4DV2M

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 24
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4dv2M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4dv2M02
4NRWA 3J7AS 3A42A 1Q3BA 3JR4A 4X66M 4DV7M 1Z59A 1L2DA 1IBKM 2Q2EB 4YY3M 3JAMS 4X64M 1K3XA 4NXMM 4LF6M 5IT9S 3DOAA 3SAVA 4LF8M 1Q3CA 4LF7M 2OQ4A 3GPUA 2HKJA 3U6MA 2UUAM 5IWAM 4DR4M 2VQEM 3U6DA 3U6QA 1KFVA 4ITQA 1HNZM 4JI4M 4B3RM 3OTOM 1N32M 1Z5BA 1EE8A 1PM5A 2ZBKB 3SBJA 1L2BA 3TWKA 3U6PA 2UU9M 1R2ZA 1L1TA 1Z5CA 3U6SA 3JR5A 2F5QA 1MU5A 1Q39A 4DV4M 5FLXS 4B3SM 4X62M 4YHHM 5ITXE 1XMOM 4NXNM 1K82A 1N36M 2UXDM 4K0KM 4JI6M 5ITTA 3SAWA 4JI7M 2F5NA 1Z5AA 5ITQA 1TDZA 4DV2M 4DR7M 4PDIA 4JI0M 4OX9M 1TDHA 1XMQM 3TWMA 4B3TM 3SAUA 1MX0A 4DV5M 4GKKM 5BR8M 4DV1M 3VK7A 3A45A 4DUZM 1NNJA 3GQ3A 3GPXA 1L1ZA 5ITXA 4MB7A 1I94M 1HR0M 1N33M 2VQFM 3U6CA 3T1HM 4JV5M 4LFAM 4DV3M 3VK8A 4B3MM 5ITUA 5LMNM 2ZM6M 1PJJA 1J5EM 5LMUM 2F5OA 3C58A 2EA0A 2XZUA 4LF9M 3U6EA 3GO8A 2UXBM 4CISA 4LF4M 4KHPM 2OPFA 4LFBM 4JI3M 4G4RA 1IBLM 4JI8M 3TWLA 3SARA 2UUBM 2UXCM 4X65M 4LFCM 2XZFA 1R2YA 1XNRM 1K3WA 4AQYM 5ITRA 4JI2M 2F4VM 3GPYA 4G4NA 3SATA 1HNXM 2HHHM 1PJIA 1N34M 2F5SA 3J80S 2UUCM 4DR5M 4DV6M 1XNQM 4PDGA 4GKJM 1IBMM 4DR2M 4DV0M 4PD2A 3GPPA 3GQ5A 3SASA 4DR1M 1FJGM 3U6OA 4JI5M 4PCZA 3J81S 3GP1A 5ITYA 4JYAM 3W0FA 4DR6M 1L2CA 4DUYM 1HNWM 2E5LM 3GQ4A 4G4OA 3U6LA 4NRVA 4DR3M 5A2QS 3T1YM 2F5PA 4G4QA 4JI1M 4LF5M 1XC8A 3A46A
chains in the Genus database with same CATH superfamily
2ZTDA 4NRWA 3J7AS 3AFHA 3SFZA 4B08A 3VDPA 3FYCA 2DAKA 4NXMM 1K3XA 2DWNA 4I81A 5GKNA 1Q3CA 2LNHC 3BBZA 1DGHA 2C99A 3GRVA 5EJCA 2YNMD 4DBGB 1NHGC 1N32M 1KFVA 2RGHA 1G59A 1JQJC 3OTOM 1EE8A 1P3QQ 2JY5A 2M60A 2VF8A 2ZBKB 3GLHA 3H4JA 5FTNA 3SBJA 1V34A 3DZDA 1UM8A 4LJ9A 1GL7A 8CATA 3T6PA 1EFUB 4W5WA 4CHTB 1R2ZA 2XFSA 2BJWA 2DKLA 2X8AA 3HJSA 4RNAA 3ZCBB 1IN8A 2DHRA 3GLHB 4X62M 4IBGA 5L8RF 3WHKA 4I8OA 2XGNA 3C9PA 1XXHA 3SYLA 1JR3E 1E32A 5FTJA 2R18A 1WR1B 1GJTA 2ZAOA 4MGHA 4DV2M 1NO1A 3HHWA 2QBYB 1GKIA 4OX9M 2L4FA 4I4LA 1TDHA 2Z3XA 5KQDA 3SHGB 2DWLA 3FRHA 3GLHE 4FD2A 1PJTA 1S3SA 1V92A 1TF0B 1VG5A 2WSEF 4MGZE 4ANRA 5JI2E 5DNYA 3KXEC 1QDRA 4P17A 2CV0A 3TQSA 2WSCF 3VK7A 3SMSA 5KQ8A 2JZ0A 3A45A 2YR0A 4M0DA 4DUZM 3HX3A 1NNJA 2D7GA 1ZMVA 2LHGA 3UZUA 1QDTA 3ZC7B 4MB7A 2CHVA 2X4AA 3MMPA 3K9OA 4L4UA 3AKZA 2G3QA 4AG5A 3RE8A 3HU2A 3FTDA 2EKFA 5KPTA 1GJSA 4B3MM 1IFYA 1HT2E 3M7GA 5ITUA 1E9RA 2C96A 5EXSA 3A98B 2KNAA 4D80A 2ZM6M 1PJJA 2F5OA 3L28A 3B89A 2J7OA 2Y20A 4LF9M 2CUZA 3FTCA 2EUCA 4NOOB 3W67A 3E4RA 2OPFA 4JI3M 2FOIC 1WGNA 3D8LA 4MGYE 1UFZA 2CHQA 4AG6A 3SARA 3AJIB 2BJVA 2UXCM 4AW4A 3GLIA 4IJFA 2XZFA 2R45A 4G3OA 3LCVB 2HL7A 3H4MA 4AQYM 2DWZB 2P5TA 1HNXM 3UMMA 2HHHM 1PJIA 1OAIA 1C7YA 1PJSA 2R6FA 1A5TA 3J80S 4FCTA 4OW0A 1XNQM 4IBEA 3GLGB 3C3DA 5EP2A 2QBYA 3LVVA 4D81A 1OAOC 1NNUC 3I4VA 4NC6A 1E94E 2FFJA 4IBKA 5JI3E 2R46A 3KOYE 1SG9A 2A5YB 4FWGA 1QZMA 2DAMA 1IXRC 4NSOB 3U6OA 5FSWA 2DNAA 2K47A 1NJFA 3TE6A 3W68A 4REZA 4LZZA 1JR3D 3KFUG 2O25A 4IBDA 3W0FA 1G71A 1GLNA 3I51A 4OVZB 4RF1A 4L6V6 2C98A 1H6UA 4NRVA 4DR3M 1VQ1A 2H5XA 3KS4A 2HAKA 4JI1M 3MJ5A 1GL6A 4GHAA 1DV0A 3GLGE 1Z59A 2JY6B 3SHFA 5IT9S 3IG8A 4LF6M 2O01F 2FE8A 4LRSA 4LF8M 2ZTCA 3VFDA 3V76A 2ZANA 1OQYA 4RF0A 2JY7A 4AKGA 4XK8F 2HKJA 3U6MA 4I5SA 2UUAM 2I7NA 4IBBA 2KHHA 3J2PB 3RFWA 3ZH9B 1J09A 1Z5BA 2BWBA 5EXPA 1PM5A 2L6OA 1VDLA 3PNYA 3ZQJA 1IXZA 3L2AA 4GH9A 1DGHB 4QNMA 1NJGA 5E26A 3NWLA 3U6SA 2F5QA 1MU5A 1TH3A 3FTFA 5EXXA 1IXSA 2LXEA 4GMQA 4MGIE 5ITXE 5FLXS 2DZOB 2UXDM 5EQTA 2KEBA 3U61A 2R0IA 2JP7A 3AV0A 3SAWA 4WURA 2C9CA 4JI7M 4ZPXA 4JN6A 1Z5AA 2FNAA 3VKGA 3RGSA 1IN4A 3I04M 4AZFA 3GLFA 2DAGA 4R3DA 2DENA 1SXJB 2GNOA 4II7A 3LVWA 3SAUA 1IY1A 3PNVA 2Z7JA 3IECA 2FH0A 5DFLA 5E6JA 4R7GA 3HJQA 5BR8M 3K1JA 2ERCA 2KZSA 2XH9A 4KLNA 3U5ZB 4JV5M 1ZQ9A 3K8ZA 3GRRA 2LH0A 3HU1A 4B7FA 5ITXA 5KO3A 1L1ZA 1I94M 4AKHA 2C9OA 3T15A 1QAQA 3KOXE 3KSXA 3HHZA 3B74A 3FD9A 3SC3A 3T38A 2DVWB 1QAMA 1ZV1A 3HHYA 4F2LA 2VQFM 3U6CA 1OFIA 2DI0A 3GLIB 4UN2B 3RGPA 3VK8A 2MGWA 1GO5A 1XXHE 1ZMWA 3NBXX 1VEGA 1J5EM 5LMUM 1SXJD 1OIPA 2DZNB 4BLCA 4GIPA 4MGKE 4LY6A 4L8RC 5FTMA 2R62A 3FUXA 4EIWA 4LF4M 1D0KA 2DHYA 4M0WA 2MJ5B 4QOSA 1IBLM 3IG5A 3E9SA 1NVMA 2JA2A 4X65M 2MROB 3MK6A 4BBAA 2MH8A 1QYRA 3KW6A 3LW5F 4GC9A 5ITRA 2F4VM 2EO2A 3CF2A 2OOBA 4G4NA 3SATA 3AOEC 1GVNA 5FTKA 1IXSB 1XWIA 2QSFX 2QNJA 4DR5M 4DV6M 3B7QA 2EKKA 4GKJM 3I01M 3M0EA 2JNHA 1G4AE 1L8QA 3GQ5A 2DZLA 2CE7A 4L16A 1D0LA 3QYBA 2N35A 1YUBA 2Z4SA 1E9SA 1WGLA 2VDBB 4M9SA 1FJGM 1Z6TA 4BB9A 3E46A 4B7GA 5ITYA 2R44A 2XSZA 3L25A 1C1KA 4GEWA 4CGYB 2XF3A 1F4IA 3LQRA 1WJ7A 1QZEA 4B7HA 4G4QA 2H1RA 4PT5A 1SXJC 4LF5M 1XC8A 3A46A 2DAEA 3A42A 1IY0A 4DV7M 2M5ZA 4M9ZA 3TPZA 1L2DA 1IBKM 4X64M 3JAMS 4QHSA 4FW9A 1JB0F 3DOAA 3SAVA 1Q02A 4IBFA 2QCUA 4AKIA 4LF7M 3T1HM 1D2NA 4Q7JA 1QVRA 2LVOC 4Z8XA 3GPUA 2OQ4A 2GQFA 3AOGA 5IWAM 1HQYE 2QP9X 2LHCA 3I4YA 2JXNA 3U6DA 3U6QA 1HNZM 4JI4M 4B3RM 1ZMUA 4CIZA 3KP1E 1YSYA 1L2BA 1DO0A 1OFHA 2XEPA 3U6PA 1R4GA 3HU3A 3LQQA 2UU9M 4MH0E 3FKEA 1R7RA 1SXJE 2JWSA 4GRIA 1Z5CA 4DV4M 1TH4A 1ORYB 4YHHM 3F92A 4NXNM 1N75A 1QAOA 4LJ5A 1N36M 1K82A 3KS8A 4K0KM 4HL4A 4JI6M 5ITTA 5EP4A 1LTMA 1ZAEA 4NL4H 1KYIA 5ITQA 4Y28F 2QENA 1QUSA 3U5ZA 3LMMA 4DR7M 1Y8GA 5KPZA 2L7IA 2OOAA 2V6ZM 2K6BA 4JI0M 5KPRA 1AUAA 2QQ8A 3BXWA 4F1IA 2XLJA 3TWMA 2J7NA 4IBJA 3U61B 2Z4RA 2Y21A 1BVSA 4OVZA 2HWJA 1N77A 2RKOA 4DV1M 1NSFA 1IN7A 4LGMA 2QZ4A 3CF0A 3PXGA 3FYDA 1XB2B 2CHGA 3BOSA 3GQ3A 3GPXA 2LWXA 3GLGA 2W82A 5FTLA 1NHWC 1YE9A 3C3EA 1HR0M 3U60A 1NY5A 2LVQD 3WHLA 4LFAM 3AL0C 1QUTA 3K9PA 4WW0A 5LMNM 2K0BX 3K2LA 1T43A 2BWEA 5C1BA 2K9DA 3UGJA 2XZUA 3U6EA 2UXBM 3ILKA 3U60B 2D7HA 3HHXA 1PJQA 3D8BA 4LJ8A 2V1UA 4IBIA 4KHPM 2G8LA 3E21A 4G4RA 1V33A 4JI8M 3FRIA 2ZAMA 3UJNA 2UUBM 1N78A 4AI6A 2KXEA 5H37D 1XHBA 3FE3A 3FUTA 1R2YA 2DXIA 1XNRM 1K3WA 4QNRA 2KRUA 4JI2M 1QANA 3CF6E 2JUJA 4HLQA 4KODA 1PGYA 1N34M 1EIJA 2LVNC 2F5SA 2UUCM 3HY5A 3SMPA 1IBMM 2DAIA 4FWDA 4DV0M 4LJ4A 3SASA 2D7EA 2I7PA 2R65A 1JR3A 1MN3A 2AHMA 4JI5M 4QHTA 2YQZA 2CV1A 3GP1A 4LJ7A 3HZJA 1WXQA 3KVWA 4M9XA 4JYAM 2V1CA 3EIHA 3SYKA 1L2CA 2L09A 4DUYM 2CV2A 3M6AA 1HNWM 3FUUA 3HGIA 3GQ4A 3UK6A 5EP1A 1WHCA 1AIPC 4G4OA 3U6LA 5A2QS 3T1YM 2XSZD 2CEAA 3FTEA 1W5SA 3MHVC 4IBCA 4LG2A 3AOEA 3DA1A 1Q3BA 3B7ZA 4X66M 3JR4A 2Q2EB 4YY3M 3W0LB 3R9XB 3DFZA 1TR8A 3VKHA 7CATA 2B3TA 3KOZE 2NQ8C 5DYGA 2O5RA 2WZJA 3KSJA 1HT1E 4LRTA 2JZ1A 4DR4M 2VQEM 4GHLA 4MM3B 4ITQA 1MJGM 4LJAA 5DYIA 3KDSE 1G41A 1VEKA 2G5GX 2R4EA 1HJPA 4KT0F 5EP3A 3HJ8A 3TWKA 2BNKA 3K92A 3J7BA 1R6BX 2CRUA 3J27B 1L1TA 4L78A 2WSFF 2Y0TA 4WP2A 3JR5A 3QYEA 1Q39A 3HWSA 4B3SM 5EXTA 1XMOM 5F3WA 1TGUA 1TTEA 1X37A 2YFQA 2L7HA 2F5NA 1OIZA 2LVPC 1TDZA 1IN5A 1NV9A 1IY2A 2CP8A 4G6ZA 3L27A 4XGIA 1OKSA 2JY8A 2LTUA 4PDIA 1IN6A 4IJEA 4TUWA 2KW0A 1XMQM 3FUVA 2VF7A 2RRUA 1QQWA 3IHPA 1IM2A 4HEOA 4B3TM 1T3TA 3HKPA 4RKUF 3B9PA 1MX0A 4KO8A 2L2DA 3VDUA 3GLIE 4DV5M 1W5TA 2KDLA 2C5RA 4GKKM 3B7NA 1LV7A 2DWMA 2QHOB 4IIWA 1D0MA 4NSRA 5IZ7D 4OU7A 1DGBA 4CJ6A 2HCBA 4LZJA 1J7KA 2KRKA 3QWLA 1N33M 1OJLA 3CTWB 4XBOA 1G3IA 4DV3M 4FWHA 1DGFA 5BPVA 1R5LA 2X49A 1NY6A 2CWBA 3VLFB 3C58A 2KA6B 4FCVA 4Z6YA 2EA0A 1KSFX 2LVAA 3GO8A 3EIEA 2VIIA 3L29A 5IREB 4CISA 3NBIA 4LFBM 1SXJA 3R8FA 2KNZA 4S12A 1VDDA 3GLFB 4GC5A 4D82A 1PRBA 4JXJA 3TWLA 1T6OA 4LFCM 1G8PA 2QPAA 4R71A 1DGGA 3KOWE 2APLA 1IQPA 1DO2A 3GRUA 3GPYA 2Y0QA 3L26A 2RGOA 2LBCA 3GRYA 2EJSA 4P16A 1GABA 3FUWA 3LCUA 1WIVA 1TH2A 2MR9A 4PDGA 1HQCA 4QOZC 1XXHB 2Z8YM 4DR2M 2J5YA 4PD2A 2FS1A 3PVSA 3GPPA 4FVMA 1OTRA 2R4JA 1I4WA 4DR1M 3KP0E 3Q8XA 4LJ6A 1YLAA 4GITA 1RU3A 3THGA 4PCZA 3J81S 3CGWA 3GLFE 1FNNA 2KNVA 2XFTA 2OO9A 5C18A 4DR6M 3Q8GA 1CUKA 3PFIA 3TL4X 2E5LM 4LGYA 1NV8A 3QAUA 4A3VB 2CFOA 2KZUA 4L15A 2L4EA 4FCWA 2F5PA 4LCBA 1VEJA
chains in the Genus database with same CATH topology
4NRWA 3J7AS 3AFHA 3SFZA 4B08A 3VDPA 3FYCA 4NXMM 1K3XA 2DWNA 4I81A 5GKNA 1Q3CA 2LNHC 1DGHA 2C99A 3GRVA 5EJCA 2YNMD 1NHGC 1N32M 1KFVA 2RGHA 1G59A 1JQJC 3OTOM 1EE8A 2M60A 3GLHA 5FTNA 2ZBKB 3SBJA 3DZDA 1UM8A 4LJ9A 1GL7A 8CATA 4W5WA 4CHTB 1R2ZA 2XFSA 2BJWA 2X8AA 3HJSA 4RNAA 3ZCBB 1IN8A 2DHRA 3GLHB 4X62M 4IBGA 3WHKA 4I8OA 2XGNA 1XXHA 3SYLA 5FTJA 1E32A 2R18A 2ZAOA 4MGHA 4DV2M 3HHWA 2QBYB 1GKIA 4OX9M 4I4LA 1TDHA 2Z3XA 5KQDA 3SHGB 2DWLA 4FD2A 1S3SA 4MGZE 5JI2E 5DNYA 3KXEC 2CV0A 3TQSA 3VK7A 3SMSA 5KQ8A 3A45A 2YR0A 4M0DA 4DUZM 1NNJA 2D7GA 3UZUA 3ZC7B 4MB7A 2CHVA 2X4AA 4L4UA 3AKZA 4AG5A 3RE8A 3HU2A 3FTDA 5KPTA 4B3MM 1HT2E 3M7GA 5ITUA 1E9RA 2C96A 5EXSA 3A98B 2ZM6M 4D80A 1PJJA 2F5OA 3L28A 2J7OA 2Y20A 4LF9M 2CUZA 3FTCA 2EUCA 4NOOB 3E4RA 2OPFA 4JI3M 2FOIC 3D8LA 4MGYE 2CHQA 4AG6A 3SARA 3AJIB 2BJVA 2UXCM 4AW4A 3GLIA 4IJFA 2XZFA 2R45A 2HL7A 3H4MA 4AQYM 2DWZB 2P5TA 1HNXM 3UMMA 2HHHM 1PJIA 3J80S 4FCTA 4OW0A 1XNQM 4IBEA 3GLGB 5EP2A 2QBYA 3LVVA 4D81A 1NNUC 3I4VA 1E94E 2FFJA 4IBKA 5JI3E 2R46A 3KOYE 2A5YB 4FWGA 1QZMA 1IXRC 4NSOB 3U6OA 5FSWA 2K47A 1NJFA 3TE6A 4REZA 4LZZA 1JR3D 3KFUG 4IBDA 3W0FA 1GLNA 3I51A 4OVZB 4RF1A 2C98A 1H6UA 4NRVA 4DR3M 3KS4A 4JI1M 3MJ5A 1GL6A 4GHAA 1Z59A 3SHFA 5IT9S 3IG8A 4LF6M 2FE8A 4LRSA 4LF8M 3VFDA 2ZANA 4RF0A 4AKGA 2HKJA 3U6MA 4I5SA 2UUAM 2I7NA 4IBBA 3J2PB 3RFWA 3ZH9B 1J09A 1Z5BA 5EXPA 1PM5A 2L6OA 3PNYA 1IXZA 3L2AA 4GH9A 1DGHB 4QNMA 1NJGA 5E26A 3NWLA 3U6SA 2F5QA 1MU5A 1TH3A 3FTFA 5EXXA 2LXEA 4MGIE 4GMQA 5ITXE 5FLXS 2DZOB 2UXDM 5EQTA 2KEBA 3U61A 3AV0A 3SAWA 4WURA 2C9CA 4JI7M 4ZPXA 4JN6A 1Z5AA 2FNAA 3VKGA 3RGSA 1IN4A 4AZFA 3GLFA 4R3DA 1SXJB 4II7A 3LVWA 3SAUA 1IY1A 3PNVA 2Z7JA 5E6JA 4R7GA 3HJQA 5BR8M 3K1JA 2ERCA 2KZSA 2XH9A 4KLNA 3U5ZB 1ZQ9A 3K8ZA 3GRRA 2LH0A 3HU1A 4B7FA 5ITXA 5KO3A 1L1ZA 1I94M 4AKHA 2C9OA 3T15A 1QAQA 3KOXE 3KSXA 3HHZA 3FD9A 3SC3A 3T38A 2DVWB 1QAMA 3HHYA 2VQFM 3U6CA 3T1HM 4JV5M 1OFIA 3GLIB 3RGPA 3VK8A 1J5EM 5LMUM 1SXJD 2DZNB 4BLCA 4GIPA 4MGKE 4LY6A 4L8RC 5FTMA 2R62A 3FUXA 4EIWA 4LF4M 4M0WA 4QOSA 1IBLM 3IG5A 3E9SA 1NVMA 2JA2A 4X65M 3MK6A 4BBAA 1QYRA 3KW6A 4GC9A 5ITRA 2F4VM 2EO2A 3CF2A 4G4NA 3SATA 3AOEC 1GVNA 5FTKA 1IXSB 1XWIA 4DR5M 4DV6M 4GKJM 3M0EA 1G4AE 1L8QA 3GQ5A 2CE7A 4L16A 1YUBA 2Z4SA 1E9SA 1FJGM 4M9SA 1Z6TA 4BB9A 4B7GA 5ITYA 2XSZA 3L25A 1C1KA 4CGYB 2XF3A 3LQRA 4B7HA 4G4QA 2H1RA 4PT5A 1SXJC 4LF5M 1XC8A 3A46A 3A42A 1IY0A 4DV7M 2M5ZA 4M9ZA 3TPZA 1L2DA 1IBKM 4X64M 3JAMS 4QHSA 4FW9A 3DOAA 3SAVA 4IBFA 4AKIA 2QCUA 4LF7M 1D2NA 4Z8XA 1QVRA 2OQ4A 3GPUA 3AOGA 5IWAM 1HQYE 2QP9X 3I4YA 3U6DA 3U6QA 4JI4M 1HNZM 4B3RM 3KP1E 1YSYA 1L2BA 1DO0A 1OFHA 2XEPA 3U6PA 3HU3A 3LQQA 2UU9M 4MH0E 3FKEA 1R7RA 1SXJE 4GRIA 1Z5CA 4DV4M 1TH4A 1ORYB 4YHHM 4NXNM 1N75A 1QAOA 4LJ5A 1N36M 1K82A 3KS8A 4K0KM 4HL4A 4JI6M 5ITTA 5EP4A 1ZAEA 4NL4H 1KYIA 5ITQA 2QENA 3U5ZA 3LMMA 4DR7M 5KPZA 2L7IA 2V6ZM 4JI0M 5KPRA 2XLJA 3TWMA 2J7NA 4IBJA 3U61B 2Z4RA 2Y21A 4OVZA 1N77A 2RKOA 4DV1M 1NSFA 1IN7A 4LGMA 2QZ4A 3CF0A 3PXGA 3FYDA 2CHGA 3BOSA 3GQ3A 3GPXA 2LWXA 3GLGA 2W82A 5FTLA 1NHWC 1YE9A 1HR0M 3U60A 1NY5A 3WHLA 4LFAM 3AL0C 4WW0A 5LMNM 3K2LA 5C1BA 3UGJA 2XZUA 3U6EA 2UXBM 3ILKA 3U60B 2D7HA 3HHXA 3D8BA 4LJ8A 2V1UA 4IBIA 4KHPM 2G8LA 4G4RA 4JI8M 2ZAMA 3UJNA 2UUBM 1N78A 4AI6A 2KXEA 5H37D 1XHBA 3FUTA 1R2YA 2DXIA 1XNRM 1K3WA 4QNRA 2KRUA 4JI2M 1QANA 3CF6E 4HLQA 4KODA 1N34M 2F5SA 2UUCM 3SMPA 1IBMM 4FWDA 4DV0M 4LJ4A 3SASA 2D7EA 2I7PA 2R65A 1JR3A 2AHMA 4JI5M 4QHTA 2YQZA 2CV1A 3GP1A 4LJ7A 1WXQA 3KVWA 4M9XA 4JYAM 2V1CA 3EIHA 3SYKA 1L2CA 2L09A 4DUYM 2CV2A 3M6AA 1HNWM 3FUUA 3HGIA 3GQ4A 3UK6A 5EP1A 4G4OA 3U6LA 5A2QS 3T1YM 2XSZD 2CEAA 3FTEA 3MHVC 1W5SA 4IBCA 4LG2A 3AOEA 3DA1A 1Q3BA 3JR4A 4X66M 2Q2EB 4YY3M 3W0LB 3R9XB 3DFZA 3VKHA 7CATA 3KOZE 2NQ8C 5DYGA 2O5RA 3KSJA 1HT1E 4LRTA 4DR4M 2VQEM 4GHLA 4MM3B 4ITQA 4LJAA 5DYIA 3KDSE 1G41A 2G5GX 2R4EA 5EP3A 3HJ8A 3TWKA 2BNKA 3K92A 3J7BA 1R6BX 3J27B 1L1TA 4L78A 2Y0TA 3JR5A 1Q39A 3HWSA 4B3SM 5EXTA 1XMOM 5F3WA 1TGUA 1X37A 2YFQA 2L7HA 2F5NA 1TDZA 1IN5A 4G6ZA 1IY2A 3L27A 4XGIA 4TUWA 4PDIA 1IN6A 4IJEA 2KW0A 1XMQM 3FUVA 1QQWA 4B3TM 1IM2A 1T3TA 3HKPA 3B9PA 1MX0A 4KO8A 3VDUA 4DV5M 1W5TA 2C5RA 4GKKM 2DWMA 1LV7A 4IIWA 4NSRA 5IZ7D 4OU7A 1DGBA 2HCBA 4LZJA 1J7KA 2KRKA 3QWLA 1N33M 1OJLA 3CTWB 4XBOA 1G3IA 4DV3M 4FWHA 1DGFA 5BPVA 2X49A 1NY6A 3VLFB 3C58A 2KA6B 4FCVA 4Z6YA 2EA0A 1KSFX 3GO8A 3EIEA 2VIIA 3L29A 5IREB 4CISA 3NBIA 4LFBM 1SXJA 3R8FA 4S12A 1VDDA 3GLFB 4GC5A 4D82A 4JXJA 3TWLA 4LFCM 1G8PA 2QPAA 1DGGA 3KOWE 1IQPA 1DO2A 3GRUA 3GPYA 2Y0QA 3L26A 2RGOA 3GRYA 4P16A 3FUWA 1TH2A 4PDGA 1HQCA 4QOZC 1XXHB 4DR2M 4PD2A 3PVSA 3GPPA 4FVMA 2R4JA 1I4WA 4DR1M 3KP0E 3Q8XA 4LJ6A 4GITA 3THGA 4PCZA 3J81S 1FNNA 2XFTA 5C18A 4DR6M 3TL4X 3PFIA 2E5LM 4LGYA 3QAUA 4A3VB 2CFOA 2KZUA 4L15A 4FCWA 2F5PA 4LCBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NRW A;  3J7A S;  3A42 A;  1Q3B A;  3JR4 A;  4X66 M;  4DV7 M;  1Z59 A;  1L2D A;  1IBK M;  2Q2E B;  4YY3 M;  3JAM S;  4X64 M;  1K3X A;  4NXM M;  4LF6 M;  5IT9 S;  3DOA A;  3SAV A;  4LF8 M;  1Q3C A;  4LF7 M;  2OQ4 A;  3GPU A;  2HKJ A;  3U6M A;  2UUA M;  5IWA M;  4DR4 M;  2VQE M;  3U6D A;  3U6Q A;  1KFV A;  4ITQ A;  1HNZ M;  4JI4 M;  4B3R M;  3OTO M;  1N32 M;  1Z5B A;  1EE8 A;  1PM5 A;  2ZBK B;  3SBJ A;  1L2B A;  3TWK A;  3U6P A;  2UU9 M;  1R2Z A;  1L1T A;  1Z5C A;  3U6S A;  3JR5 A;  2F5Q A;  1MU5 A;  1Q39 A;  4DV4 M;  5FLX S;  4B3S M;  4X62 M;  4YHH M;  5ITX E;  1XMO M;  4NXN M;  1K82 A;  1N36 M;  2UXD M;  4K0K M;  4JI6 M;  5ITT A;  3SAW A;  4JI7 M;  2F5N A;  1Z5A A;  5ITQ A;  1TDZ A;  4DV2 M;  4DR7 M;  4PDI A;  4JI0 M;  4OX9 M;  1TDH A;  1XMQ M;  3TWM A;  4B3T M;  3SAU A;  1MX0 A;  4DV5 M;  4GKK M;  5BR8 M;  4DV1 M;  3VK7 A;  3A45 A;  4DUZ M;  1NNJ A;  3GQ3 A;  3GPX A;  1L1Z A;  5ITX A;  4MB7 A;  1I94 M;  1HR0 M;  1N33 M;  2VQF M;  3U6C A;  3T1H M;  4JV5 M;  4LFA M;  4DV3 M;  3VK8 A;  4B3M M;  5ITU A;  5LMN M;  2ZM6 M;  1PJJ A;  1J5E M;  5LMU M;  2F5O A;  3C58 A;  2EA0 A;  2XZU A;  4LF9 M;  3U6E A;  3GO8 A;  2UXB M;  4CIS A;  4LF4 M;  4KHP M;  2OPF A;  4LFB M;  4JI3 M;  4G4R A;  1IBL M;  4JI8 M;  3TWL A;  3SAR A;  2UUB M;  2UXC M;  4X65 M;  4LFC M;  2XZF A;  1R2Y A;  1XNR M;  1K3W A;  4AQY M;  5ITR A;  4JI2 M;  2F4V M;  3GPY A;  4G4N A;  3SAT A;  1HNX M;  2HHH M;  1PJI A;  1N34 M;  2F5S A;  3J80 S;  2UUC M;  4DR5 M;  4DV6 M;  1XNQ M;  4PDG A;  4GKJ M;  1IBM M;  4DR2 M;  4DV0 M;  4PD2 A;  3GPP A;  3GQ5 A;  3SAS A;  4DR1 M;  1FJG M;  3U6O A;  4JI5 M;  4PCZ A;  3J81 S;  3GP1 A;  5ITY A;  4JYA M;  3W0F A;  4DR6 M;  1L2C A;  4DUY M;  1HNW M;  2E5L M;  3GQ4 A;  4G4O A;  3U6L A;  4NRV A;  4DR3 M;  5A2Q S;  3T1Y M;  2F5P A;  4G4Q A;  4JI1 M;  4LF5 M;  1XC8 A;  3A46 A; 
#chains in the Genus database with same CATH topology
 2ZTD A;  4NRW A;  3J7A S;  3AFH A;  3SFZ A;  4B08 A;  3VDP A;  3FYC A;  2DAK A;  4NXM M;  1K3X A;  2DWN A;  4I81 A;  5GKN A;  1Q3C A;  2LNH C;  3BBZ A;  1DGH A;  2C99 A;  3GRV A;  5EJC A;  2YNM D;  4DBG B;  1NHG C;  1N32 M;  1KFV A;  2RGH A;  1G59 A;  1JQJ C;  3OTO M;  1EE8 A;  1P3Q Q;  2JY5 A;  2M60 A;  2VF8 A;  2ZBK B;  3GLH A;  3H4J A;  5FTN A;  3SBJ A;  1V34 A;  3DZD A;  1UM8 A;  4LJ9 A;  1GL7 A;  8CAT A;  3T6P A;  1EFU B;  4W5W A;  4CHT B;  1R2Z A;  2XFS A;  2BJW A;  2DKL A;  2X8A A;  3HJS A;  4RNA A;  3ZCB B;  1IN8 A;  2DHR A;  3GLH B;  4X62 M;  4IBG A;  5L8R F;  3WHK A;  4I8O A;  2XGN A;  3C9P A;  1XXH A;  3SYL A;  1JR3 E;  1E32 A;  5FTJ A;  2R18 A;  1WR1 B;  1GJT A;  2ZAO A;  4MGH A;  4DV2 M;  1NO1 A;  3HHW A;  2QBY B;  1GKI A;  4OX9 M;  2L4F A;  4I4L A;  1TDH A;  2Z3X A;  5KQD A;  3SHG B;  2DWL A;  3FRH A;  3GLH E;  4FD2 A;  1PJT A;  1S3S A;  1V92 A;  1TF0 B;  1VG5 A;  2WSE F;  4MGZ E;  4ANR A;  5JI2 E;  5DNY A;  3KXE C;  1QDR A;  4P17 A;  2CV0 A;  3TQS A;  2WSC F;  3VK7 A;  3SMS A;  5KQ8 A;  2JZ0 A;  3A45 A;  2YR0 A;  4M0D A;  4DUZ M;  3HX3 A;  1NNJ A;  2D7G A;  1ZMV A;  2LHG A;  3UZU A;  1QDT A;  3ZC7 B;  4MB7 A;  2CHV A;  2X4A A;  3MMP A;  3K9O A;  4L4U A;  3AKZ A;  2G3Q A;  4AG5 A;  3RE8 A;  3HU2 A;  3FTD A;  2EKF A;  5KPT A;  1GJS A;  4B3M M;  1IFY A;  1HT2 E;  3M7G A;  5ITU A;  1E9R A;  2C96 A;  5EXS A;  3A98 B;  2KNA A;  4D80 A;  2ZM6 M;  1PJJ A;  2F5O A;  3L28 A;  3B89 A;  2J7O A;  2Y20 A;  4LF9 M;  2CUZ A;  3FTC A;  2EUC A;  4NOO B;  3W67 A;  3E4R A;  2OPF A;  4JI3 M;  2FOI C;  1WGN A;  3D8L A;  4MGY E;  1UFZ A;  2CHQ A;  4AG6 A;  3SAR A;  3AJI B;  2BJV A;  2UXC M;  4AW4 A;  3GLI A;  4IJF A;  2XZF A;  2R45 A;  4G3O A;  3LCV B;  2HL7 A;  3H4M A;  4AQY M;  2DWZ B;  2P5T A;  1HNX M;  3UMM A;  2HHH M;  1PJI A;  1OAI A;  1C7Y A;  1PJS A;  2R6F A;  1A5T A;  3J80 S;  4FCT A;  4OW0 A;  1XNQ M;  4IBE A;  3GLG B;  3C3D A;  5EP2 A;  2QBY A;  3LVV A;  4D81 A;  1OAO C;  1NNU C;  3I4V A;  4NC6 A;  1E94 E;  2FFJ A;  4IBK A;  5JI3 E;  2R46 A;  3KOY E;  1SG9 A;  2A5Y B;  4FWG A;  1QZM A;  2DAM A;  1IXR C;  4NSO B;  3U6O A;  5FSW A;  2DNA A;  2K47 A;  1NJF A;  3TE6 A;  3W68 A;  4REZ A;  4LZZ A;  1JR3 D;  3KFU G;  2O25 A;  4IBD A;  3W0F A;  1G71 A;  1GLN A;  3I51 A;  4OVZ B;  4RF1 A;  4L6V 6;  2C98 A;  1H6U A;  4NRV A;  4DR3 M;  1VQ1 A;  2H5X A;  3KS4 A;  2HAK A;  4JI1 M;  3MJ5 A;  1GL6 A;  4GHA A;  1DV0 A;  3GLG E;  1Z59 A;  2JY6 B;  3SHF A;  5IT9 S;  3IG8 A;  4LF6 M;  2O01 F;  2FE8 A;  4LRS A;  4LF8 M;  2ZTC A;  3VFD A;  3V76 A;  2ZAN A;  1OQY A;  4RF0 A;  2JY7 A;  4AKG A;  4XK8 F;  2HKJ A;  3U6M A;  4I5S A;  2UUA M;  2I7N A;  4IBB A;  2KHH A;  3J2P B;  3RFW A;  3ZH9 B;  1J09 A;  1Z5B A;  2BWB A;  5EXP A;  1PM5 A;  2L6O A;  1VDL A;  3PNY A;  3ZQJ A;  1IXZ A;  3L2A A;  4GH9 A;  1DGH B;  4QNM A;  1NJG A;  5E26 A;  3NWL A;  3U6S A;  2F5Q A;  1MU5 A;  1TH3 A;  3FTF A;  5EXX A;  1IXS A;  2LXE A;  4GMQ A;  4MGI E;  5ITX E;  5FLX S;  2DZO B;  2UXD M;  5EQT A;  2KEB A;  3U61 A;  2R0I A;  2JP7 A;  3AV0 A;  3SAW A;  4WUR A;  2C9C A;  4JI7 M;  4ZPX A;  4JN6 A;  1Z5A A;  2FNA A;  3VKG A;  3RGS A;  1IN4 A;  3I04 M;  4AZF A;  3GLF A;  2DAG A;  4R3D A;  2DEN A;  1SXJ B;  2GNO A;  4II7 A;  3LVW A;  3SAU A;  1IY1 A;  3PNV A;  2Z7J A;  3IEC A;  2FH0 A;  5DFL A;  5E6J A;  4R7G A;  3HJQ A;  5BR8 M;  3K1J A;  2ERC A;  2KZS A;  2XH9 A;  4KLN A;  3U5Z B;  4JV5 M;  1ZQ9 A;  3K8Z A;  3GRR A;  2LH0 A;  3HU1 A;  4B7F A;  5ITX A;  5KO3 A;  1L1Z A;  1I94 M;  4AKH A;  2C9O A;  3T15 A;  1QAQ A;  3KOX E;  3KSX A;  3HHZ A;  3B74 A;  3FD9 A;  3SC3 A;  3T38 A;  2DVW B;  1QAM A;  1ZV1 A;  3HHY A;  4F2L A;  2VQF M;  3U6C A;  1OFI A;  2DI0 A;  3GLI B;  4UN2 B;  3RGP A;  3VK8 A;  2MGW A;  1GO5 A;  1XXH E;  1ZMW A;  3NBX X;  1VEG A;  1J5E M;  5LMU M;  1SXJ D;  1OIP A;  2DZN B;  4BLC A;  4GIP A;  4MGK E;  4LY6 A;  4L8R C;  5FTM A;  2R62 A;  3FUX A;  4EIW A;  4LF4 M;  1D0K A;  2DHY A;  4M0W A;  2MJ5 B;  4QOS A;  1IBL M;  3IG5 A;  3E9S A;  1NVM A;  2JA2 A;  4X65 M;  2MRO B;  3MK6 A;  4BBA A;  2MH8 A;  1QYR A;  3KW6 A;  3LW5 F;  4GC9 A;  5ITR A;  2F4V M;  2EO2 A;  3CF2 A;  2OOB A;  4G4N A;  3SAT A;  3AOE C;  1GVN A;  5FTK A;  1IXS B;  1XWI A;  2QSF X;  2QNJ A;  4DR5 M;  4DV6 M;  3B7Q A;  2EKK A;  4GKJ M;  3I01 M;  3M0E A;  2JNH A;  1G4A E;  1L8Q A;  3GQ5 A;  2DZL A;  2CE7 A;  4L16 A;  1D0L A;  3QYB A;  2N35 A;  1YUB A;  2Z4S A;  1E9S A;  1WGL A;  2VDB B;  4M9S A;  1FJG M;  1Z6T A;  4BB9 A;  3E46 A;  4B7G A;  5ITY A;  2R44 A;  2XSZ A;  3L25 A;  1C1K A;  4GEW A;  4CGY B;  2XF3 A;  1F4I A;  3LQR A;  1WJ7 A;  1QZE A;  4B7H A;  4G4Q A;  2H1R A;  4PT5 A;  1SXJ C;  4LF5 M;  1XC8 A;  3A46 A;  2DAE A;  3A42 A;  1IY0 A;  4DV7 M;  2M5Z A;  4M9Z A;  3TPZ A;  1L2D A;  1IBK M;  4X64 M;  3JAM S;  4QHS A;  4FW9 A;  1JB0 F;  3DOA A;  3SAV A;  1Q02 A;  4IBF A;  2QCU A;  4AKI A;  4LF7 M;  3T1H M;  1D2N A;  4Q7J A;  1QVR A;  2LVO C;  4Z8X A;  3GPU A;  2OQ4 A;  2GQF A;  3AOG A;  5IWA M;  1HQY E;  2QP9 X;  2LHC A;  3I4Y A;  2JXN A;  3U6D A;  3U6Q A;  1HNZ M;  4JI4 M;  4B3R M;  1ZMU A;  4CIZ A;  3KP1 E;  1YSY A;  1L2B A;  1DO0 A;  1OFH A;  2XEP A;  3U6P A;  1R4G A;  3HU3 A;  3LQQ A;  2UU9 M;  4MH0 E;  3FKE A;  1R7R A;  1SXJ E;  2JWS A;  4GRI A;  1Z5C A;  4DV4 M;  1TH4 A;  1ORY B;  4YHH M;  3F92 A;  4NXN M;  1N75 A;  1QAO A;  4LJ5 A;  1N36 M;  1K82 A;  3KS8 A;  4K0K M;  4HL4 A;  4JI6 M;  5ITT A;  5EP4 A;  1LTM A;  1ZAE A;  4NL4 H;  1KYI A;  5ITQ A;  4Y28 F;  2QEN A;  1QUS A;  3U5Z A;  3LMM A;  4DR7 M;  1Y8G A;  5KPZ A;  2L7I A;  2OOA A;  2V6Z M;  2K6B A;  4JI0 M;  5KPR A;  1AUA A;  2QQ8 A;  3BXW A;  4F1I A;  2XLJ A;  3TWM A;  2J7N A;  4IBJ A;  3U61 B;  2Z4R A;  2Y21 A;  1BVS A;  4OVZ A;  2HWJ A;  1N77 A;  2RKO A;  4DV1 M;  1NSF A;  1IN7 A;  4LGM A;  2QZ4 A;  3CF0 A;  3PXG A;  3FYD A;  1XB2 B;  2CHG A;  3BOS A;  3GQ3 A;  3GPX A;  2LWX A;  3GLG A;  2W82 A;  5FTL A;  1NHW C;  1YE9 A;  3C3E A;  1HR0 M;  3U60 A;  1NY5 A;  2LVQ D;  3WHL A;  4LFA M;  3AL0 C;  1QUT A;  3K9P A;  4WW0 A;  5LMN M;  2K0B X;  3K2L A;  1T43 A;  2BWE A;  5C1B A;  2K9D A;  3UGJ A;  2XZU A;  3U6E A;  2UXB M;  3ILK A;  3U60 B;  2D7H A;  3HHX A;  1PJQ A;  3D8B A;  4LJ8 A;  2V1U A;  4IBI A;  4KHP M;  2G8L A;  3E21 A;  4G4R A;  1V33 A;  4JI8 M;  3FRI A;  2ZAM A;  3UJN A;  2UUB M;  1N78 A;  4AI6 A;  2KXE A;  5H37 D;  1XHB A;  3FE3 A;  3FUT A;  1R2Y A;  2DXI A;  1XNR M;  1K3W A;  4QNR A;  2KRU A;  4JI2 M;  1QAN A;  3CF6 E;  2JUJ A;  4HLQ A;  4KOD A;  1PGY A;  1N34 M;  1EIJ A;  2LVN C;  2F5S A;  2UUC M;  3HY5 A;  3SMP A;  1IBM M;  2DAI A;  4FWD A;  4DV0 M;  4LJ4 A;  3SAS A;  2D7E A;  2I7P A;  2R65 A;  1JR3 A;  1MN3 A;  2AHM A;  4JI5 M;  4QHT A;  2YQZ A;  2CV1 A;  3GP1 A;  4LJ7 A;  3HZJ A;  1WXQ A;  3KVW A;  4M9X A;  4JYA M;  2V1C A;  3EIH A;  3SYK A;  1L2C A;  2L09 A;  4DUY M;  2CV2 A;  3M6A A;  1HNW M;  3FUU A;  3HGI A;  3GQ4 A;  3UK6 A;  5EP1 A;  1WHC A;  1AIP C;  4G4O A;  3U6L A;  5A2Q S;  3T1Y M;  2XSZ D;  2CEA A;  3FTE A;  1W5S A;  3MHV C;  4IBC A;  4LG2 A;  3AOE A;  3DA1 A;  1Q3B A;  3B7Z A;  4X66 M;  3JR4 A;  2Q2E B;  4YY3 M;  3W0L B;  3R9X B;  3DFZ A;  1TR8 A;  3VKH A;  7CAT A;  2B3T A;  3KOZ E;  2NQ8 C;  5DYG A;  2O5R A;  2WZJ A;  3KSJ A;  1HT1 E;  4LRT A;  2JZ1 A;  4DR4 M;  2VQE M;  4GHL A;  4MM3 B;  4ITQ A;  1MJG M;  4LJA A;  5DYI A;  3KDS E;  1G41 A;  1VEK A;  2G5G X;  2R4E A;  1HJP A;  4KT0 F;  5EP3 A;  3HJ8 A;  3TWK A;  2BNK A;  3K92 A;  3J7B A;  1R6B X;  2CRU A;  3J27 B;  1L1T A;  4L78 A;  2WSF F;  2Y0T A;  4WP2 A;  3JR5 A;  3QYE A;  1Q39 A;  3HWS A;  4B3S M;  5EXT A;  1XMO M;  5F3W A;  1TGU A;  1TTE A;  1X37 A;  2YFQ A;  2L7H A;  2F5N A;  1OIZ A;  2LVP C;  1TDZ A;  1IN5 A;  1NV9 A;  1IY2 A;  2CP8 A;  4G6Z A;  3L27 A;  4XGI A;  1OKS A;  2JY8 A;  2LTU A;  4PDI A;  1IN6 A;  4IJE A;  4TUW A;  2KW0 A;  1XMQ M;  3FUV A;  2VF7 A;  2RRU A;  1QQW A;  3IHP A;  1IM2 A;  4HEO A;  4B3T M;  1T3T A;  3HKP A;  4RKU F;  3B9P A;  1MX0 A;  4KO8 A;  2L2D A;  3VDU A;  3GLI E;  4DV5 M;  1W5T A;  2KDL A;  2C5R A;  4GKK M;  3B7N A;  1LV7 A;  2DWM A;  2QHO B;  4IIW A;  1D0M A;  4NSR A;  5IZ7 D;  4OU7 A;  1DGB A;  4CJ6 A;  2HCB A;  4LZJ A;  1J7K A;  2KRK A;  3QWL A;  1N33 M;  1OJL A;  3CTW B;  4XBO A;  1G3I A;  4DV3 M;  4FWH A;  1DGF A;  5BPV A;  1R5L A;  2X49 A;  1NY6 A;  2CWB A;  3VLF B;  3C58 A;  2KA6 B;  4FCV A;  4Z6Y A;  2EA0 A;  1KSF X;  2LVA A;  3GO8 A;  3EIE A;  2VII A;  3L29 A;  5IRE B;  4CIS A;  3NBI A;  4LFB M;  1SXJ A;  3R8F A;  2KNZ A;  4S12 A;  1VDD A;  3GLF B;  4GC5 A;  4D82 A;  1PRB A;  4JXJ A;  3TWL A;  1T6O A;  4LFC M;  1G8P A;  2QPA A;  4R71 A;  1DGG A;  3KOW E;  2APL A;  1IQP A;  1DO2 A;  3GRU A;  3GPY A;  2Y0Q A;  3L26 A;  2RGO A;  2LBC A;  3GRY A;  2EJS A;  4P16 A;  1GAB A;  3FUW A;  3LCU A;  1WIV A;  1TH2 A;  2MR9 A;  4PDG A;  1HQC A;  4QOZ C;  1XXH B;  2Z8Y M;  4DR2 M;  2J5Y A;  4PD2 A;  2FS1 A;  3PVS A;  3GPP A;  4FVM A;  1OTR A;  2R4J A;  1I4W A;  4DR1 M;  3KP0 E;  3Q8X A;  4LJ6 A;  1YLA A;  4GIT A;  1RU3 A;  3THG A;  4PCZ A;  3J81 S;  3CGW A;  3GLF E;  1FNN A;  2KNV A;  2XFT A;  2OO9 A;  5C18 A;  4DR6 M;  3Q8G A;  1CUK A;  3PFI A;  3TL4 X;  2E5L M;  4LGY A;  1NV8 A;  3QAU A;  4A3V B;  2CFO A;  2KZU A;  4L15 A;  2L4E A;  4FCW A;  2F5P A;  4LCB A;  1VEJ A; 
#chains in the Genus database with same CATH homology
 4NRW A;  3J7A S;  3AFH A;  3SFZ A;  4B08 A;  3VDP A;  3FYC A;  4NXM M;  1K3X A;  2DWN A;  4I81 A;  5GKN A;  1Q3C A;  2LNH C;  1DGH A;  2C99 A;  3GRV A;  5EJC A;  2YNM D;  1NHG C;  1N32 M;  1KFV A;  2RGH A;  1G59 A;  1JQJ C;  3OTO M;  1EE8 A;  2M60 A;  3GLH A;  5FTN A;  2ZBK B;  3SBJ A;  3DZD A;  1UM8 A;  4LJ9 A;  1GL7 A;  8CAT A;  4W5W A;  4CHT B;  1R2Z A;  2XFS A;  2BJW A;  2X8A A;  3HJS A;  4RNA A;  3ZCB B;  1IN8 A;  2DHR A;  3GLH B;  4X62 M;  4IBG A;  3WHK A;  4I8O A;  2XGN A;  1XXH A;  3SYL A;  5FTJ A;  1E32 A;  2R18 A;  2ZAO A;  4MGH A;  4DV2 M;  3HHW A;  2QBY B;  1GKI A;  4OX9 M;  4I4L A;  1TDH A;  2Z3X A;  5KQD A;  3SHG B;  2DWL A;  4FD2 A;  1S3S A;  4MGZ E;  5JI2 E;  5DNY A;  3KXE C;  2CV0 A;  3TQS A;  3VK7 A;  3SMS A;  5KQ8 A;  3A45 A;  2YR0 A;  4M0D A;  4DUZ M;  1NNJ A;  2D7G A;  3UZU A;  3ZC7 B;  4MB7 A;  2CHV A;  2X4A A;  4L4U A;  3AKZ A;  4AG5 A;  3RE8 A;  3HU2 A;  3FTD A;  5KPT A;  4B3M M;  1HT2 E;  3M7G A;  5ITU A;  1E9R A;  2C96 A;  5EXS A;  3A98 B;  2ZM6 M;  4D80 A;  1PJJ A;  2F5O A;  3L28 A;  2J7O A;  2Y20 A;  4LF9 M;  2CUZ A;  3FTC A;  2EUC A;  4NOO B;  3E4R A;  2OPF A;  4JI3 M;  2FOI C;  3D8L A;  4MGY E;  2CHQ A;  4AG6 A;  3SAR A;  3AJI B;  2BJV A;  2UXC M;  4AW4 A;  3GLI A;  4IJF A;  2XZF A;  2R45 A;  2HL7 A;  3H4M A;  4AQY M;  2DWZ B;  2P5T A;  1HNX M;  3UMM A;  2HHH M;  1PJI A;  3J80 S;  4FCT A;  4OW0 A;  1XNQ M;  4IBE A;  3GLG B;  5EP2 A;  2QBY A;  3LVV A;  4D81 A;  1NNU C;  3I4V A;  1E94 E;  2FFJ A;  4IBK A;  5JI3 E;  2R46 A;  3KOY E;  2A5Y B;  4FWG A;  1QZM A;  1IXR C;  4NSO B;  3U6O A;  5FSW A;  2K47 A;  1NJF A;  3TE6 A;  4REZ A;  4LZZ A;  1JR3 D;  3KFU G;  4IBD A;  3W0F A;  1GLN A;  3I51 A;  4OVZ B;  4RF1 A;  2C98 A;  1H6U A;  4NRV A;  4DR3 M;  3KS4 A;  4JI1 M;  3MJ5 A;  1GL6 A;  4GHA A;  1Z59 A;  3SHF A;  5IT9 S;  3IG8 A;  4LF6 M;  2FE8 A;  4LRS A;  4LF8 M;  3VFD A;  2ZAN A;  4RF0 A;  4AKG A;  2HKJ A;  3U6M A;  4I5S A;  2UUA M;  2I7N A;  4IBB A;  3J2P B;  3RFW A;  3ZH9 B;  1J09 A;  1Z5B A;  5EXP A;  1PM5 A;  2L6O A;  3PNY A;  1IXZ A;  3L2A A;  4GH9 A;  1DGH B;  4QNM A;  1NJG A;  5E26 A;  3NWL A;  3U6S A;  2F5Q A;  1MU5 A;  1TH3 A;  3FTF A;  5EXX A;  2LXE A;  4MGI E;  4GMQ A;  5ITX E;  5FLX S;  2DZO B;  2UXD M;  5EQT A;  2KEB A;  3U61 A;  3AV0 A;  3SAW A;  4WUR A;  2C9C A;  4JI7 M;  4ZPX A;  4JN6 A;  1Z5A A;  2FNA A;  3VKG A;  3RGS A;  1IN4 A;  4AZF A;  3GLF A;  4R3D A;  1SXJ B;  4II7 A;  3LVW A;  3SAU A;  1IY1 A;  3PNV A;  2Z7J A;  5E6J A;  4R7G A;  3HJQ A;  5BR8 M;  3K1J A;  2ERC A;  2KZS A;  2XH9 A;  4KLN A;  3U5Z B;  1ZQ9 A;  3K8Z A;  3GRR A;  2LH0 A;  3HU1 A;  4B7F A;  5ITX A;  5KO3 A;  1L1Z A;  1I94 M;  4AKH A;  2C9O A;  3T15 A;  1QAQ A;  3KOX E;  3KSX A;  3HHZ A;  3FD9 A;  3SC3 A;  3T38 A;  2DVW B;  1QAM A;  3HHY A;  2VQF M;  3U6C A;  3T1H M;  4JV5 M;  1OFI A;  3GLI B;  3RGP A;  3VK8 A;  1J5E M;  5LMU M;  1SXJ D;  2DZN B;  4BLC A;  4GIP A;  4MGK E;  4LY6 A;  4L8R C;  5FTM A;  2R62 A;  3FUX A;  4EIW A;  4LF4 M;  4M0W A;  4QOS A;  1IBL M;  3IG5 A;  3E9S A;  1NVM A;  2JA2 A;  4X65 M;  3MK6 A;  4BBA A;  1QYR A;  3KW6 A;  4GC9 A;  5ITR A;  2F4V M;  2EO2 A;  3CF2 A;  4G4N A;  3SAT A;  3AOE C;  1GVN A;  5FTK A;  1IXS B;  1XWI A;  4DR5 M;  4DV6 M;  4GKJ M;  3M0E A;  1G4A E;  1L8Q A;  3GQ5 A;  2CE7 A;  4L16 A;  1YUB A;  2Z4S A;  1E9S A;  1FJG M;  4M9S A;  1Z6T A;  4BB9 A;  4B7G A;  5ITY A;  2XSZ A;  3L25 A;  1C1K A;  4CGY B;  2XF3 A;  3LQR A;  4B7H A;  4G4Q A;  2H1R A;  4PT5 A;  1SXJ C;  4LF5 M;  1XC8 A;  3A46 A;  3A42 A;  1IY0 A;  4DV7 M;  2M5Z A;  4M9Z A;  3TPZ A;  1L2D A;  1IBK M;  4X64 M;  3JAM S;  4QHS A;  4FW9 A;  3DOA A;  3SAV A;  4IBF A;  4AKI A;  2QCU A;  4LF7 M;  1D2N A;  4Z8X A;  1QVR A;  2OQ4 A;  3GPU A;  3AOG A;  5IWA M;  1HQY E;  2QP9 X;  3I4Y A;  3U6D A;  3U6Q A;  4JI4 M;  1HNZ M;  4B3R M;  3KP1 E;  1YSY A;  1L2B A;  1DO0 A;  1OFH A;  2XEP A;  3U6P A;  3HU3 A;  3LQQ A;  2UU9 M;  4MH0 E;  3FKE A;  1R7R A;  1SXJ E;  4GRI A;  1Z5C A;  4DV4 M;  1TH4 A;  1ORY B;  4YHH M;  4NXN M;  1N75 A;  1QAO A;  4LJ5 A;  1N36 M;  1K82 A;  3KS8 A;  4K0K M;  4HL4 A;  4JI6 M;  5ITT A;  5EP4 A;  1ZAE A;  4NL4 H;  1KYI A;  5ITQ A;  2QEN A;  3U5Z A;  3LMM A;  4DR7 M;  5KPZ A;  2L7I A;  2V6Z M;  4JI0 M;  5KPR A;  2XLJ A;  3TWM A;  2J7N A;  4IBJ A;  3U61 B;  2Z4R A;  2Y21 A;  4OVZ A;  1N77 A;  2RKO A;  4DV1 M;  1NSF A;  1IN7 A;  4LGM A;  2QZ4 A;  3CF0 A;  3PXG A;  3FYD A;  2CHG A;  3BOS A;  3GQ3 A;  3GPX A;  2LWX A;  3GLG A;  2W82 A;  5FTL A;  1NHW C;  1YE9 A;  1HR0 M;  3U60 A;  1NY5 A;  3WHL A;  4LFA M;  3AL0 C;  4WW0 A;  5LMN M;  3K2L A;  5C1B A;  3UGJ A;  2XZU A;  3U6E A;  2UXB M;  3ILK A;  3U60 B;  2D7H A;  3HHX A;  3D8B A;  4LJ8 A;  2V1U A;  4IBI A;  4KHP M;  2G8L A;  4G4R A;  4JI8 M;  2ZAM A;  3UJN A;  2UUB M;  1N78 A;  4AI6 A;  2KXE A;  5H37 D;  1XHB A;  3FUT A;  1R2Y A;  2DXI A;  1XNR M;  1K3W A;  4QNR A;  2KRU A;  4JI2 M;  1QAN A;  3CF6 E;  4HLQ A;  4KOD A;  1N34 M;  2F5S A;  2UUC M;  3SMP A;  1IBM M;  4FWD A;  4DV0 M;  4LJ4 A;  3SAS A;  2D7E A;  2I7P A;  2R65 A;  1JR3 A;  2AHM A;  4JI5 M;  4QHT A;  2YQZ A;  2CV1 A;  3GP1 A;  4LJ7 A;  1WXQ A;  3KVW A;  4M9X A;  4JYA M;  2V1C A;  3EIH A;  3SYK A;  1L2C A;  2L09 A;  4DUY M;  2CV2 A;  3M6A A;  1HNW M;  3FUU A;  3HGI A;  3GQ4 A;  3UK6 A;  5EP1 A;  4G4O A;  3U6L A;  5A2Q S;  3T1Y M;  2XSZ D;  2CEA A;  3FTE A;  3MHV C;  1W5S A;  4IBC A;  4LG2 A;  3AOE A;  3DA1 A;  1Q3B A;  3JR4 A;  4X66 M;  2Q2E B;  4YY3 M;  3W0L B;  3R9X B;  3DFZ A;  3VKH A;  7CAT A;  3KOZ E;  2NQ8 C;  5DYG A;  2O5R A;  3KSJ A;  1HT1 E;  4LRT A;  4DR4 M;  2VQE M;  4GHL A;  4MM3 B;  4ITQ A;  4LJA A;  5DYI A;  3KDS E;  1G41 A;  2G5G X;  2R4E A;  5EP3 A;  3HJ8 A;  3TWK A;  2BNK A;  3K92 A;  3J7B A;  1R6B X;  3J27 B;  1L1T A;  4L78 A;  2Y0T A;  3JR5 A;  1Q39 A;  3HWS A;  4B3S M;  5EXT A;  1XMO M;  5F3W A;  1TGU A;  1X37 A;  2YFQ A;  2L7H A;  2F5N A;  1TDZ A;  1IN5 A;  4G6Z A;  1IY2 A;  3L27 A;  4XGI A;  4TUW A;  4PDI A;  1IN6 A;  4IJE A;  2KW0 A;  1XMQ M;  3FUV A;  1QQW A;  4B3T M;  1IM2 A;  1T3T A;  3HKP A;  3B9P A;  1MX0 A;  4KO8 A;  3VDU A;  4DV5 M;  1W5T A;  2C5R A;  4GKK M;  2DWM A;  1LV7 A;  4IIW A;  4NSR A;  5IZ7 D;  4OU7 A;  1DGB A;  2HCB A;  4LZJ A;  1J7K A;  2KRK A;  3QWL A;  1N33 M;  1OJL A;  3CTW B;  4XBO A;  1G3I A;  4DV3 M;  4FWH A;  1DGF A;  5BPV A;  2X49 A;  1NY6 A;  3VLF B;  3C58 A;  2KA6 B;  4FCV A;  4Z6Y A;  2EA0 A;  1KSF X;  3GO8 A;  3EIE A;  2VII A;  3L29 A;  5IRE B;  4CIS A;  3NBI A;  4LFB M;  1SXJ A;  3R8F A;  4S12 A;  1VDD A;  3GLF B;  4GC5 A;  4D82 A;  4JXJ A;  3TWL A;  4LFC M;  1G8P A;  2QPA A;  1DGG A;  3KOW E;  1IQP A;  1DO2 A;  3GRU A;  3GPY A;  2Y0Q A;  3L26 A;  2RGO A;  3GRY A;  4P16 A;  3FUW A;  1TH2 A;  4PDG A;  1HQC A;  4QOZ C;  1XXH B;  4DR2 M;  4PD2 A;  3PVS A;  3GPP A;  4FVM A;  2R4J A;  1I4W A;  4DR1 M;  3KP0 E;  3Q8X A;  4LJ6 A;  4GIT A;  3THG A;  4PCZ A;  3J81 S;  1FNN A;  2XFT A;  5C18 A;  4DR6 M;  3TL4 X;  3PFI A;  2E5L M;  4LGY A;  3QAU A;  4A3V B;  2CFO A;  2KZU A;  4L15 A;  4FCW A;  2F5P A;  4LCB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...