4DV2M

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 24
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4dv2M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4dv2M02
5IT9S 3U6PA 4X64M 2UUAM 4DV0M 1MU5A 3GP1A 4DR4M 4NXMM 4KHPM 1Z59A 1K3WA 4JI5M 1L2CA 2F5OA 1Q39A 1XNQM 2UUBM 4DR6M 3A46A 1KFVA 1K3XA 1L1TA 4JI6M 5IWAM 1XNRM 4LFBM 1N33M 4DV1M 4JI8M 2HKJA 3GO8A 1PJIA 4JI1M 3A45A 3VK8A 1L1ZA 1PJJA 2UXCM 1R2ZA 3SAWA 1XMQM 3U6EA 4GKKM 3U6CA 4G4RA 2F5PA 1J5EM 3TWLA 1L2BA 2VQFM 1Q3CA 4G4NA 2UXBM 4DV4M 3J81S 4LF4M 4MB7A 1HNZM 2EA0A 3GPXA 4DV5M 3SASA 1Z5CA 5LMUM 4B3SM 3U6OA 4K0KM 1N32M 4LF7M 1TDHA 3JR5A 4DUYM 4YY3M 3JAMS 1HR0M 3GPUA 1R2YA 1K82A 5ITXA 3SATA 4DV3M 2OQ4A 3OTOM 4AQYM 5A2QS 3DOAA 4LF6M 3GQ4A 4OX9M 4NXNM 1L2DA 4PCZA 4DUZM 4DV7M 2UU9M 4PDIA 2XZUA 4PD2A 4JI7M 4JV5M 3GQ3A 5ITRA 4DR1M 1IBMM 4X65M 3GPPA 4JI4M 3U6LA 3SAUA 3J80S 2Q2EB 1I94M 1XC8A 3GPYA 4DV2M 5LMNM 4DR3M 1N34M 1Z5AA 2UXDM 1Z5BA 4JI3M 4DR5M 3U6MA 3VK7A 4LF9M 5ITUA 5FLXS 1N36M 4DR2M 1XMOM 5ITTA 1HNXM 1IBLM 4YHHM 4PDGA 3TWKA 1MX0A 3U6QA 4ITQA 3U6SA 4NRWA 1HNWM 1IBKM 3SARA 4X62M 4B3MM 1FJGM 4JI2M 2F5SA 3GQ5A 1PM5A 4DV6M 4JI0M 3JR4A 5ITXE 2F5NA 2HHHM 1TDZA 2XZFA 4GKJM 2F5QA 4DR7M 1Q3BA 2OPFA 4LFAM 4LF8M 2ZBKB 1NNJA 4G4QA 5ITQA 4NRVA 3SAVA 4X66M 4B3TM 4CISA 4LFCM 3T1HM 1EE8A 2ZM6M 4G4OA 4B3RM 3C58A 3A42A 3T1YM 4JYAM 2UUCM 2F4VM 5BR8M 3J7AS 3TWMA 2VQEM 3U6DA 4LF5M 2E5LM 5ITYA 3W0FA 3SBJA
chains in the Genus database with same CATH superfamily
3TL4X 2VIIA 3FYCA 5EP1A 3W0LB 4X64M 3F92A 2V1CA 1MU5A 2LXEA 3FUWA 2C96A 4LJ7A 1K3WA 2QNJA 4NXMM 1OTRA 1VQ1A 2H1RA 3AFHA 3PFIA 1QZMA 2XFTA 4DR6M 1KYIA 4IBCA 4Z6YA 1R7RA 1IN7A 2BWBA 2YR0A 2N35A 3MK6A 3VFDA 1XNRM 4RF0A 2HKJA 2G3QA 2XFSA 5BPVA 2XLJA 1PRBA 2QCUA 3GO8A 1PJIA 3SFZA 1GL7A 2EKFA 1L1ZA 4LJ8A 1FNNA 3R8FA 2DZNB 2QSFX 2EO2A 1UFZA 2J7OA 2JY5A 2DAGA 1YE9A 1XXHB 3B7QA 3U61B 3U6CA 2M5ZA 4M0WA 2HAKA 2F5PA 2ZTCA 2DVWB 2K9DA 1L2BA 2VQFM 1XXHE 2G8LA 2JY7A 3FD9A 4UN2B 2FE8A 4KODA 4R7GA 3HU3A 4XBOA 2JY6B 4TUWA 3UMMA 1J7KA 3GLHA 1WR1B 1GVNA 4LF7M 3V76A 2DWLA 2Y0QA 3M6AA 2HCBA 1TDHA 4LZJA 1E94E 4P17A 4CHTB 3LVVA 4AI6A 1HR0M 4BBAA 2LVQD 5DNYA 4IBJA 2KHHA 1QANA 1K82A 5FTMA 4B08A 1H6UA 3SATA 2C9OA 4XGIA 2K47A 2R46A 3DOAA 1NJGA 3LW5F 1OJLA 2JWSA 3HGIA 1ZQ9A 2FH0A 3M0EA 4BB9A 3CF2A 3I01M 3I4VA 4DUZM 3CF0A 4FW9A 4MGYE 3RE8A 4DV7M 2UU9M 4PD2A 2OO9A 2DAEA 5GKNA 5ITRA 1GABA 3RFWA 2CE7A 1OQYA 3GPPA 2MH8A 4JI4M 3L25A 3H4MA 3J80S 5KQ8A 3I4YA 2EJSA 1OAOC 2Q2EB 3KOWE 3NBIA 4LJAA 1TH4A 1NY6A 4WP2A 1XC8A 4FVMA 1N78A 2ERCA 1JR3A 1AIPC 5LMNM 1NV9A 4MM3B 4DR5M 5EP3A 2R18A 3GLHB 3FKEA 5ITTA 1XWIA 1JB0F 4R3DA 3BOSA 3GLHE 1MX0A 4KLNA 4AG5A 3SARA 5E26A 3KP0E 1RU3A 5FTLA 2FFJA 4DV6M 5E6JA 2YQZA 2DHRA 3K1JA 2QP9X 4LJ4A 2HHHM 5EP4A 3AKZA 4GHLA 4W5WA 2F5QA 2R6FA 4II7A 2DXIA 2RGOA 2CWBA 2OPFA 4LF8M 2NQ8C 3TPZA 2KEBA 1NJFA 5FSWA 5ITQA 1NHWC 4NRVA 2CHVA 2V1UA 1ORYB 4CISA 3T1HM 2X8AA 1ZV1A 4LJ6A 4JYAM 3GLGA 2X4AA 1HT2E 2LTUA 2W82A 3UGJA 3L29A 1WJ7A 4LF5M 1TGUA 5EXXA 4HL4A 2E5LM 4QOSA 1DO2A 3U61A 1E32A 2D7GA 1JR3E 4OW0A 1V34A 1E9RA 5DYGA 2C5RA 5IZ7D 2UUAM 4DV0M 3GP1A 4KHPM 1Z59A 4LFBM 3B7ZA 1XNQM 3NWLA 3VKGA 2FS1A 1TTEA 2L6OA 3A46A 1E9SA 3KOXE 3VDUA 1K3XA 3Q8GA 1WHCA 2JZ1A 2XF3A 3AOEC 3SHGB 4DV1M 3KS4A 1N33M 2JA2A 2DWMA 5IREB 3M7GA 3THGA 4JI1M 3C3EA 3VK8A 1V33A 3Q8XA 1Y8GA 1PJJA 4OU7A 2UXCM 1R2ZA 3AJIB 5H37D 3SAWA 5F3WA 4GMQA 2HL7A 2LHCA 4JXJA 1G59A 2C99A 1QQWA 3DFZA 1VEJA 3TWLA 3B74A 1J5EM 2ZANA 2UXBM 4DV4M 4LF4M 3GLGB 2CHQA 1ZMVA 2G5GX 3AV0A 4PT5A 4IBFA 2DWZB 1NY5A 1HT1E 2KA6B 4MGIE 4L15A 3SASA 5LMUM 1DV0A 3MHVC 5C1BA 3GLGE 2P5TA 2R4JA 3K9PA 1SXJD 1VEKA 4Z8XA 1IFYA 1D0KA 2KRKA 3KOZE 4M9SA 4DUYM 4L6V6 2R65A 4WW0A 3QWLA 1D0MA 3JAMS 3ZCBB 2R45A 2MROB 5EXPA 3GPUA 1R2YA 4IBEA 1PGYA 4KT0F 1N77A 1QUTA 2D7HA 2OQ4A 2APLA 2QHOB 2LBCA 2MGWA 3FUVA 4NXNM 3VDPA 2DAKA 1UM8A 2L2DA 1L2DA 3GRUA 5C18A 5KPZA 4PDIA 4ANRA 2JXNA 4GC5A 2QPAA 1IBMM 3B89A 3IG8A 3B9PA 3K2LA 1WXQA 2O5RA 3K92A 4I4LA 3U6LA 1TH3A 1YSYA 3HU2A 1I94M 4IBKA 3GPYA 1G41A 2QENA 4DV2M 4RNAA 1QYRA 3E9SA 3IECA 3HHWA 2I7PA 3U6MA 2L7IA 1OFIA 4IBBA 2DAIA 4MGZE 4A3VB 3EIEA 3KFUG 2KNZA 2WSEF 2VDBB 2XGNA 3I04M 2K0BX 4WURA 2J5YA 3TWKA 3SMSA 4ITQA 4D81A 1HNWM 3FYDA 4IIWA 2XEPA 3UZUA 1IBKM 1D0LA 4X62M 4B3MM 4RKUF 1IXZA 4JI2M 4KO8A 3PNYA 3FRHA 1G4AE 1QUSA 3LQQA 3KSXA 4L4UA 4D80A 1GLNA 4LZZA 1TR8A 4GKJM 1LV7A 3KP1E 1HQYE 4GRIA 4NSRA 3NBXX 2AHMA 2OOBA 3FTDA 4B7FA 2EKKA 1NNJA 1P3QQ 1PJTA 4B3RM 1T3TA 4LJ9A 4G4OA 4M9ZA 3A42A 3T1YM 5DFLA 2C9CA 2F4VM 4B7HA 3J7AS 3TWMA 2VQEM 3U6DA 1GO5A 2XSZA 2EUCA 5ITYA 3HHXA 3IHPA 5JI2E 4ZPXA 2A5YB 3U6PA 4RF1A 3I51A 5FTNA 2DNAA 1PJQA 2L09A 3HU1A 5EXSA 4AZFA 4JI5M 1DGHA 2D7EA 2F5OA 2LWXA 4QHTA 1VDLA 3UK6A 2OOAA 1KFVA 4JI6M 3HKPA 1NNUC 2ZAOA 1VEGA 3E21A 4GEWA 1ZMUA 3VKHA 4IJFA 4JI8M 3GRRA 4AKGA 1HQCA 1MJGM 2Y21A 3LVWA 4LRTA 4IJEA 1Q02A 2LHGA 4LJ5A 4FWDA 3T38A 1OIPA 4GKKM 2CEAA 2Z8YM 1Q3CA 2C98A 3AOEA 3J81S 4MB7A 2L4FA 2CV2A 4QNMA 4HEOA 1HNZM 3HY5A 4LCBA 2EA0A 1YLAA 1IY0A 2JNHA 1I4WA 8CATA 2DZLA 1LTMA 4Q7JA 4LGMA 3U6OA 1JQJC 1QDTA 4B3SM 1N32M 1F4IA 3K9OA 4BLCA 3SC3A 2VF8A 2Y20A 1SXJC 3JR5A 5EJCA 4YY3M 4FWGA 3LCUA 1DGHB 2BNKA 1L8QA 2FNAA 3T15A 3U5ZA 1DO0A 2Z3XA 1JR3D 3U60A 2J7NA 2DHYA 4CJ6A 4DV3M 3SYKA 2GNOA 4IBIA 4L78A 3ZQJA 4CIZA 4NL4H 3OTOM 5L8RF 1N75A 2GQFA 5FTKA 3GQ4A 2DWNA 4OX9M 2BWEA 4PCZA 2QBYA 1IN4A 1VG5A 4AW4A 2XZUA 3AL0C 4AKHA 3FTCA 1IN8A 3PNVA 1TH2A 2FOIC 2ZAMA 2YFQA 3QYEA 2JP7A 2RGHA 1OFHA 1C1KA 2DKLA 3TQSA 2KNAA 1G8PA 2L4EA 3HJQA 4DR3M 2UXDM 3FRIA 4JI3M 4F2LA 2LVOC 1QVRA 2LVNC 4JN6A 2MJ5B 3H4JA 4DR2M 1HNXM 4LF9M 1IBLM 1WIVA 2R44A 1XB2B 1OIZA 3U6QA 3FUUA 3U6SA 3L28A 2QQ8A 3U5ZB 3B7NA 4FD2A 5EQTA 2F5SA 3U60B 2HWJA 1V92A 3J7BA 2CP8A 2R0IA 4XK8F 1PM5A 1GJSA 3GLFA 1W5SA 3L2AA 3K8ZA 4FCVA 3E4RA 2F5NA 4G6ZA 2XZFA 4LG2A 2QBYB 1D2NA 1Q3BA 3LMMA 1QAMA 1QZEA 3J27B 1T6OA 2DI0A 3HHZA 4IBGA 2JY8A 4P16A 2RRUA 4X66M 1OAIA 3WHKA 3GLIA 1EE8A 1S3SA 4B3TM 4Y28F 2KDLA 3SYLA 2UUCM 5JI3E 4MH0E 3L26A 2JUJA 2LH0A 4I8OA 5EP2A 2DENA 1HJPA 1XHBA 2VF7A 4LFCM 1NV8A 3W0FA 2CRUA 1R5LA 3SBJA 2O01F 1NO1A 2KW0A 2L7HA 3R9XB 5IT9S 1G71A 5FTJA 3DA1A 4DR4M 3HHYA 3D8LA 4NOOB 2XH9A 1L2CA 2Z4RA 1Q39A 2BJWA 1IN5A 3KW6A 3TE6A 1W5TA 2UUBM 1L1TA 5IWAM 3FUTA 3HZJA 1X37A 2O25A 2KXEA 1IY2A 4FWHA 1T43A 4GC9A 3ZC7B 4D82A 2V6ZM 3A45A 3L27A 7CATA 3GLFB 3KS8A 3HX3A 5EXTA 2KZSA 3SHFA 3IG5A 2QZ4A 1DGFA 3MJ5A 3CTWB 3GLFE 2LNHC 1XMQM 3U6EA 3W67A 4G4RA 3UJNA 1EIJA 3CGWA 4QHSA 1KSFX 2R4EA 1GKIA 2MR9A 2YNMD 3GLIB 1IM2A 4G4NA 3QYBA 5KQDA 3HWSA 3ZH9B 3PXGA 1VDDA 1MN3A 1NVMA 4MGKE 3GLIE 1DGBA 4GH9A 3GPXA 3T6PA 4GITA 1WGLA 1Z5CA 4DV5M 2BJVA 3C9PA 4K0KM 1G3IA 2Y0TA 2DAMA 3RGSA 3FTFA 3KOYE 2I7NA 2KNVA 1GL6A 1Z6TA 2KZUA 2LVAA 2LVPC 3CF6E 1NSFA 4LRSA 4M0DA 3HJSA 4FCTA 4NC6A 5ITXA 4L16A 3SMPA 4IBDA 3EIHA 2CV0A 4AQYM 1IXSA 4DBGB 5A2QS 1BVSA 1J09A 4LF6M 3VLFB 4OVZA 4QOZC 3RGPA 1A5TA 4I5SA 4LY6A 4QNRA 5KPRA 5KO3A 1IY1A 2DZOB 1WGNA 2CUZA 3FTEA 4JI7M 1IQPA 1SXJA 2CFOA 3LQRA 4JV5M 3GQ3A 1QAQA 3D8BA 4DR1M 4X65M 1IN6A 5DYIA 2K6BA 3SAUA 2ZTDA 1CUKA 4S12A 3ILKA 4GHAA 3KVWA 3LCVB 1GJTA 3J2PB 2Z7JA 4EIWA 4R71A 1N34M 1Z5AA 1Z5BA 4CGYB 1C7YA 3BBZA 2H5XA 4REZA 2B3TA 2JZ0A 3VK7A 4AKIA 4M9XA 5ITUA 5FLXS 4G3OA 1XMOM 1N36M 3AOGA 3C3DA 4MGHA 2WSFF 3PVSA 1QAOA 4PDGA 4YHHM 1IXRC 4GIPA 4NRWA 1ZMWA 3E46A 2RKOA 2Z4SA 3GRVA 1FJGM 1QDRA 3KSJA 4I81A 2XSZD 2WZJA 3W68A 3GQ5A 3BXWA 1PJSA 2WSCF 1IXSB 1R4GA 1TF0B 2R62A 1DGGA 1AUAA 3A98B 2M60A 3QAUA 4JI0M 5ITXE 3JR4A 3KDSE 3DZDA 4OVZB 1OKSA 1TDZA 4AG6A 2CV1A 4L8RC 4DR7M 2CHGA 5KPTA 3FE3A 1R6BX 1XXHA 1SXJB 3HJ8A 4FCWA 4LFAM 4B7GA 3FUXA 1SG9A 2ZBKB 3KXEC 4G4QA 3MMPA 3SAVA 1YUBA 1SXJE 2ZM6M 3GRYA 1EFUB 3C58A 2X49A 4HLQA 3WHLA 5BR8M 2KRUA 4NSOB 4F1IA 1NHGC 1ZAEA 4LGYA
chains in the Genus database with same CATH topology
3TL4X 2VIIA 3FYCA 5EP1A 3W0LB 4X64M 2V1CA 1MU5A 2LXEA 3FUWA 2C96A 4LJ7A 1K3WA 4NXMM 2H1RA 3AFHA 3PFIA 1QZMA 2XFTA 4DR6M 1KYIA 4IBCA 4Z6YA 1R7RA 1IN7A 3VFDA 2YR0A 3MK6A 1XNRM 4RF0A 2HKJA 2XFSA 5BPVA 2XLJA 3GO8A 2QCUA 1PJIA 3SFZA 1GL7A 1L1ZA 4LJ8A 1FNNA 3R8FA 2DZNB 2EO2A 2J7OA 1YE9A 1XXHB 3U61B 3U6CA 2M5ZA 4M0WA 2F5PA 2DVWB 1L2BA 2VQFM 2G8LA 3FD9A 2FE8A 4KODA 4R7GA 3HU3A 4XBOA 4TUWA 3UMMA 1J7KA 3GLHA 1GVNA 4LF7M 2DWLA 2Y0QA 3M6AA 2HCBA 1TDHA 4LZJA 1E94E 4CHTB 3LVVA 4AI6A 1HR0M 4BBAA 5DNYA 4IBJA 1QANA 1K82A 5FTMA 4B08A 1H6UA 3SATA 2C9OA 4XGIA 2K47A 2R46A 3DOAA 1NJGA 1OJLA 3HGIA 1ZQ9A 3M0EA 4BB9A 3CF2A 3I4VA 4DUZM 3CF0A 4FW9A 4MGYE 3RE8A 4DV7M 2UU9M 4PD2A 5GKNA 5ITRA 3RFWA 2CE7A 3GPPA 3L25A 4JI4M 3H4MA 3J80S 5KQ8A 3I4YA 3NBIA 2Q2EB 4LJAA 1TH4A 1NY6A 1XC8A 4FVMA 1N78A 2ERCA 1JR3A 5LMNM 4MM3B 4DR5M 5EP3A 2R18A 3GLHB 3FKEA 5ITTA 1XWIA 4R3DA 3BOSA 1MX0A 4KLNA 4AG5A 3SARA 5E26A 3KP0E 5FTLA 2FFJA 4DV6M 5E6JA 2YQZA 2DHRA 3K1JA 2QP9X 4LJ4A 2HHHM 5EP4A 3AKZA 4GHLA 4W5WA 2F5QA 4II7A 2DXIA 2RGOA 2OPFA 4LF8M 2NQ8C 3TPZA 2KEBA 1NJFA 5FSWA 5ITQA 1NHWC 4NRVA 2CHVA 2V1UA 1ORYB 4CISA 3T1HM 2X8AA 4LJ6A 4JYAM 3GLGA 2X4AA 1HT2E 2W82A 3UGJA 3L29A 4LF5M 1TGUA 5EXXA 4HL4A 2E5LM 4QOSA 1DO2A 3U61A 1E32A 2D7GA 4OW0A 1E9RA 5DYGA 2C5RA 5IZ7D 2UUAM 4DV0M 3GP1A 4KHPM 1Z59A 1XNQM 3VKGA 3NWLA 4LFBM 3A46A 2L6OA 1K3XA 1E9SA 3KOXE 3VDUA 1N33M 2XF3A 3AOEC 3SHGB 4DV1M 3KS4A 2JA2A 2DWMA 5IREB 3M7GA 3THGA 4JI1M 3VK8A 3Q8XA 1PJJA 4OU7A 2UXCM 1R2ZA 3AJIB 5H37D 3SAWA 5F3WA 4GMQA 2HL7A 4JXJA 2C99A 1QQWA 1ZAEA 3DFZA 1J5EM 3TWLA 2ZANA 2UXBM 4DV4M 4LF4M 3GLGB 2CHQA 3AV0A 2G5GX 4PT5A 4IBFA 2DWZB 1NY5A 1HT1E 2KA6B 4MGIE 4L15A 3SASA 5LMUM 3MHVC 5C1BA 2P5TA 2R4JA 1SXJD 4Z8XA 2KRKA 3KOZE 4M9SA 4DUYM 2R65A 4WW0A 3QWLA 3JAMS 3ZCBB 2R45A 5EXPA 3GPUA 1R2YA 4IBEA 1N77A 2D7HA 2OQ4A 3FUVA 4NXNM 3VDPA 1L2DA 1UM8A 3GRUA 5C18A 5KPZA 4PDIA 4GC5A 2QPAA 1IBMM 3IG8A 3B9PA 3K2LA 1WXQA 2O5RA 3K92A 4I4LA 3U6LA 1TH3A 1YSYA 3HU2A 1I94M 4IBKA 3GPYA 1G41A 2QENA 4DV2M 4RNAA 1QYRA 3E9SA 3HHWA 2I7PA 3U6MA 2L7IA 1OFIA 4IBBA 4MGZE 3KFUG 4A3VB 3EIEA 2XGNA 4WURA 3TWKA 3SMSA 4ITQA 4D81A 1HNWM 3FYDA 4IIWA 2XEPA 3UZUA 1IBKM 4X62M 4B3MM 1IXZA 4JI2M 4KO8A 3PNYA 1G4AE 3LQQA 3KSXA 4L4UA 4D80A 1GLNA 4LZZA 4GKJM 1LV7A 3KP1E 1HQYE 4GRIA 4NSRA 2AHMA 3FTDA 4B7FA 1NNJA 4B3RM 1T3TA 4LJ9A 4G4OA 4M9ZA 3A42A 3T1YM 2C9CA 2F4VM 4B7HA 3J7AS 3TWMA 2VQEM 3U6DA 2XSZA 2EUCA 5ITYA 3HHXA 5JI2E 4ZPXA 2A5YB 3U6PA 4RF1A 3I51A 5FTNA 2L09A 3HU1A 5EXSA 4AZFA 4JI5M 1DGHA 2D7EA 2F5OA 2LWXA 4QHTA 3UK6A 1KFVA 4JI6M 3HKPA 1NNUC 2ZAOA 3VKHA 4IJFA 4JI8M 3GRRA 4AKGA 1HQCA 2Y21A 3LVWA 4LRTA 4IJEA 3T38A 4LJ5A 4FWDA 4GKKM 2CEAA 1Q3CA 2C98A 3AOEA 3J81S 4MB7A 2CV2A 4QNMA 1HNZM 4LCBA 2EA0A 1IY0A 1I4WA 8CATA 4B3SM 3U6OA 4LGMA 1N32M 1JQJC 4BLCA 3SC3A 2Y20A 1SXJC 3JR5A 5EJCA 4YY3M 4FWGA 1DGHB 2BNKA 1L8QA 2FNAA 3T15A 3U5ZA 1DO0A 2Z3XA 1JR3D 3U60A 2J7NA 4DV3M 3SYKA 4IBIA 4L78A 3OTOM 4NL4H 1N75A 5FTKA 3GQ4A 2DWNA 4OX9M 4PCZA 2QBYA 1IN4A 4AW4A 2XZUA 3AL0C 4AKHA 3FTCA 1IN8A 3PNVA 1TH2A 2FOIC 2ZAMA 2YFQA 2RGHA 1OFHA 1C1KA 3TQSA 1G8PA 3HJQA 4DR3M 4JI3M 4LF9M 1QVRA 4JN6A 4DR2M 1HNXM 1IBLM 3U6QA 3FUUA 3U6SA 3L28A 3U5ZB 4FD2A 5EQTA 2F5SA 3U60B 3J7BA 1PM5A 3GLFA 1W5SA 3L2AA 3K8ZA 4FCVA 3E4RA 2F5NA 4G6ZA 2XZFA 4LG2A 2QBYB 1D2NA 1Q3BA 3LMMA 1QAMA 3J27B 3HHZA 4IBGA 4P16A 3GLIA 4X66M 4B3TM 2UXDM 3WHKA 1EE8A 1S3SA 3SYLA 2UUCM 5JI3E 4MH0E 3L26A 2LH0A 4I8OA 5EP2A 1XHBA 4LFCM 3W0FA 3SBJA 3R9XB 5IT9S 2KW0A 2L7HA 5FTJA 3DA1A 4DR4M 3HHYA 3D8LA 4NOOB 2XH9A 1L2CA 2Z4RA 1Q39A 2BJWA 1IN5A 3KW6A 3TE6A 1W5TA 2UUBM 1L1TA 5IWAM 3FUTA 1X37A 2KXEA 1IY2A 4FWHA 4GC9A 3ZC7B 4D82A 2V6ZM 3A45A 3L27A 7CATA 3GLFB 3KS8A 5EXTA 2KZSA 3SHFA 3IG5A 2QZ4A 1DGFA 3MJ5A 3CTWB 2LNHC 1XMQM 3U6EA 4G4RA 3UJNA 4QHSA 1KSFX 2R4EA 1GKIA 2YNMD 3GLIB 1IM2A 4G4NA 5KQDA 3HWSA 3ZH9B 3PXGA 1VDDA 4MGKE 1NVMA 1G59A 1DGBA 4GH9A 3GPXA 4GITA 4DV5M 1Z5CA 2BJVA 4K0KM 1G3IA 2Y0TA 3FTFA 3RGSA 3KOYE 2I7NA 1GL6A 1Z6TA 2KZUA 3CF6E 1NSFA 4LRSA 4M0DA 3HJSA 4FCTA 5ITXA 4L16A 3SMPA 4IBDA 3EIHA 2CV0A 4AQYM 5A2QS 1J09A 4LF6M 3VLFB 4OVZA 4QOZC 3RGPA 4I5SA 4LY6A 4QNRA 5KPRA 5KO3A 1IY1A 2DZOB 2CUZA 3FTEA 4JI7M 1IQPA 1SXJA 2CFOA 3LQRA 4JV5M 3GQ3A 1QAQA 3D8BA 4DR1M 4X65M 1IN6A 5DYIA 3SAUA 4S12A 3ILKA 4GHAA 3KVWA 3J2PB 4EIWA 2Z7JA 1N34M 1Z5AA 1Z5BA 4CGYB 4REZA 3VK7A 4AKIA 4M9XA 5ITUA 5FLXS 1XMOM 1N36M 3AOGA 4MGHA 3PVSA 1QAOA 4PDGA 4YHHM 1IXRC 4GIPA 4NRWA 2RKOA 2Z4SA 3GRVA 1FJGM 3KSJA 4I81A 2XSZD 3GQ5A 1IXSB 2R62A 3A98B 1DGGA 3QAUA 2M60A 4JI0M 3JR4A 5ITXE 3KDSE 3DZDA 4OVZB 1TDZA 4AG6A 2CV1A 4L8RC 4DR7M 2CHGA 5KPTA 1R6BX 1XXHA 1SXJB 3HJ8A 4FCWA 4LFAM 4B7GA 3FUXA 3KXEC 2ZBKB 4G4QA 3SAVA 1YUBA 1SXJE 2ZM6M 1NHGC 3C58A 2X49A 4HLQA 3WHLA 5BR8M 2KRUA 4NSOB 3GRYA 3KOWE 4LGYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IT9 S;  3U6P A;  4X64 M;  2UUA M;  4DV0 M;  1MU5 A;  3GP1 A;  4DR4 M;  4NXM M;  4KHP M;  1Z59 A;  1K3W A;  4JI5 M;  1L2C A;  2F5O A;  1Q39 A;  1XNQ M;  2UUB M;  4DR6 M;  3A46 A;  1KFV A;  1K3X A;  1L1T A;  4JI6 M;  5IWA M;  1XNR M;  4LFB M;  1N33 M;  4DV1 M;  4JI8 M;  2HKJ A;  3GO8 A;  1PJI A;  4JI1 M;  3A45 A;  3VK8 A;  1L1Z A;  1PJJ A;  2UXC M;  1R2Z A;  3SAW A;  1XMQ M;  3U6E A;  4GKK M;  3U6C A;  4G4R A;  2F5P A;  1J5E M;  3TWL A;  1L2B A;  2VQF M;  1Q3C A;  4G4N A;  2UXB M;  4DV4 M;  3J81 S;  4LF4 M;  4MB7 A;  1HNZ M;  2EA0 A;  3GPX A;  4DV5 M;  3SAS A;  1Z5C A;  5LMU M;  4B3S M;  3U6O A;  4K0K M;  1N32 M;  4LF7 M;  1TDH A;  3JR5 A;  4DUY M;  4YY3 M;  3JAM S;  1HR0 M;  3GPU A;  1R2Y A;  1K82 A;  5ITX A;  3SAT A;  4DV3 M;  2OQ4 A;  3OTO M;  4AQY M;  5A2Q S;  3DOA A;  4LF6 M;  3GQ4 A;  4OX9 M;  4NXN M;  1L2D A;  4PCZ A;  4DUZ M;  4DV7 M;  2UU9 M;  4PDI A;  2XZU A;  4PD2 A;  4JI7 M;  4JV5 M;  3GQ3 A;  5ITR A;  4DR1 M;  1IBM M;  4X65 M;  3GPP A;  4JI4 M;  3U6L A;  3SAU A;  3J80 S;  2Q2E B;  1I94 M;  1XC8 A;  3GPY A;  4DV2 M;  5LMN M;  4DR3 M;  1N34 M;  1Z5A A;  2UXD M;  1Z5B A;  4JI3 M;  4DR5 M;  3U6M A;  3VK7 A;  4LF9 M;  5ITU A;  5FLX S;  1N36 M;  4DR2 M;  1XMO M;  5ITT A;  1HNX M;  1IBL M;  4YHH M;  4PDG A;  3TWK A;  1MX0 A;  3U6Q A;  4ITQ A;  3U6S A;  4NRW A;  1HNW M;  1IBK M;  3SAR A;  4X62 M;  4B3M M;  1FJG M;  4JI2 M;  2F5S A;  3GQ5 A;  1PM5 A;  4DV6 M;  4JI0 M;  3JR4 A;  5ITX E;  2F5N A;  2HHH M;  1TDZ A;  2XZF A;  4GKJ M;  2F5Q A;  4DR7 M;  1Q3B A;  2OPF A;  4LFA M;  4LF8 M;  2ZBK B;  1NNJ A;  4G4Q A;  5ITQ A;  4NRV A;  3SAV A;  4X66 M;  4B3T M;  4CIS A;  4LFC M;  3T1H M;  1EE8 A;  2ZM6 M;  4G4O A;  4B3R M;  3C58 A;  3A42 A;  3T1Y M;  4JYA M;  2UUC M;  2F4V M;  5BR8 M;  3J7A S;  3TWM A;  2VQE M;  3U6D A;  4LF5 M;  2E5L M;  5ITY A;  3W0F A;  3SBJ A; 
#chains in the Genus database with same CATH topology
 3TL4 X;  2VII A;  3FYC A;  5EP1 A;  3W0L B;  4X64 M;  3F92 A;  2V1C A;  1MU5 A;  2LXE A;  3FUW A;  2C96 A;  4LJ7 A;  1K3W A;  2QNJ A;  4NXM M;  1OTR A;  1VQ1 A;  2H1R A;  3AFH A;  3PFI A;  1QZM A;  2XFT A;  4DR6 M;  1KYI A;  4IBC A;  4Z6Y A;  1R7R A;  1IN7 A;  2BWB A;  2YR0 A;  2N35 A;  3MK6 A;  3VFD A;  1XNR M;  4RF0 A;  2HKJ A;  2G3Q A;  2XFS A;  5BPV A;  2XLJ A;  1PRB A;  2QCU A;  3GO8 A;  1PJI A;  3SFZ A;  1GL7 A;  2EKF A;  1L1Z A;  4LJ8 A;  1FNN A;  3R8F A;  2DZN B;  2QSF X;  2EO2 A;  1UFZ A;  2J7O A;  2JY5 A;  2DAG A;  1YE9 A;  1XXH B;  3B7Q A;  3U61 B;  3U6C A;  2M5Z A;  4M0W A;  2HAK A;  2F5P A;  2ZTC A;  2DVW B;  2K9D A;  1L2B A;  2VQF M;  1XXH E;  2G8L A;  2JY7 A;  3FD9 A;  4UN2 B;  2FE8 A;  4KOD A;  4R7G A;  3HU3 A;  4XBO A;  2JY6 B;  4TUW A;  3UMM A;  1J7K A;  3GLH A;  1WR1 B;  1GVN A;  4LF7 M;  3V76 A;  2DWL A;  2Y0Q A;  3M6A A;  2HCB A;  1TDH A;  4LZJ A;  1E94 E;  4P17 A;  4CHT B;  3LVV A;  4AI6 A;  1HR0 M;  4BBA A;  2LVQ D;  5DNY A;  4IBJ A;  2KHH A;  1QAN A;  1K82 A;  5FTM A;  4B08 A;  1H6U A;  3SAT A;  2C9O A;  4XGI A;  2K47 A;  2R46 A;  3DOA A;  1NJG A;  3LW5 F;  1OJL A;  2JWS A;  3HGI A;  1ZQ9 A;  2FH0 A;  3M0E A;  4BB9 A;  3CF2 A;  3I01 M;  3I4V A;  4DUZ M;  3CF0 A;  4FW9 A;  4MGY E;  3RE8 A;  4DV7 M;  2UU9 M;  4PD2 A;  2OO9 A;  2DAE A;  5GKN A;  5ITR A;  1GAB A;  3RFW A;  2CE7 A;  1OQY A;  3GPP A;  2MH8 A;  4JI4 M;  3L25 A;  3H4M A;  3J80 S;  5KQ8 A;  3I4Y A;  2EJS A;  1OAO C;  2Q2E B;  3KOW E;  3NBI A;  4LJA A;  1TH4 A;  1NY6 A;  4WP2 A;  1XC8 A;  4FVM A;  1N78 A;  2ERC A;  1JR3 A;  1AIP C;  5LMN M;  1NV9 A;  4MM3 B;  4DR5 M;  5EP3 A;  2R18 A;  3GLH B;  3FKE A;  5ITT A;  1XWI A;  1JB0 F;  4R3D A;  3BOS A;  3GLH E;  1MX0 A;  4KLN A;  4AG5 A;  3SAR A;  5E26 A;  3KP0 E;  1RU3 A;  5FTL A;  2FFJ A;  4DV6 M;  5E6J A;  2YQZ A;  2DHR A;  3K1J A;  2QP9 X;  4LJ4 A;  2HHH M;  5EP4 A;  3AKZ A;  4GHL A;  4W5W A;  2F5Q A;  2R6F A;  4II7 A;  2DXI A;  2RGO A;  2CWB A;  2OPF A;  4LF8 M;  2NQ8 C;  3TPZ A;  2KEB A;  1NJF A;  5FSW A;  5ITQ A;  1NHW C;  4NRV A;  2CHV A;  2V1U A;  1ORY B;  4CIS A;  3T1H M;  2X8A A;  1ZV1 A;  4LJ6 A;  4JYA M;  3GLG A;  2X4A A;  1HT2 E;  2LTU A;  2W82 A;  3UGJ A;  3L29 A;  1WJ7 A;  4LF5 M;  1TGU A;  5EXX A;  4HL4 A;  2E5L M;  4QOS A;  1DO2 A;  3U61 A;  1E32 A;  2D7G A;  1JR3 E;  4OW0 A;  1V34 A;  1E9R A;  5DYG A;  2C5R A;  5IZ7 D;  2UUA M;  4DV0 M;  3GP1 A;  4KHP M;  1Z59 A;  4LFB M;  3B7Z A;  1XNQ M;  3NWL A;  3VKG A;  2FS1 A;  1TTE A;  2L6O A;  3A46 A;  1E9S A;  3KOX E;  3VDU A;  1K3X A;  3Q8G A;  1WHC A;  2JZ1 A;  2XF3 A;  3AOE C;  3SHG B;  4DV1 M;  3KS4 A;  1N33 M;  2JA2 A;  2DWM A;  5IRE B;  3M7G A;  3THG A;  4JI1 M;  3C3E A;  3VK8 A;  1V33 A;  3Q8X A;  1Y8G A;  1PJJ A;  4OU7 A;  2UXC M;  1R2Z A;  3AJI B;  5H37 D;  3SAW A;  5F3W A;  4GMQ A;  2HL7 A;  2LHC A;  4JXJ A;  1G59 A;  2C99 A;  1QQW A;  3DFZ A;  1VEJ A;  3TWL A;  3B74 A;  1J5E M;  2ZAN A;  2UXB M;  4DV4 M;  4LF4 M;  3GLG B;  2CHQ A;  1ZMV A;  2G5G X;  3AV0 A;  4PT5 A;  4IBF A;  2DWZ B;  1NY5 A;  1HT1 E;  2KA6 B;  4MGI E;  4L15 A;  3SAS A;  5LMU M;  1DV0 A;  3MHV C;  5C1B A;  3GLG E;  2P5T A;  2R4J A;  3K9P A;  1SXJ D;  1VEK A;  4Z8X A;  1IFY A;  1D0K A;  2KRK A;  3KOZ E;  4M9S A;  4DUY M;  4L6V 6;  2R65 A;  4WW0 A;  3QWL A;  1D0M A;  3JAM S;  3ZCB B;  2R45 A;  2MRO B;  5EXP A;  3GPU A;  1R2Y A;  4IBE A;  1PGY A;  4KT0 F;  1N77 A;  1QUT A;  2D7H A;  2OQ4 A;  2APL A;  2QHO B;  2LBC A;  2MGW A;  3FUV A;  4NXN M;  3VDP A;  2DAK A;  1UM8 A;  2L2D A;  1L2D A;  3GRU A;  5C18 A;  5KPZ A;  4PDI A;  4ANR A;  2JXN A;  4GC5 A;  2QPA A;  1IBM M;  3B89 A;  3IG8 A;  3B9P A;  3K2L A;  1WXQ A;  2O5R A;  3K92 A;  4I4L A;  3U6L A;  1TH3 A;  1YSY A;  3HU2 A;  1I94 M;  4IBK A;  3GPY A;  1G41 A;  2QEN A;  4DV2 M;  4RNA A;  1QYR A;  3E9S A;  3IEC A;  3HHW A;  2I7P A;  3U6M A;  2L7I A;  1OFI A;  4IBB A;  2DAI A;  4MGZ E;  4A3V B;  3EIE A;  3KFU G;  2KNZ A;  2WSE F;  2VDB B;  2XGN A;  3I04 M;  2K0B X;  4WUR A;  2J5Y A;  3TWK A;  3SMS A;  4ITQ A;  4D81 A;  1HNW M;  3FYD A;  4IIW A;  2XEP A;  3UZU A;  1IBK M;  1D0L A;  4X62 M;  4B3M M;  4RKU F;  1IXZ A;  4JI2 M;  4KO8 A;  3PNY A;  3FRH A;  1G4A E;  1QUS A;  3LQQ A;  3KSX A;  4L4U A;  4D80 A;  1GLN A;  4LZZ A;  1TR8 A;  4GKJ M;  1LV7 A;  3KP1 E;  1HQY E;  4GRI A;  4NSR A;  3NBX X;  2AHM A;  2OOB A;  3FTD A;  4B7F A;  2EKK A;  1NNJ A;  1P3Q Q;  1PJT A;  4B3R M;  1T3T A;  4LJ9 A;  4G4O A;  4M9Z A;  3A42 A;  3T1Y M;  5DFL A;  2C9C A;  2F4V M;  4B7H A;  3J7A S;  3TWM A;  2VQE M;  3U6D A;  1GO5 A;  2XSZ A;  2EUC A;  5ITY A;  3HHX A;  3IHP A;  5JI2 E;  4ZPX A;  2A5Y B;  3U6P A;  4RF1 A;  3I51 A;  5FTN A;  2DNA A;  1PJQ A;  2L09 A;  3HU1 A;  5EXS A;  4AZF A;  4JI5 M;  1DGH A;  2D7E A;  2F5O A;  2LWX A;  4QHT A;  1VDL A;  3UK6 A;  2OOA A;  1KFV A;  4JI6 M;  3HKP A;  1NNU C;  2ZAO A;  1VEG A;  3E21 A;  4GEW A;  1ZMU A;  3VKH A;  4IJF A;  4JI8 M;  3GRR A;  4AKG A;  1HQC A;  1MJG M;  2Y21 A;  3LVW A;  4LRT A;  4IJE A;  1Q02 A;  2LHG A;  4LJ5 A;  4FWD A;  3T38 A;  1OIP A;  4GKK M;  2CEA A;  2Z8Y M;  1Q3C A;  2C98 A;  3AOE A;  3J81 S;  4MB7 A;  2L4F A;  2CV2 A;  4QNM A;  4HEO A;  1HNZ M;  3HY5 A;  4LCB A;  2EA0 A;  1YLA A;  1IY0 A;  2JNH A;  1I4W A;  8CAT A;  2DZL A;  1LTM A;  4Q7J A;  4LGM A;  3U6O A;  1JQJ C;  1QDT A;  4B3S M;  1N32 M;  1F4I A;  3K9O A;  4BLC A;  3SC3 A;  2VF8 A;  2Y20 A;  1SXJ C;  3JR5 A;  5EJC A;  4YY3 M;  4FWG A;  3LCU A;  1DGH B;  2BNK A;  1L8Q A;  2FNA A;  3T15 A;  3U5Z A;  1DO0 A;  2Z3X A;  1JR3 D;  3U60 A;  2J7N A;  2DHY A;  4CJ6 A;  4DV3 M;  3SYK A;  2GNO A;  4IBI A;  4L78 A;  3ZQJ A;  4CIZ A;  4NL4 H;  3OTO M;  5L8R F;  1N75 A;  2GQF A;  5FTK A;  3GQ4 A;  2DWN A;  4OX9 M;  2BWE A;  4PCZ A;  2QBY A;  1IN4 A;  1VG5 A;  4AW4 A;  2XZU A;  3AL0 C;  4AKH A;  3FTC A;  1IN8 A;  3PNV A;  1TH2 A;  2FOI C;  2ZAM A;  2YFQ A;  3QYE A;  2JP7 A;  2RGH A;  1OFH A;  1C1K A;  2DKL A;  3TQS A;  2KNA A;  1G8P A;  2L4E A;  3HJQ A;  4DR3 M;  2UXD M;  3FRI A;  4JI3 M;  4F2L A;  2LVO C;  1QVR A;  2LVN C;  4JN6 A;  2MJ5 B;  3H4J A;  4DR2 M;  1HNX M;  4LF9 M;  1IBL M;  1WIV A;  2R44 A;  1XB2 B;  1OIZ A;  3U6Q A;  3FUU A;  3U6S A;  3L28 A;  2QQ8 A;  3U5Z B;  3B7N A;  4FD2 A;  5EQT A;  2F5S A;  3U60 B;  2HWJ A;  1V92 A;  3J7B A;  2CP8 A;  2R0I A;  4XK8 F;  1PM5 A;  1GJS A;  3GLF A;  1W5S A;  3L2A A;  3K8Z A;  4FCV A;  3E4R A;  2F5N A;  4G6Z A;  2XZF A;  4LG2 A;  2QBY B;  1D2N A;  1Q3B A;  3LMM A;  1QAM A;  1QZE A;  3J27 B;  1T6O A;  2DI0 A;  3HHZ A;  4IBG A;  2JY8 A;  4P16 A;  2RRU A;  4X66 M;  1OAI A;  3WHK A;  3GLI A;  1EE8 A;  1S3S A;  4B3T M;  4Y28 F;  2KDL A;  3SYL A;  2UUC M;  5JI3 E;  4MH0 E;  3L26 A;  2JUJ A;  2LH0 A;  4I8O A;  5EP2 A;  2DEN A;  1HJP A;  1XHB A;  2VF7 A;  4LFC M;  1NV8 A;  3W0F A;  2CRU A;  1R5L A;  3SBJ A;  2O01 F;  1NO1 A;  2KW0 A;  2L7H A;  3R9X B;  5IT9 S;  1G71 A;  5FTJ A;  3DA1 A;  4DR4 M;  3HHY A;  3D8L A;  4NOO B;  2XH9 A;  1L2C A;  2Z4R A;  1Q39 A;  2BJW A;  1IN5 A;  3KW6 A;  3TE6 A;  1W5T A;  2UUB M;  1L1T A;  5IWA M;  3FUT A;  3HZJ A;  1X37 A;  2O25 A;  2KXE A;  1IY2 A;  4FWH A;  1T43 A;  4GC9 A;  3ZC7 B;  4D82 A;  2V6Z M;  3A45 A;  3L27 A;  7CAT A;  3GLF B;  3KS8 A;  3HX3 A;  5EXT A;  2KZS A;  3SHF A;  3IG5 A;  2QZ4 A;  1DGF A;  3MJ5 A;  3CTW B;  3GLF E;  2LNH C;  1XMQ M;  3U6E A;  3W67 A;  4G4R A;  3UJN A;  1EIJ A;  3CGW A;  4QHS A;  1KSF X;  2R4E A;  1GKI A;  2MR9 A;  2YNM D;  3GLI B;  1IM2 A;  4G4N A;  3QYB A;  5KQD A;  3HWS A;  3ZH9 B;  3PXG A;  1VDD A;  1MN3 A;  1NVM A;  4MGK E;  3GLI E;  1DGB A;  4GH9 A;  3GPX A;  3T6P A;  4GIT A;  1WGL A;  1Z5C A;  4DV5 M;  2BJV A;  3C9P A;  4K0K M;  1G3I A;  2Y0T A;  2DAM A;  3RGS A;  3FTF A;  3KOY E;  2I7N A;  2KNV A;  1GL6 A;  1Z6T A;  2KZU A;  2LVA A;  2LVP C;  3CF6 E;  1NSF A;  4LRS A;  4M0D A;  3HJS A;  4FCT A;  4NC6 A;  5ITX A;  4L16 A;  3SMP A;  4IBD A;  3EIH A;  2CV0 A;  4AQY M;  1IXS A;  4DBG B;  5A2Q S;  1BVS A;  1J09 A;  4LF6 M;  3VLF B;  4OVZ A;  4QOZ C;  3RGP A;  1A5T A;  4I5S A;  4LY6 A;  4QNR A;  5KPR A;  5KO3 A;  1IY1 A;  2DZO B;  1WGN A;  2CUZ A;  3FTE A;  4JI7 M;  1IQP A;  1SXJ A;  2CFO A;  3LQR A;  4JV5 M;  3GQ3 A;  1QAQ A;  3D8B A;  4DR1 M;  4X65 M;  1IN6 A;  5DYI A;  2K6B A;  3SAU A;  2ZTD A;  1CUK A;  4S12 A;  3ILK A;  4GHA A;  3KVW A;  3LCV B;  1GJT A;  3J2P B;  2Z7J A;  4EIW A;  4R71 A;  1N34 M;  1Z5A A;  1Z5B A;  4CGY B;  1C7Y A;  3BBZ A;  2H5X A;  4REZ A;  2B3T A;  2JZ0 A;  3VK7 A;  4AKI A;  4M9X A;  5ITU A;  5FLX S;  4G3O A;  1XMO M;  1N36 M;  3AOG A;  3C3D A;  4MGH A;  2WSF F;  3PVS A;  1QAO A;  4PDG A;  4YHH M;  1IXR C;  4GIP A;  4NRW A;  1ZMW A;  3E46 A;  2RKO A;  2Z4S A;  3GRV A;  1FJG M;  1QDR A;  3KSJ A;  4I81 A;  2XSZ D;  2WZJ A;  3W68 A;  3GQ5 A;  3BXW A;  1PJS A;  2WSC F;  1IXS B;  1R4G A;  1TF0 B;  2R62 A;  1DGG A;  1AUA A;  3A98 B;  2M60 A;  3QAU A;  4JI0 M;  5ITX E;  3JR4 A;  3KDS E;  3DZD A;  4OVZ B;  1OKS A;  1TDZ A;  4AG6 A;  2CV1 A;  4L8R C;  4DR7 M;  2CHG A;  5KPT A;  3FE3 A;  1R6B X;  1XXH A;  1SXJ B;  3HJ8 A;  4FCW A;  4LFA M;  4B7G A;  3FUX A;  1SG9 A;  2ZBK B;  3KXE C;  4G4Q A;  3MMP A;  3SAV A;  1YUB A;  1SXJ E;  2ZM6 M;  3GRY A;  1EFU B;  3C58 A;  2X49 A;  4HLQ A;  3WHL A;  5BR8 M;  2KRU A;  4NSO B;  4F1I A;  1NHG C;  1ZAE A;  4LGY A; 
#chains in the Genus database with same CATH homology
 3TL4 X;  2VII A;  3FYC A;  5EP1 A;  3W0L B;  4X64 M;  2V1C A;  1MU5 A;  2LXE A;  3FUW A;  2C96 A;  4LJ7 A;  1K3W A;  4NXM M;  2H1R A;  3AFH A;  3PFI A;  1QZM A;  2XFT A;  4DR6 M;  1KYI A;  4IBC A;  4Z6Y A;  1R7R A;  1IN7 A;  3VFD A;  2YR0 A;  3MK6 A;  1XNR M;  4RF0 A;  2HKJ A;  2XFS A;  5BPV A;  2XLJ A;  3GO8 A;  2QCU A;  1PJI A;  3SFZ A;  1GL7 A;  1L1Z A;  4LJ8 A;  1FNN A;  3R8F A;  2DZN B;  2EO2 A;  2J7O A;  1YE9 A;  1XXH B;  3U61 B;  3U6C A;  2M5Z A;  4M0W A;  2F5P A;  2DVW B;  1L2B A;  2VQF M;  2G8L A;  3FD9 A;  2FE8 A;  4KOD A;  4R7G A;  3HU3 A;  4XBO A;  4TUW A;  3UMM A;  1J7K A;  3GLH A;  1GVN A;  4LF7 M;  2DWL A;  2Y0Q A;  3M6A A;  2HCB A;  1TDH A;  4LZJ A;  1E94 E;  4CHT B;  3LVV A;  4AI6 A;  1HR0 M;  4BBA A;  5DNY A;  4IBJ A;  1QAN A;  1K82 A;  5FTM A;  4B08 A;  1H6U A;  3SAT A;  2C9O A;  4XGI A;  2K47 A;  2R46 A;  3DOA A;  1NJG A;  1OJL A;  3HGI A;  1ZQ9 A;  3M0E A;  4BB9 A;  3CF2 A;  3I4V A;  4DUZ M;  3CF0 A;  4FW9 A;  4MGY E;  3RE8 A;  4DV7 M;  2UU9 M;  4PD2 A;  5GKN A;  5ITR A;  3RFW A;  2CE7 A;  3GPP A;  3L25 A;  4JI4 M;  3H4M A;  3J80 S;  5KQ8 A;  3I4Y A;  3NBI A;  2Q2E B;  4LJA A;  1TH4 A;  1NY6 A;  1XC8 A;  4FVM A;  1N78 A;  2ERC A;  1JR3 A;  5LMN M;  4MM3 B;  4DR5 M;  5EP3 A;  2R18 A;  3GLH B;  3FKE A;  5ITT A;  1XWI A;  4R3D A;  3BOS A;  1MX0 A;  4KLN A;  4AG5 A;  3SAR A;  5E26 A;  3KP0 E;  5FTL A;  2FFJ A;  4DV6 M;  5E6J A;  2YQZ A;  2DHR A;  3K1J A;  2QP9 X;  4LJ4 A;  2HHH M;  5EP4 A;  3AKZ A;  4GHL A;  4W5W A;  2F5Q A;  4II7 A;  2DXI A;  2RGO A;  2OPF A;  4LF8 M;  2NQ8 C;  3TPZ A;  2KEB A;  1NJF A;  5FSW A;  5ITQ A;  1NHW C;  4NRV A;  2CHV A;  2V1U A;  1ORY B;  4CIS A;  3T1H M;  2X8A A;  4LJ6 A;  4JYA M;  3GLG A;  2X4A A;  1HT2 E;  2W82 A;  3UGJ A;  3L29 A;  4LF5 M;  1TGU A;  5EXX A;  4HL4 A;  2E5L M;  4QOS A;  1DO2 A;  3U61 A;  1E32 A;  2D7G A;  4OW0 A;  1E9R A;  5DYG A;  2C5R A;  5IZ7 D;  2UUA M;  4DV0 M;  3GP1 A;  4KHP M;  1Z59 A;  1XNQ M;  3VKG A;  3NWL A;  4LFB M;  3A46 A;  2L6O A;  1K3X A;  1E9S A;  3KOX E;  3VDU A;  1N33 M;  2XF3 A;  3AOE C;  3SHG B;  4DV1 M;  3KS4 A;  2JA2 A;  2DWM A;  5IRE B;  3M7G A;  3THG A;  4JI1 M;  3VK8 A;  3Q8X A;  1PJJ A;  4OU7 A;  2UXC M;  1R2Z A;  3AJI B;  5H37 D;  3SAW A;  5F3W A;  4GMQ A;  2HL7 A;  4JXJ A;  2C99 A;  1QQW A;  1ZAE A;  3DFZ A;  1J5E M;  3TWL A;  2ZAN A;  2UXB M;  4DV4 M;  4LF4 M;  3GLG B;  2CHQ A;  3AV0 A;  2G5G X;  4PT5 A;  4IBF A;  2DWZ B;  1NY5 A;  1HT1 E;  2KA6 B;  4MGI E;  4L15 A;  3SAS A;  5LMU M;  3MHV C;  5C1B A;  2P5T A;  2R4J A;  1SXJ D;  4Z8X A;  2KRK A;  3KOZ E;  4M9S A;  4DUY M;  2R65 A;  4WW0 A;  3QWL A;  3JAM S;  3ZCB B;  2R45 A;  5EXP A;  3GPU A;  1R2Y A;  4IBE A;  1N77 A;  2D7H A;  2OQ4 A;  3FUV A;  4NXN M;  3VDP A;  1L2D A;  1UM8 A;  3GRU A;  5C18 A;  5KPZ A;  4PDI A;  4GC5 A;  2QPA A;  1IBM M;  3IG8 A;  3B9P A;  3K2L A;  1WXQ A;  2O5R A;  3K92 A;  4I4L A;  3U6L A;  1TH3 A;  1YSY A;  3HU2 A;  1I94 M;  4IBK A;  3GPY A;  1G41 A;  2QEN A;  4DV2 M;  4RNA A;  1QYR A;  3E9S A;  3HHW A;  2I7P A;  3U6M A;  2L7I A;  1OFI A;  4IBB A;  4MGZ E;  3KFU G;  4A3V B;  3EIE A;  2XGN A;  4WUR A;  3TWK A;  3SMS A;  4ITQ A;  4D81 A;  1HNW M;  3FYD A;  4IIW A;  2XEP A;  3UZU A;  1IBK M;  4X62 M;  4B3M M;  1IXZ A;  4JI2 M;  4KO8 A;  3PNY A;  1G4A E;  3LQQ A;  3KSX A;  4L4U A;  4D80 A;  1GLN A;  4LZZ A;  4GKJ M;  1LV7 A;  3KP1 E;  1HQY E;  4GRI A;  4NSR A;  2AHM A;  3FTD A;  4B7F A;  1NNJ A;  4B3R M;  1T3T A;  4LJ9 A;  4G4O A;  4M9Z A;  3A42 A;  3T1Y M;  2C9C A;  2F4V M;  4B7H A;  3J7A S;  3TWM A;  2VQE M;  3U6D A;  2XSZ A;  2EUC A;  5ITY A;  3HHX A;  5JI2 E;  4ZPX A;  2A5Y B;  3U6P A;  4RF1 A;  3I51 A;  5FTN A;  2L09 A;  3HU1 A;  5EXS A;  4AZF A;  4JI5 M;  1DGH A;  2D7E A;  2F5O A;  2LWX A;  4QHT A;  3UK6 A;  1KFV A;  4JI6 M;  3HKP A;  1NNU C;  2ZAO A;  3VKH A;  4IJF A;  4JI8 M;  3GRR A;  4AKG A;  1HQC A;  2Y21 A;  3LVW A;  4LRT A;  4IJE A;  3T38 A;  4LJ5 A;  4FWD A;  4GKK M;  2CEA A;  1Q3C A;  2C98 A;  3AOE A;  3J81 S;  4MB7 A;  2CV2 A;  4QNM A;  1HNZ M;  4LCB A;  2EA0 A;  1IY0 A;  1I4W A;  8CAT A;  4B3S M;  3U6O A;  4LGM A;  1N32 M;  1JQJ C;  4BLC A;  3SC3 A;  2Y20 A;  1SXJ C;  3JR5 A;  5EJC A;  4YY3 M;  4FWG A;  1DGH B;  2BNK A;  1L8Q A;  2FNA A;  3T15 A;  3U5Z A;  1DO0 A;  2Z3X A;  1JR3 D;  3U60 A;  2J7N A;  4DV3 M;  3SYK A;  4IBI A;  4L78 A;  3OTO M;  4NL4 H;  1N75 A;  5FTK A;  3GQ4 A;  2DWN A;  4OX9 M;  4PCZ A;  2QBY A;  1IN4 A;  4AW4 A;  2XZU A;  3AL0 C;  4AKH A;  3FTC A;  1IN8 A;  3PNV A;  1TH2 A;  2FOI C;  2ZAM A;  2YFQ A;  2RGH A;  1OFH A;  1C1K A;  3TQS A;  1G8P A;  3HJQ A;  4DR3 M;  4JI3 M;  4LF9 M;  1QVR A;  4JN6 A;  4DR2 M;  1HNX M;  1IBL M;  3U6Q A;  3FUU A;  3U6S A;  3L28 A;  3U5Z B;  4FD2 A;  5EQT A;  2F5S A;  3U60 B;  3J7B A;  1PM5 A;  3GLF A;  1W5S A;  3L2A A;  3K8Z A;  4FCV A;  3E4R A;  2F5N A;  4G6Z A;  2XZF A;  4LG2 A;  2QBY B;  1D2N A;  1Q3B A;  3LMM A;  1QAM A;  3J27 B;  3HHZ A;  4IBG A;  4P16 A;  3GLI A;  4X66 M;  4B3T M;  2UXD M;  3WHK A;  1EE8 A;  1S3S A;  3SYL A;  2UUC M;  5JI3 E;  4MH0 E;  3L26 A;  2LH0 A;  4I8O A;  5EP2 A;  1XHB A;  4LFC M;  3W0F A;  3SBJ A;  3R9X B;  5IT9 S;  2KW0 A;  2L7H A;  5FTJ A;  3DA1 A;  4DR4 M;  3HHY A;  3D8L A;  4NOO B;  2XH9 A;  1L2C A;  2Z4R A;  1Q39 A;  2BJW A;  1IN5 A;  3KW6 A;  3TE6 A;  1W5T A;  2UUB M;  1L1T A;  5IWA M;  3FUT A;  1X37 A;  2KXE A;  1IY2 A;  4FWH A;  4GC9 A;  3ZC7 B;  4D82 A;  2V6Z M;  3A45 A;  3L27 A;  7CAT A;  3GLF B;  3KS8 A;  5EXT A;  2KZS A;  3SHF A;  3IG5 A;  2QZ4 A;  1DGF A;  3MJ5 A;  3CTW B;  2LNH C;  1XMQ M;  3U6E A;  4G4R A;  3UJN A;  4QHS A;  1KSF X;  2R4E A;  1GKI A;  2YNM D;  3GLI B;  1IM2 A;  4G4N A;  5KQD A;  3HWS A;  3ZH9 B;  3PXG A;  1VDD A;  4MGK E;  1NVM A;  1G59 A;  1DGB A;  4GH9 A;  3GPX A;  4GIT A;  4DV5 M;  1Z5C A;  2BJV A;  4K0K M;  1G3I A;  2Y0T A;  3FTF A;  3RGS A;  3KOY E;  2I7N A;  1GL6 A;  1Z6T A;  2KZU A;  3CF6 E;  1NSF A;  4LRS A;  4M0D A;  3HJS A;  4FCT A;  5ITX A;  4L16 A;  3SMP A;  4IBD A;  3EIH A;  2CV0 A;  4AQY M;  5A2Q S;  1J09 A;  4LF6 M;  3VLF B;  4OVZ A;  4QOZ C;  3RGP A;  4I5S A;  4LY6 A;  4QNR A;  5KPR A;  5KO3 A;  1IY1 A;  2DZO B;  2CUZ A;  3FTE A;  4JI7 M;  1IQP A;  1SXJ A;  2CFO A;  3LQR A;  4JV5 M;  3GQ3 A;  1QAQ A;  3D8B A;  4DR1 M;  4X65 M;  1IN6 A;  5DYI A;  3SAU A;  4S12 A;  3ILK A;  4GHA A;  3KVW A;  3J2P B;  4EIW A;  2Z7J A;  1N34 M;  1Z5A A;  1Z5B A;  4CGY B;  4REZ A;  3VK7 A;  4AKI A;  4M9X A;  5ITU A;  5FLX S;  1XMO M;  1N36 M;  3AOG A;  4MGH A;  3PVS A;  1QAO A;  4PDG A;  4YHH M;  1IXR C;  4GIP A;  4NRW A;  2RKO A;  2Z4S A;  3GRV A;  1FJG M;  3KSJ A;  4I81 A;  2XSZ D;  3GQ5 A;  1IXS B;  2R62 A;  3A98 B;  1DGG A;  3QAU A;  2M60 A;  4JI0 M;  3JR4 A;  5ITX E;  3KDS E;  3DZD A;  4OVZ B;  1TDZ A;  4AG6 A;  2CV1 A;  4L8R C;  4DR7 M;  2CHG A;  5KPT A;  1R6B X;  1XXH A;  1SXJ B;  3HJ8 A;  4FCW A;  4LFA M;  4B7G A;  3FUX A;  3KXE C;  2ZBK B;  4G4Q A;  3SAV A;  1YUB A;  1SXJ E;  2ZM6 M;  1NHG C;  3C58 A;  2X49 A;  4HLQ A;  3WHL A;  5BR8 M;  2KRU A;  4NSO B;  3GRY A;  3KOW E;  4LGY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...