4DV2M

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
118
structure length
118
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 24
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4dv2M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4dv2M02
5ITTA 2F5OA 4GKKM 4LF9M 3J7AS 4JYAM 2XZUA 2UXCM 4G4RA 3SBJA 4X62M 1KFVA 2ZBKB 1MU5A 5A2QS 2F5QA 4JV5M 3W0FA 1N36M 3SAWA 3TWKA 3TWLA 3U6DA 1XNQM 1XNRM 1HNXM 4DUZM 4DV5M 1PJIA 4DR1M 2F5SA 5IT9S 1L2CA 3GPPA 3JR5A 4JI8M 3SATA 4JI7M 3GQ4A 4DV1M 5ITYA 4AQYM 5IWAM 2E5LM 1N34M 4ITQA 3J80S 4LFCM 3VK7A 2HHHM 2F4VM 4LF5M 2OQ4A 2UXBM 1MX0A 3U6EA 4CISA 4X64M 4DV2M 4DR2M 4G4OA 1HNZM 1K3XA 2UXDM 4DV0M 3GP1A 4B3RM 2VQEM 4B3MM 4LFBM 5ITXA 3GPYA 4DR7M 1N32M 4JI0M 5LMNM 3VK8A 2UU9M 4NRVA 4NRWA 4LF8M 4NXNM 4MB7A 4JI4M 4NXMM 3JR4A 2UUBM 4LF7M 1K82A 4OX9M 3A45A 4LFAM 3U6LA 4JI5M 4DV4M 1FJGM 1TDHA 3A42A 1XMOM 3C58A 4DR3M 1PJJA 1I94M 3JAMS 1IBMM 2UUAM 1R2ZA 4GKJM 1N33M 2ZM6M 5ITXE 1PM5A 4G4QA 4JI2M 5BR8M 1L2DA 3U6PA 2VQFM 2Q2EB 1TDZA 2F5PA 4B3SM 1XC8A 1EE8A 1XMQM 3U6QA 4JI3M 3OTOM 1Q3CA 4JI6M 5ITRA 2F5NA 3SARA 4PD2A 3TWMA 1L1TA 1Q3BA 1IBLM 1HR0M 4PCZA 1Z59A 3GPXA 1Z5AA 2HKJA 3A46A 1Z5BA 3GQ3A 4LF4M 1IBKM 4DR6M 2OPFA 3J81S 4PDIA 4LF6M 3GPUA 4K0KM 4YY3M 1Z5CA 4YHHM 3SAUA 1J5EM 3DOAA 3GQ5A 3SAVA 3T1HM 4DV3M 5ITQA 1NNJA 2EA0A 4DV7M 1L2BA 4KHPM 3U6MA 1L1ZA 5FLXS 5ITUA 4PDGA 4X65M 3GO8A 1Q39A 4X66M 2UUCM 3T1YM 3U6CA 2XZFA 4DV6M 3SASA 4B3TM 3U6OA 5LMUM 4G4NA 4JI1M 1K3WA 4DUYM 4DR4M 1R2YA 3U6SA 1HNWM 4DR5M
chains in the Genus database with same CATH superfamily
4GKKM 1JR3E 4LF9M 4F2LA 2UXCM 4GHLA 1NV9A 2ZBKB 1TTEA 1QAQA 5KPZA 3W0LB 3VKGA 2F5QA 1MJGM 4I81A 1SXJE 3W0FA 1DO2A 1GO5A 3SAWA 4GC5A 3K2LA 4QOZC 3CGWA 4GIPA 1XNQM 1TR8A 2X49A 2QP9X 2GQFA 4DR1M 3AOEA 5IT9S 1DV0A 2JZ0A 1G71A 2DNAA 3FTEA 4JI8M 3RGPA 4JI7M 1QDRA 5ITYA 2JNHA 3C9PA 4LJ9A 1N34M 2Y0QA 3C3EA 3GLFE 1PJQA 1VG5A 2F4VM 1C7YA 1QVRA 2YR0A 3FUUA 2OQ4A 1MX0A 3E9SA 3FYDA 4FVMA 2RRUA 1NHWC 4LRTA 3HU1A 4REZA 1SXJC 2O5RA 4OU7A 4G4OA 3I01M 4GC9A 1QZEA 3SHFA 3LMMA 4R71A 2FFJA 4ZPXA 3UZUA 3GLHA 3KOWE 2FNAA 4JI0M 4M9XA 1G4AE 1R5LA 4NRVA 3BOSA 3B7ZA 4NRWA 2EUCA 2R65A 2MGWA 5FTNA 4NXMM 2N35A 3VDUA 2DZOB 3R8FA 4KT0F 2UUBM 3UMMA 3KS4A 2XSZD 4LY6A 4QHSA 1VDDA 3BXWA 1FJGM 1GL7A 1KYIA 3KOYE 2DXIA 2QZ4A 3UJNA 2L4EA 2UUAM 1IXSB 1N33M 1PM5A 3VDPA 4G4QA 1QAMA 2QQ8A 3I4VA 5H37D 4JI2M 3MK6A 5BR8M 4HEOA 1ORYB 3WHKA 1QAOA 1Q02A 2EKFA 2F5PA 3J27B 5IZ7D 1Y8GA 2JY6B 3L28A 2HWJA 1IN8A 2R4JA 1Q3CA 1TH2A 4IBGA 2MJ5B 4QNRA 3NWLA 1OAOC 4PT5A 5EJCA 3TWMA 4LRSA 3RE8A 3T6PA 4FWDA 1UFZA 2QBYA 1OFHA 2MROB 5FTLA 1D0MA 2VF8A 4GMQA 3GPXA 3A46A 2DHRA 1Z6TA 3TQSA 3GLIE 3MMPA 3T38A 1IBKM 4QHTA 4AKGA 2R18A 4PDIA 3AKZA 3GPUA 4K0KM 1N77A 3LVWA 2LNHC 2XH9A 5EXTA 1J5EM 2Y0TA 3DOAA 4JXJA 3SAVA 3H4JA 2FE8A 1V92A 2BJWA 3T1HM 4LZJA 2KZSA 2A5YB 1AUAA 2EA0A 2GNOA 4KHPM 1OJLA 2CP8A 1L1ZA 5C1BA 1MN3A 1VEKA 2LVAA 4Q7JA 1HT2E 3GLGE 3V76A 3PNVA 3D8BA 3HWSA 2J7OA 4X65M 4GH9A 4X66M 3SASA 1IXRC 2VF7A 2XF3A 2DKLA 3BBZA 2R4EA 2KHHA 4DUYM 1WXQA 1GJSA 3L26A 3KXEC 3ILKA 5ITTA 1ZQ9A 2JUJA 2RGHA 2F5OA 3J7AS 2JP7A 2EJSA 1IM2A 1WHCA 2L4FA 2L6OA 4FD2A 4MM3B 5EXSA 1R6BX 3GLHB 3SYLA 2R44A 4L8RC 1IY2A 4B7GA 3TE6A 2V1CA 4CGYB 3PNYA 4RF0A 2M60A 4DUZM 4IJEA 1IY0A 3HHXA 2YNMD 4LZZA 1NJFA 2O01F 4I8OA 3NBIA 5FTMA 3FRHA 3GQ4A 2Z3XA 4DV1M 1EFUB 3KP0E 4FCVA 2LTUA 3SHGB 1YUBA 3QWLA 3J80S 2ZANA 2QENA 3AL0C 3KFUG 1F4IA 4LF5M 1DGHA 1JQJC 2FOIC 2DZNB 2NQ8C 1J7KA 3K92A 3CF0A 3LQQA 4II7A 5C18A 4X64M 3AOGA 4DV2M 4R7GA 4OVZA 3TPZA 2C9OA 4IBKA 2EKKA 2CE7A 2G5GX 5EP2A 2HCBA 3T15A 3H4MA 2G3QA 4F1IA 2R0IA 4LG2A 1IN4A 2J7NA 3FUXA 4LFBM 1NV8A 2R45A 1IN6A 1GL6A 5EP3A 2BWBA 2ERCA 5LMNM 1WGLA 2KW0A 2L09A 3W68A 1YLAA 3VK8A 2MR9A 3LVVA 1D2NA 3DA1A 3HKPA 4MB7A 2RKOA 1KSFX 1PRBA 1IFYA 4IBEA 2QBYB 3E46A 2Z7JA 4A3VB 4FWHA 4FW9A 3KSXA 4L6V6 1V34A 5L8RF 5DNYA 4IBCA 1DGFA 3HHZA 2R6FA 3U60B 4W5WA 3I04M 4DV4M 1XMOM 4AI6A 3KDSE 2YFQA 1T43A 3GLFB 2LVNC 3HHYA 1IBMM 5ITXE 2KNVA 4P16A 3LQRA 2QCUA 1W5SA 1HQCA 1OQYA 4KO8A 3KP1E 5JI3E 3U5ZB 2RGOA 3U6PA 5E26A 2XSZA 2VQFM 1A5TA 1J09A 1TDZA 1GABA 2LH0A 3VLFB 3SMSA 4B3SM 1L8QA 3J7BA 1PJSA 1EE8A 3A98B 4MGIE 1XC8A 1XMQM 1TF0B 4JI3M 3U61A 1E32A 3HHWA 4P17A 5ITRA 2DWNA 2F5NA 1VEGA 2CHVA 1XXHA 3HJSA 1GJTA 3PVSA 4KLNA 5KO3A 3B7QA 4L16A 1L1TA 1Q3BA 4NL4H 1ZAEA 1IBLM 1HR0M 1GVNA 1Z59A 3CTWB 4NSRA 4AW4A 4M9SA 3K9OA 4DR6M 3R9XB 2OPFA 1T6OA 4RF1A 4S12A 4Y28F 5EQTA 2DAKA 1E9RA 1Z5CA 2CHGA 3GRVA 3KSJA 3J2PB 3SMPA 3KS8A 1OTRA 1TH4A 2CEAA 2D7GA 4IBDA 3GQ5A 1JR3A 2WSFF 1JB0F 4AZFA 2V6ZM 1ZMWA 2K0BX 4LGMA 5ITQA 2XLJA 4GRIA 1NNJA 2OOBA 1UM8A 4B7FA 4DV7M 1WIVA 3U6MA 3KW6A 2Z4RA 1SXJA 3EIHA 1R4GA 4PDGA 3GO8A 2CV2A 3U6CA 4DV6M 3FD9A 1DGHB 2JY5A 4LJ4A 1PGYA 1JR3D 1R2YA 1I94M 5KQ8A 3U60A 1HNWM 4DR4M 4OVZB 5KQDA 2KRUA 4JYAM 2XZUA 3GRRA 3GLIB 4G4RA 3SBJA 1KFVA 1XWIA 3GLFA 2L7HA 4MGYE 1SXJD 2C96A 2I7NA 5A2QS 1N78A 1QZMA 3QYBA 1DO0A 1IQPA 4AG6A 3U5ZA 3K9PA 2C98A 5EXPA 1V33A 2CUZA 1N75A 3U6DA 2C9CA 2KRKA 2JXNA 4DV5M 4XBOA 3FTCA 2F5SA 2DWZB 2K9DA 1L2CA 1R7RA 2R46A 3ZCBB 2EO2A 3GLGB 2CRUA 2BNKA 5IWAM 2WSEF 4ITQA 5DFLA 3VKHA 3B9PA 4UN2B 5KPTA 4LFCM 3HU2A 4I5SA 3IHPA 2LVOC 2H5XA 4CHTB 4CISA 5E6JA 1G59A 1HJPA 2BJVA 4LJ7A 2QPAA 2AHMA 2DVWB 2BWEA 4Z8XA 4DV0M 1ZMVA 3L2AA 4M9ZA 4B3RM 2L2DA 4G6ZA 3U61B 1WJ7A 3M7GA 4DR7M 2LVPC 2KXEA 2UU9M 3QYEA 3HX3A 4JN6A 4LJ8A 1XXHB 4NXNM 4LF8M 2KDLA 3IG8A 4FCWA 4JI4M 4AKHA 4B7HA 3HZJA 3E4RA 4LJAA 3JR4A 4GEWA 4LF7M 3A45A 1QUTA 3RGSA 3U6LA 4JI5M 3K8ZA 2LXEA 1TDHA 3A42A 3W67A 3UK6A 2OOAA 3ZC7B 1P3QQ 3I4YA 4DR3M 1PJJA 1DGBA 3JAMS 4GKJM 3GLHE 2XGNA 4AG5A 2ZM6M 3AOEC 2LWXA 4M0DA 2R62A 4D80A 4HLQA 2HL7A 3Q8XA 4WW0A 1XHBA 1L2DA 4M0WA 2K47A 1E94E 3GRUA 3GLIA 2P5TA 5FTKA 4LGYA 2LVQD 2WZJA 1BVSA 4MGHA 2CHQA 1GKIA 1SXJB 4IBIA 4NOOB 3DFZA 3SFZA 3SYKA 3E21A 1SG9A 2KA6B 2QHOB 2ZTDA 3QAUA 5DYIA 4JI6M 2V1UA 1WR1B 4PD2A 4QOSA 1ZV1A 1LTMA 1TH3A 1Z5AA 2JZ1A 3M6AA 4Z6YA 3GLGA 1OKSA 2X4AA 3GQ3A 4LF4M 1IY1A 2LHGA 4NSOB 3J81S 3LCUA 2MH8A 2D7EA 2FH0A 4LF6M 4YY3M 1XB2B 1QDTA 2KEBA 2KZUA 1NSFA 4YHHM 3SAUA 4GITA 3NBXX 1G3IA 1RU3A 1GLNA 3LCVB 4IBFA 4DV3M 2XFTA 3L29A 2DWLA 3HY5A 1OIPA 1NNUC 2Y21A 5FLXS 3FRIA 2LHCA 3GRYA 3FE3A 1G41A 4LJ5A 2CV1A 1Q39A 5FSWA 3T1YM 2XZFA 4B3TM 1AIPC 3L27A 4D81A 3U6OA 5LMUM 2XEPA 4JI1M 8CATA 1OFIA 2KNAA 3HJ8A 1K3WA 4L15A 3U6SA 3RFWA 4TUWA 3VFDA 2CWBA 4X62M 3CF2A 1MU5A 3K1JA 1HQYE 4JV5M 5FTJA 1T3TA 4AKIA 1N36M 4DBGB 1S3SA 1FNNA 1PJTA 2LBCA 1QQWA 3TWKA 3TL4X 3TWLA 5EP4A 1D0KA 4RKUF 4EIWA 2DI0A 1HNXM 1XNRM 1PJIA 4LCBA 2DZLA 2Z4SA 4L78A 3L25A 4CIZA 1NY5A 3THGA 3GPPA 3JR5A 4LJ6A 1NO1A 1YSYA 3SATA 3FTDA 5EP1A 5DYGA 4D82A 1NJGA 4AQYM 2E5LM 2M5ZA 2ZAMA 2ZAOA 2ZTCA 1HT1E 5GKNA 3VK7A 3MHVC 2HHHM 3HJQA 1IN5A 2QSFX 2VDBB 2UXBM 2Z8YM 3PXGA 3U6EA 3M0EA 1I4WA 4RNAA 2JY7A 2C5RA 1EIJA 1DGGA 1QYRA 2JY8A 4IBJA 2L7IA 4XK8F 4DR2M 1HNZM 2B3TA 1IXZA 2HAKA 3AV0A 1K3XA 2OO9A 2DAEA 3D8LA 4MGZE 2UXDM 2O25A 5KPRA 3GP1A 2VQEM 3FUWA 1YE9A 4B3MM 2DAIA 5ITXA 3GPYA 1N32M 2APLA 4IIWA 1C1KA 1NHGC 4L4UA 1VEJA 1OAIA 4FWGA 1LV7A 1VQ1A 4OW0A 1IN7A 4XGIA 2WSCF 5F3WA 4MH0E 4MGKE 2CFOA 3B89A 1ZMUA 1NY6A 1K82A 4OX9M 4LFAM 2QNJA 3HGIA 3C58A 4BB9A 3C3DA 1R2ZA 2CV0A 3WHLA 4I4LA 3LW5F 1CUKA 1QUSA 4IJFA 4BLCA 3B7NA 3Q8GA 3KOXE 4ANRA 2Q2EB 2DHYA 3KOZE 1G8PA 2H1RA 3UGJA 3FKEA 3U6QA 2W82A 7CATA 2KNZA 3OTOM 3I51A 3CF6E 2DWMA 1D0LA 3SARA 2JWSA 3DZDA 3MJ5A 4B08A 3PFIA 4IBBA 5JI2E 4G3OA 2G8LA 2I7PA 2DAGA 4PCZA 4WP2A 2DENA 2Y20A 3ZQJA 2HKJA 2D7HA 4HL4A 1W5TA 1Z5BA 1QANA 2J5YA 5BPVA 2X8AA 2K6BA 3IG5A 1VDLA 2VIIA 3F92A 4BBAA 1IXSA 1OIZA 2JA2A 1E9SA 2DAMA 4R3DA 4GHAA 1XXHE 2C99A 4WURA 3FTFA 4CJ6A 3HU3A 5EXXA 1L2BA 5IREB 2YQZA 4KODA 3FUTA 3KVWA 2XFSA 4NC6A 4QNMA 4FCTA 1X37A 3FYCA 5ITUA 2UUCM 3EIEA 2FS1A 3FUVA 3SC3A 3ZH9B 1WGNA 3AFHA 1H6UA 4G4NA 1TGUA 3AJIB 1NVMA 3IECA 3B74A 4DR5M
chains in the Genus database with same CATH topology
4GKKM 4LF9M 2UXCM 4GHLA 2ZBKB 1QAQA 5KPZA 3W0LB 3VKGA 2F5QA 4I81A 1SXJE 3W0FA 1DO2A 3SAWA 4GC5A 3K2LA 4QOZC 4GIPA 1XNQM 2X49A 2QP9X 4DR1M 3AOEA 5IT9S 3FTEA 4JI8M 3RGPA 4JI7M 5ITYA 1N34M 4LJ9A 2Y0QA 2F4VM 1QVRA 2YR0A 3FUUA 2OQ4A 1MX0A 3E9SA 3FYDA 4FVMA 4LRTA 1NHWC 3HU1A 4REZA 1SXJC 2O5RA 4OU7A 4G4OA 4GC9A 3SHFA 3LMMA 2FFJA 4ZPXA 3UZUA 3GLHA 3KOWE 2FNAA 4JI0M 4M9XA 1G4AE 4NRVA 4NRWA 3BOSA 2EUCA 2R65A 5FTNA 4NXMM 3VDUA 2DZOB 3R8FA 2UUBM 3UMMA 3KS4A 2XSZD 4LY6A 4QHSA 1VDDA 1FJGM 1GL7A 1KYIA 3KOYE 2DXIA 2QZ4A 3UJNA 2UUAM 1N33M 1IXSB 1PM5A 3VDPA 4G4QA 1QAMA 3I4VA 5H37D 4JI2M 3MK6A 5BR8M 3WHKA 1ORYB 1QAOA 2F5PA 3J27B 5IZ7D 3L28A 1IN8A 2R4JA 1Q3CA 1TH2A 4IBGA 4QNRA 3NWLA 4PT5A 5EJCA 3TWMA 4LRSA 3RE8A 4FWDA 2QBYA 1OFHA 5FTLA 4GMQA 3GPXA 3A46A 2DHRA 1Z6TA 3TQSA 4AKGA 3T38A 1IBKM 4QHTA 2R18A 4PDIA 3AKZA 3GPUA 4K0KM 1N77A 3LVWA 2LNHC 2XH9A 5EXTA 1J5EM 2Y0TA 3DOAA 4JXJA 3SAVA 2FE8A 2BJWA 3T1HM 4LZJA 2KZSA 2A5YB 2EA0A 4KHPM 1OJLA 1L1ZA 5C1BA 1HT2E 3PNVA 3D8BA 3HWSA 2J7OA 4X65M 4GH9A 4X66M 3SASA 1IXRC 2XF3A 2R4EA 4DUYM 1WXQA 3L26A 3KXEC 3ILKA 5ITTA 1ZQ9A 2RGHA 2F5OA 3J7AS 1IM2A 2L6OA 4FD2A 4MM3B 5EXSA 1R6BX 3GLHB 3SYLA 4L8RC 1IY2A 4B7GA 3TE6A 2V1CA 4CGYB 3PNYA 4RF0A 2M60A 4DUZM 4IJEA 1IY0A 3HHXA 2YNMD 4LZZA 1NJFA 4I8OA 3NBIA 5FTMA 3GQ4A 2Z3XA 4DV1M 3KP0E 4FCVA 3SHGB 1YUBA 3QWLA 3J80S 2ZANA 2QENA 3AL0C 3KFUG 4LF5M 1DGHA 1JQJC 2FOIC 2DZNB 2NQ8C 1J7KA 3K92A 3CF0A 3LQQA 4II7A 5C18A 4X64M 3AOGA 4DV2M 4R7GA 4OVZA 3TPZA 2C9OA 4IBKA 2G5GX 2CE7A 5EP2A 2HCBA 3T15A 3H4MA 4LG2A 1IN4A 2J7NA 3FUXA 4LFBM 5EP3A 2R45A 1IN6A 1GL6A 5LMNM 2ERCA 3VK8A 2KW0A 2L09A 3LVVA 1D2NA 3DA1A 3HKPA 4MB7A 2RKOA 1KSFX 4IBEA 2QBYB 2Z7JA 4A3VB 4FWHA 4FW9A 3KSXA 5DNYA 4IBCA 1DGFA 3HHZA 3U60B 4W5WA 4DV4M 1XMOM 4AI6A 3KDSE 2YFQA 3GLFB 3HHYA 1IBMM 5ITXE 4P16A 3LQRA 2QCUA 1W5SA 1HQCA 4KO8A 3KP1E 5JI3E 3U5ZB 2RGOA 3U6PA 5E26A 2XSZA 2VQFM 1J09A 1TDZA 2LH0A 3VLFB 3SMSA 4B3SM 1L8QA 3J7BA 3A98B 1EE8A 1XC8A 4MGIE 1XMQM 4JI3M 3U61A 1E32A 3HHWA 5ITRA 2DWNA 2F5NA 2CHVA 1XXHA 3HJSA 3PVSA 4KLNA 5KO3A 4L16A 1L1TA 1Q3BA 4NL4H 1ZAEA 1IBLM 1HR0M 1GVNA 1Z59A 3CTWB 4NSRA 4AW4A 4M9SA 4DR6M 3R9XB 2OPFA 4RF1A 4S12A 5EQTA 1E9RA 3GRVA 1Z5CA 2CHGA 3KSJA 3J2PB 3SMPA 3KS8A 2CEAA 1TH4A 2D7GA 4IBDA 3GQ5A 1JR3A 4AZFA 2V6ZM 4LGMA 5ITQA 1NNJA 2XLJA 4GRIA 4DV7M 1UM8A 4B7FA 3U6MA 3KW6A 2Z4RA 1SXJA 3EIHA 4PDGA 3GO8A 2CV2A 3U6CA 4DV6M 3FD9A 1DGHB 4LJ4A 1JR3D 1R2YA 1I94M 5KQ8A 3U60A 1HNWM 4DR4M 4OVZB 5KQDA 2KRUA 4JYAM 2XZUA 3GRRA 3GLIB 4G4RA 3SBJA 1KFVA 1XWIA 3GLFA 2L7HA 4MGYE 1SXJD 2C96A 2I7NA 5A2QS 1N78A 1QZMA 1DO0A 1IQPA 4AG6A 3U5ZA 2C98A 5EXPA 3U6DA 2CUZA 1N75A 2C9CA 2KRKA 4DV5M 4XBOA 3FTCA 2F5SA 2DWZB 1L2CA 1R7RA 2R46A 3ZCBB 2EO2A 3GLGB 2BNKA 5IWAM 4ITQA 3VKHA 3B9PA 5KPTA 4LFCM 3HU2A 4I5SA 4CHTB 4CISA 5E6JA 1G59A 2BJVA 4LJ7A 2QPAA 2AHMA 2DVWB 4Z8XA 4DV0M 3L2AA 4M9ZA 4B3RM 4G6ZA 3U61B 3M7GA 4DR7M 2KXEA 2UU9M 4JN6A 4LJ8A 1XXHB 4NXNM 4LF8M 3IG8A 4FCWA 4JI4M 4AKHA 4B7HA 3E4RA 4LJAA 3JR4A 4LF7M 3A45A 3RGSA 3U6LA 4JI5M 3K8ZA 2LXEA 1TDHA 3A42A 3UK6A 3ZC7B 3I4YA 4DR3M 1PJJA 1DGBA 3JAMS 4GKJM 4AG5A 2XGNA 2ZM6M 3AOEC 2LWXA 4M0DA 2R62A 4D80A 4HLQA 2HL7A 3Q8XA 4WW0A 1XHBA 1L2DA 4M0WA 2K47A 1E94E 3GRUA 3GLIA 2P5TA 5FTKA 4LGYA 4MGHA 2CHQA 1GKIA 1SXJB 4IBIA 4NOOB 3DFZA 3SFZA 3SYKA 5DYIA 4JI6M 2KA6B 3QAUA 2V1UA 4PD2A 4QOSA 1TH3A 1Z5AA 3M6AA 4Z6YA 3GLGA 3GQ3A 2X4AA 4LF4M 1IY1A 4NSOB 3J81S 2D7EA 4LF6M 4YY3M 2KEBA 2KZUA 1NSFA 4YHHM 3SAUA 4GITA 1G3IA 4IBFA 1GLNA 4DV3M 2XFTA 3L29A 2DWLA 1NNUC 2Y21A 5FLXS 3GRYA 2CV1A 4LJ5A 1G41A 1Q39A 5FSWA 3T1YM 2XZFA 4B3TM 3L27A 4D81A 3U6OA 5LMUM 2XEPA 4JI1M 8CATA 1OFIA 3HJ8A 1K3WA 4L15A 3U6SA 3RFWA 4TUWA 3VFDA 4X62M 3CF2A 1MU5A 3K1JA 1HQYE 4JV5M 5FTJA 1T3TA 4AKIA 1N36M 1S3SA 1FNNA 3TWKA 1QQWA 3TL4X 3TWLA 5EP4A 4EIWA 1XNRM 1HNXM 1PJIA 4LCBA 2Z4SA 4L78A 3L25A 1NY5A 3THGA 3GPPA 3JR5A 4LJ6A 1YSYA 3SATA 3FTDA 5EP1A 5DYGA 4D82A 1NJGA 4AQYM 2E5LM 2M5ZA 2ZAMA 2ZAOA 1HT1E 5GKNA 3VK7A 3MHVC 2HHHM 3HJQA 1IN5A 2UXBM 3PXGA 3U6EA 2C5RA 3M0EA 1I4WA 4RNAA 1DGGA 1QYRA 4IBJA 2L7IA 4DR2M 1HNZM 1IXZA 3AV0A 1K3XA 2UXDM 3D8LA 4MGZE 5KPRA 3GP1A 2VQEM 3FUWA 1YE9A 4B3MM 5ITXA 3GPYA 1N32M 4IIWA 1C1KA 1NHGC 4L4UA 4FWGA 1LV7A 4OW0A 1IN7A 4XGIA 5F3WA 4MH0E 4MGKE 2CFOA 1NY6A 1K82A 4OX9M 4LFAM 3HGIA 3C58A 4BB9A 1R2ZA 2CV0A 3WHLA 4I4LA 4IJFA 4BLCA 3KOXE 2Q2EB 3KOZE 1G8PA 2H1RA 3UGJA 3FKEA 3U6QA 2W82A 7CATA 2DWMA 3OTOM 3I51A 3CF6E 3SARA 3MJ5A 3DZDA 4B08A 3PFIA 4IBBA 5JI2E 2G8LA 2I7PA 4PCZA 2Y20A 2HKJA 2D7HA 4HL4A 1W5TA 1Z5BA 1QANA 5BPVA 2X8AA 3IG5A 2VIIA 4BBAA 2JA2A 1E9SA 4R3DA 4GHAA 4WURA 2C99A 3FTFA 3HU3A 5EXXA 1L2BA 5IREB 2YQZA 4KODA 3FUTA 3KVWA 2XFSA 4QNMA 4FCTA 1X37A 3FYCA 5ITUA 2UUCM 3EIEA 3FUVA 3SC3A 3ZH9B 3AFHA 1H6UA 4G4NA 1TGUA 3AJIB 1NVMA 4DR5M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ITT A;  2F5O A;  4GKK M;  4LF9 M;  3J7A S;  4JYA M;  2XZU A;  2UXC M;  4G4R A;  3SBJ A;  4X62 M;  1KFV A;  2ZBK B;  1MU5 A;  5A2Q S;  2F5Q A;  4JV5 M;  3W0F A;  1N36 M;  3SAW A;  3TWK A;  3TWL A;  3U6D A;  1XNQ M;  1XNR M;  1HNX M;  4DUZ M;  4DV5 M;  1PJI A;  4DR1 M;  2F5S A;  5IT9 S;  1L2C A;  3GPP A;  3JR5 A;  4JI8 M;  3SAT A;  4JI7 M;  3GQ4 A;  4DV1 M;  5ITY A;  4AQY M;  5IWA M;  2E5L M;  1N34 M;  4ITQ A;  3J80 S;  4LFC M;  3VK7 A;  2HHH M;  2F4V M;  4LF5 M;  2OQ4 A;  2UXB M;  1MX0 A;  3U6E A;  4CIS A;  4X64 M;  4DV2 M;  4DR2 M;  4G4O A;  1HNZ M;  1K3X A;  2UXD M;  4DV0 M;  3GP1 A;  4B3R M;  2VQE M;  4B3M M;  4LFB M;  5ITX A;  3GPY A;  4DR7 M;  1N32 M;  4JI0 M;  5LMN M;  3VK8 A;  2UU9 M;  4NRV A;  4NRW A;  4LF8 M;  4NXN M;  4MB7 A;  4JI4 M;  4NXM M;  3JR4 A;  2UUB M;  4LF7 M;  1K82 A;  4OX9 M;  3A45 A;  4LFA M;  3U6L A;  4JI5 M;  4DV4 M;  1FJG M;  1TDH A;  3A42 A;  1XMO M;  3C58 A;  4DR3 M;  1PJJ A;  1I94 M;  3JAM S;  1IBM M;  2UUA M;  1R2Z A;  4GKJ M;  1N33 M;  2ZM6 M;  5ITX E;  1PM5 A;  4G4Q A;  4JI2 M;  5BR8 M;  1L2D A;  3U6P A;  2VQF M;  2Q2E B;  1TDZ A;  2F5P A;  4B3S M;  1XC8 A;  1EE8 A;  1XMQ M;  3U6Q A;  4JI3 M;  3OTO M;  1Q3C A;  4JI6 M;  5ITR A;  2F5N A;  3SAR A;  4PD2 A;  3TWM A;  1L1T A;  1Q3B A;  1IBL M;  1HR0 M;  4PCZ A;  1Z59 A;  3GPX A;  1Z5A A;  2HKJ A;  3A46 A;  1Z5B A;  3GQ3 A;  4LF4 M;  1IBK M;  4DR6 M;  2OPF A;  3J81 S;  4PDI A;  4LF6 M;  3GPU A;  4K0K M;  4YY3 M;  1Z5C A;  4YHH M;  3SAU A;  1J5E M;  3DOA A;  3GQ5 A;  3SAV A;  3T1H M;  4DV3 M;  5ITQ A;  1NNJ A;  2EA0 A;  4DV7 M;  1L2B A;  4KHP M;  3U6M A;  1L1Z A;  5FLX S;  5ITU A;  4PDG A;  4X65 M;  3GO8 A;  1Q39 A;  4X66 M;  2UUC M;  3T1Y M;  3U6C A;  2XZF A;  4DV6 M;  3SAS A;  4B3T M;  3U6O A;  5LMU M;  4G4N A;  4JI1 M;  1K3W A;  4DUY M;  4DR4 M;  1R2Y A;  3U6S A;  1HNW M;  4DR5 M; 
#chains in the Genus database with same CATH topology
 4GKK M;  1JR3 E;  4LF9 M;  4F2L A;  2UXC M;  4GHL A;  1NV9 A;  2ZBK B;  1TTE A;  1QAQ A;  5KPZ A;  3W0L B;  3VKG A;  2F5Q A;  1MJG M;  4I81 A;  1SXJ E;  3W0F A;  1DO2 A;  1GO5 A;  3SAW A;  4GC5 A;  3K2L A;  4QOZ C;  3CGW A;  4GIP A;  1XNQ M;  1TR8 A;  2X49 A;  2QP9 X;  2GQF A;  4DR1 M;  3AOE A;  5IT9 S;  1DV0 A;  2JZ0 A;  1G71 A;  2DNA A;  3FTE A;  4JI8 M;  3RGP A;  4JI7 M;  1QDR A;  5ITY A;  2JNH A;  3C9P A;  4LJ9 A;  1N34 M;  2Y0Q A;  3C3E A;  3GLF E;  1PJQ A;  1VG5 A;  2F4V M;  1C7Y A;  1QVR A;  2YR0 A;  3FUU A;  2OQ4 A;  1MX0 A;  3E9S A;  3FYD A;  4FVM A;  2RRU A;  1NHW C;  4LRT A;  3HU1 A;  4REZ A;  1SXJ C;  2O5R A;  4OU7 A;  4G4O A;  3I01 M;  4GC9 A;  1QZE A;  3SHF A;  3LMM A;  4R71 A;  2FFJ A;  4ZPX A;  3UZU A;  3GLH A;  3KOW E;  2FNA A;  4JI0 M;  4M9X A;  1G4A E;  1R5L A;  4NRV A;  3BOS A;  3B7Z A;  4NRW A;  2EUC A;  2R65 A;  2MGW A;  5FTN A;  4NXM M;  2N35 A;  3VDU A;  2DZO B;  3R8F A;  4KT0 F;  2UUB M;  3UMM A;  3KS4 A;  2XSZ D;  4LY6 A;  4QHS A;  1VDD A;  3BXW A;  1FJG M;  1GL7 A;  1KYI A;  3KOY E;  2DXI A;  2QZ4 A;  3UJN A;  2L4E A;  2UUA M;  1IXS B;  1N33 M;  1PM5 A;  3VDP A;  4G4Q A;  1QAM A;  2QQ8 A;  3I4V A;  5H37 D;  4JI2 M;  3MK6 A;  5BR8 M;  4HEO A;  1ORY B;  3WHK A;  1QAO A;  1Q02 A;  2EKF A;  2F5P A;  3J27 B;  5IZ7 D;  1Y8G A;  2JY6 B;  3L28 A;  2HWJ A;  1IN8 A;  2R4J A;  1Q3C A;  1TH2 A;  4IBG A;  2MJ5 B;  4QNR A;  3NWL A;  1OAO C;  4PT5 A;  5EJC A;  3TWM A;  4LRS A;  3RE8 A;  3T6P A;  4FWD A;  1UFZ A;  2QBY A;  1OFH A;  2MRO B;  5FTL A;  1D0M A;  2VF8 A;  4GMQ A;  3GPX A;  3A46 A;  2DHR A;  1Z6T A;  3TQS A;  3GLI E;  3MMP A;  3T38 A;  1IBK M;  4QHT A;  4AKG A;  2R18 A;  4PDI A;  3AKZ A;  3GPU A;  4K0K M;  1N77 A;  3LVW A;  2LNH C;  2XH9 A;  5EXT A;  1J5E M;  2Y0T A;  3DOA A;  4JXJ A;  3SAV A;  3H4J A;  2FE8 A;  1V92 A;  2BJW A;  3T1H M;  4LZJ A;  2KZS A;  2A5Y B;  1AUA A;  2EA0 A;  2GNO A;  4KHP M;  1OJL A;  2CP8 A;  1L1Z A;  5C1B A;  1MN3 A;  1VEK A;  2LVA A;  4Q7J A;  1HT2 E;  3GLG E;  3V76 A;  3PNV A;  3D8B A;  3HWS A;  2J7O A;  4X65 M;  4GH9 A;  4X66 M;  3SAS A;  1IXR C;  2VF7 A;  2XF3 A;  2DKL A;  3BBZ A;  2R4E A;  2KHH A;  4DUY M;  1WXQ A;  1GJS A;  3L26 A;  3KXE C;  3ILK A;  5ITT A;  1ZQ9 A;  2JUJ A;  2RGH A;  2F5O A;  3J7A S;  2JP7 A;  2EJS A;  1IM2 A;  1WHC A;  2L4F A;  2L6O A;  4FD2 A;  4MM3 B;  5EXS A;  1R6B X;  3GLH B;  3SYL A;  2R44 A;  4L8R C;  1IY2 A;  4B7G A;  3TE6 A;  2V1C A;  4CGY B;  3PNY A;  4RF0 A;  2M60 A;  4DUZ M;  4IJE A;  1IY0 A;  3HHX A;  2YNM D;  4LZZ A;  1NJF A;  2O01 F;  4I8O A;  3NBI A;  5FTM A;  3FRH A;  3GQ4 A;  2Z3X A;  4DV1 M;  1EFU B;  3KP0 E;  4FCV A;  2LTU A;  3SHG B;  1YUB A;  3QWL A;  3J80 S;  2ZAN A;  2QEN A;  3AL0 C;  3KFU G;  1F4I A;  4LF5 M;  1DGH A;  1JQJ C;  2FOI C;  2DZN B;  2NQ8 C;  1J7K A;  3K92 A;  3CF0 A;  3LQQ A;  4II7 A;  5C18 A;  4X64 M;  3AOG A;  4DV2 M;  4R7G A;  4OVZ A;  3TPZ A;  2C9O A;  4IBK A;  2EKK A;  2CE7 A;  2G5G X;  5EP2 A;  2HCB A;  3T15 A;  3H4M A;  2G3Q A;  4F1I A;  2R0I A;  4LG2 A;  1IN4 A;  2J7N A;  3FUX A;  4LFB M;  1NV8 A;  2R45 A;  1IN6 A;  1GL6 A;  5EP3 A;  2BWB A;  2ERC A;  5LMN M;  1WGL A;  2KW0 A;  2L09 A;  3W68 A;  1YLA A;  3VK8 A;  2MR9 A;  3LVV A;  1D2N A;  3DA1 A;  3HKP A;  4MB7 A;  2RKO A;  1KSF X;  1PRB A;  1IFY A;  4IBE A;  2QBY B;  3E46 A;  2Z7J A;  4A3V B;  4FWH A;  4FW9 A;  3KSX A;  4L6V 6;  1V34 A;  5L8R F;  5DNY A;  4IBC A;  1DGF A;  3HHZ A;  2R6F A;  3U60 B;  4W5W A;  3I04 M;  4DV4 M;  1XMO M;  4AI6 A;  3KDS E;  2YFQ A;  1T43 A;  3GLF B;  2LVN C;  3HHY A;  1IBM M;  5ITX E;  2KNV A;  4P16 A;  3LQR A;  2QCU A;  1W5S A;  1HQC A;  1OQY A;  4KO8 A;  3KP1 E;  5JI3 E;  3U5Z B;  2RGO A;  3U6P A;  5E26 A;  2XSZ A;  2VQF M;  1A5T A;  1J09 A;  1TDZ A;  1GAB A;  2LH0 A;  3VLF B;  3SMS A;  4B3S M;  1L8Q A;  3J7B A;  1PJS A;  1EE8 A;  3A98 B;  4MGI E;  1XC8 A;  1XMQ M;  1TF0 B;  4JI3 M;  3U61 A;  1E32 A;  3HHW A;  4P17 A;  5ITR A;  2DWN A;  2F5N A;  1VEG A;  2CHV A;  1XXH A;  3HJS A;  1GJT A;  3PVS A;  4KLN A;  5KO3 A;  3B7Q A;  4L16 A;  1L1T A;  1Q3B A;  4NL4 H;  1ZAE A;  1IBL M;  1HR0 M;  1GVN A;  1Z59 A;  3CTW B;  4NSR A;  4AW4 A;  4M9S A;  3K9O A;  4DR6 M;  3R9X B;  2OPF A;  1T6O A;  4RF1 A;  4S12 A;  4Y28 F;  5EQT A;  2DAK A;  1E9R A;  1Z5C A;  2CHG A;  3GRV A;  3KSJ A;  3J2P B;  3SMP A;  3KS8 A;  1OTR A;  1TH4 A;  2CEA A;  2D7G A;  4IBD A;  3GQ5 A;  1JR3 A;  2WSF F;  1JB0 F;  4AZF A;  2V6Z M;  1ZMW A;  2K0B X;  4LGM A;  5ITQ A;  2XLJ A;  4GRI A;  1NNJ A;  2OOB A;  1UM8 A;  4B7F A;  4DV7 M;  1WIV A;  3U6M A;  3KW6 A;  2Z4R A;  1SXJ A;  3EIH A;  1R4G A;  4PDG A;  3GO8 A;  2CV2 A;  3U6C A;  4DV6 M;  3FD9 A;  1DGH B;  2JY5 A;  4LJ4 A;  1PGY A;  1JR3 D;  1R2Y A;  1I94 M;  5KQ8 A;  3U60 A;  1HNW M;  4DR4 M;  4OVZ B;  5KQD A;  2KRU A;  4JYA M;  2XZU A;  3GRR A;  3GLI B;  4G4R A;  3SBJ A;  1KFV A;  1XWI A;  3GLF A;  2L7H A;  4MGY E;  1SXJ D;  2C96 A;  2I7N A;  5A2Q S;  1N78 A;  1QZM A;  3QYB A;  1DO0 A;  1IQP A;  4AG6 A;  3U5Z A;  3K9P A;  2C98 A;  5EXP A;  1V33 A;  2CUZ A;  1N75 A;  3U6D A;  2C9C A;  2KRK A;  2JXN A;  4DV5 M;  4XBO A;  3FTC A;  2F5S A;  2DWZ B;  2K9D A;  1L2C A;  1R7R A;  2R46 A;  3ZCB B;  2EO2 A;  3GLG B;  2CRU A;  2BNK A;  5IWA M;  2WSE F;  4ITQ A;  5DFL A;  3VKH A;  3B9P A;  4UN2 B;  5KPT A;  4LFC M;  3HU2 A;  4I5S A;  3IHP A;  2LVO C;  2H5X A;  4CHT B;  4CIS A;  5E6J A;  1G59 A;  1HJP A;  2BJV A;  4LJ7 A;  2QPA A;  2AHM A;  2DVW B;  2BWE A;  4Z8X A;  4DV0 M;  1ZMV A;  3L2A A;  4M9Z A;  4B3R M;  2L2D A;  4G6Z A;  3U61 B;  1WJ7 A;  3M7G A;  4DR7 M;  2LVP C;  2KXE A;  2UU9 M;  3QYE A;  3HX3 A;  4JN6 A;  4LJ8 A;  1XXH B;  4NXN M;  4LF8 M;  2KDL A;  3IG8 A;  4FCW A;  4JI4 M;  4AKH A;  4B7H A;  3HZJ A;  3E4R A;  4LJA A;  3JR4 A;  4GEW A;  4LF7 M;  3A45 A;  1QUT A;  3RGS A;  3U6L A;  4JI5 M;  3K8Z A;  2LXE A;  1TDH A;  3A42 A;  3W67 A;  3UK6 A;  2OOA A;  3ZC7 B;  1P3Q Q;  3I4Y A;  4DR3 M;  1PJJ A;  1DGB A;  3JAM S;  4GKJ M;  3GLH E;  2XGN A;  4AG5 A;  2ZM6 M;  3AOE C;  2LWX A;  4M0D A;  2R62 A;  4D80 A;  4HLQ A;  2HL7 A;  3Q8X A;  4WW0 A;  1XHB A;  1L2D A;  4M0W A;  2K47 A;  1E94 E;  3GRU A;  3GLI A;  2P5T A;  5FTK A;  4LGY A;  2LVQ D;  2WZJ A;  1BVS A;  4MGH A;  2CHQ A;  1GKI A;  1SXJ B;  4IBI A;  4NOO B;  3DFZ A;  3SFZ A;  3SYK A;  3E21 A;  1SG9 A;  2KA6 B;  2QHO B;  2ZTD A;  3QAU A;  5DYI A;  4JI6 M;  2V1U A;  1WR1 B;  4PD2 A;  4QOS A;  1ZV1 A;  1LTM A;  1TH3 A;  1Z5A A;  2JZ1 A;  3M6A A;  4Z6Y A;  3GLG A;  1OKS A;  2X4A A;  3GQ3 A;  4LF4 M;  1IY1 A;  2LHG A;  4NSO B;  3J81 S;  3LCU A;  2MH8 A;  2D7E A;  2FH0 A;  4LF6 M;  4YY3 M;  1XB2 B;  1QDT A;  2KEB A;  2KZU A;  1NSF A;  4YHH M;  3SAU A;  4GIT A;  3NBX X;  1G3I A;  1RU3 A;  1GLN A;  3LCV B;  4IBF A;  4DV3 M;  2XFT A;  3L29 A;  2DWL A;  3HY5 A;  1OIP A;  1NNU C;  2Y21 A;  5FLX S;  3FRI A;  2LHC A;  3GRY A;  3FE3 A;  1G41 A;  4LJ5 A;  2CV1 A;  1Q39 A;  5FSW A;  3T1Y M;  2XZF A;  4B3T M;  1AIP C;  3L27 A;  4D81 A;  3U6O A;  5LMU M;  2XEP A;  4JI1 M;  8CAT A;  1OFI A;  2KNA A;  3HJ8 A;  1K3W A;  4L15 A;  3U6S A;  3RFW A;  4TUW A;  3VFD A;  2CWB A;  4X62 M;  3CF2 A;  1MU5 A;  3K1J A;  1HQY E;  4JV5 M;  5FTJ A;  1T3T A;  4AKI A;  1N36 M;  4DBG B;  1S3S A;  1FNN A;  1PJT A;  2LBC A;  1QQW A;  3TWK A;  3TL4 X;  3TWL A;  5EP4 A;  1D0K A;  4RKU F;  4EIW A;  2DI0 A;  1HNX M;  1XNR M;  1PJI A;  4LCB A;  2DZL A;  2Z4S A;  4L78 A;  3L25 A;  4CIZ A;  1NY5 A;  3THG A;  3GPP A;  3JR5 A;  4LJ6 A;  1NO1 A;  1YSY A;  3SAT A;  3FTD A;  5EP1 A;  5DYG A;  4D82 A;  1NJG A;  4AQY M;  2E5L M;  2M5Z A;  2ZAM A;  2ZAO A;  2ZTC A;  1HT1 E;  5GKN A;  3VK7 A;  3MHV C;  2HHH M;  3HJQ A;  1IN5 A;  2QSF X;  2VDB B;  2UXB M;  2Z8Y M;  3PXG A;  3U6E A;  3M0E A;  1I4W A;  4RNA A;  2JY7 A;  2C5R A;  1EIJ A;  1DGG A;  1QYR A;  2JY8 A;  4IBJ A;  2L7I A;  4XK8 F;  4DR2 M;  1HNZ M;  2B3T A;  1IXZ A;  2HAK A;  3AV0 A;  1K3X A;  2OO9 A;  2DAE A;  3D8L A;  4MGZ E;  2UXD M;  2O25 A;  5KPR A;  3GP1 A;  2VQE M;  3FUW A;  1YE9 A;  4B3M M;  2DAI A;  5ITX A;  3GPY A;  1N32 M;  2APL A;  4IIW A;  1C1K A;  1NHG C;  4L4U A;  1VEJ A;  1OAI A;  4FWG A;  1LV7 A;  1VQ1 A;  4OW0 A;  1IN7 A;  4XGI A;  2WSC F;  5F3W A;  4MH0 E;  4MGK E;  2CFO A;  3B89 A;  1ZMU A;  1NY6 A;  1K82 A;  4OX9 M;  4LFA M;  2QNJ A;  3HGI A;  3C58 A;  4BB9 A;  3C3D A;  1R2Z A;  2CV0 A;  3WHL A;  4I4L A;  3LW5 F;  1CUK A;  1QUS A;  4IJF A;  4BLC A;  3B7N A;  3Q8G A;  3KOX E;  4ANR A;  2Q2E B;  2DHY A;  3KOZ E;  1G8P A;  2H1R A;  3UGJ A;  3FKE A;  3U6Q A;  2W82 A;  7CAT A;  2KNZ A;  3OTO M;  3I51 A;  3CF6 E;  2DWM A;  1D0L A;  3SAR A;  2JWS A;  3DZD A;  3MJ5 A;  4B08 A;  3PFI A;  4IBB A;  5JI2 E;  4G3O A;  2G8L A;  2I7P A;  2DAG A;  4PCZ A;  4WP2 A;  2DEN A;  2Y20 A;  3ZQJ A;  2HKJ A;  2D7H A;  4HL4 A;  1W5T A;  1Z5B A;  1QAN A;  2J5Y A;  5BPV A;  2X8A A;  2K6B A;  3IG5 A;  1VDL A;  2VII A;  3F92 A;  4BBA A;  1IXS A;  1OIZ A;  2JA2 A;  1E9S A;  2DAM A;  4R3D A;  4GHA A;  1XXH E;  2C99 A;  4WUR A;  3FTF A;  4CJ6 A;  3HU3 A;  5EXX A;  1L2B A;  5IRE B;  2YQZ A;  4KOD A;  3FUT A;  3KVW A;  2XFS A;  4NC6 A;  4QNM A;  4FCT A;  1X37 A;  3FYC A;  5ITU A;  2UUC M;  3EIE A;  2FS1 A;  3FUV A;  3SC3 A;  3ZH9 B;  1WGN A;  3AFH A;  1H6U A;  4G4N A;  1TGU A;  3AJI B;  1NVM A;  3IEC A;  3B74 A;  4DR5 M; 
#chains in the Genus database with same CATH homology
 4GKK M;  4LF9 M;  2UXC M;  4GHL A;  2ZBK B;  1QAQ A;  5KPZ A;  3W0L B;  3VKG A;  2F5Q A;  4I81 A;  1SXJ E;  3W0F A;  1DO2 A;  3SAW A;  4GC5 A;  3K2L A;  4QOZ C;  4GIP A;  1XNQ M;  2X49 A;  2QP9 X;  4DR1 M;  3AOE A;  5IT9 S;  3FTE A;  4JI8 M;  3RGP A;  4JI7 M;  5ITY A;  1N34 M;  4LJ9 A;  2Y0Q A;  2F4V M;  1QVR A;  2YR0 A;  3FUU A;  2OQ4 A;  1MX0 A;  3E9S A;  3FYD A;  4FVM A;  4LRT A;  1NHW C;  3HU1 A;  4REZ A;  1SXJ C;  2O5R A;  4OU7 A;  4G4O A;  4GC9 A;  3SHF A;  3LMM A;  2FFJ A;  4ZPX A;  3UZU A;  3GLH A;  3KOW E;  2FNA A;  4JI0 M;  4M9X A;  1G4A E;  4NRV A;  4NRW A;  3BOS A;  2EUC A;  2R65 A;  5FTN A;  4NXM M;  3VDU A;  2DZO B;  3R8F A;  2UUB M;  3UMM A;  3KS4 A;  2XSZ D;  4LY6 A;  4QHS A;  1VDD A;  1FJG M;  1GL7 A;  1KYI A;  3KOY E;  2DXI A;  2QZ4 A;  3UJN A;  2UUA M;  1N33 M;  1IXS B;  1PM5 A;  3VDP A;  4G4Q A;  1QAM A;  3I4V A;  5H37 D;  4JI2 M;  3MK6 A;  5BR8 M;  3WHK A;  1ORY B;  1QAO A;  2F5P A;  3J27 B;  5IZ7 D;  3L28 A;  1IN8 A;  2R4J A;  1Q3C A;  1TH2 A;  4IBG A;  4QNR A;  3NWL A;  4PT5 A;  5EJC A;  3TWM A;  4LRS A;  3RE8 A;  4FWD A;  2QBY A;  1OFH A;  5FTL A;  4GMQ A;  3GPX A;  3A46 A;  2DHR A;  1Z6T A;  3TQS A;  4AKG A;  3T38 A;  1IBK M;  4QHT A;  2R18 A;  4PDI A;  3AKZ A;  3GPU A;  4K0K M;  1N77 A;  3LVW A;  2LNH C;  2XH9 A;  5EXT A;  1J5E M;  2Y0T A;  3DOA A;  4JXJ A;  3SAV A;  2FE8 A;  2BJW A;  3T1H M;  4LZJ A;  2KZS A;  2A5Y B;  2EA0 A;  4KHP M;  1OJL A;  1L1Z A;  5C1B A;  1HT2 E;  3PNV A;  3D8B A;  3HWS A;  2J7O A;  4X65 M;  4GH9 A;  4X66 M;  3SAS A;  1IXR C;  2XF3 A;  2R4E A;  4DUY M;  1WXQ A;  3L26 A;  3KXE C;  3ILK A;  5ITT A;  1ZQ9 A;  2RGH A;  2F5O A;  3J7A S;  1IM2 A;  2L6O A;  4FD2 A;  4MM3 B;  5EXS A;  1R6B X;  3GLH B;  3SYL A;  4L8R C;  1IY2 A;  4B7G A;  3TE6 A;  2V1C A;  4CGY B;  3PNY A;  4RF0 A;  2M60 A;  4DUZ M;  4IJE A;  1IY0 A;  3HHX A;  2YNM D;  4LZZ A;  1NJF A;  4I8O A;  3NBI A;  5FTM A;  3GQ4 A;  2Z3X A;  4DV1 M;  3KP0 E;  4FCV A;  3SHG B;  1YUB A;  3QWL A;  3J80 S;  2ZAN A;  2QEN A;  3AL0 C;  3KFU G;  4LF5 M;  1DGH A;  1JQJ C;  2FOI C;  2DZN B;  2NQ8 C;  1J7K A;  3K92 A;  3CF0 A;  3LQQ A;  4II7 A;  5C18 A;  4X64 M;  3AOG A;  4DV2 M;  4R7G A;  4OVZ A;  3TPZ A;  2C9O A;  4IBK A;  2G5G X;  2CE7 A;  5EP2 A;  2HCB A;  3T15 A;  3H4M A;  4LG2 A;  1IN4 A;  2J7N A;  3FUX A;  4LFB M;  5EP3 A;  2R45 A;  1IN6 A;  1GL6 A;  5LMN M;  2ERC A;  3VK8 A;  2KW0 A;  2L09 A;  3LVV A;  1D2N A;  3DA1 A;  3HKP A;  4MB7 A;  2RKO A;  1KSF X;  4IBE A;  2QBY B;  2Z7J A;  4A3V B;  4FWH A;  4FW9 A;  3KSX A;  5DNY A;  4IBC A;  1DGF A;  3HHZ A;  3U60 B;  4W5W A;  4DV4 M;  1XMO M;  4AI6 A;  3KDS E;  2YFQ A;  3GLF B;  3HHY A;  1IBM M;  5ITX E;  4P16 A;  3LQR A;  2QCU A;  1W5S A;  1HQC A;  4KO8 A;  3KP1 E;  5JI3 E;  3U5Z B;  2RGO A;  3U6P A;  5E26 A;  2XSZ A;  2VQF M;  1J09 A;  1TDZ A;  2LH0 A;  3VLF B;  3SMS A;  4B3S M;  1L8Q A;  3J7B A;  3A98 B;  1EE8 A;  1XC8 A;  4MGI E;  1XMQ M;  4JI3 M;  3U61 A;  1E32 A;  3HHW A;  5ITR A;  2DWN A;  2F5N A;  2CHV A;  1XXH A;  3HJS A;  3PVS A;  4KLN A;  5KO3 A;  4L16 A;  1L1T A;  1Q3B A;  4NL4 H;  1ZAE A;  1IBL M;  1HR0 M;  1GVN A;  1Z59 A;  3CTW B;  4NSR A;  4AW4 A;  4M9S A;  4DR6 M;  3R9X B;  2OPF A;  4RF1 A;  4S12 A;  5EQT A;  1E9R A;  3GRV A;  1Z5C A;  2CHG A;  3KSJ A;  3J2P B;  3SMP A;  3KS8 A;  2CEA A;  1TH4 A;  2D7G A;  4IBD A;  3GQ5 A;  1JR3 A;  4AZF A;  2V6Z M;  4LGM A;  5ITQ A;  1NNJ A;  2XLJ A;  4GRI A;  4DV7 M;  1UM8 A;  4B7F A;  3U6M A;  3KW6 A;  2Z4R A;  1SXJ A;  3EIH A;  4PDG A;  3GO8 A;  2CV2 A;  3U6C A;  4DV6 M;  3FD9 A;  1DGH B;  4LJ4 A;  1JR3 D;  1R2Y A;  1I94 M;  5KQ8 A;  3U60 A;  1HNW M;  4DR4 M;  4OVZ B;  5KQD A;  2KRU A;  4JYA M;  2XZU A;  3GRR A;  3GLI B;  4G4R A;  3SBJ A;  1KFV A;  1XWI A;  3GLF A;  2L7H A;  4MGY E;  1SXJ D;  2C96 A;  2I7N A;  5A2Q S;  1N78 A;  1QZM A;  1DO0 A;  1IQP A;  4AG6 A;  3U5Z A;  2C98 A;  5EXP A;  3U6D A;  2CUZ A;  1N75 A;  2C9C A;  2KRK A;  4DV5 M;  4XBO A;  3FTC A;  2F5S A;  2DWZ B;  1L2C A;  1R7R A;  2R46 A;  3ZCB B;  2EO2 A;  3GLG B;  2BNK A;  5IWA M;  4ITQ A;  3VKH A;  3B9P A;  5KPT A;  4LFC M;  3HU2 A;  4I5S A;  4CHT B;  4CIS A;  5E6J A;  1G59 A;  2BJV A;  4LJ7 A;  2QPA A;  2AHM A;  2DVW B;  4Z8X A;  4DV0 M;  3L2A A;  4M9Z A;  4B3R M;  4G6Z A;  3U61 B;  3M7G A;  4DR7 M;  2KXE A;  2UU9 M;  4JN6 A;  4LJ8 A;  1XXH B;  4NXN M;  4LF8 M;  3IG8 A;  4FCW A;  4JI4 M;  4AKH A;  4B7H A;  3E4R A;  4LJA A;  3JR4 A;  4LF7 M;  3A45 A;  3RGS A;  3U6L A;  4JI5 M;  3K8Z A;  2LXE A;  1TDH A;  3A42 A;  3UK6 A;  3ZC7 B;  3I4Y A;  4DR3 M;  1PJJ A;  1DGB A;  3JAM S;  4GKJ M;  4AG5 A;  2XGN A;  2ZM6 M;  3AOE C;  2LWX A;  4M0D A;  2R62 A;  4D80 A;  4HLQ A;  2HL7 A;  3Q8X A;  4WW0 A;  1XHB A;  1L2D A;  4M0W A;  2K47 A;  1E94 E;  3GRU A;  3GLI A;  2P5T A;  5FTK A;  4LGY A;  4MGH A;  2CHQ A;  1GKI A;  1SXJ B;  4IBI A;  4NOO B;  3DFZ A;  3SFZ A;  3SYK A;  5DYI A;  4JI6 M;  2KA6 B;  3QAU A;  2V1U A;  4PD2 A;  4QOS A;  1TH3 A;  1Z5A A;  3M6A A;  4Z6Y A;  3GLG A;  3GQ3 A;  2X4A A;  4LF4 M;  1IY1 A;  4NSO B;  3J81 S;  2D7E A;  4LF6 M;  4YY3 M;  2KEB A;  2KZU A;  1NSF A;  4YHH M;  3SAU A;  4GIT A;  1G3I A;  4IBF A;  1GLN A;  4DV3 M;  2XFT A;  3L29 A;  2DWL A;  1NNU C;  2Y21 A;  5FLX S;  3GRY A;  2CV1 A;  4LJ5 A;  1G41 A;  1Q39 A;  5FSW A;  3T1Y M;  2XZF A;  4B3T M;  3L27 A;  4D81 A;  3U6O A;  5LMU M;  2XEP A;  4JI1 M;  8CAT A;  1OFI A;  3HJ8 A;  1K3W A;  4L15 A;  3U6S A;  3RFW A;  4TUW A;  3VFD A;  4X62 M;  3CF2 A;  1MU5 A;  3K1J A;  1HQY E;  4JV5 M;  5FTJ A;  1T3T A;  4AKI A;  1N36 M;  1S3S A;  1FNN A;  3TWK A;  1QQW A;  3TL4 X;  3TWL A;  5EP4 A;  4EIW A;  1XNR M;  1HNX M;  1PJI A;  4LCB A;  2Z4S A;  4L78 A;  3L25 A;  1NY5 A;  3THG A;  3GPP A;  3JR5 A;  4LJ6 A;  1YSY A;  3SAT A;  3FTD A;  5EP1 A;  5DYG A;  4D82 A;  1NJG A;  4AQY M;  2E5L M;  2M5Z A;  2ZAM A;  2ZAO A;  1HT1 E;  5GKN A;  3VK7 A;  3MHV C;  2HHH M;  3HJQ A;  1IN5 A;  2UXB M;  3PXG A;  3U6E A;  2C5R A;  3M0E A;  1I4W A;  4RNA A;  1DGG A;  1QYR A;  4IBJ A;  2L7I A;  4DR2 M;  1HNZ M;  1IXZ A;  3AV0 A;  1K3X A;  2UXD M;  3D8L A;  4MGZ E;  5KPR A;  3GP1 A;  2VQE M;  3FUW A;  1YE9 A;  4B3M M;  5ITX A;  3GPY A;  1N32 M;  4IIW A;  1C1K A;  1NHG C;  4L4U A;  4FWG A;  1LV7 A;  4OW0 A;  1IN7 A;  4XGI A;  5F3W A;  4MH0 E;  4MGK E;  2CFO A;  1NY6 A;  1K82 A;  4OX9 M;  4LFA M;  3HGI A;  3C58 A;  4BB9 A;  1R2Z A;  2CV0 A;  3WHL A;  4I4L A;  4IJF A;  4BLC A;  3KOX E;  2Q2E B;  3KOZ E;  1G8P A;  2H1R A;  3UGJ A;  3FKE A;  3U6Q A;  2W82 A;  7CAT A;  2DWM A;  3OTO M;  3I51 A;  3CF6 E;  3SAR A;  3MJ5 A;  3DZD A;  4B08 A;  3PFI A;  4IBB A;  5JI2 E;  2G8L A;  2I7P A;  4PCZ A;  2Y20 A;  2HKJ A;  2D7H A;  4HL4 A;  1W5T A;  1Z5B A;  1QAN A;  5BPV A;  2X8A A;  3IG5 A;  2VII A;  4BBA A;  2JA2 A;  1E9S A;  4R3D A;  4GHA A;  4WUR A;  2C99 A;  3FTF A;  3HU3 A;  5EXX A;  1L2B A;  5IRE B;  2YQZ A;  4KOD A;  3FUT A;  3KVW A;  2XFS A;  4QNM A;  4FCT A;  1X37 A;  3FYC A;  5ITU A;  2UUC M;  3EIE A;  3FUV A;  3SC3 A;  3ZH9 B;  3AFH A;  1H6U A;  4G4N A;  1TGU A;  3AJI B;  1NVM A;  4DR5 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...