6 B;  1H2K A;  3CCL V;  4KHP O;  3H9V A;  4H33 A;  5IWA O;  4JYC A;  3VOU A;  3OT7 A;  1M1K W;  2YS8 A;  2PY5 A;  3AEI A;  3J7A U;  2DYR B;  2B9Z A;  4PV1 B;  5KHI A;  4C7U A;  4O4I A;  4JI1 O;  1XL6 A;  3WG7 C;  1H2L A;  2V4D A;  1WAZ A;  4IIJ A;  4LH7 A;  3L70 H;  3OTF A;  3P30 A;  1DLB A;  4DO2 A;  1F4N A;  5CA3 A;  4NXM B;  2RCV A;  1K34 A;  4WBN A;  2WLI B;  4IL6 Z;  4J7Z A;  4GCZ A;  3K5O A;  2JJ1 G;  2EJ7 A;  4O4L A;  1P4R A;  4O2B A;  4CC5 A;  3E8B A;  4OGQ B;  1D2D A;  4GKJ O;  3FKS G;  5GON B;  3AK2 A;  4UCS A;  4UB6 Z;  4X64 O;  5LA6 B;  4DK0 A;  2IU3 A;  1VQ5 V;  2FKX A;  3D3Q A;  3UQ8 A;  4JZG A;  5DM6 V;  4Q20 A;  4J10 A;  4PDR A;  4FLV A;  4PDL A;  2P90 A;  5IYZ A;  2OTL V;  3T4D A;  2ZM6 O;  1W0J G;  5C8Y B;  3GVM A;  3G71 V;  4XDK A;  5CA1 B;  3AG2 C;  5FL7 G;  2JVD A;  5H2F Z;  1V55 B;  5KLV H;  4K0K B;  1FXV A;  3CCR V;  1AR4 A;  3ABT A;  3SR2 C;  2H8P C;  4JYY A;  4WCE V;  4FLT A;  4QE9 A;  4B3T B;  1AJP A;  3K58 A;  1LUW A;  1GAX A;  1VQ4 V;  1RFY A;  4G2K A;  4A5U B;  3RN4 A;  4J7J A;  4AHC A;  2A3Q A;  4K8Z A;  5CBH A;  4FFK A;  4MW8 A;  5CMU A;  1FFT B;  2Z3Y A;  2WLH A;  4O4I B;  4OX9 O;  3CJH B;  1JFF A;  4QNH B;  4LNU A;  1XMQ B;  4LFC B;  4R8C A;  2WLL A;  2ZD9 A;  5IDJ A;  1XEQ A;  3HKC A;  2ZIO A;  3M8A A;  3Q4H A;  4AIL C;  3D36 A;  4TV8 B;  5C8Y A;  4IHJ B;  4DR6 O;  2IW5 A;  3F5T A;  1N36 O;  2UUA O;  1X59 A;  3IFX A;  1XDC A;  1FJG O;  2JS5 A;  4AQY B;  5BY1 A;  4MTO A;  1BCC H;  3E86 A;  1TUB B;  5K1P A;  1JPX A;  2YEV B;  3OE7 G;  4GX0 A;  3SJC C;  4PJ0 Z;  1AJQ A;  4LF4 O;  2IH1 C;  5KMG A;  3IJ4 A;  1SKV A;  5CB4 A;  1RM1 B;  3E83 A;  3FAV A;  2FTK A;  3QNE A;  3VQY A;  2WA4 A;  1VF6 C;  4X20 B;  5IY5 C;  4BW9 A;  1N32 O;  4OPH A;  1S76 D;  5J2U B;  4FLX A;  2QKS A;  4UVA A;  1DTO A;  4NR1 A;  3FYE B;  1SC5 B;  2E5L B;  1S5J A;  1OV9 A;  1SET A;  2QTO A;  5B1O A;  2DWD C;  1P49 A;  2WLI A;  4H37 A;  2Q4P A;  4LFA B;  2V1D A;  2GHY A;  2ATK C;  5KA5 A;  2CGN A;  1PD3 A;  3FB5 C;  1SA0 A;  3CCS V;  2CAZ C;  1PP9 H;  1QR8 A;  3W7T A;  1VAR A;  1G8M A;  3I5D A;  1O9G A;  2C2A A;  4AI8 A;  3U11 A;  4LF5 O;  2PUS A;  1ZUQ A;  4ZOL B;  3DXR A;  2YIA A;  1J95 A;  2UXD O;  3STZ C;  1GO3 F;  4DR2 O;  1EBO A;  2OCC B;  4JI4 B;  3L71 H;  1YF2 A;  4JI1 B;  1FYJ A;  2CTP A;  3OM3 B;  1GN4 A;  2F43 G;  1NZ6 A;  2X6A A;  4Q6G A;  1ZSP A;  1G4Y B;  4TV8 A;  4FK5 C;  4TV9 B;  5LXT B;  2HHH B;  3LUT B;  4TWK A;  4O4J A;  4U7N A;  4NTX A;  4MS2 A;  4X62 O;  1Q6I A;  2HG5 C;  4CH6 A;  1I5X A;  3H1J H;  1HNX O;  1LUV A;  2YI8 A;  1NVP B;  2EJR A;  3QO8 A;  4UB8 Z;  3AK3 A;  5LMU B;  1E79 G;  3UT5 A;  1VQ6 V;  1AP6 A;  1OCO B;  1WLE A;  1XL4 A;  2EIK C;  2ZKO A;  3JAK A;  5L3E A;  4ABM A;  1H2G A;  2BSK A;  3K0D A;  3RWR D;  1KP2 A;  1EFR G;  1XMQ O;  1MG1 A;  1F4M A;  3R65 A;  4W4L A;  2W6J G;  4RWU A;  4X20 A;  1Z5W A;  3O65 A;  2ZR2 A;  4H44 B;  5CBG A;  4JI4 O;  2HJD A;  4JYA B;  5C93 A;  3ZMV A;  5IJ0 B;  2OCH A;  4B3S B;  1FAF A;  4BWA A;  4KUM A;  3OD4 A;  3RYH B;  2WAM A;  4UV8 A;  1R3K C;  3JAR B;  1GRJ A;  1HNW O;  4LP8 A;  3O9O A;  1IBM B;  4DV1 B;  4X9Q A;  1Q81 W;  5JJE B;  5L3D A;  1YJW V;  1YIJ V;  1H2S B;  2ZE8 A;  1T5E A;  5KHH A;  3W7X A;  2B1I A;  2IJH A;  2DWE C;  2GV9 A;  3DC6 A;  1CEZ A;  1R6N A;  1F51 A;  2HP8 A;  3B09 A;  1YJN V;  3ETD A;  1LR1 A;  5H6Q A;  2A7W A;  5CB4 B;  4DUZ O;  4JTD B;  1Q6H A;  3ABM B;  4KP4 A;  1AI7 A;  2Y69 C;  4YXW G;  5LXT A;  4O4H A;  5KX5 B;  4LF4 B;  1JVM A;  4WFF A;  1IBM O;  2D2C B;  4ZKI A;  4JI3 O;  1TA8 A;  2WSS G;  1JJO A;  1QR9 A;  3LDD A;  4TUY B;  1KUQ A;  2PI4 A;  3IC9 A;  1HNW B;  1Z2G A;  2DJV A;  5IJ0 A;  3A0B Z;  5LYJ A;  4JI2 O;  3SPH A;  4I7Z B;  4LBE C;  4NXM O;  3W7W A;  5LA6 A;  4JI7 O;  4EB6 B;  2CUG A;  5HFM A;  1NT2 B;  5A2Q N;  1MZF A;  2VWJ A;  1YJ9 V;  2Q0O C;  1RSO A;  1QNM A;  4Z1M G;  3ZMU A;  1NTZ H;  4LFB O;  4PA7 A;  3OTO B;  2P22 C;  2EIN C;  2WA3 A;  3K3W A;  4ZHQ A;  3CXC U;  1FXK B;  1Q86 W;  3AG3 B;  2YXY A;  2ZR3 A;  4KXR A;  1OZ0 A;  2ZIM A;  1YSC A;  1Q7Y W;  4QJF B;  5EZY A;  1KU9 A;  4JI5 B;  1WPB A;  3E22 B;  1VQO V;  3MDS A;  3K06 A;  2A06 H;  3RFR A;  2R72 A;  3C90 A;  4R50 A;  3JCZ A;  3J80 N;  3ASN C;  5EBL C;  4J9Y B;  3ZED A;  4XBF A;  1SZX A;  1QU7 A;  1IXB A;  1AI6 A;  2Y4T A;  5LYJ B;  2UXX A;  1JA8 A;  2QWO B;  1MAB G;  2CH7 B;  1PNK A;  1EN6 A;  2YDE A;  3SYP A;  4LF9 B;  4I5S A;  2BSK B;  1JFF B;  2GTS A;  4EB6 A;  2DE0 X;  3T1C A;  3EHB B;  2EBO A;  3E2E A;  4MW3 A;  3JAW A;  4YY3 O;  3OEE G;  2IM9 A;  5L3C A;  2PI5 A;  2XAS A;  3S3W A;  3HKB B;  2CK3 G;  1Y4M A;  3B40 A;  1UPG A;  3L72 H;  4DV7 O;  3CC4 V;  2YUA A;  1M90 W;  2AHZ A;  1QBZ A;  2K9P A;  2Q7G A;  4NTY A;  5FPR A;  3K5M A;  1V9P A;  2DYS C;  1Q3E A;  4XDJ A;  1B6Q A;  3B2E E;  1KQS U;  4U3F H;  5E1A C;  1VIB A;  2E3C A;  4X1I B;  1DF5 A;  3A0H Z;  1ZL8 A;  2XTA A;  3LDE A;  4RAI A;  4F4L A;  4D7T A;  1OCZ B;  2XAQ A;  3H1H H;  3J81 N;  3ABK B;  2CH7 A;  2LP7 A;  4UCU A;  5DED A;  4WFH A;  3BA9 A;  1MZE A;  3E8G A;  2LJ2 A;  4X64 B;  1RPR A;  1L0L H;  4HNA B;  5AG2 A;  2HFE C;  2R9A A;  3CXH F;  1R3L C;  1HWY A;  4DYL A;  4F6R A;  3SPC A;  1SQX H;  1F7Y A;  4UVC A;  3OR6 C;  4X66 O;  3UCS C;  1N33 O;  4FVM A;  3CP1 A;  3GB7 C;  2OTJ V;  4TUY A;  3T1Y O;  2GDS A;  4UCR A;  3CYO A;  4UFZ A;  3G4S V;  1V54 B;  3WB1 A;  1W59 A;  1Y74 B;  2QWR B;  1IVS A;  2HKO A;  3P3N A;  4K3A A;  3TJT A;  5EIB D;  4IT5 A;  3STL C;  4LF5 B;  3QF7 A;  2UUB O;  5JQG A;  2Q7H A;  5B5E Z;  2IBZ H;  1P7B A;  3EXA A;  4GX2 A;  2Q7E A;  2X6B A;  2FL4 A;  5LMU O;  2X6C A;  5CA0 B;  3BPZ A;  5TIS Z;  5B66 Z;  2EIN B;  2LFR A;  2CTQ A;  3SJA C;  2HVJ C;  3BAA A;  1OCO C;  4LF6 O;  3CCQ V;  3CSX A;  3CPW U;  4IIJ B;  1F23 A;  2ITC C;  4JI5 O;  4YIP A;  2QR4 A;  4FM2 A;  1ZL8 B;  4ASU G;  4MVZ A;  1JJ2 U;  1QVF U;  1AJN A;  3W7U A;  4ZBM A;  1OCC C;  4O2A A;  4GUN A;  2QEX V;  5IT9 N;  5LL6 Y;  3ASO C;  2BTQ B;  3BCC H;  1PL4 A;  2MK3 A;  1O9H A;  2QM4 A;  3N27 A;  1ZAU A;  3ZJZ A;  4HNA A; 
#chains in the Genus database with same CATH homology
 3T1H O;  4DV4 O;  2UU9 O;  4B3T O;  1F7Y A;  3J80 N;  4X66 O;  1N33 O;  1HNW O;  1R1B A;  3JAM N;  4A5U B;  4JI8 O;  2F4V O;  3T1Y O;  2VQF O;  1XMO O;  4LFA O;  1AIL A;  1I94 O;  1G1X B;  4KHP O;  4LF8 O;  5H5N A;  4AQY O;  4LF5 O;  4LF9 O;  4K0K O;  5IWA O;  2UXD O;  1IBL O;  4DR2 O;  3SDL A;  4DV2 O;  3J7A U;  4OX9 O;  1DK1 A;  4DR5 O;  4JI1 O;  4LFC O;  2UUB O;  1FYJ A;  2HHH O;  3OTO O;  4DUZ O;  4DV5 O;  3RT3 C;  1XEQ A;  1YZB A;  1HR0 O;  2DOS A;  3M8A A;  5LMU O;  4YY3 O;  4DUY O;  1XNQ O;  1AB3 A;  1IBM O;  4DR6 O;  4DV3 O;  1XNR O;  3F5T A;  1N34 O;  4DR4 O;  4JI3 O;  4NXN O;  4X62 O;  1N36 O;  2E5L O;  2UUA O;  1X59 A;  4JI0 O;  2VQE O;  4LF6 O;  1KUQ A;  4OPA A;  1FJG O;  1HNX O;  4DV7 O;  2LW7 A;  5BY1 A;  5BXZ A;  2AGA A;  4X65 O;  2DJV A;  4DR3 O;  4JI6 O;  5FLX N;  5LMN O;  4B3S O;  4JI2 O;  1D2D A;  4GKJ O;  1J5E O;  4DV1 O;  2UUC O;  1NS1 A;  4NXM O;  4JI5 O;  2UXB O;  4B3M O;  4X64 O;  4DR1 O;  1HNZ O;  1R6T A;  1FKA O;  2ZKO A;  2N74 A;  4B3R O;  4DV0 O;  2FKX A;  3R66 A;  4LF4 O;  4LF7 O;  4DR7 O;  4JI7 O;  5A2Q N;  4DV6 O;  4LFB O;  5BR8 O;  4JYA O;  1A32 A;  1IBK O;  2ZM6 O;  1XMQ O;  5IT9 N;  5LL6 Y;  3J81 N;  4YHH O;  4GKK O;  2Z0A A;  2UXC O;  3O65 A;  2JRI A;  1N32 O;  4OPH A;  4JV5 O;  4JI4 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...