4DV2M

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
118
structure length
118
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome
publication title A structural basis for streptomycin resistance
rcsb
total genus 24
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4dv2M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4dv2M02
3GO8A 4DV2M 2UUAM 2HHHM 4B3RM 2F4VM 3W0FA 2UXCM 5ITXA 2F5NA 3JR5A 1HR0M 1IBLM 5A2QS 4DV1M 1L1TA 4G4RA 1Q39A 5ITUA 4OX9M 4NRVA 4DR5M 3SAUA 4YY3M 3GP1A 1IBKM 4LFAM 3A46A 2UUBM 1XNQM 4JI2M 3U6MA 3GPXA 2VQFM 1Z59A 5IWAM 4X64M 4G4OA 2XZUA 3SASA 4JI7M 4LF5M 1IBMM 1MU5A 4X66M 4NXNM 4LF8M 4AQYM 5ITXE 1XMQM 4NXMM 4JI0M 1TDZA 2ZBKB 2F5PA 3U6PA 1R2YA 4NRWA 3T1HM 5IT9S 4LF9M 4JI5M 1Z5CA 3OTOM 2EA0A 4GKKM 3J80S 1K3WA 4LFBM 3GPPA 5ITRA 3J81S 3TWLA 4JV5M 3SAVA 4DV0M 2Q2EB 4ITQA 4PCZA 4B3TM 1N34M 4LF4M 4JI4M 3J7AS 4PDGA 4DV3M 1PM5A 1HNXM 3C58A 4GKJM 2UXDM 1Z5AA 2HKJA 4PD2A 3SAWA 4JI6M 4DUYM 3T1YM 4DV4M 1PJIA 3TWMA 3A42A 4PDIA 1Q3BA 1EE8A 4G4QA 1TDHA 3SBJA 1HNWM 4DR3M 3VK7A 1L2CA 4KHPM 2UU9M 1L2BA 5ITTA 4DV5M 3JR4A 2UUCM 4B3SM 3GPUA 4X65M 4DR1M 1HNZM 2XZFA 2F5QA 3GPYA 2OQ4A 3GQ4A 3GQ5A 5ITYA 1K82A 4LF6M 4DR7M 4JYAM 1XMOM 4DV6M 1Z5BA 2E5LM 1N32M 1NNJA 1PJJA 4MB7A 5FLXS 5LMNM 1I94M 4JI1M 4LF7M 3GQ3A 1Q3CA 1KFVA 3U6QA 4DR2M 4B3MM 4G4NA 3U6DA 1N36M 3U6EA 1XNRM 1N33M 1K3XA 3U6SA 4DR4M 2UXBM 4JI3M 1XC8A 3U6CA 3SARA 3SATA 3VK8A 1MX0A 2VQEM 2F5OA 4DR6M 5ITQA 4DV7M 2OPFA 1L1ZA 1FJGM 3TWKA 4CISA 3A45A 2F5SA 3DOAA 5LMUM 1L2DA 5BR8M 4JI8M 1R2ZA 3JAMS 1J5EM 4LFCM 3U6LA 4YHHM 4DUZM 4X62M 3U6OA 2ZM6M 4K0KM
chains in the Genus database with same CATH superfamily
2QNJA 4IBIA 4QHTA 4CJ6A 5IREB 1VEJA 3CTWB 3KFUG 3K9OA 5KPTA 2UXCM 2M5ZA 2YFQA 2I7PA 3PNVA 4KLNA 2L4EA 1WGNA 1L1TA 1NHGC 2EKKA 1ORYB 4L8RC 5JI2E 3SAUA 1IBKM 3A46A 3H4MA 3R9XB 2EJSA 4JI2M 4OW0A 1OFIA 1NO1A 1OAIA 4M0WA 1H6UA 2VQFM 1GL7A 3HJQA 4NSOB 4IBKA 4RKUF 5IWAM 4G4OA 2XZUA 1DO2A 3SASA 4LF5M 4XK8F 1SXJC 2DXIA 1WXQA 1X37A 1E9SA 3LQQA 5ITXE 1IN7A 3FUXA 1GABA 2C96A 3U6PA 1DGFA 2MR9A 3GRUA 2G3QA 2XEPA 1Z5CA 1MJGM 3FUVA 4ZPXA 3J80S 2LHCA 3FYDA 4M0DA 3KSXA 1HQYE 5GKNA 3GPPA 3J81S 3I4VA 1T6OA 3UZUA 4JV5M 3HHXA 5FSWA 2L09A 2KZSA 4IBJA 2Z7JA 2LNHC 3LCVB 3U61A 4S12A 2KEBA 3SYKA 3FUUA 4PDGA 4FCTA 1IM2A 3T15A 4AG6A 2BJVA 3E9SA 4GMQA 2KDLA 4WURA 4D81A 2BNKA 5DYGA 4LCBA 3ZC7B 4JI6M 4L16A 3J27B 3A98B 1PJSA 2Z4SA 4DV4M 3E21A 1S3SA 3PVSA 1PJIA 1HT1E 2X49A 3A42A 1Q3BA 1EE8A 4GEWA 3LW5F 2YNMD 2OOBA 3SBJA 2MGWA 1P3QQ 3UMMA 1QAOA 3K8ZA 1W5SA 3NBIA 3DZDA 4FWGA 4M9SA 2QQ8A 1L2CA 4KHPM 3HHYA 2UU9M 2JUJA 1L2BA 1QANA 4DR1M 1GL6A 1PRBA 1MN3A 1HNZM 2O25A 4B7GA 1G8PA 4QOZC 3C3EA 3GQ5A 5ITYA 4LG2A 1XMOM 3MMPA 1XXHA 2ERCA 4DV6M 2V1CA 4AKGA 2DENA 1TH2A 1JQJC 1NNJA 4HL4A 5FLXS 2BWBA 2KHHA 1L8QA 2LH0A 1JB0F 5IZ7D 3VKGA 4B3MM 1OQYA 1G4AE 1IN6A 4M9ZA 1IQPA 1G71A 3KP0E 4FW9A 4BLCA 2Z8YM 1N33M 2DI0A 3U6SA 1V92A 1NJGA 5EXXA 2CV0A 1OTRA 5EP1A 2UXBM 3M0EA 4JI3M 4R3DA 3U6CA 1TGUA 2KW0A 2R4EA 2X8AA 4DV7M 2Y0TA 2CWBA 4Y28F 2QP9X 4RF0A 4MGIE 3FTDA 3EIHA 3RGPA 3TWKA 4CISA 3HX3A 1WR1B 2DZNB 2LVPC 1YLAA 3SHFA 3Q8GA 1SG9A 2ZAMA 4NOOB 4LFCM 3KXEC 4YHHM 4IJEA 2DVWB 4PT5A 1IXRC 3IHPA 3W68A 3GO8A 2HHHM 4B3RM 5H37D 3GLFA 4OVZA 3ZCBB 2FH0A 1G41A 3GLHE 5ITXA 1TR8A 2XF3A 2XFTA 3M7GA 5A2QS 1Y8GA 1G59A 4OX9M 4QOSA 4NRVA 1SXJD 2EO2A 4LFAM 5KQDA 5KPZA 4GHAA 3GPXA 2RKOA 3HWSA 5C1BA 3TE6A 5EXSA 4X64M 2DWMA 1T3TA 1Z6TA 3UJNA 3E4RA 4JI7M 3SC3A 3FRHA 3KOXE 3M6AA 4X66M 2XH9A 5DFLA 4NXNM 1TH4A 5FTKA 2DWLA 4XGIA 1VQ1A 2DAIA 3AV0A 3BOSA 4LJAA 4JI0M 1TDZA 1UM8A 2Z4RA 3R8FA 1E32A 3TPZA 2C9OA 3U5ZA 4AW4A 1R2YA 1OIZA 5IT9S 3B89A 4QHSA 1K3WA 4LFBM 2KXEA 3HU3A 5ITRA 3SYLA 2LXEA 3T38A 1NNUC 4ITQA 1N77A 3KOYE 1VEGA 2QBYB 4GHLA 4B3TM 3TQSA 2MROB 2HWJA 4JI4M 1V33A 3ZQJA 3FTFA 2AHMA 4RNAA 4AI6A 2EUCA 1UFZA 2QBYA 3CF6E 1CUKA 2DAMA 5EP2A 4PD2A 2VF7A 2DZLA 1SXJA 1JR3D 3LCUA 3T1YM 3GRVA 4LJ8A 2R65A 3V76A 2DHYA 1VEKA 1TDHA 3KDSE 2A5YB 4P17A 3GRYA 4G4QA 1DGGA 3GLIB 1XXHE 3VK7A 1QYRA 4W5WA 3JR4A 5JI3E 4B3SM 1W5TA 2BJWA 4MH0E 3GLIA 3L25A 2HAKA 3GPYA 5FTNA 1JR3A 5L8RF 1K82A 3B7NA 4JYAM 1R5LA 2GNOA 2JA2A 1D2NA 4GITA 3ILKA 4G6ZA 3L27A 4JI1M 2L6OA 2XLJA 3VFDA 3UK6A 3U6QA 2FFJA 1GJTA 1VG5A 1YUBA 1WIVA 1R4GA 3AOGA 2D7GA 4LY6A 3U6EA 5KO3A 1R7RA 3FYCA 3L28A 3B7QA 1SXJE 2W82A 4I5SA 2CEAA 3D8BA 2R6FA 3SFZA 2P5TA 2DAGA 2KNVA 2R62A 3C3DA 2F5OA 2EKFA 2JZ0A 2WZJA 3KP1E 3VKHA 4M9XA 1L1ZA 3KS4A 1PJTA 2JZ1A 2DNAA 2RRUA 1IY1A 3FE3A 3HJSA 4LJ6A 2F5SA 3HHWA 4B7FA 1L2DA 1J7KA 1I4WA 1ZV1A 2D7EA 3FUTA 2NQ8C 3ZH9B 5BR8M 1ZMWA 3GLGE 1V34A 1R2ZA 1J5EM 2CV1A 4DUZM 2ZM6M 2MJ5B 2JP7A 3J7BA 1QUTA 4FD2A 2R45A 4L6V6 3KS8A 3WHKA 2F4VM 3W0FA 2Y0QA 1YE9A 3GLGB 2CV2A 2F5NA 1HR0M 3L26A 4DV1M 4AKHA 4G4RA 1Q39A 3AOEC 4AG5A 5ITUA 3QAUA 4IBGA 1QAMA 1XXHB 1QUSA 4L4UA 2UUBM 1R6BX 2R4JA 1XNQM 2OO9A 4IBEA 1QZMA 4GIPA 2O01F 3U6MA 5EQTA 3HU1A 4MGHA 2VF8A 3RE8A 2J7OA 1VDLA 3AJIB 2LWXA 3I4YA 2CRUA 5E26A 3GRRA 2Y20A 3D8LA 4LF8M 2FNAA 1QDTA 2V6ZM 3GLHA 4AQYM 3HY5A 1N75A 5E6JA 3E46A 4MGYE 4GH9A 4LF9M 1QDRA 4LGYA 3THGA 3OTOM 2ZANA 1GO5A 4I8OA 5KQ8A 1GKIA 2G8LA 3QYBA 2DWNA 2V1UA 3GLGA 3DA1A 3SAVA 2KNZA 4DV0M 2CHVA 5KPRA 3MK6A 4PCZA 4LF4M 1D0KA 1XHBA 2ZTCA 3J7AS 1IN8A 2JWSA 3LVVA 2KRKA 1PM5A 2L2DA 3CF2A 3C58A 2UXDM 3FTEA 2XFSA 3SAWA 1FNNA 1DGHB 1NVMA 4R7GA 2I7NA 4II7A 4B7HA 4CGYB 4DUYM 1QVRA 3VLFB 1HT2E 3AFHA 2APLA 3FRIA 3HGIA 4CHTB 3TWMA 3W0LB 4NSRA 1GLNA 1ZQ9A 4KODA 1OKSA 3RFWA 1WHCA 3SMPA 1NV9A 4BBAA 4D80A 5C18A 4PDIA 3U60A 1HNWM 4MGZE 3HJ8A 2C9CA 7CATA 2L7IA 4LZJA 3AOEA 3B9PA 3HKPA 4JXJA 3NWLA 1GJSA 1PGYA 5ITTA 4DV5M 1TF0B 1JR3E 2JY6B 2UUCM 1OJLA 2JNHA 2LHGA 1HJPA 2XZFA 2F5QA 2CHGA 1OIPA 1PJQA 1TH3A 4LF6M 4DR7M 2QHOB 4QNRA 1Z5BA 3L2AA 1N32M 4RF1A 4MB7A 2QZ4A 5LMNM 2Z3XA 2R0IA 1I94M 2H5XA 2O5RA 3EIEA 3U60B 1QAQA 2DZOB 2R18A 4I4LA 4F1IA 4QNMA 8CATA 3PXGA 3U6DA 2JY7A 3BXWA 5EJCA 4B08A 1XNRM 1DGHA 1K3XA 3PNYA 2CHQA 1OAOC 3KOWE 3T6PA 2RGHA 2J7NA 1G3IA 2DWZB 4GRIA 3U5ZB 1NJFA 3IG8A 2KRUA 1XC8A 3SARA 3VK8A 1WGLA 4AKIA 4IBDA 4JN6A 3KOZE 1MX0A 4DR6M 2XGNA 5ITQA 2OPFA 1QQWA 2C98A 2YR0A 4NL4H 1IN5A 3AKZA 1WJ7A 3LQRA 3QYEA 3FTCA 3HU2A 3DOAA 3Q8XA 5LMUM 4JI8M 3B7ZA 3PFIA 4F2LA 2VDBB 1E9RA 2CP8A 3H4JA 4X62M 3BBZA 2LBCA 3NBXX 1YSYA 2FS1A 4WP2A 4K0KM 4FCVA 5EP4A 4G3OA 4DV2M 2UUAM 4LJ5A 1D0MA 2ZAOA 4A3VB 4GC9A 1ZAEA 4FCWA 4ANRA 2VIIA 2RGOA 4GC5A 5DNYA 2FE8A 1IXZA 2BWEA 2MH8A 3JR5A 3GLFE 1KYIA 1DGBA 3GLFB 1IBLM 3KSJA 4TUWA 4L15A 2HL7A 1OFHA 3UGJA 3RGSA 2KA6B 3K2LA 4DR5M 3B74A 1F4IA 4D82A 4YY3M 2JXNA 2R44A 2OOAA 4LZZA 4Z6YA 3GP1A 5FTMA 2WSCF 1C7YA 3LVWA 2GQFA 3J2PB 3SHGB 2QSFX 1Z59A 2B3TA 2DAKA 2M60A 4IJFA 4L78A 1IBMM 2YQZA 1BVSA 1MU5A 2H1RA 2XSZD 3I01M 3KVWA 2DAEA 3W67A 2LVQD 1VDDA 3MJ5A 1XMQM 4NXMM 1IFYA 1NY5A 3I51A 2ZBKB 3WHLA 2F5PA 4Z8XA 2QCUA 5BPVA 1SXJB 4NRWA 3T1HM 2CUZA 3K9PA 2FOIC 1E94E 2JY5A 3SMSA 2C5RA 4JI5M 1IY0A 2EA0A 4GKKM 3K92A 3FD9A 4OVZB 3TWLA 3U61B 5EP3A 2QPAA 5EXTA 3VDPA 2JY8A 1AUAA 1EFUB 2Q2EB 3HHZA 2CFOA 1Q02A 1IXSA 4IBBA 4IIWA 2XSZA 5DYIA 1N34M 1NY6A 4R71A 3GLHB 2DKLA 4DV3M 2R46A 1IXSB 4GKJM 2G5GX 1HNXM 2LVAA 1Z5AA 2HKJA 2K6BA 3KW6A 4WW0A 1HQCA 2CE7A 2DHRA 3I04M 1LV7A 4LJ9A 3HZJA 1NV8A 4Q7JA 4FWDA 4IBFA 1EIJA 2Y21A 1N78A 4BB9A 5FTLA 2QENA 2D7HA 4DR3M 3LMMA 4DBGB 4LJ7A 4EIWA 1RU3A 4FWHA 3IG5A 1NHWC 1AIPC 2LVNC 3C9PA 4AZFA 3MHVC 4MGKE 3GPUA 4X65M 3AL0C 3GLIE 3FUWA 2OQ4A 4REZA 3GQ4A 1TTEA 3DFZA 2HCBA 1ZMUA 3TL4X 2J5YA 3L29A 2WSEF 2L7HA 3VDUA 2K9DA 4LRSA 4OU7A 2E5LM 1PJJA 2N35A 4LF7M 3CF0A 5F3WA 1XB2B 2WSFF 2ZTDA 3F92A 1Q3CA 1IY2A 3GQ3A 1KFVA 3K1JA 4LGMA 3CGWA 4DR2M 3IECA 4G4NA 1XWIA 2K0BX 1N36M 4P16A 1T43A 1D0LA 5FTJA 4CIZA 4DR4M 2L4FA 2C99A 4NC6A 4HEOA 4I81A 3QWLA 1J09A 3SATA 1IN4A 1ZMVA 5EXPA 1DO0A 4KT0F 4MM3B 2VQEM 1FJGM 4UN2B 2K47A 3A45A 1NSFA 2LVOC 2X4AA 4LJ4A 1GVNA 4IBCA 1A5TA 3FKEA 2LTUA 3JAMS 4HLQA 1QZEA 2KZUA 4XBOA 1LTMA 4FVMA 2KNAA 1KSFX 4KO8A 3U6LA 4LRTA 3U6OA 1C1KA 1DV0A
chains in the Genus database with same CATH topology
4IBIA 4QHTA 5IREB 3KFUG 3CTWB 5KPTA 2UXCM 2M5ZA 2YFQA 2I7PA 3PNVA 4KLNA 1L1TA 1NHGC 1ORYB 4L8RC 5JI2E 3SAUA 1IBKM 3A46A 3H4MA 3R9XB 4JI2M 4OW0A 1OFIA 4M0WA 1H6UA 2VQFM 1GL7A 3HJQA 4NSOB 4IBKA 5IWAM 2XZUA 4G4OA 3SASA 1DO2A 4LF5M 1SXJC 2DXIA 1WXQA 1X37A 1E9SA 3LQQA 5ITXE 1IN7A 3FUXA 2C96A 3U6PA 1DGFA 3GRUA 2XEPA 1Z5CA 3FUVA 4ZPXA 3J80S 3FYDA 4M0DA 5GKNA 3KSXA 1HQYE 3GPPA 3J81S 3I4VA 4JV5M 3UZUA 3HHXA 5FSWA 2L09A 2KZSA 4IBJA 2Z7JA 2LNHC 3U61A 4S12A 2KEBA 3SYKA 3FUUA 4PDGA 4FCTA 1IM2A 3T15A 4AG6A 2BJVA 3E9SA 4GMQA 4WURA 4D81A 2BNKA 5DYGA 4LCBA 3ZC7B 4JI6M 4L16A 3J27B 3A98B 2Z4SA 4DV4M 1S3SA 3PVSA 1PJIA 1HT1E 2X49A 3A42A 1Q3BA 1EE8A 2YNMD 3SBJA 3UMMA 1QAOA 3K8ZA 1W5SA 3NBIA 3DZDA 4FWGA 4M9SA 1L2CA 4KHPM 3HHYA 2UU9M 1L2BA 1QANA 4DR1M 1GL6A 1HNZM 4B7GA 1G8PA 4QOZC 3GQ5A 5ITYA 4LG2A 1XMOM 1XXHA 2ERCA 4DV6M 2V1CA 4AKGA 1TH2A 1JQJC 1NNJA 4HL4A 5FLXS 1L8QA 2LH0A 5IZ7D 3VKGA 4B3MM 1G4AE 1IN6A 4M9ZA 1IQPA 3KP0E 4FW9A 4BLCA 1N33M 3U6SA 1NJGA 5EXXA 2CV0A 5EP1A 2UXBM 3M0EA 4JI3M 4R3DA 3U6CA 1TGUA 2KW0A 2R4EA 2X8AA 4DV7M 2Y0TA 2QP9X 4RF0A 4MGIE 3FTDA 3EIHA 3RGPA 3TWKA 4CISA 2DZNB 3SHFA 2ZAMA 4NOOB 4LFCM 3KXEC 4YHHM 4IJEA 2DVWB 4PT5A 1IXRC 3GO8A 2HHHM 4B3RM 5H37D 3GLFA 4OVZA 3ZCBB 1G41A 5ITXA 2XF3A 2XFTA 3M7GA 5A2QS 1G59A 4OX9M 4QOSA 4NRVA 1SXJD 2EO2A 4LFAM 5KQDA 5KPZA 4GHAA 3GPXA 2RKOA 3HWSA 5C1BA 3TE6A 5EXSA 4X64M 2DWMA 1T3TA 1Z6TA 3UJNA 3E4RA 4JI7M 3SC3A 3KOXE 3M6AA 4X66M 2XH9A 4NXNM 1TH4A 5FTKA 2DWLA 4XGIA 3AV0A 3BOSA 4LJAA 4JI0M 1TDZA 1UM8A 2Z4RA 3R8FA 1E32A 3TPZA 2C9OA 3U5ZA 4AW4A 1R2YA 5IT9S 4QHSA 1K3WA 4LFBM 2KXEA 3HU3A 5ITRA 3SYLA 2LXEA 3T38A 1NNUC 4ITQA 1N77A 3KOYE 2QBYB 4GHLA 4B3TM 3TQSA 3FTFA 4JI4M 2AHMA 4RNAA 4AI6A 2EUCA 2QBYA 3CF6E 5EP2A 4PD2A 1SXJA 1JR3D 3T1YM 3GRVA 4LJ8A 2R65A 3KDSE 4G4QA 1TDHA 2A5YB 3GRYA 1DGGA 3GLIB 3VK7A 1QYRA 4W5WA 3JR4A 5JI3E 4B3SM 1W5TA 2BJWA 4MH0E 3GLIA 3L25A 3GPYA 5FTNA 1JR3A 1K82A 4JYAM 2JA2A 1D2NA 4GITA 3ILKA 4G6ZA 3L27A 4JI1M 2L6OA 2XLJA 3VFDA 3UK6A 3U6QA 2FFJA 1YUBA 3AOGA 4LY6A 2D7GA 3U6EA 5KO3A 1R7RA 3FYCA 3L28A 1SXJE 2W82A 4I5SA 2CEAA 3D8BA 3SFZA 2P5TA 2R62A 2F5OA 3KP1E 3VKHA 4M9XA 1L1ZA 3KS4A 1IY1A 3HJSA 4LJ6A 2F5SA 3HHWA 4B7FA 1L2DA 1J7KA 1I4WA 2D7EA 3FUTA 3ZH9B 2NQ8C 5BR8M 1R2ZA 1J5EM 1N78A 2CV1A 4DUZM 2ZM6M 3J7BA 4FD2A 2R45A 3KS8A 3WHKA 2F4VM 3W0FA 2Y0QA 1YE9A 3GLGB 2CV2A 2F5NA 1HR0M 3L26A 4DV1M 4G4RA 1Q39A 3AOEC 4AG5A 5ITUA 3QAUA 4IBGA 1QAMA 1XXHB 4L4UA 2UUBM 1R6BX 2R4JA 1XNQM 4IBEA 1QZMA 4GIPA 3U6MA 5EQTA 3HU1A 4MGHA 3RE8A 2J7OA 3AJIB 2LWXA 3I4YA 5E26A 3GRRA 2Y20A 3D8LA 4LF8M 2FNAA 3GLHA 2V6ZM 4AQYM 5E6JA 1N75A 4MGYE 4GH9A 4LF9M 4LGYA 3THGA 3OTOM 2ZANA 4I8OA 5KQ8A 1GKIA 2G8LA 2DWNA 2V1UA 3GLGA 3DA1A 3SAVA 4DV0M 2CHVA 5KPRA 3MK6A 4PCZA 4LF4M 1XHBA 3J7AS 1IN8A 3LVVA 2KRKA 1PM5A 3CF2A 3C58A 2UXDM 3FTEA 2XFSA 3SAWA 1FNNA 1DGHB 1NVMA 4R7GA 2I7NA 4II7A 4B7HA 4CGYB 4DUYM 1QVRA 3VLFB 1HT2E 3AFHA 3HGIA 4CHTB 3TWMA 3W0LB 4NSRA 1GLNA 1ZQ9A 4KODA 3RFWA 3SMPA 4BBAA 5C18A 4PDIA 3U60A 4D80A 1HNWM 4MGZE 3HJ8A 2C9CA 7CATA 2L7IA 4LZJA 3AOEA 3B9PA 3HKPA 4JXJA 3NWLA 5ITTA 4DV5M 2UUCM 1OJLA 2XZFA 2F5QA 2CHGA 1TH3A 4DR7M 4LF6M 4QNRA 1Z5BA 3L2AA 1N32M 4RF1A 4MB7A 2QZ4A 5LMNM 2Z3XA 1I94M 2O5RA 3EIEA 3U60B 1QAQA 2DZOB 2R18A 4I4LA 4QNMA 8CATA 3PXGA 3U6DA 4B08A 5EJCA 1XNRM 1DGHA 1K3XA 3PNYA 2CHQA 3KOWE 2RGHA 2J7NA 1G3IA 2DWZB 4GRIA 3U5ZB 1NJFA 3IG8A 2KRUA 1XC8A 3SARA 3VK8A 4AKIA 4IBDA 4JN6A 3KOZE 1MX0A 4DR6M 2XGNA 5ITQA 2OPFA 1QQWA 2C98A 2YR0A 4NL4H 1IN5A 3AKZA 3LQRA 3FTCA 3HU2A 3DOAA 3Q8XA 5LMUM 4JI8M 3PFIA 1E9RA 4X62M 4K0KM 1YSYA 4FCVA 5EP4A 4DV2M 2UUAM 4LJ5A 2ZAOA 4A3VB 4GC9A 1ZAEA 4FCWA 2VIIA 2RGOA 4GC5A 5DNYA 2FE8A 1IXZA 3JR5A 1KYIA 1DGBA 3GLFB 1IBLM 3KSJA 4TUWA 4L15A 2HL7A 1OFHA 3UGJA 3RGSA 2KA6B 3K2LA 4DR5M 4D82A 4YY3M 4LZZA 3GP1A 4Z6YA 5FTMA 3LVWA 3J2PB 3SHGB 1Z59A 2M60A 4IJFA 4L78A 1IBMM 2YQZA 1MU5A 2XSZD 2H1RA 3KVWA 1VDDA 3MJ5A 1XMQM 4NXMM 1NY5A 3I51A 2ZBKB 3WHLA 2F5PA 4Z8XA 2QCUA 5BPVA 1SXJB 4NRWA 3T1HM 2CUZA 2FOIC 1E94E 4JI5M 3SMSA 2C5RA 1IY0A 2EA0A 4GKKM 3K92A 3FD9A 4OVZB 3TWLA 3U61B 5EP3A 2QPAA 5EXTA 3VDPA 3HHZA 2Q2EB 2CFOA 4IBBA 4IIWA 2XSZA 5DYIA 1N34M 1NY6A 3GLHB 4DV3M 2R46A 1IXSB 4GKJM 2G5GX 1HNXM 1Z5AA 2HKJA 3KW6A 4WW0A 1HQCA 2CE7A 2DHRA 1LV7A 4LJ9A 4FWDA 4IBFA 2Y21A 4BB9A 5FTLA 2QENA 2D7HA 4DR3M 3LMMA 4LJ7A 4EIWA 4FWHA 3IG5A 1NHWC 4AZFA 3MHVC 4MGKE 3GPUA 4X65M 3AL0C 3FUWA 2OQ4A 4REZA 3GQ4A 3DFZA 2HCBA 3TL4X 4AKHA 3L29A 2E5LM 2L7HA 3VDUA 4OU7A 4LRSA 1PJJA 4LF7M 3CF0A 5F3WA 3GQ3A 1Q3CA 1IY2A 1KFVA 3K1JA 4LGMA 4DR2M 4G4NA 1XWIA 1N36M 4P16A 5FTJA 4DR4M 2C99A 4I81A 3QWLA 1J09A 3SATA 1IN4A 5EXPA 1DO0A 2VQEM 4MM3B 1FJGM 2K47A 3A45A 1NSFA 2X4AA 4LJ4A 1GVNA 4IBCA 3FKEA 3JAMS 4HLQA 4XBOA 2KZUA 3U6LA 4FVMA 4KO8A 1KSFX 3U6OA 4LRTA 1C1KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GO8 A;  4DV2 M;  2UUA M;  2HHH M;  4B3R M;  2F4V M;  3W0F A;  2UXC M;  5ITX A;  2F5N A;  3JR5 A;  1HR0 M;  1IBL M;  5A2Q S;  4DV1 M;  1L1T A;  4G4R A;  1Q39 A;  5ITU A;  4OX9 M;  4NRV A;  4DR5 M;  3SAU A;  4YY3 M;  3GP1 A;  1IBK M;  4LFA M;  3A46 A;  2UUB M;  1XNQ M;  4JI2 M;  3U6M A;  3GPX A;  2VQF M;  1Z59 A;  5IWA M;  4X64 M;  4G4O A;  2XZU A;  3SAS A;  4JI7 M;  4LF5 M;  1IBM M;  1MU5 A;  4X66 M;  4NXN M;  4LF8 M;  4AQY M;  5ITX E;  1XMQ M;  4NXM M;  4JI0 M;  1TDZ A;  2ZBK B;  2F5P A;  3U6P A;  1R2Y A;  4NRW A;  3T1H M;  5IT9 S;  4LF9 M;  4JI5 M;  1Z5C A;  3OTO M;  2EA0 A;  4GKK M;  3J80 S;  1K3W A;  4LFB M;  3GPP A;  5ITR A;  3J81 S;  3TWL A;  4JV5 M;  3SAV A;  4DV0 M;  2Q2E B;  4ITQ A;  4PCZ A;  4B3T M;  1N34 M;  4LF4 M;  4JI4 M;  3J7A S;  4PDG A;  4DV3 M;  1PM5 A;  1HNX M;  3C58 A;  4GKJ M;  2UXD M;  1Z5A A;  2HKJ A;  4PD2 A;  3SAW A;  4JI6 M;  4DUY M;  3T1Y M;  4DV4 M;  1PJI A;  3TWM A;  3A42 A;  4PDI A;  1Q3B A;  1EE8 A;  4G4Q A;  1TDH A;  3SBJ A;  1HNW M;  4DR3 M;  3VK7 A;  1L2C A;  4KHP M;  2UU9 M;  1L2B A;  5ITT A;  4DV5 M;  3JR4 A;  2UUC M;  4B3S M;  3GPU A;  4X65 M;  4DR1 M;  1HNZ M;  2XZF A;  2F5Q A;  3GPY A;  2OQ4 A;  3GQ4 A;  3GQ5 A;  5ITY A;  1K82 A;  4LF6 M;  4DR7 M;  4JYA M;  1XMO M;  4DV6 M;  1Z5B A;  2E5L M;  1N32 M;  1NNJ A;  1PJJ A;  4MB7 A;  5FLX S;  5LMN M;  1I94 M;  4JI1 M;  4LF7 M;  3GQ3 A;  1Q3C A;  1KFV A;  3U6Q A;  4DR2 M;  4B3M M;  4G4N A;  3U6D A;  1N36 M;  3U6E A;  1XNR M;  1N33 M;  1K3X A;  3U6S A;  4DR4 M;  2UXB M;  4JI3 M;  1XC8 A;  3U6C A;  3SAR A;  3SAT A;  3VK8 A;  1MX0 A;  2VQE M;  2F5O A;  4DR6 M;  5ITQ A;  4DV7 M;  2OPF A;  1L1Z A;  1FJG M;  3TWK A;  4CIS A;  3A45 A;  2F5S A;  3DOA A;  5LMU M;  1L2D A;  5BR8 M;  4JI8 M;  1R2Z A;  3JAM S;  1J5E M;  4LFC M;  3U6L A;  4YHH M;  4DUZ M;  4X62 M;  3U6O A;  2ZM6 M;  4K0K M; 
#chains in the Genus database with same CATH topology
 2QNJ A;  4IBI A;  4QHT A;  4CJ6 A;  5IRE B;  1VEJ A;  3CTW B;  3KFU G;  3K9O A;  5KPT A;  2UXC M;  2M5Z A;  2YFQ A;  2I7P A;  3PNV A;  4KLN A;  2L4E A;  1WGN A;  1L1T A;  1NHG C;  2EKK A;  1ORY B;  4L8R C;  5JI2 E;  3SAU A;  1IBK M;  3A46 A;  3H4M A;  3R9X B;  2EJS A;  4JI2 M;  4OW0 A;  1OFI A;  1NO1 A;  1OAI A;  4M0W A;  1H6U A;  2VQF M;  1GL7 A;  3HJQ A;  4NSO B;  4IBK A;  4RKU F;  5IWA M;  4G4O A;  2XZU A;  1DO2 A;  3SAS A;  4LF5 M;  4XK8 F;  1SXJ C;  2DXI A;  1WXQ A;  1X37 A;  1E9S A;  3LQQ A;  5ITX E;  1IN7 A;  3FUX A;  1GAB A;  2C96 A;  3U6P A;  1DGF A;  2MR9 A;  3GRU A;  2G3Q A;  2XEP A;  1Z5C A;  1MJG M;  3FUV A;  4ZPX A;  3J80 S;  2LHC A;  3FYD A;  4M0D A;  3KSX A;  1HQY E;  5GKN A;  3GPP A;  3J81 S;  3I4V A;  1T6O A;  3UZU A;  4JV5 M;  3HHX A;  5FSW A;  2L09 A;  2KZS A;  4IBJ A;  2Z7J A;  2LNH C;  3LCV B;  3U61 A;  4S12 A;  2KEB A;  3SYK A;  3FUU A;  4PDG A;  4FCT A;  1IM2 A;  3T15 A;  4AG6 A;  2BJV A;  3E9S A;  4GMQ A;  2KDL A;  4WUR A;  4D81 A;  2BNK A;  5DYG A;  4LCB A;  3ZC7 B;  4JI6 M;  4L16 A;  3J27 B;  3A98 B;  1PJS A;  2Z4S A;  4DV4 M;  3E21 A;  1S3S A;  3PVS A;  1PJI A;  1HT1 E;  2X49 A;  3A42 A;  1Q3B A;  1EE8 A;  4GEW A;  3LW5 F;  2YNM D;  2OOB A;  3SBJ A;  2MGW A;  1P3Q Q;  3UMM A;  1QAO A;  3K8Z A;  1W5S A;  3NBI A;  3DZD A;  4FWG A;  4M9S A;  2QQ8 A;  1L2C A;  4KHP M;  3HHY A;  2UU9 M;  2JUJ A;  1L2B A;  1QAN A;  4DR1 M;  1GL6 A;  1PRB A;  1MN3 A;  1HNZ M;  2O25 A;  4B7G A;  1G8P A;  4QOZ C;  3C3E A;  3GQ5 A;  5ITY A;  4LG2 A;  1XMO M;  3MMP A;  1XXH A;  2ERC A;  4DV6 M;  2V1C A;  4AKG A;  2DEN A;  1TH2 A;  1JQJ C;  1NNJ A;  4HL4 A;  5FLX S;  2BWB A;  2KHH A;  1L8Q A;  2LH0 A;  1JB0 F;  5IZ7 D;  3VKG A;  4B3M M;  1OQY A;  1G4A E;  1IN6 A;  4M9Z A;  1IQP A;  1G71 A;  3KP0 E;  4FW9 A;  4BLC A;  2Z8Y M;  1N33 M;  2DI0 A;  3U6S A;  1V92 A;  1NJG A;  5EXX A;  2CV0 A;  1OTR A;  5EP1 A;  2UXB M;  3M0E A;  4JI3 M;  4R3D A;  3U6C A;  1TGU A;  2KW0 A;  2R4E A;  2X8A A;  4DV7 M;  2Y0T A;  2CWB A;  4Y28 F;  2QP9 X;  4RF0 A;  4MGI E;  3FTD A;  3EIH A;  3RGP A;  3TWK A;  4CIS A;  3HX3 A;  1WR1 B;  2DZN B;  2LVP C;  1YLA A;  3SHF A;  3Q8G A;  1SG9 A;  2ZAM A;  4NOO B;  4LFC M;  3KXE C;  4YHH M;  4IJE A;  2DVW B;  4PT5 A;  1IXR C;  3IHP A;  3W68 A;  3GO8 A;  2HHH M;  4B3R M;  5H37 D;  3GLF A;  4OVZ A;  3ZCB B;  2FH0 A;  1G41 A;  3GLH E;  5ITX A;  1TR8 A;  2XF3 A;  2XFT A;  3M7G A;  5A2Q S;  1Y8G A;  1G59 A;  4OX9 M;  4QOS A;  4NRV A;  1SXJ D;  2EO2 A;  4LFA M;  5KQD A;  5KPZ A;  4GHA A;  3GPX A;  2RKO A;  3HWS A;  5C1B A;  3TE6 A;  5EXS A;  4X64 M;  2DWM A;  1T3T A;  1Z6T A;  3UJN A;  3E4R A;  4JI7 M;  3SC3 A;  3FRH A;  3KOX E;  3M6A A;  4X66 M;  2XH9 A;  5DFL A;  4NXN M;  1TH4 A;  5FTK A;  2DWL A;  4XGI A;  1VQ1 A;  2DAI A;  3AV0 A;  3BOS A;  4LJA A;  4JI0 M;  1TDZ A;  1UM8 A;  2Z4R A;  3R8F A;  1E32 A;  3TPZ A;  2C9O A;  3U5Z A;  4AW4 A;  1R2Y A;  1OIZ A;  5IT9 S;  3B89 A;  4QHS A;  1K3W A;  4LFB M;  2KXE A;  3HU3 A;  5ITR A;  3SYL A;  2LXE A;  3T38 A;  1NNU C;  4ITQ A;  1N77 A;  3KOY E;  1VEG A;  2QBY B;  4GHL A;  4B3T M;  3TQS A;  2MRO B;  2HWJ A;  4JI4 M;  1V33 A;  3ZQJ A;  3FTF A;  2AHM A;  4RNA A;  4AI6 A;  2EUC A;  1UFZ A;  2QBY A;  3CF6 E;  1CUK A;  2DAM A;  5EP2 A;  4PD2 A;  2VF7 A;  2DZL A;  1SXJ A;  1JR3 D;  3LCU A;  3T1Y M;  3GRV A;  4LJ8 A;  2R65 A;  3V76 A;  2DHY A;  1VEK A;  1TDH A;  3KDS E;  2A5Y B;  4P17 A;  3GRY A;  4G4Q A;  1DGG A;  3GLI B;  1XXH E;  3VK7 A;  1QYR A;  4W5W A;  3JR4 A;  5JI3 E;  4B3S M;  1W5T A;  2BJW A;  4MH0 E;  3GLI A;  3L25 A;  2HAK A;  3GPY A;  5FTN A;  1JR3 A;  5L8R F;  1K82 A;  3B7N A;  4JYA M;  1R5L A;  2GNO A;  2JA2 A;  1D2N A;  4GIT A;  3ILK A;  4G6Z A;  3L27 A;  4JI1 M;  2L6O A;  2XLJ A;  3VFD A;  3UK6 A;  3U6Q A;  2FFJ A;  1GJT A;  1VG5 A;  1YUB A;  1WIV A;  1R4G A;  3AOG A;  2D7G A;  4LY6 A;  3U6E A;  5KO3 A;  1R7R A;  3FYC A;  3L28 A;  3B7Q A;  1SXJ E;  2W82 A;  4I5S A;  2CEA A;  3D8B A;  2R6F A;  3SFZ A;  2P5T A;  2DAG A;  2KNV A;  2R62 A;  3C3D A;  2F5O A;  2EKF A;  2JZ0 A;  2WZJ A;  3KP1 E;  3VKH A;  4M9X A;  1L1Z A;  3KS4 A;  1PJT A;  2JZ1 A;  2DNA A;  2RRU A;  1IY1 A;  3FE3 A;  3HJS A;  4LJ6 A;  2F5S A;  3HHW A;  4B7F A;  1L2D A;  1J7K A;  1I4W A;  1ZV1 A;  2D7E A;  3FUT A;  2NQ8 C;  3ZH9 B;  5BR8 M;  1ZMW A;  3GLG E;  1V34 A;  1R2Z A;  1J5E M;  2CV1 A;  4DUZ M;  2ZM6 M;  2MJ5 B;  2JP7 A;  3J7B A;  1QUT A;  4FD2 A;  2R45 A;  4L6V 6;  3KS8 A;  3WHK A;  2F4V M;  3W0F A;  2Y0Q A;  1YE9 A;  3GLG B;  2CV2 A;  2F5N A;  1HR0 M;  3L26 A;  4DV1 M;  4AKH A;  4G4R A;  1Q39 A;  3AOE C;  4AG5 A;  5ITU A;  3QAU A;  4IBG A;  1QAM A;  1XXH B;  1QUS A;  4L4U A;  2UUB M;  1R6B X;  2R4J A;  1XNQ M;  2OO9 A;  4IBE A;  1QZM A;  4GIP A;  2O01 F;  3U6M A;  5EQT A;  3HU1 A;  4MGH A;  2VF8 A;  3RE8 A;  2J7O A;  1VDL A;  3AJI B;  2LWX A;  3I4Y A;  2CRU A;  5E26 A;  3GRR A;  2Y20 A;  3D8L A;  4LF8 M;  2FNA A;  1QDT A;  2V6Z M;  3GLH A;  4AQY M;  3HY5 A;  1N75 A;  5E6J A;  3E46 A;  4MGY E;  4GH9 A;  4LF9 M;  1QDR A;  4LGY A;  3THG A;  3OTO M;  2ZAN A;  1GO5 A;  4I8O A;  5KQ8 A;  1GKI A;  2G8L A;  3QYB A;  2DWN A;  2V1U A;  3GLG A;  3DA1 A;  3SAV A;  2KNZ A;  4DV0 M;  2CHV A;  5KPR A;  3MK6 A;  4PCZ A;  4LF4 M;  1D0K A;  1XHB A;  2ZTC A;  3J7A S;  1IN8 A;  2JWS A;  3LVV A;  2KRK A;  1PM5 A;  2L2D A;  3CF2 A;  3C58 A;  2UXD M;  3FTE A;  2XFS A;  3SAW A;  1FNN A;  1DGH B;  1NVM A;  4R7G A;  2I7N A;  4II7 A;  4B7H A;  4CGY B;  4DUY M;  1QVR A;  3VLF B;  1HT2 E;  3AFH A;  2APL A;  3FRI A;  3HGI A;  4CHT B;  3TWM A;  3W0L B;  4NSR A;  1GLN A;  1ZQ9 A;  4KOD A;  1OKS A;  3RFW A;  1WHC A;  3SMP A;  1NV9 A;  4BBA A;  4D80 A;  5C18 A;  4PDI A;  3U60 A;  1HNW M;  4MGZ E;  3HJ8 A;  2C9C A;  7CAT A;  2L7I A;  4LZJ A;  3AOE A;  3B9P A;  3HKP A;  4JXJ A;  3NWL A;  1GJS A;  1PGY A;  5ITT A;  4DV5 M;  1TF0 B;  1JR3 E;  2JY6 B;  2UUC M;  1OJL A;  2JNH A;  2LHG A;  1HJP A;  2XZF A;  2F5Q A;  2CHG A;  1OIP A;  1PJQ A;  1TH3 A;  4LF6 M;  4DR7 M;  2QHO B;  4QNR A;  1Z5B A;  3L2A A;  1N32 M;  4RF1 A;  4MB7 A;  2QZ4 A;  5LMN M;  2Z3X A;  2R0I A;  1I94 M;  2H5X A;  2O5R A;  3EIE A;  3U60 B;  1QAQ A;  2DZO B;  2R18 A;  4I4L A;  4F1I A;  4QNM A;  8CAT A;  3PXG A;  3U6D A;  2JY7 A;  3BXW A;  5EJC A;  4B08 A;  1XNR M;  1DGH A;  1K3X A;  3PNY A;  2CHQ A;  1OAO C;  3KOW E;  3T6P A;  2RGH A;  2J7N A;  1G3I A;  2DWZ B;  4GRI A;  3U5Z B;  1NJF A;  3IG8 A;  2KRU A;  1XC8 A;  3SAR A;  3VK8 A;  1WGL A;  4AKI A;  4IBD A;  4JN6 A;  3KOZ E;  1MX0 A;  4DR6 M;  2XGN A;  5ITQ A;  2OPF A;  1QQW A;  2C98 A;  2YR0 A;  4NL4 H;  1IN5 A;  3AKZ A;  1WJ7 A;  3LQR A;  3QYE A;  3FTC A;  3HU2 A;  3DOA A;  3Q8X A;  5LMU M;  4JI8 M;  3B7Z A;  3PFI A;  4F2L A;  2VDB B;  1E9R A;  2CP8 A;  3H4J A;  4X62 M;  3BBZ A;  2LBC A;  3NBX X;  1YSY A;  2FS1 A;  4WP2 A;  4K0K M;  4FCV A;  5EP4 A;  4G3O A;  4DV2 M;  2UUA M;  4LJ5 A;  1D0M A;  2ZAO A;  4A3V B;  4GC9 A;  1ZAE A;  4FCW A;  4ANR A;  2VII A;  2RGO A;  4GC5 A;  5DNY A;  2FE8 A;  1IXZ A;  2BWE A;  2MH8 A;  3JR5 A;  3GLF E;  1KYI A;  1DGB A;  3GLF B;  1IBL M;  3KSJ A;  4TUW A;  4L15 A;  2HL7 A;  1OFH A;  3UGJ A;  3RGS A;  2KA6 B;  3K2L A;  4DR5 M;  3B74 A;  1F4I A;  4D82 A;  4YY3 M;  2JXN A;  2R44 A;  2OOA A;  4LZZ A;  4Z6Y A;  3GP1 A;  5FTM A;  2WSC F;  1C7Y A;  3LVW A;  2GQF A;  3J2P B;  3SHG B;  2QSF X;  1Z59 A;  2B3T A;  2DAK A;  2M60 A;  4IJF A;  4L78 A;  1IBM M;  2YQZ A;  1BVS A;  1MU5 A;  2H1R A;  2XSZ D;  3I01 M;  3KVW A;  2DAE A;  3W67 A;  2LVQ D;  1VDD A;  3MJ5 A;  1XMQ M;  4NXM M;  1IFY A;  1NY5 A;  3I51 A;  2ZBK B;  3WHL A;  2F5P A;  4Z8X A;  2QCU A;  5BPV A;  1SXJ B;  4NRW A;  3T1H M;  2CUZ A;  3K9P A;  2FOI C;  1E94 E;  2JY5 A;  3SMS A;  2C5R A;  4JI5 M;  1IY0 A;  2EA0 A;  4GKK M;  3K92 A;  3FD9 A;  4OVZ B;  3TWL A;  3U61 B;  5EP3 A;  2QPA A;  5EXT A;  3VDP A;  2JY8 A;  1AUA A;  1EFU B;  2Q2E B;  3HHZ A;  2CFO A;  1Q02 A;  1IXS A;  4IBB A;  4IIW A;  2XSZ A;  5DYI A;  1N34 M;  1NY6 A;  4R71 A;  3GLH B;  2DKL A;  4DV3 M;  2R46 A;  1IXS B;  4GKJ M;  2G5G X;  1HNX M;  2LVA A;  1Z5A A;  2HKJ A;  2K6B A;  3KW6 A;  4WW0 A;  1HQC A;  2CE7 A;  2DHR A;  3I04 M;  1LV7 A;  4LJ9 A;  3HZJ A;  1NV8 A;  4Q7J A;  4FWD A;  4IBF A;  1EIJ A;  2Y21 A;  1N78 A;  4BB9 A;  5FTL A;  2QEN A;  2D7H A;  4DR3 M;  3LMM A;  4DBG B;  4LJ7 A;  4EIW A;  1RU3 A;  4FWH A;  3IG5 A;  1NHW C;  1AIP C;  2LVN C;  3C9P A;  4AZF A;  3MHV C;  4MGK E;  3GPU A;  4X65 M;  3AL0 C;  3GLI E;  3FUW A;  2OQ4 A;  4REZ A;  3GQ4 A;  1TTE A;  3DFZ A;  2HCB A;  1ZMU A;  3TL4 X;  2J5Y A;  3L29 A;  2WSE F;  2L7H A;  3VDU A;  2K9D A;  4LRS A;  4OU7 A;  2E5L M;  1PJJ A;  2N35 A;  4LF7 M;  3CF0 A;  5F3W A;  1XB2 B;  2WSF F;  2ZTD A;  3F92 A;  1Q3C A;  1IY2 A;  3GQ3 A;  1KFV A;  3K1J A;  4LGM A;  3CGW A;  4DR2 M;  3IEC A;  4G4N A;  1XWI A;  2K0B X;  1N36 M;  4P16 A;  1T43 A;  1D0L A;  5FTJ A;  4CIZ A;  4DR4 M;  2L4F A;  2C99 A;  4NC6 A;  4HEO A;  4I81 A;  3QWL A;  1J09 A;  3SAT A;  1IN4 A;  1ZMV A;  5EXP A;  1DO0 A;  4KT0 F;  4MM3 B;  2VQE M;  1FJG M;  4UN2 B;  2K47 A;  3A45 A;  1NSF A;  2LVO C;  2X4A A;  4LJ4 A;  1GVN A;  4IBC A;  1A5T A;  3FKE A;  2LTU A;  3JAM S;  4HLQ A;  1QZE A;  2KZU A;  4XBO A;  1LTM A;  4FVM A;  2KNA A;  1KSF X;  4KO8 A;  3U6L A;  4LRT A;  3U6O A;  1C1K A;  1DV0 A; 
#chains in the Genus database with same CATH homology
 4IBI A;  4QHT A;  5IRE B;  3KFU G;  3CTW B;  5KPT A;  2UXC M;  2M5Z A;  2YFQ A;  2I7P A;  3PNV A;  4KLN A;  1L1T A;  1NHG C;  1ORY B;  4L8R C;  5JI2 E;  3SAU A;  1IBK M;  3A46 A;  3H4M A;  3R9X B;  4JI2 M;  4OW0 A;  1OFI A;  4M0W A;  1H6U A;  2VQF M;  1GL7 A;  3HJQ A;  4NSO B;  4IBK A;  5IWA M;  2XZU A;  4G4O A;  3SAS A;  1DO2 A;  4LF5 M;  1SXJ C;  2DXI A;  1WXQ A;  1X37 A;  1E9S A;  3LQQ A;  5ITX E;  1IN7 A;  3FUX A;  2C96 A;  3U6P A;  1DGF A;  3GRU A;  2XEP A;  1Z5C A;  3FUV A;  4ZPX A;  3J80 S;  3FYD A;  4M0D A;  5GKN A;  3KSX A;  1HQY E;  3GPP A;  3J81 S;  3I4V A;  4JV5 M;  3UZU A;  3HHX A;  5FSW A;  2L09 A;  2KZS A;  4IBJ A;  2Z7J A;  2LNH C;  3U61 A;  4S12 A;  2KEB A;  3SYK A;  3FUU A;  4PDG A;  4FCT A;  1IM2 A;  3T15 A;  4AG6 A;  2BJV A;  3E9S A;  4GMQ A;  4WUR A;  4D81 A;  2BNK A;  5DYG A;  4LCB A;  3ZC7 B;  4JI6 M;  4L16 A;  3J27 B;  3A98 B;  2Z4S A;  4DV4 M;  1S3S A;  3PVS A;  1PJI A;  1HT1 E;  2X49 A;  3A42 A;  1Q3B A;  1EE8 A;  2YNM D;  3SBJ A;  3UMM A;  1QAO A;  3K8Z A;  1W5S A;  3NBI A;  3DZD A;  4FWG A;  4M9S A;  1L2C A;  4KHP M;  3HHY A;  2UU9 M;  1L2B A;  1QAN A;  4DR1 M;  1GL6 A;  1HNZ M;  4B7G A;  1G8P A;  4QOZ C;  3GQ5 A;  5ITY A;  4LG2 A;  1XMO M;  1XXH A;  2ERC A;  4DV6 M;  2V1C A;  4AKG A;  1TH2 A;  1JQJ C;  1NNJ A;  4HL4 A;  5FLX S;  1L8Q A;  2LH0 A;  5IZ7 D;  3VKG A;  4B3M M;  1G4A E;  1IN6 A;  4M9Z A;  1IQP A;  3KP0 E;  4FW9 A;  4BLC A;  1N33 M;  3U6S A;  1NJG A;  5EXX A;  2CV0 A;  5EP1 A;  2UXB M;  3M0E A;  4JI3 M;  4R3D A;  3U6C A;  1TGU A;  2KW0 A;  2R4E A;  2X8A A;  4DV7 M;  2Y0T A;  2QP9 X;  4RF0 A;  4MGI E;  3FTD A;  3EIH A;  3RGP A;  3TWK A;  4CIS A;  2DZN B;  3SHF A;  2ZAM A;  4NOO B;  4LFC M;  3KXE C;  4YHH M;  4IJE A;  2DVW B;  4PT5 A;  1IXR C;  3GO8 A;  2HHH M;  4B3R M;  5H37 D;  3GLF A;  4OVZ A;  3ZCB B;  1G41 A;  5ITX A;  2XF3 A;  2XFT A;  3M7G A;  5A2Q S;  1G59 A;  4OX9 M;  4QOS A;  4NRV A;  1SXJ D;  2EO2 A;  4LFA M;  5KQD A;  5KPZ A;  4GHA A;  3GPX A;  2RKO A;  3HWS A;  5C1B A;  3TE6 A;  5EXS A;  4X64 M;  2DWM A;  1T3T A;  1Z6T A;  3UJN A;  3E4R A;  4JI7 M;  3SC3 A;  3KOX E;  3M6A A;  4X66 M;  2XH9 A;  4NXN M;  1TH4 A;  5FTK A;  2DWL A;  4XGI A;  3AV0 A;  3BOS A;  4LJA A;  4JI0 M;  1TDZ A;  1UM8 A;  2Z4R A;  3R8F A;  1E32 A;  3TPZ A;  2C9O A;  3U5Z A;  4AW4 A;  1R2Y A;  5IT9 S;  4QHS A;  1K3W A;  4LFB M;  2KXE A;  3HU3 A;  5ITR A;  3SYL A;  2LXE A;  3T38 A;  1NNU C;  4ITQ A;  1N77 A;  3KOY E;  2QBY B;  4GHL A;  4B3T M;  3TQS A;  3FTF A;  4JI4 M;  2AHM A;  4RNA A;  4AI6 A;  2EUC A;  2QBY A;  3CF6 E;  5EP2 A;  4PD2 A;  1SXJ A;  1JR3 D;  3T1Y M;  3GRV A;  4LJ8 A;  2R65 A;  3KDS E;  4G4Q A;  1TDH A;  2A5Y B;  3GRY A;  1DGG A;  3GLI B;  3VK7 A;  1QYR A;  4W5W A;  3JR4 A;  5JI3 E;  4B3S M;  1W5T A;  2BJW A;  4MH0 E;  3GLI A;  3L25 A;  3GPY A;  5FTN A;  1JR3 A;  1K82 A;  4JYA M;  2JA2 A;  1D2N A;  4GIT A;  3ILK A;  4G6Z A;  3L27 A;  4JI1 M;  2L6O A;  2XLJ A;  3VFD A;  3UK6 A;  3U6Q A;  2FFJ A;  1YUB A;  3AOG A;  4LY6 A;  2D7G A;  3U6E A;  5KO3 A;  1R7R A;  3FYC A;  3L28 A;  1SXJ E;  2W82 A;  4I5S A;  2CEA A;  3D8B A;  3SFZ A;  2P5T A;  2R62 A;  2F5O A;  3KP1 E;  3VKH A;  4M9X A;  1L1Z A;  3KS4 A;  1IY1 A;  3HJS A;  4LJ6 A;  2F5S A;  3HHW A;  4B7F A;  1L2D A;  1J7K A;  1I4W A;  2D7E A;  3FUT A;  3ZH9 B;  2NQ8 C;  5BR8 M;  1R2Z A;  1J5E M;  1N78 A;  2CV1 A;  4DUZ M;  2ZM6 M;  3J7B A;  4FD2 A;  2R45 A;  3KS8 A;  3WHK A;  2F4V M;  3W0F A;  2Y0Q A;  1YE9 A;  3GLG B;  2CV2 A;  2F5N A;  1HR0 M;  3L26 A;  4DV1 M;  4G4R A;  1Q39 A;  3AOE C;  4AG5 A;  5ITU A;  3QAU A;  4IBG A;  1QAM A;  1XXH B;  4L4U A;  2UUB M;  1R6B X;  2R4J A;  1XNQ M;  4IBE A;  1QZM A;  4GIP A;  3U6M A;  5EQT A;  3HU1 A;  4MGH A;  3RE8 A;  2J7O A;  3AJI B;  2LWX A;  3I4Y A;  5E26 A;  3GRR A;  2Y20 A;  3D8L A;  4LF8 M;  2FNA A;  3GLH A;  2V6Z M;  4AQY M;  5E6J A;  1N75 A;  4MGY E;  4GH9 A;  4LF9 M;  4LGY A;  3THG A;  3OTO M;  2ZAN A;  4I8O A;  5KQ8 A;  1GKI A;  2G8L A;  2DWN A;  2V1U A;  3GLG A;  3DA1 A;  3SAV A;  4DV0 M;  2CHV A;  5KPR A;  3MK6 A;  4PCZ A;  4LF4 M;  1XHB A;  3J7A S;  1IN8 A;  3LVV A;  2KRK A;  1PM5 A;  3CF2 A;  3C58 A;  2UXD M;  3FTE A;  2XFS A;  3SAW A;  1FNN A;  1DGH B;  1NVM A;  4R7G A;  2I7N A;  4II7 A;  4B7H A;  4CGY B;  4DUY M;  1QVR A;  3VLF B;  1HT2 E;  3AFH A;  3HGI A;  4CHT B;  3TWM A;  3W0L B;  4NSR A;  1GLN A;  1ZQ9 A;  4KOD A;  3RFW A;  3SMP A;  4BBA A;  5C18 A;  4PDI A;  3U60 A;  4D80 A;  1HNW M;  4MGZ E;  3HJ8 A;  2C9C A;  7CAT A;  2L7I A;  4LZJ A;  3AOE A;  3B9P A;  3HKP A;  4JXJ A;  3NWL A;  5ITT A;  4DV5 M;  2UUC M;  1OJL A;  2XZF A;  2F5Q A;  2CHG A;  1TH3 A;  4DR7 M;  4LF6 M;  4QNR A;  1Z5B A;  3L2A A;  1N32 M;  4RF1 A;  4MB7 A;  2QZ4 A;  5LMN M;  2Z3X A;  1I94 M;  2O5R A;  3EIE A;  3U60 B;  1QAQ A;  2DZO B;  2R18 A;  4I4L A;  4QNM A;  8CAT A;  3PXG A;  3U6D A;  4B08 A;  5EJC A;  1XNR M;  1DGH A;  1K3X A;  3PNY A;  2CHQ A;  3KOW E;  2RGH A;  2J7N A;  1G3I A;  2DWZ B;  4GRI A;  3U5Z B;  1NJF A;  3IG8 A;  2KRU A;  1XC8 A;  3SAR A;  3VK8 A;  4AKI A;  4IBD A;  4JN6 A;  3KOZ E;  1MX0 A;  4DR6 M;  2XGN A;  5ITQ A;  2OPF A;  1QQW A;  2C98 A;  2YR0 A;  4NL4 H;  1IN5 A;  3AKZ A;  3LQR A;  3FTC A;  3HU2 A;  3DOA A;  3Q8X A;  5LMU M;  4JI8 M;  3PFI A;  1E9R A;  4X62 M;  4K0K M;  1YSY A;  4FCV A;  5EP4 A;  4DV2 M;  2UUA M;  4LJ5 A;  2ZAO A;  4A3V B;  4GC9 A;  1ZAE A;  4FCW A;  2VII A;  2RGO A;  4GC5 A;  5DNY A;  2FE8 A;  1IXZ A;  3JR5 A;  1KYI A;  1DGB A;  3GLF B;  1IBL M;  3KSJ A;  4TUW A;  4L15 A;  2HL7 A;  1OFH A;  3UGJ A;  3RGS A;  2KA6 B;  3K2L A;  4DR5 M;  4D82 A;  4YY3 M;  4LZZ A;  3GP1 A;  4Z6Y A;  5FTM A;  3LVW A;  3J2P B;  3SHG B;  1Z59 A;  2M60 A;  4IJF A;  4L78 A;  1IBM M;  2YQZ A;  1MU5 A;  2XSZ D;  2H1R A;  3KVW A;  1VDD A;  3MJ5 A;  1XMQ M;  4NXM M;  1NY5 A;  3I51 A;  2ZBK B;  3WHL A;  2F5P A;  4Z8X A;  2QCU A;  5BPV A;  1SXJ B;  4NRW A;  3T1H M;  2CUZ A;  2FOI C;  1E94 E;  4JI5 M;  3SMS A;  2C5R A;  1IY0 A;  2EA0 A;  4GKK M;  3K92 A;  3FD9 A;  4OVZ B;  3TWL A;  3U61 B;  5EP3 A;  2QPA A;  5EXT A;  3VDP A;  3HHZ A;  2Q2E B;  2CFO A;  4IBB A;  4IIW A;  2XSZ A;  5DYI A;  1N34 M;  1NY6 A;  3GLH B;  4DV3 M;  2R46 A;  1IXS B;  4GKJ M;  2G5G X;  1HNX M;  1Z5A A;  2HKJ A;  3KW6 A;  4WW0 A;  1HQC A;  2CE7 A;  2DHR A;  1LV7 A;  4LJ9 A;  4FWD A;  4IBF A;  2Y21 A;  4BB9 A;  5FTL A;  2QEN A;  2D7H A;  4DR3 M;  3LMM A;  4LJ7 A;  4EIW A;  4FWH A;  3IG5 A;  1NHW C;  4AZF A;  3MHV C;  4MGK E;  3GPU A;  4X65 M;  3AL0 C;  3FUW A;  2OQ4 A;  4REZ A;  3GQ4 A;  3DFZ A;  2HCB A;  3TL4 X;  4AKH A;  3L29 A;  2E5L M;  2L7H A;  3VDU A;  4OU7 A;  4LRS A;  1PJJ A;  4LF7 M;  3CF0 A;  5F3W A;  3GQ3 A;  1Q3C A;  1IY2 A;  1KFV A;  3K1J A;  4LGM A;  4DR2 M;  4G4N A;  1XWI A;  1N36 M;  4P16 A;  5FTJ A;  4DR4 M;  2C99 A;  4I81 A;  3QWL A;  1J09 A;  3SAT A;  1IN4 A;  5EXP A;  1DO0 A;  2VQE M;  4MM3 B;  1FJG M;  2K47 A;  3A45 A;  1NSF A;  2X4A A;  4LJ4 A;  1GVN A;  4IBC A;  3FKE A;  3JAM S;  4HLQ A;  4XBO A;  2KZU A;  3U6L A;  4FVM A;  4KO8 A;  1KSF X;  3U6O A;  4LRT A;  1C1K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...