4DV1O

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g, bound with streptomycin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
87
structure length
87
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 31
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4dv1O00
3RT3C 3F5TA 1X59A 1N34O 1A32A 1XNRO 2FKXA 4X65O 4JI8O 4YY3O 2UUBO 4JI4O 4B3SO 2JRIA 1R6TA 5LMUO 1XNQO 2DOSA 4JI5O 4A5UB 4OPAA 4OX9O 1FJGO 2HHHO 1IBKO 1YZBA 4K0KO 3T1YO 1IBLO 3T1HO 4DV1O 1HNWO 1DK1A 5BXZA 4DV7O 3M8AA 4JV5O 2UXCO 2UUAO 5FLXN 4YHHO 4X62O 4DV2O 4LF9O 1AILA 4JI1O 5IWAO 5LMNO 4AQYO 4DR5O 5H5NA 1N32O 4LF6O 4LF5O 4X66O 2E5LO 2UUCO 4DR6O 1G1XB 1HNXO 5A2QN 3J81N 1J5EO 4KHPO 4DR2O 2VQEO 4DUZO 4JI3O 4DV5O 4DR4O 4JYAO 5BR8O 2N74A 1F7YA 3O65A 2LW7A 1FYJA 4X64O 1R1BA 4DUYO 4DV3O 4LF7O 4LFBO 4JI7O 5BY1A 4GKKO 4DR1O 2ZM6O 1KUQA 1I94O 4LF4O 4LF8O 1NS1A 4LFCO 4NXNO 4B3MO 2UXDO 3J7AU 3J80N 2VQFO 5LL6Y 1FKAO 1N33O 1XEQA 3JAMN 4GKJO 2ZKOA 3R66A 5IT9N 4DV4O 2AGAA 2Z0AA 3OTOO 4OPHA 4JI0O 4JI2O 2DJVA 4B3RO 1AB3A 2UU9O 4LFAO 4DR7O 1XMQO 4DV0O 4DV6O 1IBMO 4B3TO 1HNZO 1D2DA 1XMOO 1N36O 1HR0O 2UXBO 4JI6O 2F4VO 4NXMO 3SDLA 4DR3O
chains in the Genus database with same CATH superfamily
4FFBA 4AHCA 2RJZA 3JSLA 2WSSG 2EJRA 3STLC 1VEWA 1FD9A 4YJ3A 3FYEB 3SPHA 1RM1C 1PD3A 1BQZA 1V54B 1EM1A 4A5UB 4IIJB 4JI1B 5J2TB 1E1QG 4MTGA 2KQXA 1PKXA 3ZCCA 4DV1B 2ZXWB 2R9IA 5LXTA 4EB6A 1SQPH 2LGQA 1S5LZ 1G8MA 3T1CA 1I94B 3ZRVA 4F6RB 1FS0G 2DQ0A 3H1IH 3FD9A 4DUYB 4ZOLB 1US6A 3FKSG 5BR8B 3T4ZA 3NR7A 5KA5A 3G6EV 2CE4A 4UCTA 3KG2A 3AG7A 2XAJA 3CCSV 2QWNB 4X1IA 4LF5B 1IVSA 1SERA 4J42A 1H2MA 2Q68A 4UFZA 1Q6HA 3U10A 3DGEA 4B3MO 3SPCA 3SGIA 1XUQA 3AEIA 4GKJB 3Q4HB 1N33B 3P3NA 4UCUA 1CEZA 1N0JA 5C8YB 3E22B 2KSDA 1V9PA 2P22C 1H2GA 2P7TC 3B09A 2IJKA 1H38A 4GUNA 2VWJA 4DR1B 2F66C 3CSXA 1YJNV 2V7QG 2DN9A 2UXBO 2EIJB 3ASNC 4FFBB 5LGNA 3MDSA 2OCCC 2B1GA 2ADPA 1M90W 1HNZB 3S3WA 5IJ0B 3RT3C 4PDMA 4HYOA 3E86A 4O2AB 3CE2A 5LP6B 2PF4E 4DR5B 1KQSU 1VQ6V 4JI5O 2Q0OC 4JAUA 4RAIA 3E83A 4H0LB 1YZBA 5B3SC 2GUZB 1AI4A 2A06H 3G71V 4YHHO 2EIJC 2JEUA 3L73H 4G2KA 4LF5O 2VWKA 1XQ8A 4UV9A 2UUCO 2Y0PA 1NH2B 3J81N 3OMNB 4X1YB 4K8ZA 1AR1B 3H9VA 1Q6UA 3CC7V 4DR3B 1R6KA 3JATA 2GTAA 2UXXA 5BR8O 3CCMV 1S72V 4PA9A 4ZIBA 2KKWA 3AK3A 4ZKIA 1XREA 4GCZA 4DUYO 4JZ2A 2P4VA 3HKDA 4DV6B 3EVKA 4L8JA 1VQ5V 1YJ9V 1MSWD 5KHIA 5AG2A 3ZJZA 3M7MX 4O2BA 3VBBA 1G6UA 4X20A 4J11A 1AR5A 1JJ2U 4WCEV 2QR4A 2YIDA 4OX9B 4DV4O 4B08A 5BMVB 2ZD9A 4UCVA 2RQ6A 4HNAA 4LFCB 2ZDIC 1DLBA 1Z5WA 3CEIA 4DV0O 5IYBO 1FXKC 4O4HA 2NNUA 1S5JA 4H33A 2ARHA 2WAMA 4U3FH 2PZSA 2QKCA 3JATB 4PI2A 1AR4A 1YF2A 3HB3B 5H9CA 1OV9A 2E5LB 2JRIA 2IJIA 2R9RB 2QEXV 1QLEB 1B06A 4OPAA 3TJTA 4F4LA 4EFBA 3DXRA 1N4CA 3GWKC 1GH6A 3H1JH 4B7KA 2UXCO 3QO7A 2HHHB 4DV2O 2IH3C 3RYHB 5LMNO 3SJQC 3N2GA 4DV3B 4MVZA 1L8DA 4R50A 2UUBB 2QTOA 2Y48A 3HKBB 4L87A 1FXKB 3A2FA 3ICXA 3P30A 4I55B 4UCSA 2E76B 4DRXA 1OCCB 4QPKA 3SPGA 3K5NA 1ZSPA 4YIPA 4F6RA 2PI5A 2A0LA 1PM9A 2BTOA 2HVKC 4DR1O 2RNBA 5LHHA 1VQ7V 4JTAB 5LP6A 1VARA 4J7JA 3CC4V 3JARA 1WLEA 3FB5C 2QWRB 3SJAC 3CC2V 2NLJC 1BGYH 1SZTA 1FJGB 2VQFB 1SQVH 1Q6IA 4B3MB 2YIBA 1VF5B 2KB1A 2EJ7A 3K9AA 4QGPA 4U3JA 3A0RA 4NTYA 1W59A 4IHJA 4TUYA 3ETDA 1K9MW 4FM0A 3DC6A 3CMAV 2Y0IA 1KD1W 4X89A 2ZNIA 1NU1H 1NR1A 3BA9A 1E79G 3IFXA 3RW0A 1OCZB 3K04A 3DC5A 1VIBA 2DE0X 2DYSB 1KKCA 1OCCC 2LGWA 4QE9A 2HJDA 4N21A 3AG3C 4BAYA 4BW9A 4GX2A 1FJGO 2JGDA 3BHPA 1S0VA 1IBLO 4TT3G 1VP7A 4G28B 4J7ZA 3CRAA 1YDXA 3G67A 1Q82W 1HP8A 3K5LA 1QQCA 4JI1O 2ZR3A 1QLNA 3VQWA 4JI7B 3JALB 5LBQA 4GT1A 4X88A 2Q73A 1IX9A 1G1XB 1YSCA 4DR4O 3P3PA 4YJ2A 4OXSA 3ABLB 1JPXA 3SR2C 1F7YA 1N36B 3A0BZ 3ZN0A 1FYJA 4UCOA 5KUMA 5IY5C 1KMIZ 1MOFA 5BY1A 3JCUZ 2HKOA 2V4DA 5C8YA 5IWAB 3OR6C 4LFAB 2EBOA 3ZHTA 3K08A 4NYKA 1I5YA 3ZBHA 3LDDA 1TAEA 3W7SA 4IGGA 1IXMA 4HAMA 5J2UB 3WFVA 2ZKOA 1SQFA 4C7UA 1OJHA 2P67A 3RYCA 3CCQV 5KAFZ 4JAVA 4LFAO 4EKWA 3HKEA 2ZIMA 2F23A 2A3QA 3N2GB 2YEVB 2H3OA 3ETQA 1N36O 2R70A 2ATKC 3ZIAG 2HFEC 3PN1A 3BFRA 1GO3F 4I9WA 1V55C 4TSFG 4X65O 2GUZA 4FM1A 1R6TA 3H01A 5A9GA 2M6YA 2ODMA 5IYDO 2WLMA 1K5QA 4OGQB 3WU2Z 5CB4B 1I7FA 2NR5A 2EIKC 2CAZC 1ZTEA 2QGNA 2ZE8A 3SPJA 3UM7A 3T1HO 3T1YB 3Q4HA 1QR9A 3EFFK 3VQVA 2XAHA 3ABKC 2OIEA 2LP7A 5FLXN 1L0LH 4NTXA 3RYCB 5KMGA 2D2CB 5CA0B 4LF6O 4ABMA 3CRQA 1VF6C 4I50A 1AJQA 1QU7A 3M99B 2YS8A 4JYAB 3SJCC 5EC1C 4DK1A 1M57C 2N74A 3I56V 2GDSA 4WFHA 2JIZG 5LOVA 1XL6A 1JMKC 2BTQA 1R1BA 4JYBA 4KL1A 3CCUV 2JGDB 4O4IB 3ABKB 2F1MA 1WP7A 1QLEC 4CBCA 1OCOC 3OTFA 2IM9A 1NVPD 5JVDA 1GM8A 3ZHRA 3A8TA 2B5UA 2H94A 4JI5B 1JJOA 3SYPA 5LA6A 3OTOO 1FFTB 1TUBB 2JS5A 2WLLB 4J9YB 3CXHF 2QJ1A 3QF7A 3K0GA 3CX5F 3ZEDA 4PV1B 2YXHA 3OEHG 3JCZA 1DF5A 4PELA 1MZEA 5B1BB 4JI6B 3JD0A 4FM2A 2Q5ZA 4TQDA 4TOIA 5CA3A 1K5SA 3C3SA 5L3DA 4PDVA 3F5TA 1GN4A 5GONB 1J5EB 1A32A 4MTXA 2IU0A 1EBOA 3A0HZ 2WLLA 4K35A 2NN4A 3QNEA 3HR0A 1AI7A 4X1KA 1EFRG 5LMNB 2OTJV 2HHHO 1M4UA 4DK0A 4G27B 1Y4MA 3JAWB 4KFMA 3E8HA 2BCCH 1X4TA 1JOYA 3CB2A 1MSDA 1GM9A 3CCEV 1IXBA 3KCXA 4X66O 4X64B 2BE3A 2PYJA 4JI8B 3FB8C 4P9OA 1N34B 1RFYA 4FPPA 1JX9A 3JSNA 5K1XA 1D5AA 3X2QB 1AP5A 1HR0B 2LW7A 2JGUA 1URFA 2ADQB 4BIZA 3TCUA 2HJFC 3QTCA 2AZ2A 3R65A 2EULA 1I94O 4MW8A 1THZA 3ASOC 3SYCA 1NS1A 3LSUA 4MS2A 3ABLC 3ML0A 1NR7A 5LXTB 4E2LA 4TV8B 3SYOA 2CTRA 5LL6Y 4LNUB 3R66A 3G4SV 2R72A 3CRRA 2YI8A 4B3RO 1AB3A 4W4KA 2LJ2A 3G6BA 4DV6O 1SQGA 2QA4V 1H2LA 2IW5A 4TV9A 2MW2B 3TETA 1JFFA 3KZIZ 2FB5A 4GLXA 1HR0O 3UO3A 3ASOB 1COWG 1SF9A 2WWWA 3RWRD 3CD6V 1PL0A 1OCRB 4PJ0Z 2EZOA 5JQGA 1KBHA 3L9DA 4JI8O 1SESA 1Y76B 3X2QC 2UUCB 3RYIB 2IJHA 5DECA 1S76D 1UFIA 5FPOA 1XNQO 4J80A 4U3JB 4D6TH 2R9AA 2K9PA 4K8XA 1IURA 3LSSA 1EN5A 2HG5C 4X62O 3RYFA 2LQTA 2N04A 3CS5A 4DR5O 1H2NA 1SS3A 4MT8A 5H5NA 3ZMVA 1BMFG 1N32O 1K73W 4DR6O 1GM7A 4JGSA 3O9OA 1F4MA 1FFXA 2LFRA 3W7WA 1SRYA 2CGOA 5B1AC 2Y4UA 3K57A 4DUZB 5B1NA 4JASA 4UV8A 3K5OA 4WFBV 4DW1A 5KMGB 3D3IA 3ZHVA 2GSMB 2YEVA 2W0FC 3BCCH 3RBZA 4AQYB 1XMQB 1GN3A 2XAGA 2B1IA 3BEHA 5HFLA 2UXDO 3OAAG 1O9HA 3RFRA 1N33O 1XDCA 4AI8A 2WLJA 2YC0A 2G38A 5KX5B 3BPZA 5LMUB 5JCOA 1WPXA 2L35A 5EZYB 4LF8B 1P7GA 4FVMA 1IBMO 4I9QA 4LFBB 2WA3A 4R6ZA 3ETEA 5D5QA 1SKVA 1VF6A 3AK2A 1XMOO 3JASA 4RUFA 4WFEA 1LUVA 3L74H 3K3WA 3F5WC 3LUTB 4FZ1A 2FYUH 2HP8A 3UT5B 3OR7C 2WA4A 5ITZB 4RQEA 4LF6B 3D3QA 5KX5A 1NQTA 4NKGB 4DYLA 3FAVB 2CTQA 3BVOA 1M1KW 1IBKO 4DV7B 3E8GA 1PNMA 4KXRA 4HNAB 4K0KO 1F23A 3K59A 3T1HB 4FLTA 3P32A 4U7OA 3HKCA 1VQLV 3N2KA 1E1RG 3TK1A 2QDOA 1BSMA 4GKKB 5B1AB 4J9ZB 3OGCC 1I5XA 4XDJA 4P9PA 5BZBA 4H13B 1NI8A 3ZMUA 3K5MA 4ICGA 1L1FA 1PP9H 1LUWA 2X7RB 1N32B 3CHXA 3FFQA 5L3GA 2Q0AA 5F2VO 4K3AA 4NTWA 4DV2B 1W0KG 2BOBC 2EIKB 5LYJB 1M5IA 4D7SA 2DQ3A 2P4KA 1MZFA 3E8FA 5FPRA 4N23A 2AHYA 4PA4A 4BWAA 5CA1A 1SZXA 5JJJB 2VRZA 2AW9A 2QM8A 2YUAA 3F7YC 3OEEG 2ITDC 2Q69A 2DJVA 4JZGA 1Q8IA 3K58A 3RVZA 2OWOA 2A9HA 4BW5A 1ZAUA 3CJHB 3W7UA 5LGTA 4TV8A 2A7WA 3K06A 4X8AA 4PA3A 5KHHA 3TXQA 2ZIOA 4LWSB 1EZVH 4YXWG 4U7NA 4UVAA 3B4SA 4RO2A 1J95A 2RDCA 4F6EA 2DW4A 1VQMV 3RYIA 5CB4A 5LP6C 4DV4B 3BABA 4PI0A 1UJWB 4O2AA 2FTKA 3CWBH 3UKMA 2QM4A 1M56B 4K0KB 2C2AA 1DK1A 3UCSC 1TVKB 3SYQA 3S3XA 1VQ4V 4UVBA 1K4CC 5CMUA 4O4LB 3AG1C 4CH6A 2VQEO 4UB6Z 1K4DC 1VF7A 2QWPB 4DR2B 5DM6V 4QJFB 3JASB 5EIBC 4XBFA 1JCHA 3CCJV 2JEXA 4X66B 1BHAA 1NVPB 1ROPA 2LFSA 1EN6A 2FL4A 4FMTA 2Q7EA 2XOKG 4LF9B 2GV9A 1QVFU 1EZJA 3T4DA 4MVQA 1Q5OA 1NT2B 4QPJA 3QVNA 3CXCU 1DF4A 2VQFO 1FAFA 3CCLV 5DN6G 1YHQV 1N8RW 4LH6A 4Z2WA 3L71H 4FZ0A 2EZPA 3L70H 2X0LA 3RGBA 1Z5VA 4DR7O 1GAXA 2ILMA 4W4LA 1SA0B 1CPYA 3FX7A 1QNMA 3WB1A 1HNZO 2JDIG 4WFGA 1ZL8A 2QWOB 4YJ3B 4AILC 4LBEC 5EK0A 1CXZB 3ZRSA 4BIUA 2OCHA 3ZRXA 3C90A 3ZS8C 2ZE5A 1KB9F 1Q3EA 2A79B 1AJNA 2QM7A 3H1LH 1XNRO 4UUJC 3I5DA 4JF3A 4YY3O 3BRCA 1M93A 3OTOB 1RSOB 1K33A 3OUSA 1S3JA 1HNWB 1Y66A 1NH2D 4LR3A 4BR6A 4JV5O 2UUAO 3IC9A 1SC5B 5ITZA 4MW3A 3JD4A 2W0XA 4WBNA 3VQXA 5IDJA 1Q81W 1Q7YW 3HKBA 4FLUA 3E89A 5H2FZ 3IGAC 1VQPV 1I0HA 5E79Z 4LF7O 1Y74B 1R73A 1G4YB 4ZBMA 2HLDG 4LF4O 3JALA 4CS3A 2LO1A 3J7AU 5H6RA 1L0NH 5B66Z 1KYOF 4OPHA 4JI2O 2Q67A 2PY5A 4LF4B 3ZMSA 4TV9B 3ABUA 2QTSA 1JFFB 2Z3YA 3ABMB 1GKFA 3FB7C 2OCCB 3CCRV 4CZZA 3SJBC 4JYYA 5D5PA 2OYQA 1NZ6A 5KLVH 4NXMO 2EILC 4DR3O 2YSUB 3ZHQA 1PNLA 2P6JA 3VQYA 1N34O 3ZN1A 4GZRB 2RN9A 1VMGA 4MVUA 1NTKH 3LDCA 4X9QA 1B04A 5B3SB 5EZYA 2DOSA 3AG2B 2EINB 1Z2GA 4JV5B 3JD2A 1P7BA 4FFKA 1WB7A 1R3IC 4J10A 1HNWO 5C93A 3EHBB 3OMIB 4FIPC 3JARB 5IWAO 2CDYA 5KHJA 2Z5UA 2JJ2G 1QR8A 3MD0A 2WLIB 1FPOA 1WJZA 1BE3H 4DW0A 4DR4B 4JI3O 2ETNA 1MG1A 1N0NA 4TWKA 3FAVA 1WA8A 3OW2U 3SPIA 5K1PA 1R6NA 2UXBB 3U0ZA 2JS3A 3BA8A 1FFXB 1BT8A 5FNVB 3CMEV 4JI7O 1SQBH 1KUQA 4FLVA 4R8CA 2F43G 2JJ1G 4J41A 2ZT9B 4LP8A 1QVGU 4NXNO 5LGUA 3WB0A 3B40A 2PI4A 1WB8A 3RYFB 1AVMA 3J80N 1AROP 4X20B 2AHZA 2FMLA 1NKDA 1K8AW 1IBKB 2WPDG 3LNNA 4I0XA 4GKJO 1BS3A 3AG4B 3NXSA 1U97A 2Q4PA 2XAFA 3H1KH 4FLYA 4FK5C 3H1HH 3MHSC 1WA8B 4CS4A 5L3FA 1S5HC 2HR3A 4I5SA 1NTMH 2BSKA 4QIWF 4YIOA 3AG1B 3JYCA 1ORQC 1RPRA 1YI2V 3B8MA 1K34A 2YI9A 4O4JB 1D2DA 4NB5A 1SQXH 2XHBA 3D36A 1XMOB 1EN4A 5JVDB 2VQEB 1JVMA 4PA6A 2EINC 1HNXB 1BL8A 3K9SA 2W6IG 4ZHQB 3PJSK 1R3KC 4QE7A 2L6LA 2CK3G 3ABTA 1V54C 1XBLA 2EX3A 4MTFA 3ETGA 1XHZA 3T1YO 4LC1A 4H37A 5BMVA 3M8AA 2XAQA 1TUBA 2O57A 1I08A 2CGNA 4AQYO 3WB2A 2GTSA 3OMAB 4NR1A 1B3QA 4GX1A 2DYRB 3GB7C 1BHBA 2P5OA 1H8HG 1KP3A 1Y6XA 1H8EG 2YXYA 4TQFA 2MK3A 4R7CA 4DUZO 4UB8Z 4FJCC 1YTFD 2AXTZ 3EXAA 5CA0A 1ZLZA 4JYCA 2UXNA 5GW7A 4KHPB 1QCEA 2XTAA 4BIOA 1AI6A 3W7XA 4WF9V 1XL4A 2H8PC 4MSWC 2DWEC 3HPLC 1CP9A 2OTLV 1UPGA 4X1YA 1XI1A 5J2TA 4LCUC 3RYHA 1RP3B 2F93B 1PV0A 4X62B 3B2EE 3N27A 1AJPA 3CP1A 3DXRB 3C3TA 3L75H 4PDLA 4FLZA 4O4IA 5IT9N 2AGAA 4I55A 2Z0AA 2VS0A 3DTUB 1XNQB 1B6QA 1XOUA 1RM1B 1OHHG 1M9NA 2QE7G 4JI0O 1P49A 3N2KB 3D36C 3BAAA 1M57B 1ENVA 4J7KA 4B3TO 1WNSA 3FB6C 5LHGA 5IYCO 2Q8VA 3W7TA 3ZRWA 4I50B 4PDRA 1NJIW 4WBNB 1IZ3A 1YCIA 4UCRA 2YDEA 1BZKA 2CUGA 4O4HB 3VOUA 2IJJA 1IDSA 4B3RB 2XUMA 4DO2A 2KG7A 1JQ0A 1TUEB 2EILB 4I7ZB 2P90A 5EBLC 3FYIB 4ASUG 4OX9O 2OT5A 1T5EA 1Q86W 1VQOV 5IYZA 1IBLB 2Q6AA 3QG5A 1DGSA 4DV7O 4CC5A 2ZXWC 3APQA 3RVYA 2YXLA 2AZ0A 1JR9A 2ZM6B 1VQ8V 3HKDB 4LF7B 2ZDIA 5TISZ 1JA8A 4QNHB 4LWSA 5JH7A 1HNXO 1PL4A 2E75B 1R3JC 2F95B 2ZE7A 3WG7B 4DXWA 4X1IB 3IC7A 1MMMA 4IYIA 5IJ9B 2WLIA 3ZRWB 1RSOA 4DV5O 1LR1A 4ZI7A 3O65A 5EIBD 2DYRC 3OE7G 1WAZA 3ZX6A 1W2BU 4O4JA 1W0JG 3T2MA 4X64O 1YEWA 4LFBO 4Q6GA 1IBMB 3B8NA 1KC8W 2PYLA 5IJ0A 4LF8O 4KUMA 4YHHB 2ZE6A 2PUSA 2HVJC 4ZHQA 5L3BA 5IY5B 4EFEA 1FKAO 5DEDA 1XEQA 5IYZB 1P84F 1AP6A 5EYPB 1NTZH 5KAIZ 1M56C 3ZHUA 4ZI7B 2Y4TA 2D3OW 2X6BA 1XMQO 5B5EZ 2OIGA 4CH4A 2P06A 2JK5C 3AG2C 1WPBA 3ASNB 3ZHSA 2F4VB 2K1EA 5JJNB 4JI6O 2F4VO 2IU3A 2QWQB 3I55V 3JAWA 4JI3B 1SA0A 5EBMC 1X59A 2EIMB 4DR6B 1XHXA 5JJEB 2UUBO 2WLNA 5B1OA 4FLXA 3ZMTA 1DTOA 3HKEB 1LNQA 3DSQA 3STZC 1KP2A 2QKAA 1WN7A 4XDKA 2WLKA 3THOA 4HBNA 4DRXB 3CPWU 3QO5A 4LF9O 3RN4A 1YJWV 1ZL8B 3UT5A 4CH3A 3E8BA 4JTDB 3AG3B 4JI4B 2E5LO 4X1KB 2BTQB 1H2KA 4EB6B 2DWDC 2ZCEA 1KECA 2GHYA 4DR2O 2ITCC 1H2SB 2X6AA 4MVOA 1OCRC 4H44B 4TUYB 3E22A 3UQ8A 4JYAO 4IIJA 5FL7G 1YIJV 2KG7B 4LH7A 1KU9A 1Y74A 3TXSA 2XASA 1TA8A 5KHGA 4DV0B 1SQQH 1U96A 4GYCB 1GMGA 3OM3B 3IJ4A 2ZM6O 3ABMC 2YIAA 2UU9B 4LFCO 4JI2B 1Y76A 1MNGA 5GTHZ 3K0DA 2QSAA 3CRCA 3CJHA 3HKCB 1YVWA 5IE9A 3SYAA 4XDLA 4MVRA 2V1DA 1D5NA 4YJ2B 5J9PC 2UU9O 4IL6Z 2E3CA 1QHTA 1OCOB 1YTFB 2HEPA 3CYOA 2ZR2A 4MTOA 5JCOC 5LYJA 2BOCC 3L72H 4Q20A 4Z1MG 2FKXA 3OFNG 4JI4O 4GX0A 4Z1VA 4O2BB 2RCVA 4CS2A 2CH7B 5CN0A 2UUAB 5H6QA 1V55B 4JPRA 5EBWC 2IBZH 4WFAV 1OZ0A 4P2ZA 1K92A 2WLHA 2ZINA 4P30A 2EIMC 4CC6A 1AILA 4E4EA 5JQGB 3CRMA 1VQ9V 3BY6A 4B7EA 4YY3B 4RWUA 1BQ0A 1P4RA 1TGOA 5A2QN 1XNRB 3GWOA 1J5EO 4KHPO 4RUEA 1GTOA 1K97A 4GX5A 3KKYA 3GVMA 2DYSC 1HWYA 3G80A 4IT5A 1HDJA 5JWPA 1WP8A 1ZUQA 4GKKO 2Q9LA 1F4NA 4DR7B 2YIBD 3TGUH 2LW1A 4MVSA 2GBOA 3WG7C 5CBHA 4UXNA 4D7TA 5GTIZ 2E74B 3D8CA 5FNVA 2RMKB 3UO2A 4MVMA 3JAMN 4IHJB 3CCVV 2XNDG 2BSKB 4I4TB 5KA6A 4B3SB 1K3EA 3MAQA 3OD4A 1NBMG 1R3LC 4RQFA 3B77A 4FLWA 2JVDA 2PTMA 1F51A 1K7DA 4I0XB 3QO8A 3OT7A 3LSQA 2DMXA 1FXHA 4PHZA 1AI5A 1GRJA 5CBGA 3OUFA 1SETA 4EEQA 4DV5B 2Y69C 5EYPA 2YICA 3E35A 3AK1A 1GN6A 2X6CA 1Q90D 4O4LA 5B1BC 4I4TA 4B3SO 1ZX3A 5EC2C 5LMUO 5J2UA 1VQNV 1FXKA 5KHKA 2PGGA 2ZQMA 3JD3A 1ZWIC 4LNUA 4DV1O 2UXDB 5BXZA 4HZ3A 4NXNB 4JTCB 5LOVB 1HW7A 1MABG 1MA1A 3ZMZA 5CBFA 5IJ9A 2B9ZA 3APOA 3LNMB 4JAAA 4PA7A 3MHHC 2Y69B 1RPOA 5L3CA 4NVPA 5GONA 4X65B 3IAYA 1XILA 4ZOLA 2Q7GA 1KKDA 1TVKA 1FXVA 2ZNJA 4UVCA 3JAKB 3F7VC 2IH1C 4WFFA 5L3EA 4KP4A 5HFMA 1PPJH 5LA6B 1VQKV 4DV3O 1OCZC 4B3TB 1O9GA 5LHIA 1S77D 2N05A 1BCCH 2UXCB 4JI0B 1GK9A 2Q7HA 2QKSA 5JH7B 1YITV 2M7WA 3AG4C 3K03A 1QBZA 2CH7A 3KCYA 3K79A 2XT9A 3U11A 3OGIB 1Y67A 1GN2A 3JD1A 4PD4F 2W6JG 1PNKA 5E1AC 3LDEA 4CH5A 4NXMB 2CTPA 3E2EA 4IYHA 1Q43A 5KUKA 5CA1B 3SDLA 3JAKA 1YXBA 2CTWA
chains in the Genus database with same CATH topology
3RT3C 3F5TA 1X59A 1N34O 1A32A 1XNRO 2FKXA 4X65O 4JI8O 4YY3O 2UUBO 4JI4O 4B3SO 2JRIA 1R6TA 5LMUO 1XNQO 2DOSA 4JI5O 4A5UB 4OPAA 4OX9O 1FJGO 2HHHO 1IBKO 1YZBA 4K0KO 3T1YO 1IBLO 3T1HO 4DV1O 1HNWO 1DK1A 5BXZA 4DV7O 3M8AA 4JV5O 2UXCO 2UUAO 5FLXN 4YHHO 4X62O 4DV2O 4LF9O 1AILA 4JI1O 5IWAO 5LMNO 4AQYO 4DR5O 5H5NA 1N32O 4LF6O 4LF5O 4X66O 2E5LO 2UUCO 4DR6O 1G1XB 1HNXO 5A2QN 3J81N 1J5EO 4KHPO 4DR2O 2VQEO 4DUZO 4JI3O 4DV5O 4DR4O 4JYAO 5BR8O 2N74A 1F7YA 3O65A 2LW7A 1FYJA 4X64O 1R1BA 4DUYO 4DV3O 4LF7O 4LFBO 4JI7O 5BY1A 4GKKO 4DR1O 2ZM6O 1KUQA 1I94O 4LF4O 4LF8O 1NS1A 4LFCO 4NXNO 4B3MO 2UXDO 3J7AU 3J80N 2VQFO 5LL6Y 1FKAO 1N33O 1XEQA 3JAMN 4GKJO 2ZKOA 3R66A 5IT9N 4DV4O 2AGAA 2Z0AA 3OTOO 4OPHA 4JI0O 4JI2O 2DJVA 4B3RO 1AB3A 2UU9O 4LFAO 4DR7O 1XMQO 4DV0O 4DV6O 1IBMO 4B3TO 1HNZO 1D2DA 1XMOO 1N36O 1HR0O 2UXBO 4JI6O 2F4VO 4NXMO 3SDLA 4DR3O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RT3 C;  3F5T A;  1X59 A;  1N34 O;  1A32 A;  1XNR O;  2FKX A;  4X65 O;  4JI8 O;  4YY3 O;  2UUB O;  4JI4 O;  4B3S O;  2JRI A;  1R6T A;  5LMU O;  1XNQ O;  2DOS A;  4JI5 O;  4A5U B;  4OPA A;  4OX9 O;  1FJG O;  2HHH O;  1IBK O;  1YZB A;  4K0K O;  3T1Y O;  1IBL O;  3T1H O;  4DV1 O;  1HNW O;  1DK1 A;  5BXZ A;  4DV7 O;  3M8A A;  4JV5 O;  2UXC O;  2UUA O;  5FLX N;  4YHH O;  4X62 O;  4DV2 O;  4LF9 O;  1AIL A;  4JI1 O;  5IWA O;  5LMN O;  4AQY O;  4DR5 O;  5H5N A;  1N32 O;  4LF6 O;  4LF5 O;  4X66 O;  2E5L O;  2UUC O;  4DR6 O;  1G1X B;  1HNX O;  5A2Q N;  3J81 N;  1J5E O;  4KHP O;  4DR2 O;  2VQE O;  4DUZ O;  4JI3 O;  4DV5 O;  4DR4 O;  4JYA O;  5BR8 O;  2N74 A;  1F7Y A;  3O65 A;  2LW7 A;  1FYJ A;  4X64 O;  1R1B A;  4DUY O;  4DV3 O;  4LF7 O;  4LFB O;  4JI7 O;  5BY1 A;  4GKK O;  4DR1 O;  2ZM6 O;  1KUQ A;  1I94 O;  4LF4 O;  4LF8 O;  1NS1 A;  4LFC O;  4NXN O;  4B3M O;  2UXD O;  3J7A U;  3J80 N;  2VQF O;  5LL6 Y;  1FKA O;  1N33 O;  1XEQ A;  3JAM N;  4GKJ O;  2ZKO A;  3R66 A;  5IT9 N;  4DV4 O;  2AGA A;  2Z0A A;  3OTO O;  4OPH A;  4JI0 O;  4JI2 O;  2DJV A;  4B3R O;  1AB3 A;  2UU9 O;  4LFA O;  4DR7 O;  1XMQ O;  4DV0 O;  4DV6 O;  1IBM O;  4B3T O;  1HNZ O;  1D2D A;  1XMO O;  1N36 O;  1HR0 O;  2UXB O;  4JI6 O;  2F4V O;  4NXM O;  3SDL A;  4DR3 O; 
#chains in the Genus database with same CATH topology
 4FFB A;  4AHC A;  2RJZ A;  3JSL A;  2WSS G;  2EJR A;  3STL C;  1VEW A;  1FD9 A;  4YJ3 A;  3FYE B;  3SPH A;  1RM1 C;  1PD3 A;  1BQZ A;  1V54 B;  1EM1 A;  4A5U B;  4IIJ B;  4JI1 B;  5J2T B;  1E1Q G;  4MTG A;  2KQX A;  1PKX A;  3ZCC A;  4DV1 B;  2ZXW B;  2R9I A;  5LXT A;  4EB6 A;  1SQP H;  2LGQ A;  1S5L Z;  1G8M A;  3T1C A;  1I94 B;  3ZRV A;  4F6R B;  1FS0 G;  2DQ0 A;  3H1I H;  3FD9 A;  4DUY B;  4ZOL B;  1US6 A;  3FKS G;  5BR8 B;  3T4Z A;  3NR7 A;  5KA5 A;  3G6E V;  2CE4 A;  4UCT A;  3KG2 A;  3AG7 A;  2XAJ A;  3CCS V;  2QWN B;  4X1I A;  4LF5 B;  1IVS A;  1SER A;  4J42 A;  1H2M A;  2Q68 A;  4UFZ A;  1Q6H A;  3U10 A;  3DGE A;  4B3M O;  3SPC A;  3SGI A;  1XUQ A;  3AEI A;  4GKJ B;  3Q4H B;  1N33 B;  3P3N A;  4UCU A;  1CEZ A;  1N0J A;  5C8Y B;  3E22 B;  2KSD A;  1V9P A;  2P22 C;  1H2G A;  2P7T C;  3B09 A;  2IJK A;  1H38 A;  4GUN A;  2VWJ A;  4DR1 B;  2F66 C;  3CSX A;  1YJN V;  2V7Q G;  2DN9 A;  2UXB O;  2EIJ B;  3ASN C;  4FFB B;  5LGN A;  3MDS A;  2OCC C;  2B1G A;  2ADP A;  1M90 W;  1HNZ B;  3S3W A;  5IJ0 B;  3RT3 C;  4PDM A;  4HYO A;  3E86 A;  4O2A B;  3CE2 A;  5LP6 B;  2PF4 E;  4DR5 B;  1KQS U;  1VQ6 V;  4JI5 O;  2Q0O C;  4JAU A;  4RAI A;  3E83 A;  4H0L B;  1YZB A;  5B3S C;  2GUZ B;  1AI4 A;  2A06 H;  3G71 V;  4YHH O;  2EIJ C;  2JEU A;  3L73 H;  4G2K A;  4LF5 O;  2VWK A;  1XQ8 A;  4UV9 A;  2UUC O;  2Y0P A;  1NH2 B;  3J81 N;  3OMN B;  4X1Y B;  4K8Z A;  1AR1 B;  3H9V A;  1Q6U A;  3CC7 V;  4DR3 B;  1R6K A;  3JAT A;  2GTA A;  2UXX A;  5BR8 O;  3CCM V;  1S72 V;  4PA9 A;  4ZIB A;  2KKW A;  3AK3 A;  4ZKI A;  1XRE A;  4GCZ A;  4DUY O;  4JZ2 A;  2P4V A;  3HKD A;  4DV6 B;  3EVK A;  4L8J A;  1VQ5 V;  1YJ9 V;  1MSW D;  5KHI A;  5AG2 A;  3ZJZ A;  3M7M X;  4O2B A;  3VBB A;  1G6U A;  4X20 A;  4J11 A;  1AR5 A;  1JJ2 U;  4WCE V;  2QR4 A;  2YID A;  4OX9 B;  4DV4 O;  4B08 A;  5BMV B;  2ZD9 A;  4UCV A;  2RQ6 A;  4HNA A;  4LFC B;  2ZDI C;  1DLB A;  1Z5W A;  3CEI A;  4DV0 O;  5IYB O;  1FXK C;  4O4H A;  2NNU A;  1S5J A;  4H33 A;  2ARH A;  2WAM A;  4U3F H;  2PZS A;  2QKC A;  3JAT B;  4PI2 A;  1AR4 A;  1YF2 A;  3HB3 B;  5H9C A;  1OV9 A;  2E5L B;  2JRI A;  2IJI A;  2R9R B;  2QEX V;  1QLE B;  1B06 A;  4OPA A;  3TJT A;  4F4L A;  4EFB A;  3DXR A;  1N4C A;  3GWK C;  1GH6 A;  3H1J H;  4B7K A;  2UXC O;  3QO7 A;  2HHH B;  4DV2 O;  2IH3 C;  3RYH B;  5LMN O;  3SJQ C;  3N2G A;  4DV3 B;  4MVZ A;  1L8D A;  4R50 A;  2UUB B;  2QTO A;  2Y48 A;  3HKB B;  4L87 A;  1FXK B;  3A2F A;  3ICX A;  3P30 A;  4I55 B;  4UCS A;  2E76 B;  4DRX A;  1OCC B;  4QPK A;  3SPG A;  3K5N A;  1ZSP A;  4YIP A;  4F6R A;  2PI5 A;  2A0L A;  1PM9 A;  2BTO A;  2HVK C;  4DR1 O;  2RNB A;  5LHH A;  1VQ7 V;  4JTA B;  5LP6 A;  1VAR A;  4J7J A;  3CC4 V;  3JAR A;  1WLE A;  3FB5 C;  2QWR B;  3SJA C;  3CC2 V;  2NLJ C;  1BGY H;  1SZT A;  1FJG B;  2VQF B;  1SQV H;  1Q6I A;  4B3M B;  2YIB A;  1VF5 B;  2KB1 A;  2EJ7 A;  3K9A A;  4QGP A;  4U3J A;  3A0R A;  4NTY A;  1W59 A;  4IHJ A;  4TUY A;  3ETD A;  1K9M W;  4FM0 A;  3DC6 A;  3CMA V;  2Y0I A;  1KD1 W;  4X89 A;  2ZNI A;  1NU1 H;  1NR1 A;  3BA9 A;  1E79 G;  3IFX A;  3RW0 A;  1OCZ B;  3K04 A;  3DC5 A;  1VIB A;  2DE0 X;  2DYS B;  1KKC A;  1OCC C;  2LGW A;  4QE9 A;  2HJD A;  4N21 A;  3AG3 C;  4BAY A;  4BW9 A;  4GX2 A;  1FJG O;  2JGD A;  3BHP A;  1S0V A;  1IBL O;  4TT3 G;  1VP7 A;  4G28 B;  4J7Z A;  3CRA A;  1YDX A;  3G67 A;  1Q82 W;  1HP8 A;  3K5L A;  1QQC A;  4JI1 O;  2ZR3 A;  1QLN A;  3VQW A;  4JI7 B;  3JAL B;  5LBQ A;  4GT1 A;  4X88 A;  2Q73 A;  1IX9 A;  1G1X B;  1YSC A;  4DR4 O;  3P3P A;  4YJ2 A;  4OXS A;  3ABL B;  1JPX A;  3SR2 C;  1F7Y A;  1N36 B;  3A0B Z;  3ZN0 A;  1FYJ A;  4UCO A;  5KUM A;  5IY5 C;  1KMI Z;  1MOF A;  5BY1 A;  3JCU Z;  2HKO A;  2V4D A;  5C8Y A;  5IWA B;  3OR6 C;  4LFA B;  2EBO A;  3ZHT A;  3K08 A;  4NYK A;  1I5Y A;  3ZBH A;  3LDD A;  1TAE A;  3W7S A;  4IGG A;  1IXM A;  4HAM A;  5J2U B;  3WFV A;  2ZKO A;  1SQF A;  4C7U A;  1OJH A;  2P67 A;  3RYC A;  3CCQ V;  5KAF Z;  4JAV A;  4LFA O;  4EKW A;  3HKE A;  2ZIM A;  2F23 A;  2A3Q A;  3N2G B;  2YEV B;  2H3O A;  3ETQ A;  1N36 O;  2R70 A;  2ATK C;  3ZIA G;  2HFE C;  3PN1 A;  3BFR A;  1GO3 F;  4I9W A;  1V55 C;  4TSF G;  4X65 O;  2GUZ A;  4FM1 A;  1R6T A;  3H01 A;  5A9G A;  2M6Y A;  2ODM A;  5IYD O;  2WLM A;  1K5Q A;  4OGQ B;  3WU2 Z;  5CB4 B;  1I7F A;  2NR5 A;  2EIK C;  2CAZ C;  1ZTE A;  2QGN A;  2ZE8 A;  3SPJ A;  3UM7 A;  3T1H O;  3T1Y B;  3Q4H A;  1QR9 A;  3EFF K;  3VQV A;  2XAH A;  3ABK C;  2OIE A;  2LP7 A;  5FLX N;  1L0L H;  4NTX A;  3RYC B;  5KMG A;  2D2C B;  5CA0 B;  4LF6 O;  4ABM A;  3CRQ A;  1VF6 C;  4I50 A;  1AJQ A;  1QU7 A;  3M99 B;  2YS8 A;  4JYA B;  3SJC C;  5EC1 C;  4DK1 A;  1M57 C;  2N74 A;  3I56 V;  2GDS A;  4WFH A;  2JIZ G;  5LOV A;  1XL6 A;  1JMK C;  2BTQ A;  1R1B A;  4JYB A;  4KL1 A;  3CCU V;  2JGD B;  4O4I B;  3ABK B;  2F1M A;  1WP7 A;  1QLE C;  4CBC A;  1OCO C;  3OTF A;  2IM9 A;  1NVP D;  5JVD A;  1GM8 A;  3ZHR A;  3A8T A;  2B5U A;  2H94 A;  4JI5 B;  1JJO A;  3SYP A;  5LA6 A;  3OTO O;  1FFT B;  1TUB B;  2JS5 A;  2WLL B;  4J9Y B;  3CXH F;  2QJ1 A;  3QF7 A;  3K0G A;  3CX5 F;  3ZED A;  4PV1 B;  2YXH A;  3OEH G;  3JCZ A;  1DF5 A;  4PEL A;  1MZE A;  5B1B B;  4JI6 B;  3JD0 A;  4FM2 A;  2Q5Z A;  4TQD A;  4TOI A;  5CA3 A;  1K5S A;  3C3S A;  5L3D A;  4PDV A;  3F5T A;  1GN4 A;  5GON B;  1J5E B;  1A32 A;  4MTX A;  2IU0 A;  1EBO A;  3A0H Z;  2WLL A;  4K35 A;  2NN4 A;  3QNE A;  3HR0 A;  1AI7 A;  4X1K A;  1EFR G;  5LMN B;  2OTJ V;  2HHH O;  1M4U A;  4DK0 A;  4G27 B;  1Y4M A;  3JAW B;  4KFM A;  3E8H A;  2BCC H;  1X4T A;  1JOY A;  3CB2 A;  1MSD A;  1GM9 A;  3CCE V;  1IXB A;  3KCX A;  4X66 O;  4X64 B;  2BE3 A;  2PYJ A;  4JI8 B;  3FB8 C;  4P9O A;  1N34 B;  1RFY A;  4FPP A;  1JX9 A;  3JSN A;  5K1X A;  1D5A A;  3X2Q B;  1AP5 A;  1HR0 B;  2LW7 A;  2JGU A;  1URF A;  2ADQ B;  4BIZ A;  3TCU A;  2HJF C;  3QTC A;  2AZ2 A;  3R65 A;  2EUL A;  1I94 O;  4MW8 A;  1THZ A;  3ASO C;  3SYC A;  1NS1 A;  3LSU A;  4MS2 A;  3ABL C;  3ML0 A;  1NR7 A;  5LXT B;  4E2L A;  4TV8 B;  3SYO A;  2CTR A;  5LL6 Y;  4LNU B;  3R66 A;  3G4S V;  2R72 A;  3CRR A;  2YI8 A;  4B3R O;  1AB3 A;  4W4K A;  2LJ2 A;  3G6B A;  4DV6 O;  1SQG A;  2QA4 V;  1H2L A;  2IW5 A;  4TV9 A;  2MW2 B;  3TET A;  1JFF A;  3KZI Z;  2FB5 A;  4GLX A;  1HR0 O;  3UO3 A;  3ASO B;  1COW G;  1SF9 A;  2WWW A;  3RWR D;  3CD6 V;  1PL0 A;  1OCR B;  4PJ0 Z;  2EZO A;  5JQG A;  1KBH A;  3L9D A;  4JI8 O;  1SES A;  1Y76 B;  3X2Q C;  2UUC B;  3RYI B;  2IJH A;  5DEC A;  1S76 D;  1UFI A;  5FPO A;  1XNQ O;  4J80 A;  4U3J B;  4D6T H;  2R9A A;  2K9P A;  4K8X A;  1IUR A;  3LSS A;  1EN5 A;  2HG5 C;  4X62 O;  3RYF A;  2LQT A;  2N04 A;  3CS5 A;  4DR5 O;  1H2N A;  1SS3 A;  4MT8 A;  5H5N A;  3ZMV A;  1BMF G;  1N32 O;  1K73 W;  4DR6 O;  1GM7 A;  4JGS A;  3O9O A;  1F4M A;  1FFX A;  2LFR A;  3W7W A;  1SRY A;  2CGO A;  5B1A C;  2Y4U A;  3K57 A;  4DUZ B;  5B1N A;  4JAS A;  4UV8 A;  3K5O A;  4WFB V;  4DW1 A;  5KMG B;  3D3I A;  3ZHV A;  2GSM B;  2YEV A;  2W0F C;  3BCC H;  3RBZ A;  4AQY B;  1XMQ B;  1GN3 A;  2XAG A;  2B1I A;  3BEH A;  5HFL A;  2UXD O;  3OAA G;  1O9H A;  3RFR A;  1N33 O;  1XDC A;  4AI8 A;  2WLJ A;  2YC0 A;  2G38 A;  5KX5 B;  3BPZ A;  5LMU B;  5JCO A;  1WPX A;  2L35 A;  5EZY B;  4LF8 B;  1P7G A;  4FVM A;  1IBM O;  4I9Q A;  4LFB B;  2WA3 A;  4R6Z A;  3ETE A;  5D5Q A;  1SKV A;  1VF6 A;  3AK2 A;  1XMO O;  3JAS A;  4RUF A;  4WFE A;  1LUV A;  3L74 H;  3K3W A;  3F5W C;  3LUT B;  4FZ1 A;  2FYU H;  2HP8 A;  3UT5 B;  3OR7 C;  2WA4 A;  5ITZ B;  4RQE A;  4LF6 B;  3D3Q A;  5KX5 A;  1NQT A;  4NKG B;  4DYL A;  3FAV B;  2CTQ A;  3BVO A;  1M1K W;  1IBK O;  4DV7 B;  3E8G A;  1PNM A;  4KXR A;  4HNA B;  4K0K O;  1F23 A;  3K59 A;  3T1H B;  4FLT A;  3P32 A;  4U7O A;  3HKC A;  1VQL V;  3N2K A;  1E1R G;  3TK1 A;  2QDO A;  1BSM A;  4GKK B;  5B1A B;  4J9Z B;  3OGC C;  1I5X A;  4XDJ A;  4P9P A;  5BZB A;  4H13 B;  1NI8 A;  3ZMU A;  3K5M A;  4ICG A;  1L1F A;  1PP9 H;  1LUW A;  2X7R B;  1N32 B;  3CHX A;  3FFQ A;  5L3G A;  2Q0A A;  5F2V O;  4K3A A;  4NTW A;  4DV2 B;  1W0K G;  2BOB C;  2EIK B;  5LYJ B;  1M5I A;  4D7S A;  2DQ3 A;  2P4K A;  1MZF A;  3E8F A;  5FPR A;  4N23 A;  2AHY A;  4PA4 A;  4BWA A;  5CA1 A;  1SZX A;  5JJJ B;  2VRZ A;  2AW9 A;  2QM8 A;  2YUA A;  3F7Y C;  3OEE G;  2ITD C;  2Q69 A;  2DJV A;  4JZG A;  1Q8I A;  3K58 A;  3RVZ A;  2OWO A;  2A9H A;  4BW5 A;  1ZAU A;  3CJH B;  3W7U A;  5LGT A;  4TV8 A;  2A7W A;  3K06 A;  4X8A A;  4PA3 A;  5KHH A;  3TXQ A;  2ZIO A;  4LWS B;  1EZV H;  4YXW G;  4U7N A;  4UVA A;  3B4S A;  4RO2 A;  1J95 A;  2RDC A;  4F6E A;  2DW4 A;  1VQM V;  3RYI A;  5CB4 A;  5LP6 C;  4DV4 B;  3BAB A;  4PI0 A;  1UJW B;  4O2A A;  2FTK A;  3CWB H;  3UKM A;  2QM4 A;  1M56 B;  4K0K B;  2C2A A;  1DK1 A;  3UCS C;  1TVK B;  3SYQ A;  3S3X A;  1VQ4 V;  4UVB A;  1K4C C;  5CMU A;  4O4L B;  3AG1 C;  4CH6 A;  2VQE O;  4UB6 Z;  1K4D C;  1VF7 A;  2QWP B;  4DR2 B;  5DM6 V;  4QJF B;  3JAS B;  5EIB C;  4XBF A;  1JCH A;  3CCJ V;  2JEX A;  4X66 B;  1BHA A;  1NVP B;  1ROP A;  2LFS A;  1EN6 A;  2FL4 A;  4FMT A;  2Q7E A;  2XOK G;  4LF9 B;  2GV9 A;  1QVF U;  1EZJ A;  3T4D A;  4MVQ A;  1Q5O A;  1NT2 B;  4QPJ A;  3QVN A;  3CXC U;  1DF4 A;  2VQF O;  1FAF A;  3CCL V;  5DN6 G;  1YHQ V;  1N8R W;  4LH6 A;  4Z2W A;  3L71 H;  4FZ0 A;  2EZP A;  3L70 H;  2X0L A;  3RGB A;  1Z5V A;  4DR7 O;  1GAX A;  2ILM A;  4W4L A;  1SA0 B;  1CPY A;  3FX7 A;  1QNM A;  3WB1 A;  1HNZ O;  2JDI G;  4WFG A;  1ZL8 A;  2QWO B;  4YJ3 B;  4AIL C;  4LBE C;  5EK0 A;  1CXZ B;  3ZRS A;  4BIU A;  2OCH A;  3ZRX A;  3C90 A;  3ZS8 C;  2ZE5 A;  1KB9 F;  1Q3E A;  2A79 B;  1AJN A;  2QM7 A;  3H1L H;  1XNR O;  4UUJ C;  3I5D A;  4JF3 A;  4YY3 O;  3BRC A;  1M93 A;  3OTO B;  1RSO B;  1K33 A;  3OUS A;  1S3J A;  1HNW B;  1Y66 A;  1NH2 D;  4LR3 A;  4BR6 A;  4JV5 O;  2UUA O;  3IC9 A;  1SC5 B;  5ITZ A;  4MW3 A;  3JD4 A;  2W0X A;  4WBN A;  3VQX A;  5IDJ A;  1Q81 W;  1Q7Y W;  3HKB A;  4FLU A;  3E89 A;  5H2F Z;  3IGA C;  1VQP V;  1I0H A;  5E79 Z;  4LF7 O;  1Y74 B;  1R73 A;  1G4Y B;  4ZBM A;  2HLD G;  4LF4 O;  3JAL A;  4CS3 A;  2LO1 A;  3J7A U;  5H6R A;  1L0N H;  5B66 Z;  1KYO F;  4OPH A;  4JI2 O;  2Q67 A;  2PY5 A;  4LF4 B;  3ZMS A;  4TV9 B;  3ABU A;  2QTS A;  1JFF B;  2Z3Y A;  3ABM B;  1GKF A;  3FB7 C;  2OCC B;  3CCR V;  4CZZ A;  3SJB C;  4JYY A;  5D5P A;  2OYQ A;  1NZ6 A;  5KLV H;  4NXM O;  2EIL C;  4DR3 O;  2YSU B;  3ZHQ A;  1PNL A;  2P6J A;  3VQY A;  1N34 O;  3ZN1 A;  4GZR B;  2RN9 A;  1VMG A;  4MVU A;  1NTK H;  3LDC A;  4X9Q A;  1B04 A;  5B3S B;  5EZY A;  2DOS A;  3AG2 B;  2EIN B;  1Z2G A;  4JV5 B;  3JD2 A;  1P7B A;  4FFK A;  1WB7 A;  1R3I C;  4J10 A;  1HNW O;  5C93 A;  3EHB B;  3OMI B;  4FIP C;  3JAR B;  5IWA O;  2CDY A;  5KHJ A;  2Z5U A;  2JJ2 G;  1QR8 A;  3MD0 A;  2WLI B;  1FPO A;  1WJZ A;  1BE3 H;  4DW0 A;  4DR4 B;  4JI3 O;  2ETN A;  1MG1 A;  1N0N A;  4TWK A;  3FAV A;  1WA8 A;  3OW2 U;  3SPI A;  5K1P A;  1R6N A;  2UXB B;  3U0Z A;  2JS3 A;  3BA8 A;  1FFX B;  1BT8 A;  5FNV B;  3CME V;  4JI7 O;  1SQB H;  1KUQ A;  4FLV A;  4R8C A;  2F43 G;  2JJ1 G;  4J41 A;  2ZT9 B;  4LP8 A;  1QVG U;  4NXN O;  5LGU A;  3WB0 A;  3B40 A;  2PI4 A;  1WB8 A;  3RYF B;  1AVM A;  3J80 N;  1ARO P;  4X20 B;  2AHZ A;  2FML A;  1NKD A;  1K8A W;  1IBK B;  2WPD G;  3LNN A;  4I0X A;  4GKJ O;  1BS3 A;  3AG4 B;  3NXS A;  1U97 A;  2Q4P A;  2XAF A;  3H1K H;  4FLY A;  4FK5 C;  3H1H H;  3MHS C;  1WA8 B;  4CS4 A;  5L3F A;  1S5H C;  2HR3 A;  4I5S A;  1NTM H;  2BSK A;  4QIW F;  4YIO A;  3AG1 B;  3JYC A;  1ORQ C;  1RPR A;  1YI2 V;  3B8M A;  1K34 A;  2YI9 A;  4O4J B;  1D2D A;  4NB5 A;  1SQX H;  2XHB A;  3D36 A;  1XMO B;  1EN4 A;  5JVD B;  2VQE B;  1JVM A;  4PA6 A;  2EIN C;  1HNX B;  1BL8 A;  3K9S A;  2W6I G;  4ZHQ B;  3PJS K;  1R3K C;  4QE7 A;  2L6L A;  2CK3 G;  3ABT A;  1V54 C;  1XBL A;  2EX3 A;  4MTF A;  3ETG A;  1XHZ A;  3T1Y O;  4LC1 A;  4H37 A;  5BMV A;  3M8A A;  2XAQ A;  1TUB A;  2O57 A;  1I08 A;  2CGN A;  4AQY O;  3WB2 A;  2GTS A;  3OMA B;  4NR1 A;  1B3Q A;  4GX1 A;  2DYR B;  3GB7 C;  1BHB A;  2P5O A;  1H8H G;  1KP3 A;  1Y6X A;  1H8E G;  2YXY A;  4TQF A;  2MK3 A;  4R7C A;  4DUZ O;  4UB8 Z;  4FJC C;  1YTF D;  2AXT Z;  3EXA A;  5CA0 A;  1ZLZ A;  4JYC A;  2UXN A;  5GW7 A;  4KHP B;  1QCE A;  2XTA A;  4BIO A;  1AI6 A;  3W7X A;  4WF9 V;  1XL4 A;  2H8P C;  4MSW C;  2DWE C;  3HPL C;  1CP9 A;  2OTL V;  1UPG A;  4X1Y A;  1XI1 A;  5J2T A;  4LCU C;  3RYH A;  1RP3 B;  2F93 B;  1PV0 A;  4X62 B;  3B2E E;  3N27 A;  1AJP A;  3CP1 A;  3DXR B;  3C3T A;  3L75 H;  4PDL A;  4FLZ A;  4O4I A;  5IT9 N;  2AGA A;  4I55 A;  2Z0A A;  2VS0 A;  3DTU B;  1XNQ B;  1B6Q A;  1XOU A;  1RM1 B;  1OHH G;  1M9N A;  2QE7 G;  4JI0 O;  1P49 A;  3N2K B;  3D36 C;  3BAA A;  1M57 B;  1ENV A;  4J7K A;  4B3T O;  1WNS A;  3FB6 C;  5LHG A;  5IYC O;  2Q8V A;  3W7T A;  3ZRW A;  4I50 B;  4PDR A;  1NJI W;  4WBN B;  1IZ3 A;  1YCI A;  4UCR A;  2YDE A;  1BZK A;  2CUG A;  4O4H B;  3VOU A;  2IJJ A;  1IDS A;  4B3R B;  2XUM A;  4DO2 A;  2KG7 A;  1JQ0 A;  1TUE B;  2EIL B;  4I7Z B;  2P90 A;  5EBL C;  3FYI B;  4ASU G;  4OX9 O;  2OT5 A;  1T5E A;  1Q86 W;  1VQO V;  5IYZ A;  1IBL B;  2Q6A A;  3QG5 A;  1DGS A;  4DV7 O;  4CC5 A;  2ZXW C;  3APQ A;  3RVY A;  2YXL A;  2AZ0 A;  1JR9 A;  2ZM6 B;  1VQ8 V;  3HKD B;  4LF7 B;  2ZDI A;  5TIS Z;  1JA8 A;  4QNH B;  4LWS A;  5JH7 A;  1HNX O;  1PL4 A;  2E75 B;  1R3J C;  2F95 B;  2ZE7 A;  3WG7 B;  4DXW A;  4X1I B;  3IC7 A;  1MMM A;  4IYI A;  5IJ9 B;  2WLI A;  3ZRW B;  1RSO A;  4DV5 O;  1LR1 A;  4ZI7 A;  3O65 A;  5EIB D;  2DYR C;  3OE7 G;  1WAZ A;  3ZX6 A;  1W2B U;  4O4J A;  1W0J G;  3T2M A;  4X64 O;  1YEW A;  4LFB O;  4Q6G A;  1IBM B;  3B8N A;  1KC8 W;  2PYL A;  5IJ0 A;  4LF8 O;  4KUM A;  4YHH B;  2ZE6 A;  2PUS A;  2HVJ C;  4ZHQ A;  5L3B A;  5IY5 B;  4EFE A;  1FKA O;  5DED A;  1XEQ A;  5IYZ B;  1P84 F;  1AP6 A;  5EYP B;  1NTZ H;  5KAI Z;  1M56 C;  3ZHU A;  4ZI7 B;  2Y4T A;  2D3O W;  2X6B A;  1XMQ O;  5B5E Z;  2OIG A;  4CH4 A;  2P06 A;  2JK5 C;  3AG2 C;  1WPB A;  3ASN B;  3ZHS A;  2F4V B;  2K1E A;  5JJN B;  4JI6 O;  2F4V O;  2IU3 A;  2QWQ B;  3I55 V;  3JAW A;  4JI3 B;  1SA0 A;  5EBM C;  1X59 A;  2EIM B;  4DR6 B;  1XHX A;  5JJE B;  2UUB O;  2WLN A;  5B1O A;  4FLX A;  3ZMT A;  1DTO A;  3HKE B;  1LNQ A;  3DSQ A;  3STZ C;  1KP2 A;  2QKA A;  1WN7 A;  4XDK A;  2WLK A;  3THO A;  4HBN A;  4DRX B;  3CPW U;  3QO5 A;  4LF9 O;  3RN4 A;  1YJW V;  1ZL8 B;  3UT5 A;  4CH3 A;  3E8B A;  4JTD B;  3AG3 B;  4JI4 B;  2E5L O;  4X1K B;  2BTQ B;  1H2K A;  4EB6 B;  2DWD C;  2ZCE A;  1KEC A;  2GHY A;  4DR2 O;  2ITC C;  1H2S B;  2X6A A;  4MVO A;  1OCR C;  4H44 B;  4TUY B;  3E22 A;  3UQ8 A;  4JYA O;  4IIJ A;  5FL7 G;  1YIJ V;  2KG7 B;  4LH7 A;  1KU9 A;  1Y74 A;  3TXS A;  2XAS A;  1TA8 A;  5KHG A;  4DV0 B;  1SQQ H;  1U96 A;  4GYC B;  1GMG A;  3OM3 B;  3IJ4 A;  2ZM6 O;  3ABM C;  2YIA A;  2UU9 B;  4LFC O;  4JI2 B;  1Y76 A;  1MNG A;  5GTH Z;  3K0D A;  2QSA A;  3CRC A;  3CJH A;  3HKC B;  1YVW A;  5IE9 A;  3SYA A;  4XDL A;  4MVR A;  2V1D A;  1D5N A;  4YJ2 B;  5J9P C;  2UU9 O;  4IL6 Z;  2E3C A;  1QHT A;  1OCO B;  1YTF B;  2HEP A;  3CYO A;  2ZR2 A;  4MTO A;  5JCO C;  5LYJ A;  2BOC C;  3L72 H;  4Q20 A;  4Z1M G;  2FKX A;  3OFN G;  4JI4 O;  4GX0 A;  4Z1V A;  4O2B B;  2RCV A;  4CS2 A;  2CH7 B;  5CN0 A;  2UUA B;  5H6Q A;  1V55 B;  4JPR A;  5EBW C;  2IBZ H;  4WFA V;  1OZ0 A;  4P2Z A;  1K92 A;  2WLH A;  2ZIN A;  4P30 A;  2EIM C;  4CC6 A;  1AIL A;  4E4E A;  5JQG B;  3CRM A;  1VQ9 V;  3BY6 A;  4B7E A;  4YY3 B;  4RWU A;  1BQ0 A;  1P4R A;  1TGO A;  5A2Q N;  1XNR B;  3GWO A;  1J5E O;  4KHP O;  4RUE A;  1GTO A;  1K97 A;  4GX5 A;  3KKY A;  3GVM A;  2DYS C;  1HWY A;  3G80 A;  4IT5 A;  1HDJ A;  5JWP A;  1WP8 A;  1ZUQ A;  4GKK O;  2Q9L A;  1F4N A;  4DR7 B;  2YIB D;  3TGU H;  2LW1 A;  4MVS A;  2GBO A;  3WG7 C;  5CBH A;  4UXN A;  4D7T A;  5GTI Z;  2E74 B;  3D8C A;  5FNV A;  2RMK B;  3UO2 A;  4MVM A;  3JAM N;  4IHJ B;  3CCV V;  2XND G;  2BSK B;  4I4T B;  5KA6 A;  4B3S B;  1K3E A;  3MAQ A;  3OD4 A;  1NBM G;  1R3L C;  4RQF A;  3B77 A;  4FLW A;  2JVD A;  2PTM A;  1F51 A;  1K7D A;  4I0X B;  3QO8 A;  3OT7 A;  3LSQ A;  2DMX A;  1FXH A;  4PHZ A;  1AI5 A;  1GRJ A;  5CBG A;  3OUF A;  1SET A;  4EEQ A;  4DV5 B;  2Y69 C;  5EYP A;  2YIC A;  3E35 A;  3AK1 A;  1GN6 A;  2X6C A;  1Q90 D;  4O4L A;  5B1B C;  4I4T A;  4B3S O;  1ZX3 A;  5EC2 C;  5LMU O;  5J2U A;  1VQN V;  1FXK A;  5KHK A;  2PGG A;  2ZQM A;  3JD3 A;  1ZWI C;  4LNU A;  4DV1 O;  2UXD B;  5BXZ A;  4HZ3 A;  4NXN B;  4JTC B;  5LOV B;  1HW7 A;  1MAB G;  1MA1 A;  3ZMZ A;  5CBF A;  5IJ9 A;  2B9Z A;  3APO A;  3LNM B;  4JAA A;  4PA7 A;  3MHH C;  2Y69 B;  1RPO A;  5L3C A;  4NVP A;  5GON A;  4X65 B;  3IAY A;  1XIL A;  4ZOL A;  2Q7G A;  1KKD A;  1TVK A;  1FXV A;  2ZNJ A;  4UVC A;  3JAK B;  3F7V C;  2IH1 C;  4WFF A;  5L3E A;  4KP4 A;  5HFM A;  1PPJ H;  5LA6 B;  1VQK V;  4DV3 O;  1OCZ C;  4B3T B;  1O9G A;  5LHI A;  1S77 D;  2N05 A;  1BCC H;  2UXC B;  4JI0 B;  1GK9 A;  2Q7H A;  2QKS A;  5JH7 B;  1YIT V;  2M7W A;  3AG4 C;  3K03 A;  1QBZ A;  2CH7 A;  3KCY A;  3K79 A;  2XT9 A;  3U11 A;  3OGI B;  1Y67 A;  1GN2 A;  3JD1 A;  4PD4 F;  2W6J G;  1PNK A;  5E1A C;  3LDE A;  4CH5 A;  4NXM B;  2CTP A;  3E2E A;  4IYH A;  1Q43 A;  5KUK A;  5CA1 B;  3SDL A;  3JAK A;  1YXB A;  2CTW A; 
#chains in the Genus database with same CATH homology
 3RT3 C;  3F5T A;  1X59 A;  1N34 O;  1A32 A;  1XNR O;  2FKX A;  4X65 O;  4JI8 O;  4YY3 O;  2UUB O;  4JI4 O;  4B3S O;  2JRI A;  1R6T A;  5LMU O;  1XNQ O;  2DOS A;  4JI5 O;  4A5U B;  4OPA A;  4OX9 O;  1FJG O;  2HHH O;  1IBK O;  1YZB A;  4K0K O;  3T1Y O;  1IBL O;  3T1H O;  4DV1 O;  1HNW O;  1DK1 A;  5BXZ A;  4DV7 O;  3M8A A;  4JV5 O;  2UXC O;  2UUA O;  5FLX N;  4YHH O;  4X62 O;  4DV2 O;  4LF9 O;  1AIL A;  4JI1 O;  5IWA O;  5LMN O;  4AQY O;  4DR5 O;  5H5N A;  1N32 O;  4LF6 O;  4LF5 O;  4X66 O;  2E5L O;  2UUC O;  4DR6 O;  1G1X B;  1HNX O;  5A2Q N;  3J81 N;  1J5E O;  4KHP O;  4DR2 O;  2VQE O;  4DUZ O;  4JI3 O;  4DV5 O;  4DR4 O;  4JYA O;  5BR8 O;  2N74 A;  1F7Y A;  3O65 A;  2LW7 A;  1FYJ A;  4X64 O;  1R1B A;  4DUY O;  4DV3 O;  4LF7 O;  4LFB O;  4JI7 O;  5BY1 A;  4GKK O;  4DR1 O;  2ZM6 O;  1KUQ A;  1I94 O;  4LF4 O;  4LF8 O;  1NS1 A;  4LFC O;  4NXN O;  4B3M O;  2UXD O;  3J7A U;  3J80 N;  2VQF O;  5LL6 Y;  1FKA O;  1N33 O;  1XEQ A;  3JAM N;  4GKJ O;  2ZKO A;  3R66 A;  5IT9 N;  4DV4 O;  2AGA A;  2Z0A A;  3OTO O;  4OPH A;  4JI0 O;  4JI2 O;  2DJV A;  4B3R O;  1AB3 A;  2UU9 O;  4LFA O;  4DR7 O;  1XMQ O;  4DV0 O;  4DV6 O;  1IBM O;  4B3T O;  1HNZ O;  1D2D A;  1XMO O;  1N36 O;  1HR0 O;  2UXB O;  4JI6 O;  2F4V O;  4NXM O;  3SDL A;  4DR3 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...