4DV1O

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g, bound with streptomycin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
87
structure length
87
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 31
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4dv1O00
1G1XB 4X65O 1AILA 2AGAA 3J7AU 1R6TA 4YY3O 4GKKO 4JI1O 5IWAO 4DV2O 1FKAO 1FYJA 4JV5O 2VQFO 4DR2O 4YHHO 5LL6Y 1XEQA 4OX9O 4LF7O 4DR3O 2DJVA 4DUYO 4LF9O 2ZKOA 4GKJO 1I94O 4JI8O 1IBMO 4LF4O 2E5LO 1N36O 4X64O 4LF5O 3JAMN 4B3MO 3R66A 4JYAO 3RT3C 2UUBO 2UUAO 1AB3A 4B3TO 4JI7O 3OTOO 1J5EO 3F5TA 4DR6O 2DOSA 2UXBO 4DR7O 4LF6O 1YZBA 3SDLA 4LF8O 4DV1O 1X59A 2ZM6O 1F7YA 5BY1A 4X66O 5IT9N 4K0KO 2JRIA 1HNWO 2VQEO 3J81N 4JI3O 3T1HO 2F4VO 1D2DA 4OPAA 4DV5O 1FJGO 1HR0O 5BXZA 1A32A 4A5UB 5H5NA 2HHHO 1NS1A 1XNQO 4JI0O 4DV3O 1HNZO 2UXDO 4DUZO 1N32O 4NXMO 4DR5O 2UUCO 4DV6O 4B3RO 1XMQO 4LFAO 4JI2O 5LMNO 1XMOO 5BR8O 4B3SO 3M8AA 4JI6O 2N74A 1N34O 3T1YO 5A2QN 2UU9O 4DV7O 1IBKO 4KHPO 4DR1O 4DR4O 4DV0O 1HNXO 4OPHA 1R1BA 4JI5O 4LFBO 2LW7A 3O65A 4LFCO 4DV4O 1KUQA 2Z0AA 1IBLO 2FKXA 3J80N 1DK1A 1XNRO 5FLXN 2UXCO 1N33O 4NXNO 4JI4O 5LMUO 4AQYO 4X62O
chains in the Genus database with same CATH superfamily
1Y67A 3BAAA 2HKOA 2H8PC 5IWAB 3RVYA 1Y4MA 5DM6V 2UXBB 4LF8B 1NR7A 2M6YA 3FD9A 3ASOB 3CJHB 4NYKA 3SYPA 1AR1B 2H94A 3QF7A 4LF4B 2E5LB 4DO2A 4GYCB 1P4RA 1SF9A 3HKBA 3WB0A 1S76D 3E89A 4JYAO 2DWEC 2UUAO 4W4LA 4B3RB 1J5EO 2RQ6A 3RYFA 1YVWA 2WPDG 4LF6O 4DR7O 3G6EV 4IYIA 2CH7A 2ZM6O 2YSUB 4X1YA 5H6RA 1WPBA 2XAHA 1XUQA 4U3JA 2YXHA 3ZMTA 1SA0A 3S3XA 3AK3A 1UPGA 1XL4A 1N32B 4FZ0A 4IHJB 4GX1A 1Y74B 4DUZO 4WBNA 3TXSA 2ZDIA 5EYPB 2C2AA 1WN7A 2JVDA 3H1JH 4JI6O 1ZAUA 3SPHA 3SPGA 4O2AB 4BIZA 2L35A 4JAVA 1NH2B 3TJTA 4DR1O 4TV9B 2QM7A 3ASNC 5E1AC 3BCCH 2HR3A 4MTGA 5L3DA 3DSQA 3N2GA 4MVMA 2Y4TA 1GM7A 1XNRO 4FLXA 3DXRB 4UVCA 5EZYA 1VP7A 2LW1A 1KU9A 3E2EA 3OTFA 3FAVA 1QR8A 1EZVH 1JCHA 1GAXA 3G71V 2QKAA 2ZDIC 3CB2A 4DV2O 1AR4A 4W4KA 4YHHO 3K0DA 4FMTA 1I08A 4AILC 4FVMA 4ASUG 2A06H 3A0BZ 2XNDG 4XDLA 1IX9A 4JZ2A 3G6BA 3JCUZ 4UVBA 1IXBA 4B3MB 1FJGB 4J7ZA 5LP6A 1OZ0A 3HKBB 2WLLA 4FFKA 2V7QG 1AB3A 1VQ4V 2OTJV 2YDEA 3F5TA 1MOFA 5KMGA 5KUKA 4IL6Z 2WLIA 3RYFB 4NTWA 5BY1A 1N4CA 2YC0A 3ASNB 2CH7B 4E4EA 3OMAB 2EZPA 2HEPA 1HNWO 1CXZB 4DXWA 4X1YB 3QVNA 2CTQA 4U3JB 2ZR2A 1WB8A 1Z2GA 1SA0B 4GUNA 4DV4B 2NR5A 4JI0O 3I56V 1M9NA 3BHPA 5B1AC 1FD9A 3B8MA 4JAAA 5LYJA 5J9PC 2ZT9B 5LP6C 5KHHA 1KP3A 2F4VB 4WBNB 4B7EA 3UO2A 2JGDA 1CEZA 1R3IC 3P3PA 4PI2A 1YSCA 4PDLA 2QWRB 3HPLC 1BCCH 2Z0AA 2Q67A 3T2MA 3ZEDA 4AHCA 3N2GB 2CE4A 4JI4O 1RPOA 1WJZA 1P49A 3LNNA 4UCUA 4YY3B 5EZYB 3J7AU 2ITDC 1TA8A 3CCUV 3BRCA 3FAVB 4OXSA 2YIDA 3OUFA 2HJFC 4DV1B 3JASA 4PV1B 2GBOA 4DR3O 1PV0A 2LFSA 1N36B 4I9WA 1E1RG 2QTOA 3L75H 2GTAA 4QPJA 3L74H 5B1AB 1M56C 4G2KA 1XBLA 3OFNG 5LP6B 5CA0A 1O9HA 1TUBA 4G27B 4P30A 1Q7YW 2WLLB 4PI0A 2UXBO 3RYCA 2OYQA 3A0HZ 4LF8O 1VQ8V 5KMGB 4IIJA 1QLNA 4UB8Z 1F7YA 4K0KB 2WLIB 5IT9N 1FXKA 2DYSC 5LGUA 4DV0B 3J81N 3T1HO 1HNXB 5F2VO 1R3KC 4OPAA 1Q5OA 1SKVA 1S5JA 3A0RA 3BVOA 4UVAA 2PY5A 2JK5C 3JD0A 1ZL8A 4MTXA 4PA7A 4LFAB 3S3WA 4B3RO 1VQPV 1XMOB 3CYOA 5LYJB 2HVKC 3VBBA 1D5NA 1XI1A 2WAMA 2IU0A 3JATA 3T1YB 4GKKB 1V55C 4D7TA 1VQ9V 3K3WA 5DECA 2LGQA 2JGDB 2Q7EA 5J2TA 1WA8A 3BABA 3L72H 5L3CA 3E8BA 5KA6A 3AG2C 1EM1A 2RNBA 2X7RB 1FXKC 4O4LA 3X2QC 1PPJH 4UCVA 3E22A 1OCCC 1VF6A 1B3QA 1M56B 2R9AA 4R6ZA 2QKSA 3G4SV 5LBQA 5B3SC 3OTOB 1PNLA 2IM9A 4JV5O 4MTFA 2YIBD 4LH6A 1SQVH 2DYSB 3JCZA 3JASB 2W6IG 1F51A 4LF9O 1MZEA 1S3JA 1RP3B 3RGBA 3F7VC 1WNSA 2DQ0A 3ZHTA 1VF7A 1M4UA 4JYAB 2ZIOA 2QTSA 5A9GA 3KZIZ 3RYHA 1XNQB 3OEEG 4I0XA 4NXMB 2Z5UA 5K1PA 4DR5B 1VF6C 2DN9A 3DC5A 4FM2A 2RCVA 4LWSA 1EFRG 3EXAA 1TUBB 3K9AA 3JYCA 1K4DC 3RYCB 5JJNB 3QNEA 4X66O 1W0KG 3AG2B 4IIJB 1JA8A 1FXKB 4EFBA 4GLXA 1FJGO 3X2QB 3STLC 2AW9A 1M90W 4MSWC 3CCJV 4UFZA 2QWPB 2ZQMA 4YJ2B 4DK1A 1XMQO 4NXNB 2F95B 1ZL8B 4AQYB 4JI6B 4TT3G 4J10A 2JS5A 1AI5A 5B3SB 3M8AA 1H2SB 3VQYA 1XDCA 2QDOA 3LDCA 1YJWV 1QVFU 4WFGA 1VQ6V 4DV7O 3JD1A 3HKDA 4L87A 4OPHA 4DR2B 5J2TB 3ETEA 1WA8B 3O65A 2D3OW 4DV4O 4FFBA 4WCEV 3H1LH 5JQGA 3FFQA 2HG5C 2CTRA 2GSMB 2ZINA 4O4LB 1K34A 2Q68A 2F4VO 4RQEA 3THOA 3E22B 3UKMA 1PL0A 3CRCA 1YEWA 3JAWB 5IYZA 5B1BC 4MS2A 1FKAO 3D36A 3SPIA 1QLEC 2ZE5A 1N8RW 3ZRSA 3JARA 1EN4A 3EVKA 2DJVA 1NJIW 3IFXA 1R3JC 1PNMA 4I4TA 1PD3A 4J7JA 4R7CA 2ZNIA 2QWOB 4FM1A 3VOUA 3ETDA 2ADPA 3IJ4A 1YIJV 4BIUA 2UUCB 3RYHB 3RFRA 4DV6B 4O4HA 4I0XB 2DOSA 1YZBA 2F1MA 5BR8B 4DV1O 4LWSB 2X6AA 2NN4A 1P84F 2R70A 1N34B 3K9SA 1HNWB 4HNAA 2RMKB 3UO3A 1B6QA 4HYOA 2HJDA 4DR4B 3CP1A 2JDIG 3D36C 1LNQA 3IAYA 1YHQV 4ABMA 1AP6A 1JPXA 3JAKA 2QWNB 4PHZA 1SQFA 4A5UB 1TVKA 4J11A 3ZN0A 1I7FA 3RW0A 5LMUB 3GVMA 5B1BB 1YTFB 1NTZH 3ZMSA 3ASOC 1RPRA 3ZMVA 4MVUA 1ZUQA 1GH6A 5IYBO 1QLEB 2W0XA 4DV0O 1HNXO 2IU3A 3HKDB 4KP4A 4TWKA 4LF7B 2FB5A 4DUYB 5EYPA 1VQNV 2PYJA 1ORQC 2A0LA 1U97A 4QE7A 1K73W 1IBMB 4FFBB 5JQGB 1O9GA 3EFFK 1NZ6A 4UCTA 1E1QG 4WFAV 1KKDA 3IGAC 4X20A 1ENVA 4GKKO 3H1HH 3CC4V 2K1EA 5IYZB 2RDCA 4CC5A 2OTLV 1VQOV 1AP5A 4UUJC 1GTOA 5LL6Y 4FLTA 1K8AW 2EJRA 3KCXA 4H13B 3JARB 5IJ9A 2NNUA 4LC1A 4O4JA 5LGNA 4JAUA 3SYAA 2PI4A 4I4TB 3CMAV 2OIEA 4LP8A 1SQPH 3OTOO 5FL7G 1JJ2U 4O4HB 1QU7A 4GT1A 4KFMA 3WG7C 4NB5A 3T1HB 2Q6AA 4HAMA 4HNAB 3SGIA 3FB5C 3CEIA 3LDDA 5LA6A 2QR4A 2KB1A 1KP2A 5E79Z 1XNQO 1HNZO 1XHXA 1KBHA 4NXMO 3JAKB 4DR5O 2ZE7A 3DTUB 1TVKB 3BFRA 5CN0A 2IJJA 5EC1C 1W2BU 2R9RB 2E3CA 1H2LA 2QKCA 4B08A 3E8HA 2XAQA 1VQKV 3RWRD 2QM8A 2Z3YA 1F4NA 4ZBMA 5B66Z 3B2EE 2YEVA 3BPZA 3E86A 1KUQA 1F23A 1OCZC 4NXNO 3ZHVA 4QNHB 1XQ8A 2YXYA 4AQYO 4Z1VA 2PI5A 2QA4V 3JSNA 2VS0A 3B40A 4PDRA 2LO1A 1R6TA 2EZOA 4MW3A 3TGUH 3O9OA 1US6A 5FPOA 4JV5B 2X0LA 4X20B 3B09A 2DW4A 3HR0A 3WG7B 1AI4A 2VQFO 1VQMV 4DR2O 2ZR3A 3N2KA 4LF9B 1LUWA 4RAIA 1ZX3A 4X64O 4DV5B 5IJ9B 3JAMN 4CBCA 4O4JB 4CH5A 2V1DA 1BHAA 3MAQA 5FPRA 1HW7A 3OEHG 3B4SA 3AG3C 1ZTEA 4I9QA 1X59A 4X66B 5J2UA 5AG2A 2ZD9A 4HZ3A 2EILC 1VARA 2QGNA 1MZFA 1EZJA 3RVZA 2ZIMA 1FXHA 1OV9A 1WAZA 3SYCA 1OCZB 4MTOA 5L3EA 5LA6B 5C8YA 1XMQB 2UUCO 4DV6O 5JWPA 3H01A 3G80A 1SC5B 5BR8O 2EIKC 1WLEA 4DV7B 1N34O 1FFTB 1MSWD 4DR4O 4LR3A 1UJWB 3H1KH 3CS5A 4PA6A 4QJFB 4F6EA 3SPJA 4K8XA 4GKJB 1K97A 2YEVB 4BAYA 2BOBC 5FLXN 1BQ0A 5JJEB 4WFBV 5LMUO 1S77D 2G38A 2LJ2A 1BMFG 3OAAG 4RQFA 4X65O 5IJ0A 2UUBB 2DE0X 4I55B 4B3TB 2CUGA 4JF3A 4FLYA 3AG3B 3ZX6A 4MVOA 2Q0OC 1GM8A 5KAIZ 2EILB 4TV8A 1T5EA 5D5QA 4LF7O 4NTXA 4DUYO 2IW5A 3N2KB 1IBMO 3CCRV 1CPYA 3JALB 2W0FC 4K35A 2ARHA 2EBOA 1WPXA 2QEXV 3GB7C 4LH7A 2EIKB 2DWDC 4JGSA 2VWKA 4X88A 1DTOA 1S5LZ 4CC6A 1Z5VA 2ZE8A 2ZXWC 5BZBA 1JVMA 3WB2A 5LHGA 1H8EG 5J2UB 2CTWA 3UCSC 1V9PA 3CRRA 5JJJB 3OMNB 1COWG 3MD0A 4ZKIA 2IJKA 1N33B 4Q20A 2PF4E 5C8YB 1W0JG 4YIOA 3KG2A 3K5NA 4PA9A 1BSMA 1WP8A 2VRZA 2GHYA 3QG5A 4UCOA 3D8CA 3CCMV 4ZOLA 1BGYH 4YJ3B 2OCHA 3DGEA 1SERA 2R72A 4LFCO 4YJ2A 1QR9A 5C93A 3OR6C 5GW7A 3ABLC 1NQTA 3CWBH 1SQGA 4MVRA 3R65A 4PDVA 4BW5A 1XL6A 3CC2V 4JYBA 1AJPA 2ZE6A 1YF2A 2R9IA 2WLKA 1NT2B 5IJ0B 3K08A 5B1NA 2ZXWB 1P7BA 2IJIA 4JTCB 1NU1H 2O57A 4TV8B 5IE9A 2ILMA 3JAWA 3OD4A 1MSDA 2Q69A 5EBLC 3STZC 2IJHA 1GM9A 3EHBB 1KECA 4NTYA 5KHJA 5KX5A 3CRAA 3ZHQA 3K5LA 4JI2B 1L1FA 1BHBA 1EBOA 4J9YB 4D7SA 2QM4A 4FLUA 3CXHF 3ZJZA 2H3OA 2Y0PA 4P2ZA 1JQ0A 4G28B 3TETA 3BEHA 3ML0A 4JI3O 2ADQB 2Q7HA 2X6CA 3ABLB 4DV5O 3WFVA 3H9VA 1GRJA 2HLDG 1HNZB 1MMMA 3QO7A 3GWKC 1QNMA 3JD4A 1OHHG 2P06A 2XAFA 4OGQB 3ZMZA 1BE3H 4X62B 1UFIA 5JCOA 3ZBHA 5HFMA 2F66C 3HB3B 5EBWC 2FMLA 3I5DA 2V4DA 2XT9A 3K0GA 1K9MW 4UXNA 1B04A 2AXTZ 4ZOLB 3CRMA 2CGOA 4J42A 1YXBA 2FKXA 3WB1A 3ZS8C 2AHZA 3SJBC 4JI8B 1L0NH 3ABMC 4FJCC 3RBZA 2Q4PA 3Q4HA 2B9ZA 4JTDB 1G1XB 1HWYA 1Z5WA 1G6UA 3E35A 3ZCCA 4J7KA 3MHSC 2WSSG 2VQFB 2YI8A 2QJ1A 5JCOC 2B1GA 2Q73A 1XHZA 2WLMA 4RUEA 2Y48A 3F7YC 2ZKOA 3CCEV 3OW2U 4GKJO 1TUEB 3P32A 1KYOF 1ZWIC 4X64B 2OT5A 3VQVA 1MNGA 1RFYA 1N0NA 2UXNA 3R66A 1XREA 1H2MA 3ZN1A 3N27A 5K1XA 2UUBO 4CS2A 1VEWA 4H33A 3TCUA 2PTMA 3I55V 4B3TO 4I50A 1Q8IA 4DR6O 5LMNB 5KX5B 2IH1C 1YITV 4X1IA 1TAEA 1I5YA 1GK9A 4CH6A 4CS4A 4H44B 4N21A 2Q5ZA 3ABMB 1QBZA 2UXDO 2Q0AA 1PL4A 2UXCB 3JD3A 3L9DA 4QE9A 4PDMA 4JASA 2KKWA 4B3SO 3ZRVA 5DEDA 5CMUA 3ZHRA 1NH2D 4JI1B 5A2QN 3CC7V 3MDSA 1K5SA 4FLZA 1Y76B 3K03A 3ZIAG 5LXTB 3LNMB 3K5OA 3CPWU 1EN6A 1RSOB 4E2LA 1I94B 4O4IA 2NLJC 1BT8A 3P3NA 2P7TC 1N33O 3D3QA 1SETA 4QGPA 4X65B 3P30A 1Q86W 3Q4HB 2Y0IA 2EINC 5KLVH 2ETNA 3RYIA 3LDEA 2RN9A 2QWQB 2E74B 5TISZ 2DYRC 4WFFA 2N05A 2P4KA 1KD1W 3RN4A 5EC2C 4MVZA 1GKFA 1WP7A 1DGSA 3L71H 3CE2A 4LF5O 1JMKC 5CBFA 2KG7A 3HKEA 4DV3B 1KKCA 3C90A 1K92A 2YXLA 3AG1C 1OJHA 1KQSU 2FTKA 4TSFG 4PA3A 1YJNV 4B7KA 2P5OA 2WA4A 4I50B 1QHTA 3E8FA 2DQ3A 4YXWG 1JOYA 4X1IB 3AG7A 2P22C 4P9OA 4GX0A 4U3FH 1HR0O 3PJSK 3DC6A 2EJ7A 3CRQA 2OIGA 3L73H 2A9HA 2PYLA 2HP8A 1KC8W 4IT5A 2F93B 4JI2O 1M5IA 2EINB 1VQLV 4TQDA 2WA3A 3CCQV 1OCOC 2N74A 2A7WA 2DYRB 3U0ZA 3A8TA 4CZZA 4K8ZA 2VWJA 1PM9A 3APOA 2WLJA 4MW8A 4JI5O 4LFCB 5FNVA 2ZNJA 3L70H 5BMVB 1X4TA 3CCVV 1Q82W 1DK1A 1K4CC 1AR5A 4XDJA 5IYDO 3VQXA 4J41A 4DRXA 4WFEA 4O4IB 2YIAA 3K04A 4X62O 4ZHQA 3AG1B 1GN6A 4CH4A 1Q6IA 1JFFB 1NTMH 4X1KA 3VQWA 2HFEC 2HVJC 1FYJA 4R50A 2MW2B 5EIBC 3SYQA 3W7SA 3RYIB 3HKCA 2PZSA 3K79A 4UV9A 5LGTA 4KUMA 1G4YB 3WU2Z 2VQEB 4JI8O 3OMIB 1BQZA 3BY6A 3OT7A 3ETQA 3ICXA 3H1IH 2M7WA 4I55A 3OGCC 3FYIB 1RM1C 3RT3C 2KG7B 2JIZG 3HKEB 2Y69B 3ZHSA 1TGOA 1SESA 4PELA 4MVSA 1R73A 1YDXA 1OCOB 2A3QA 4U7NA 4BWAA 4BR6A 2BE3A 1PKXA 3BA8A 3JALA 4JI3B 1D5AA 1AJNA 2LP7A 3GWOA 2EX3A 4LFBB 4UB6Z 2B1IA 2ZCEA 3CMEV 3LUTB 3B77A 2HHHO 4UCSA 3KCYA 3MHHC 4N23A 2JJ2G 1N0JA 3OGIB 5CB4A 1FFXA 5LMNO 3D3IA 3QTCA 4O2BA 2E76B 3CHXA 1IBKO 1SQQH 1VQ5V 3U11A 3AK2A 1DLBA 3CCLV 2E75B 1BS3A 4OX9B 3IC9A 2FL4A 3ABTA 1Y66A 5FNVB 5LHHA 5IYCO 3IC7A 4LBEC 4Q6GA 5KA5A 4PJ0Z 2UXCO 5KHIA 1NVPB 3OUSA 1RM1B 4WFHA 4Z2WA 3NXSA 4TUYA 1S0VA 4DRXB 3E83A 3K58A 4ZHQB 2DMXA 4YJ3A 4JI1O 4JI7B 1K5QA 1BZKA 5L3FA 3CSXA 1MA1A 4X1KB 1AROP 2W6JG 2K9PA 1GO3F 1H38A 4WF9V 1J95A 3SPCA 4GX2A 3HKCB 2IH3C 4GZRB 1I94O 5KHKA 5JVDA 3CX5F 4XDKA 1WB7A 4JYCA 3OE7G 2D2CB 1YCIA 4X89A 4EB6A 3W7XA 2JGUA 2BTOA 4DR6B 2BCCH 5LHIA 5GTIZ 1AI6A 1FS0G 2CAZC 2AHYA 5DN6G 4AI8A 2UU9B 4J9ZB 4GCZA 1R6KA 2CK3G 2XOKG 5KHGA 1K33A 2JRIA 3K06A 3SYOA 3LSQA 1DF5A 2WLHA 4QPKA 2N04A 3JSLA 4ZIBA 2P67A 2UXDB 5BXZA 5H5NA 4DV3O 4QIWF 1ZSPA 5B5EZ 1IDSA 3CD6V 4JPRA 1IVSA 4B3SB 3OM3B 4R8CA 1H2NA 2AZ0A 5CB4B 1SZTA 5B1OA 1FFXB 2MK3A 5LOVA 4EEQA 2F43G 4O2BB 1SQXH 2WLNA 1GN3A 4KHPO 1IXMA 3M99B 2OWOA 5GONA 3W7WA 1GMGA 1FAFA 1H2KA 3UM7A 2CDYA 1L0LH 1MG1A 2WWWA 2IBZH 3FB6C 3ZRWA 2KQXA 5JH7A 2AZ2A 4TUYB 1QVGU 5IWAO 4JYYA 4KL1A 2EIMC 1P7GA 4IGGA 1U96A 5CBGA 3F5WC 3SJQC 1DF4A 2X6BA 4H0LB 1YI2V 1GN2A 4LF5B 4LF4O 2E5LO 1XOUA 4RUFA 1M1KW 2LFRA 5JVDB 1MABG 1BL8A 1GN4A 1I0HA 4MT8A 4EB6B 1LUVA 2GDSA 5HFLA 4LCUC 3LSSA 5D5PA 3AK1A 3PN1A 4RWUA 2VQEO 3FX7A 4DK0A 3LSUA 3UT5A 1HR0B 4BIOA 2ATKC 1S5HC 4X8AA 4HBNA 1E79G 4CH3A 4NVPA 1PP9H 3K5MA 1K3EA 3KKYA 1IBLB 2XAJA 1N32O 3W7TA 1OCRC 1URFA 5GTHZ 5L3GA 2L6LA 1R6NA 3K59A 3FB8C 1YTFD 3NR7A 4IYHA 2XASA 3W7UA 1Q3EA 4RO2A 3SJCC 4PD4F 1JR9A 1F4MA 4FIPC 2EIMB 3K57A 4JI5B 2JS3A 3SJAC 5LOVB 4FZ1A 1HP8A 4FK5C 4JZGA 4LFBO 3UQ8A 1L8DA 3ABKC 2GUZA 5GONB 1G8MA 1IURA 1M57C 1Y6XA 4CS3A 4ICGA 3AG4C 1NBMG 2AGAA 3ABUA 1H8HG 3BA9A 2P90A 2XAGA 2UUAB 1Y76A 2GV9A 4EKWA 5H6QA 3ZRWB 5IY5C 1J5EB 2BSKA 2JEXA 5EK0A 5CA3A 2YI9A 5JH7B 5LXTA 4H37A 1THZA 3ZHUA 4DR7B 3QO8A 4LF6B 4GX5A 1RSOA 5CA0B 1V55B 2QE7G 4LNUA 2OCCC 2ZM6B 1XEQA 4OX9O 4J80A 4JTAB 1Q81W 2PGGA 4BW9A 3AEIA 1IZ3A 4FLVA 1R3LC 4EFEA 2EIJC 4ZI7A 5CBHA 2A79B 4D6TH 1OCRB 4B3MO 5L3BA 1JJOA 4DUZB 5CA1A 1Q43A 1OCCB 4NR1A 3FYEB 4JI7O 3T4DA 2YIBA 1ZLZA 2XTAA 3APQA 3SDLA 2P6JA 2XUMA 3B8NA 1NKDA 2UXXA 5ITZA 3FB7C 4C7UA 1AI7A 2Y4UA 3JATB 4DR1B 4FLWA 2B5UA 3ABKB 4PA4A 1K7DA 2P4VA 1M93A 2HHHB 1A32A 3UT5B 3ETGA 4UCRA 1VF5B 1KMIZ 1Q6UA 2F23A 1M57B 4Z1MG 1XNRB 2EULA 1B06A 3AG4B 4X9QA 4F6RA 1LR1A 4U7OA 2GTSA 3JD2A 1JX9A 3M7MX 4DW0A 5IY5B 4FM0A 1S72V 4L8JA 2LGWA 1ROPA 1IBKB 2PUSA 2ODMA 3OR7C 1SRYA 2UU9O 1AJQA 2KSDA 4DV2B 3T1CA 3TK1A 2OCCB 4FPPA 3ZMUA 5EBMC 1SQBH 3A2FA 2LW7A 4YHHB 4YIPA 2ITCC 4F4LA 2BTQA 2EIJB 3J80N 3QO5A 1XILA 2GUZB 3C3TA 2JJ1G 1FXVA 1I5XA 4TOIA 5KAFZ 1AILA 4YY3O 3U10A 1VIBA 4UV8A 5BMVA 2RJZA 3CJHA 1FPOA 2BSKB 5IDJA 5H2FZ 2YICA 4DW1A 4LNUB 5H9CA 1KB9F 1SS3A 2CTPA 1JFFA 3E8GA 1SZXA 1N36O 1QQCA 1V54C 4ZI7B 4JI0B 3FKSG 3TXQA 1W59A 4XBFA 1YJ9V 5CA1B 4I7ZB 4I5SA 2FYUH 2Q9LA 2XHBA 4DYLA 3SR2C 1Q6HA 1NI8A 1NTKH 5EIBD 3C3SA 4K0KO 1EN5A 2YS8A 4IHJA 5ITZB 1D2DA 3CCSV 1Y74A 2BOCC 2Q8VA 1NS1A 5KUMA 1H2GA 2Q7GA 1NVPD 2QSAA 4JI4B 4LFAO 1XMOO 1HDJA 4O2AA 3T4ZA 4F6RB 2CGNA 1VQ7V 4MVQA 2JEUA 2YUAA 3T1YO 4TV9A 4KHPB 3CXCU 4K3AA 4P9PA 1CP9A 1QCEA 1R1BA 3ZRXA 1VMGA 4DR3B 1NR1A 4NKGB 3DXRA 4TQFA 1IBLO 2LQTA 4KXRA 2BTQB 1PNKA 1Q90D 1V54B 1AVMA 2Y69C 3G67A
chains in the Genus database with same CATH topology
1G1XB 4X65O 1AILA 2AGAA 3J7AU 1R6TA 4YY3O 4GKKO 4JI1O 5IWAO 4DV2O 1FKAO 1FYJA 4JV5O 2VQFO 4DR2O 4YHHO 5LL6Y 1XEQA 4OX9O 4LF7O 4DR3O 2DJVA 4DUYO 4LF9O 2ZKOA 4GKJO 1I94O 4JI8O 1IBMO 4LF4O 2E5LO 1N36O 4X64O 4LF5O 3JAMN 4B3MO 3R66A 4JYAO 3RT3C 2UUBO 2UUAO 1AB3A 4B3TO 4JI7O 3OTOO 1J5EO 3F5TA 4DR6O 2DOSA 2UXBO 4DR7O 4LF6O 1YZBA 3SDLA 4LF8O 4DV1O 1X59A 2ZM6O 1F7YA 5BY1A 4X66O 5IT9N 4K0KO 2JRIA 1HNWO 2VQEO 3J81N 4JI3O 3T1HO 2F4VO 1D2DA 4OPAA 4DV5O 1FJGO 1HR0O 5BXZA 1A32A 4A5UB 5H5NA 2HHHO 1NS1A 1XNQO 4JI0O 4DV3O 1HNZO 2UXDO 4DUZO 1N32O 4NXMO 4DR5O 2UUCO 4DV6O 4B3RO 1XMQO 4LFAO 4JI2O 5LMNO 1XMOO 5BR8O 4B3SO 3M8AA 4JI6O 2N74A 1N34O 3T1YO 5A2QN 2UU9O 4DV7O 1IBKO 4KHPO 4DR1O 4DR4O 4DV0O 1HNXO 4OPHA 1R1BA 4JI5O 4LFBO 2LW7A 3O65A 4LFCO 4DV4O 1KUQA 2Z0AA 1IBLO 2FKXA 3J80N 1DK1A 1XNRO 5FLXN 2UXCO 1N33O 4NXNO 4JI4O 5LMUO 4AQYO 4X62O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G1X B;  4X65 O;  1AIL A;  2AGA A;  3J7A U;  1R6T A;  4YY3 O;  4GKK O;  4JI1 O;  5IWA O;  4DV2 O;  1FKA O;  1FYJ A;  4JV5 O;  2VQF O;  4DR2 O;  4YHH O;  5LL6 Y;  1XEQ A;  4OX9 O;  4LF7 O;  4DR3 O;  2DJV A;  4DUY O;  4LF9 O;  2ZKO A;  4GKJ O;  1I94 O;  4JI8 O;  1IBM O;  4LF4 O;  2E5L O;  1N36 O;  4X64 O;  4LF5 O;  3JAM N;  4B3M O;  3R66 A;  4JYA O;  3RT3 C;  2UUB O;  2UUA O;  1AB3 A;  4B3T O;  4JI7 O;  3OTO O;  1J5E O;  3F5T A;  4DR6 O;  2DOS A;  2UXB O;  4DR7 O;  4LF6 O;  1YZB A;  3SDL A;  4LF8 O;  4DV1 O;  1X59 A;  2ZM6 O;  1F7Y A;  5BY1 A;  4X66 O;  5IT9 N;  4K0K O;  2JRI A;  1HNW O;  2VQE O;  3J81 N;  4JI3 O;  3T1H O;  2F4V O;  1D2D A;  4OPA A;  4DV5 O;  1FJG O;  1HR0 O;  5BXZ A;  1A32 A;  4A5U B;  5H5N A;  2HHH O;  1NS1 A;  1XNQ O;  4JI0 O;  4DV3 O;  1HNZ O;  2UXD O;  4DUZ O;  1N32 O;  4NXM O;  4DR5 O;  2UUC O;  4DV6 O;  4B3R O;  1XMQ O;  4LFA O;  4JI2 O;  5LMN O;  1XMO O;  5BR8 O;  4B3S O;  3M8A A;  4JI6 O;  2N74 A;  1N34 O;  3T1Y O;  5A2Q N;  2UU9 O;  4DV7 O;  1IBK O;  4KHP O;  4DR1 O;  4DR4 O;  4DV0 O;  1HNX O;  4OPH A;  1R1B A;  4JI5 O;  4LFB O;  2LW7 A;  3O65 A;  4LFC O;  4DV4 O;  1KUQ A;  2Z0A A;  1IBL O;  2FKX A;  3J80 N;  1DK1 A;  1XNR O;  5FLX N;  2UXC O;  1N33 O;  4NXN O;  4JI4 O;  5LMU O;  4AQY O;  4X62 O; 
#chains in the Genus database with same CATH topology
 1Y67 A;  3BAA A;  2HKO A;  2H8P C;  5IWA B;  3RVY A;  1Y4M A;  5DM6 V;  2UXB B;  4LF8 B;  1NR7 A;  2M6Y A;  3FD9 A;  3ASO B;  3CJH B;  4NYK A;  3SYP A;  1AR1 B;  2H94 A;  3QF7 A;  4LF4 B;  2E5L B;  4DO2 A;  4GYC B;  1P4R A;  1SF9 A;  3HKB A;  3WB0 A;  1S76 D;  3E89 A;  4JYA O;  2DWE C;  2UUA O;  4W4L A;  4B3R B;  1J5E O;  2RQ6 A;  3RYF A;  1YVW A;  2WPD G;  4LF6 O;  4DR7 O;  3G6E V;  4IYI A;  2CH7 A;  2ZM6 O;  2YSU B;  4X1Y A;  5H6R A;  1WPB A;  2XAH A;  1XUQ A;  4U3J A;  2YXH A;  3ZMT A;  1SA0 A;  3S3X A;  3AK3 A;  1UPG A;  1XL4 A;  1N32 B;  4FZ0 A;  4IHJ B;  4GX1 A;  1Y74 B;  4DUZ O;  4WBN A;  3TXS A;  2ZDI A;  5EYP B;  2C2A A;  1WN7 A;  2JVD A;  3H1J H;  4JI6 O;  1ZAU A;  3SPH A;  3SPG A;  4O2A B;  4BIZ A;  2L35 A;  4JAV A;  1NH2 B;  3TJT A;  4DR1 O;  4TV9 B;  2QM7 A;  3ASN C;  5E1A C;  3BCC H;  2HR3 A;  4MTG A;  5L3D A;  3DSQ A;  3N2G A;  4MVM A;  2Y4T A;  1GM7 A;  1XNR O;  4FLX A;  3DXR B;  4UVC A;  5EZY A;  1VP7 A;  2LW1 A;  1KU9 A;  3E2E A;  3OTF A;  3FAV A;  1QR8 A;  1EZV H;  1JCH A;  1GAX A;  3G71 V;  2QKA A;  2ZDI C;  3CB2 A;  4DV2 O;  1AR4 A;  4W4K A;  4YHH O;  3K0D A;  4FMT A;  1I08 A;  4AIL C;  4FVM A;  4ASU G;  2A06 H;  3A0B Z;  2XND G;  4XDL A;  1IX9 A;  4JZ2 A;  3G6B A;  3JCU Z;  4UVB A;  1IXB A;  4B3M B;  1FJG B;  4J7Z A;  5LP6 A;  1OZ0 A;  3HKB B;  2WLL A;  4FFK A;  2V7Q G;  1AB3 A;  1VQ4 V;  2OTJ V;  2YDE A;  3F5T A;  1MOF A;  5KMG A;  5KUK A;  4IL6 Z;  2WLI A;  3RYF B;  4NTW A;  5BY1 A;  1N4C A;  2YC0 A;  3ASN B;  2CH7 B;  4E4E A;  3OMA B;  2EZP A;  2HEP A;  1HNW O;  1CXZ B;  4DXW A;  4X1Y B;  3QVN A;  2CTQ A;  4U3J B;  2ZR2 A;  1WB8 A;  1Z2G A;  1SA0 B;  4GUN A;  4DV4 B;  2NR5 A;  4JI0 O;  3I56 V;  1M9N A;  3BHP A;  5B1A C;  1FD9 A;  3B8M A;  4JAA A;  5LYJ A;  5J9P C;  2ZT9 B;  5LP6 C;  5KHH A;  1KP3 A;  2F4V B;  4WBN B;  4B7E A;  3UO2 A;  2JGD A;  1CEZ A;  1R3I C;  3P3P A;  4PI2 A;  1YSC A;  4PDL A;  2QWR B;  3HPL C;  1BCC H;  2Z0A A;  2Q67 A;  3T2M A;  3ZED A;  4AHC A;  3N2G B;  2CE4 A;  4JI4 O;  1RPO A;  1WJZ A;  1P49 A;  3LNN A;  4UCU A;  4YY3 B;  5EZY B;  3J7A U;  2ITD C;  1TA8 A;  3CCU V;  3BRC A;  3FAV B;  4OXS A;  2YID A;  3OUF A;  2HJF C;  4DV1 B;  3JAS A;  4PV1 B;  2GBO A;  4DR3 O;  1PV0 A;  2LFS A;  1N36 B;  4I9W A;  1E1R G;  2QTO A;  3L75 H;  2GTA A;  4QPJ A;  3L74 H;  5B1A B;  1M56 C;  4G2K A;  1XBL A;  3OFN G;  5LP6 B;  5CA0 A;  1O9H A;  1TUB A;  4G27 B;  4P30 A;  1Q7Y W;  2WLL B;  4PI0 A;  2UXB O;  3RYC A;  2OYQ A;  3A0H Z;  4LF8 O;  1VQ8 V;  5KMG B;  4IIJ A;  1QLN A;  4UB8 Z;  1F7Y A;  4K0K B;  2WLI B;  5IT9 N;  1FXK A;  2DYS C;  5LGU A;  4DV0 B;  3J81 N;  3T1H O;  1HNX B;  5F2V O;  1R3K C;  4OPA A;  1Q5O A;  1SKV A;  1S5J A;  3A0R A;  3BVO A;  4UVA A;  2PY5 A;  2JK5 C;  3JD0 A;  1ZL8 A;  4MTX A;  4PA7 A;  4LFA B;  3S3W A;  4B3R O;  1VQP V;  1XMO B;  3CYO A;  5LYJ B;  2HVK C;  3VBB A;  1D5N A;  1XI1 A;  2WAM A;  2IU0 A;  3JAT A;  3T1Y B;  4GKK B;  1V55 C;  4D7T A;  1VQ9 V;  3K3W A;  5DEC A;  2LGQ A;  2JGD B;  2Q7E A;  5J2T A;  1WA8 A;  3BAB A;  3L72 H;  5L3C A;  3E8B A;  5KA6 A;  3AG2 C;  1EM1 A;  2RNB A;  2X7R B;  1FXK C;  4O4L A;  3X2Q C;  1PPJ H;  4UCV A;  3E22 A;  1OCC C;  1VF6 A;  1B3Q A;  1M56 B;  2R9A A;  4R6Z A;  2QKS A;  3G4S V;  5LBQ A;  5B3S C;  3OTO B;  1PNL A;  2IM9 A;  4JV5 O;  4MTF A;  2YIB D;  4LH6 A;  1SQV H;  2DYS B;  3JCZ A;  3JAS B;  2W6I G;  1F51 A;  4LF9 O;  1MZE A;  1S3J A;  1RP3 B;  3RGB A;  3F7V C;  1WNS A;  2DQ0 A;  3ZHT A;  1VF7 A;  1M4U A;  4JYA B;  2ZIO A;  2QTS A;  5A9G A;  3KZI Z;  3RYH A;  1XNQ B;  3OEE G;  4I0X A;  4NXM B;  2Z5U A;  5K1P A;  4DR5 B;  1VF6 C;  2DN9 A;  3DC5 A;  4FM2 A;  2RCV A;  4LWS A;  1EFR G;  3EXA A;  1TUB B;  3K9A A;  3JYC A;  1K4D C;  3RYC B;  5JJN B;  3QNE A;  4X66 O;  1W0K G;  3AG2 B;  4IIJ B;  1JA8 A;  1FXK B;  4EFB A;  4GLX A;  1FJG O;  3X2Q B;  3STL C;  2AW9 A;  1M90 W;  4MSW C;  3CCJ V;  4UFZ A;  2QWP B;  2ZQM A;  4YJ2 B;  4DK1 A;  1XMQ O;  4NXN B;  2F95 B;  1ZL8 B;  4AQY B;  4JI6 B;  4TT3 G;  4J10 A;  2JS5 A;  1AI5 A;  5B3S B;  3M8A A;  1H2S B;  3VQY A;  1XDC A;  2QDO A;  3LDC A;  1YJW V;  1QVF U;  4WFG A;  1VQ6 V;  4DV7 O;  3JD1 A;  3HKD A;  4L87 A;  4OPH A;  4DR2 B;  5J2T B;  3ETE A;  1WA8 B;  3O65 A;  2D3O W;  4DV4 O;  4FFB A;  4WCE V;  3H1L H;  5JQG A;  3FFQ A;  2HG5 C;  2CTR A;  2GSM B;  2ZIN A;  4O4L B;  1K34 A;  2Q68 A;  2F4V O;  4RQE A;  3THO A;  3E22 B;  3UKM A;  1PL0 A;  3CRC A;  1YEW A;  3JAW B;  5IYZ A;  5B1B C;  4MS2 A;  1FKA O;  3D36 A;  3SPI A;  1QLE C;  2ZE5 A;  1N8R W;  3ZRS A;  3JAR A;  1EN4 A;  3EVK A;  2DJV A;  1NJI W;  3IFX A;  1R3J C;  1PNM A;  4I4T A;  1PD3 A;  4J7J A;  4R7C A;  2ZNI A;  2QWO B;  4FM1 A;  3VOU A;  3ETD A;  2ADP A;  3IJ4 A;  1YIJ V;  4BIU A;  2UUC B;  3RYH B;  3RFR A;  4DV6 B;  4O4H A;  4I0X B;  2DOS A;  1YZB A;  2F1M A;  5BR8 B;  4DV1 O;  4LWS B;  2X6A A;  2NN4 A;  1P84 F;  2R70 A;  1N34 B;  3K9S A;  1HNW B;  4HNA A;  2RMK B;  3UO3 A;  1B6Q A;  4HYO A;  2HJD A;  4DR4 B;  3CP1 A;  2JDI G;  3D36 C;  1LNQ A;  3IAY A;  1YHQ V;  4ABM A;  1AP6 A;  1JPX A;  3JAK A;  2QWN B;  4PHZ A;  1SQF A;  4A5U B;  1TVK A;  4J11 A;  3ZN0 A;  1I7F A;  3RW0 A;  5LMU B;  3GVM A;  5B1B B;  1YTF B;  1NTZ H;  3ZMS A;  3ASO C;  1RPR A;  3ZMV A;  4MVU A;  1ZUQ A;  1GH6 A;  5IYB O;  1QLE B;  2W0X A;  4DV0 O;  1HNX O;  2IU3 A;  3HKD B;  4KP4 A;  4TWK A;  4LF7 B;  2FB5 A;  4DUY B;  5EYP A;  1VQN V;  2PYJ A;  1ORQ C;  2A0L A;  1U97 A;  4QE7 A;  1K73 W;  1IBM B;  4FFB B;  5JQG B;  1O9G A;  3EFF K;  1NZ6 A;  4UCT A;  1E1Q G;  4WFA V;  1KKD A;  3IGA C;  4X20 A;  1ENV A;  4GKK O;  3H1H H;  3CC4 V;  2K1E A;  5IYZ B;  2RDC A;  4CC5 A;  2OTL V;  1VQO V;  1AP5 A;  4UUJ C;  1GTO A;  5LL6 Y;  4FLT A;  1K8A W;  2EJR A;  3KCX A;  4H13 B;  3JAR B;  5IJ9 A;  2NNU A;  4LC1 A;  4O4J A;  5LGN A;  4JAU A;  3SYA A;  2PI4 A;  4I4T B;  3CMA V;  2OIE A;  4LP8 A;  1SQP H;  3OTO O;  5FL7 G;  1JJ2 U;  4O4H B;  1QU7 A;  4GT1 A;  4KFM A;  3WG7 C;  4NB5 A;  3T1H B;  2Q6A A;  4HAM A;  4HNA B;  3SGI A;  3FB5 C;  3CEI A;  3LDD A;  5LA6 A;  2QR4 A;  2KB1 A;  1KP2 A;  5E79 Z;  1XNQ O;  1HNZ O;  1XHX A;  1KBH A;  4NXM O;  3JAK B;  4DR5 O;  2ZE7 A;  3DTU B;  1TVK B;  3BFR A;  5CN0 A;  2IJJ A;  5EC1 C;  1W2B U;  2R9R B;  2E3C A;  1H2L A;  2QKC A;  4B08 A;  3E8H A;  2XAQ A;  1VQK V;  3RWR D;  2QM8 A;  2Z3Y A;  1F4N A;  4ZBM A;  5B66 Z;  3B2E E;  2YEV A;  3BPZ A;  3E86 A;  1KUQ A;  1F23 A;  1OCZ C;  4NXN O;  3ZHV A;  4QNH B;  1XQ8 A;  2YXY A;  4AQY O;  4Z1V A;  2PI5 A;  2QA4 V;  3JSN A;  2VS0 A;  3B40 A;  4PDR A;  2LO1 A;  1R6T A;  2EZO A;  4MW3 A;  3TGU H;  3O9O A;  1US6 A;  5FPO A;  4JV5 B;  2X0L A;  4X20 B;  3B09 A;  2DW4 A;  3HR0 A;  3WG7 B;  1AI4 A;  2VQF O;  1VQM V;  4DR2 O;  2ZR3 A;  3N2K A;  4LF9 B;  1LUW A;  4RAI A;  1ZX3 A;  4X64 O;  4DV5 B;  5IJ9 B;  3JAM N;  4CBC A;  4O4J B;  4CH5 A;  2V1D A;  1BHA A;  3MAQ A;  5FPR A;  1HW7 A;  3OEH G;  3B4S A;  3AG3 C;  1ZTE A;  4I9Q A;  1X59 A;  4X66 B;  5J2U A;  5AG2 A;  2ZD9 A;  4HZ3 A;  2EIL C;  1VAR A;  2QGN A;  1MZF A;  1EZJ A;  3RVZ A;  2ZIM A;  1FXH A;  1OV9 A;  1WAZ A;  3SYC A;  1OCZ B;  4MTO A;  5L3E A;  5LA6 B;  5C8Y A;  1XMQ B;  2UUC O;  4DV6 O;  5JWP A;  3H01 A;  3G80 A;  1SC5 B;  5BR8 O;  2EIK C;  1WLE A;  4DV7 B;  1N34 O;  1FFT B;  1MSW D;  4DR4 O;  4LR3 A;  1UJW B;  3H1K H;  3CS5 A;  4PA6 A;  4QJF B;  4F6E A;  3SPJ A;  4K8X A;  4GKJ B;  1K97 A;  2YEV B;  4BAY A;  2BOB C;  5FLX N;  1BQ0 A;  5JJE B;  4WFB V;  5LMU O;  1S77 D;  2G38 A;  2LJ2 A;  1BMF G;  3OAA G;  4RQF A;  4X65 O;  5IJ0 A;  2UUB B;  2DE0 X;  4I55 B;  4B3T B;  2CUG A;  4JF3 A;  4FLY A;  3AG3 B;  3ZX6 A;  4MVO A;  2Q0O C;  1GM8 A;  5KAI Z;  2EIL B;  4TV8 A;  1T5E A;  5D5Q A;  4LF7 O;  4NTX A;  4DUY O;  2IW5 A;  3N2K B;  1IBM O;  3CCR V;  1CPY A;  3JAL B;  2W0F C;  4K35 A;  2ARH A;  2EBO A;  1WPX A;  2QEX V;  3GB7 C;  4LH7 A;  2EIK B;  2DWD C;  4JGS A;  2VWK A;  4X88 A;  1DTO A;  1S5L Z;  4CC6 A;  1Z5V A;  2ZE8 A;  2ZXW C;  5BZB A;  1JVM A;  3WB2 A;  5LHG A;  1H8E G;  5J2U B;  2CTW A;  3UCS C;  1V9P A;  3CRR A;  5JJJ B;  3OMN B;  1COW G;  3MD0 A;  4ZKI A;  2IJK A;  1N33 B;  4Q20 A;  2PF4 E;  5C8Y B;  1W0J G;  4YIO A;  3KG2 A;  3K5N A;  4PA9 A;  1BSM A;  1WP8 A;  2VRZ A;  2GHY A;  3QG5 A;  4UCO A;  3D8C A;  3CCM V;  4ZOL A;  1BGY H;  4YJ3 B;  2OCH A;  3DGE A;  1SER A;  2R72 A;  4LFC O;  4YJ2 A;  1QR9 A;  5C93 A;  3OR6 C;  5GW7 A;  3ABL C;  1NQT A;  3CWB H;  1SQG A;  4MVR A;  3R65 A;  4PDV A;  4BW5 A;  1XL6 A;  3CC2 V;  4JYB A;  1AJP A;  2ZE6 A;  1YF2 A;  2R9I A;  2WLK A;  1NT2 B;  5IJ0 B;  3K08 A;  5B1N A;  2ZXW B;  1P7B A;  2IJI A;  4JTC B;  1NU1 H;  2O57 A;  4TV8 B;  5IE9 A;  2ILM A;  3JAW A;  3OD4 A;  1MSD A;  2Q69 A;  5EBL C;  3STZ C;  2IJH A;  1GM9 A;  3EHB B;  1KEC A;  4NTY A;  5KHJ A;  5KX5 A;  3CRA A;  3ZHQ A;  3K5L A;  4JI2 B;  1L1F A;  1BHB A;  1EBO A;  4J9Y B;  4D7S A;  2QM4 A;  4FLU A;  3CXH F;  3ZJZ A;  2H3O A;  2Y0P A;  4P2Z A;  1JQ0 A;  4G28 B;  3TET A;  3BEH A;  3ML0 A;  4JI3 O;  2ADQ B;  2Q7H A;  2X6C A;  3ABL B;  4DV5 O;  3WFV A;  3H9V A;  1GRJ A;  2HLD G;  1HNZ B;  1MMM A;  3QO7 A;  3GWK C;  1QNM A;  3JD4 A;  1OHH G;  2P06 A;  2XAF A;  4OGQ B;  3ZMZ A;  1BE3 H;  4X62 B;  1UFI A;  5JCO A;  3ZBH A;  5HFM A;  2F66 C;  3HB3 B;  5EBW C;  2FML A;  3I5D A;  2V4D A;  2XT9 A;  3K0G A;  1K9M W;  4UXN A;  1B04 A;  2AXT Z;  4ZOL B;  3CRM A;  2CGO A;  4J42 A;  1YXB A;  2FKX A;  3WB1 A;  3ZS8 C;  2AHZ A;  3SJB C;  4JI8 B;  1L0N H;  3ABM C;  4FJC C;  3RBZ A;  2Q4P A;  3Q4H A;  2B9Z A;  4JTD B;  1G1X B;  1HWY A;  1Z5W A;  1G6U A;  3E35 A;  3ZCC A;  4J7K A;  3MHS C;  2WSS G;  2VQF B;  2YI8 A;  2QJ1 A;  5JCO C;  2B1G A;  2Q73 A;  1XHZ A;  2WLM A;  4RUE A;  2Y48 A;  3F7Y C;  2ZKO A;  3CCE V;  3OW2 U;  4GKJ O;  1TUE B;  3P32 A;  1KYO F;  1ZWI C;  4X64 B;  2OT5 A;  3VQV A;  1MNG A;  1RFY A;  1N0N A;  2UXN A;  3R66 A;  1XRE A;  1H2M A;  3ZN1 A;  3N27 A;  5K1X A;  2UUB O;  4CS2 A;  1VEW A;  4H33 A;  3TCU A;  2PTM A;  3I55 V;  4B3T O;  4I50 A;  1Q8I A;  4DR6 O;  5LMN B;  5KX5 B;  2IH1 C;  1YIT V;  4X1I A;  1TAE A;  1I5Y A;  1GK9 A;  4CH6 A;  4CS4 A;  4H44 B;  4N21 A;  2Q5Z A;  3ABM B;  1QBZ A;  2UXD O;  2Q0A A;  1PL4 A;  2UXC B;  3JD3 A;  3L9D A;  4QE9 A;  4PDM A;  4JAS A;  2KKW A;  4B3S O;  3ZRV A;  5DED A;  5CMU A;  3ZHR A;  1NH2 D;  4JI1 B;  5A2Q N;  3CC7 V;  3MDS A;  1K5S A;  4FLZ A;  1Y76 B;  3K03 A;  3ZIA G;  5LXT B;  3LNM B;  3K5O A;  3CPW U;  1EN6 A;  1RSO B;  4E2L A;  1I94 B;  4O4I A;  2NLJ C;  1BT8 A;  3P3N A;  2P7T C;  1N33 O;  3D3Q A;  1SET A;  4QGP A;  4X65 B;  3P30 A;  1Q86 W;  3Q4H B;  2Y0I A;  2EIN C;  5KLV H;  2ETN A;  3RYI A;  3LDE A;  2RN9 A;  2QWQ B;  2E74 B;  5TIS Z;  2DYR C;  4WFF A;  2N05 A;  2P4K A;  1KD1 W;  3RN4 A;  5EC2 C;  4MVZ A;  1GKF A;  1WP7 A;  1DGS A;  3L71 H;  3CE2 A;  4LF5 O;  1JMK C;  5CBF A;  2KG7 A;  3HKE A;  4DV3 B;  1KKC A;  3C90 A;  1K92 A;  2YXL A;  3AG1 C;  1OJH A;  1KQS U;  2FTK A;  4TSF G;  4PA3 A;  1YJN V;  4B7K A;  2P5O A;  2WA4 A;  4I50 B;  1QHT A;  3E8F A;  2DQ3 A;  4YXW G;  1JOY A;  4X1I B;  3AG7 A;  2P22 C;  4P9O A;  4GX0 A;  4U3F H;  1HR0 O;  3PJS K;  3DC6 A;  2EJ7 A;  3CRQ A;  2OIG A;  3L73 H;  2A9H A;  2PYL A;  2HP8 A;  1KC8 W;  4IT5 A;  2F93 B;  4JI2 O;  1M5I A;  2EIN B;  1VQL V;  4TQD A;  2WA3 A;  3CCQ V;  1OCO C;  2N74 A;  2A7W A;  2DYR B;  3U0Z A;  3A8T A;  4CZZ A;  4K8Z A;  2VWJ A;  1PM9 A;  3APO A;  2WLJ A;  4MW8 A;  4JI5 O;  4LFC B;  5FNV A;  2ZNJ A;  3L70 H;  5BMV B;  1X4T A;  3CCV V;  1Q82 W;  1DK1 A;  1K4C C;  1AR5 A;  4XDJ A;  5IYD O;  3VQX A;  4J41 A;  4DRX A;  4WFE A;  4O4I B;  2YIA A;  3K04 A;  4X62 O;  4ZHQ A;  3AG1 B;  1GN6 A;  4CH4 A;  1Q6I A;  1JFF B;  1NTM H;  4X1K A;  3VQW A;  2HFE C;  2HVJ C;  1FYJ A;  4R50 A;  2MW2 B;  5EIB C;  3SYQ A;  3W7S A;  3RYI B;  3HKC A;  2PZS A;  3K79 A;  4UV9 A;  5LGT A;  4KUM A;  1G4Y B;  3WU2 Z;  2VQE B;  4JI8 O;  3OMI B;  1BQZ A;  3BY6 A;  3OT7 A;  3ETQ A;  3ICX A;  3H1I H;  2M7W A;  4I55 A;  3OGC C;  3FYI B;  1RM1 C;  3RT3 C;  2KG7 B;  2JIZ G;  3HKE B;  2Y69 B;  3ZHS A;  1TGO A;  1SES A;  4PEL A;  4MVS A;  1R73 A;  1YDX A;  1OCO B;  2A3Q A;  4U7N A;  4BWA A;  4BR6 A;  2BE3 A;  1PKX A;  3BA8 A;  3JAL A;  4JI3 B;  1D5A A;  1AJN A;  2LP7 A;  3GWO A;  2EX3 A;  4LFB B;  4UB6 Z;  2B1I A;  2ZCE A;  3CME V;  3LUT B;  3B77 A;  2HHH O;  4UCS A;  3KCY A;  3MHH C;  4N23 A;  2JJ2 G;  1N0J A;  3OGI B;  5CB4 A;  1FFX A;  5LMN O;  3D3I A;  3QTC A;  4O2B A;  2E76 B;  3CHX A;  1IBK O;  1SQQ H;  1VQ5 V;  3U11 A;  3AK2 A;  1DLB A;  3CCL V;  2E75 B;  1BS3 A;  4OX9 B;  3IC9 A;  2FL4 A;  3ABT A;  1Y66 A;  5FNV B;  5LHH A;  5IYC O;  3IC7 A;  4LBE C;  4Q6G A;  5KA5 A;  4PJ0 Z;  2UXC O;  5KHI A;  1NVP B;  3OUS A;  1RM1 B;  4WFH A;  4Z2W A;  3NXS A;  4TUY A;  1S0V A;  4DRX B;  3E83 A;  3K58 A;  4ZHQ B;  2DMX A;  4YJ3 A;  4JI1 O;  4JI7 B;  1K5Q A;  1BZK A;  5L3F A;  3CSX A;  1MA1 A;  4X1K B;  1ARO P;  2W6J G;  2K9P A;  1GO3 F;  1H38 A;  4WF9 V;  1J95 A;  3SPC A;  4GX2 A;  3HKC B;  2IH3 C;  4GZR B;  1I94 O;  5KHK A;  5JVD A;  3CX5 F;  4XDK A;  1WB7 A;  4JYC A;  3OE7 G;  2D2C B;  1YCI A;  4X89 A;  4EB6 A;  3W7X A;  2JGU A;  2BTO A;  4DR6 B;  2BCC H;  5LHI A;  5GTI Z;  1AI6 A;  1FS0 G;  2CAZ C;  2AHY A;  5DN6 G;  4AI8 A;  2UU9 B;  4J9Z B;  4GCZ A;  1R6K A;  2CK3 G;  2XOK G;  5KHG A;  1K33 A;  2JRI A;  3K06 A;  3SYO A;  3LSQ A;  1DF5 A;  2WLH A;  4QPK A;  2N04 A;  3JSL A;  4ZIB A;  2P67 A;  2UXD B;  5BXZ A;  5H5N A;  4DV3 O;  4QIW F;  1ZSP A;  5B5E Z;  1IDS A;  3CD6 V;  4JPR A;  1IVS A;  4B3S B;  3OM3 B;  4R8C A;  1H2N A;  2AZ0 A;  5CB4 B;  1SZT A;  5B1O A;  1FFX B;  2MK3 A;  5LOV A;  4EEQ A;  2F43 G;  4O2B B;  1SQX H;  2WLN A;  1GN3 A;  4KHP O;  1IXM A;  3M99 B;  2OWO A;  5GON A;  3W7W A;  1GMG A;  1FAF A;  1H2K A;  3UM7 A;  2CDY A;  1L0L H;  1MG1 A;  2WWW A;  2IBZ H;  3FB6 C;  3ZRW A;  2KQX A;  5JH7 A;  2AZ2 A;  4TUY B;  1QVG U;  5IWA O;  4JYY A;  4KL1 A;  2EIM C;  1P7G A;  4IGG A;  1U96 A;  5CBG A;  3F5W C;  3SJQ C;  1DF4 A;  2X6B A;  4H0L B;  1YI2 V;  1GN2 A;  4LF5 B;  4LF4 O;  2E5L O;  1XOU A;  4RUF A;  1M1K W;  2LFR A;  5JVD B;  1MAB G;  1BL8 A;  1GN4 A;  1I0H A;  4MT8 A;  4EB6 B;  1LUV A;  2GDS A;  5HFL A;  4LCU C;  3LSS A;  5D5P A;  3AK1 A;  3PN1 A;  4RWU A;  2VQE O;  3FX7 A;  4DK0 A;  3LSU A;  3UT5 A;  1HR0 B;  4BIO A;  2ATK C;  1S5H C;  4X8A A;  4HBN A;  1E79 G;  4CH3 A;  4NVP A;  1PP9 H;  3K5M A;  1K3E A;  3KKY A;  1IBL B;  2XAJ A;  1N32 O;  3W7T A;  1OCR C;  1URF A;  5GTH Z;  5L3G A;  2L6L A;  1R6N A;  3K59 A;  3FB8 C;  1YTF D;  3NR7 A;  4IYH A;  2XAS A;  3W7U A;  1Q3E A;  4RO2 A;  3SJC C;  4PD4 F;  1JR9 A;  1F4M A;  4FIP C;  2EIM B;  3K57 A;  4JI5 B;  2JS3 A;  3SJA C;  5LOV B;  4FZ1 A;  1HP8 A;  4FK5 C;  4JZG A;  4LFB O;  3UQ8 A;  1L8D A;  3ABK C;  2GUZ A;  5GON B;  1G8M A;  1IUR A;  1M57 C;  1Y6X A;  4CS3 A;  4ICG A;  3AG4 C;  1NBM G;  2AGA A;  3ABU A;  1H8H G;  3BA9 A;  2P90 A;  2XAG A;  2UUA B;  1Y76 A;  2GV9 A;  4EKW A;  5H6Q A;  3ZRW B;  5IY5 C;  1J5E B;  2BSK A;  2JEX A;  5EK0 A;  5CA3 A;  2YI9 A;  5JH7 B;  5LXT A;  4H37 A;  1THZ A;  3ZHU A;  4DR7 B;  3QO8 A;  4LF6 B;  4GX5 A;  1RSO A;  5CA0 B;  1V55 B;  2QE7 G;  4LNU A;  2OCC C;  2ZM6 B;  1XEQ A;  4OX9 O;  4J80 A;  4JTA B;  1Q81 W;  2PGG A;  4BW9 A;  3AEI A;  1IZ3 A;  4FLV A;  1R3L C;  4EFE A;  2EIJ C;  4ZI7 A;  5CBH A;  2A79 B;  4D6T H;  1OCR B;  4B3M O;  5L3B A;  1JJO A;  4DUZ B;  5CA1 A;  1Q43 A;  1OCC B;  4NR1 A;  3FYE B;  4JI7 O;  3T4D A;  2YIB A;  1ZLZ A;  2XTA A;  3APQ A;  3SDL A;  2P6J A;  2XUM A;  3B8N A;  1NKD A;  2UXX A;  5ITZ A;  3FB7 C;  4C7U A;  1AI7 A;  2Y4U A;  3JAT B;  4DR1 B;  4FLW A;  2B5U A;  3ABK B;  4PA4 A;  1K7D A;  2P4V A;  1M93 A;  2HHH B;  1A32 A;  3UT5 B;  3ETG A;  4UCR A;  1VF5 B;  1KMI Z;  1Q6U A;  2F23 A;  1M57 B;  4Z1M G;  1XNR B;  2EUL A;  1B06 A;  3AG4 B;  4X9Q A;  4F6R A;  1LR1 A;  4U7O A;  2GTS A;  3JD2 A;  1JX9 A;  3M7M X;  4DW0 A;  5IY5 B;  4FM0 A;  1S72 V;  4L8J A;  2LGW A;  1ROP A;  1IBK B;  2PUS A;  2ODM A;  3OR7 C;  1SRY A;  2UU9 O;  1AJQ A;  2KSD A;  4DV2 B;  3T1C A;  3TK1 A;  2OCC B;  4FPP A;  3ZMU A;  5EBM C;  1SQB H;  3A2F A;  2LW7 A;  4YHH B;  4YIP A;  2ITC C;  4F4L A;  2BTQ A;  2EIJ B;  3J80 N;  3QO5 A;  1XIL A;  2GUZ B;  3C3T A;  2JJ1 G;  1FXV A;  1I5X A;  4TOI A;  5KAF Z;  1AIL A;  4YY3 O;  3U10 A;  1VIB A;  4UV8 A;  5BMV A;  2RJZ A;  3CJH A;  1FPO A;  2BSK B;  5IDJ A;  5H2F Z;  2YIC A;  4DW1 A;  4LNU B;  5H9C A;  1KB9 F;  1SS3 A;  2CTP A;  1JFF A;  3E8G A;  1SZX A;  1N36 O;  1QQC A;  1V54 C;  4ZI7 B;  4JI0 B;  3FKS G;  3TXQ A;  1W59 A;  4XBF A;  1YJ9 V;  5CA1 B;  4I7Z B;  4I5S A;  2FYU H;  2Q9L A;  2XHB A;  4DYL A;  3SR2 C;  1Q6H A;  1NI8 A;  1NTK H;  5EIB D;  3C3S A;  4K0K O;  1EN5 A;  2YS8 A;  4IHJ A;  5ITZ B;  1D2D A;  3CCS V;  1Y74 A;  2BOC C;  2Q8V A;  1NS1 A;  5KUM A;  1H2G A;  2Q7G A;  1NVP D;  2QSA A;  4JI4 B;  4LFA O;  1XMO O;  1HDJ A;  4O2A A;  3T4Z A;  4F6R B;  2CGN A;  1VQ7 V;  4MVQ A;  2JEU A;  2YUA A;  3T1Y O;  4TV9 A;  4KHP B;  3CXC U;  4K3A A;  4P9P A;  1CP9 A;  1QCE A;  1R1B A;  3ZRX A;  1VMG A;  4DR3 B;  1NR1 A;  4NKG B;  3DXR A;  4TQF A;  1IBL O;  2LQT A;  4KXR A;  2BTQ B;  1PNK A;  1Q90 D;  1V54 B;  1AVM A;  2Y69 C;  3G67 A; 
#chains in the Genus database with same CATH homology
 1G1X B;  4X65 O;  1AIL A;  2AGA A;  3J7A U;  1R6T A;  4YY3 O;  4GKK O;  4JI1 O;  5IWA O;  4DV2 O;  1FKA O;  1FYJ A;  4JV5 O;  2VQF O;  4DR2 O;  4YHH O;  5LL6 Y;  1XEQ A;  4OX9 O;  4LF7 O;  4DR3 O;  2DJV A;  4DUY O;  4LF9 O;  2ZKO A;  4GKJ O;  1I94 O;  4JI8 O;  1IBM O;  4LF4 O;  2E5L O;  1N36 O;  4X64 O;  4LF5 O;  3JAM N;  4B3M O;  3R66 A;  4JYA O;  3RT3 C;  2UUB O;  2UUA O;  1AB3 A;  4B3T O;  4JI7 O;  3OTO O;  1J5E O;  3F5T A;  4DR6 O;  2DOS A;  2UXB O;  4DR7 O;  4LF6 O;  1YZB A;  3SDL A;  4LF8 O;  4DV1 O;  1X59 A;  2ZM6 O;  1F7Y A;  5BY1 A;  4X66 O;  5IT9 N;  4K0K O;  2JRI A;  1HNW O;  2VQE O;  3J81 N;  4JI3 O;  3T1H O;  2F4V O;  1D2D A;  4OPA A;  4DV5 O;  1FJG O;  1HR0 O;  5BXZ A;  1A32 A;  4A5U B;  5H5N A;  2HHH O;  1NS1 A;  1XNQ O;  4JI0 O;  4DV3 O;  1HNZ O;  2UXD O;  4DUZ O;  1N32 O;  4NXM O;  4DR5 O;  2UUC O;  4DV6 O;  4B3R O;  1XMQ O;  4LFA O;  4JI2 O;  5LMN O;  1XMO O;  5BR8 O;  4B3S O;  3M8A A;  4JI6 O;  2N74 A;  1N34 O;  3T1Y O;  5A2Q N;  2UU9 O;  4DV7 O;  1IBK O;  4KHP O;  4DR1 O;  4DR4 O;  4DV0 O;  1HNX O;  4OPH A;  1R1B A;  4JI5 O;  4LFB O;  2LW7 A;  3O65 A;  4LFC O;  4DV4 O;  1KUQ A;  2Z0A A;  1IBL O;  2FKX A;  3J80 N;  1DK1 A;  1XNR O;  5FLX N;  2UXC O;  1N33 O;  4NXN O;  4JI4 O;  5LMU O;  4AQY O;  4X62 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...