4DV2M

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 24
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4dv2M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4dv2M02
3JR4A 4DV2M 1L1ZA 3A42A 2UXCM 4DV0M 1Z59A 4DR7M 1PJJA 4DUZM 1J5EM 4JI4M 2OQ4A 2UXBM 4CISA 4JI8M 4X66M 3J81S 3SATA 3JR5A 1K82A 3GQ5A 1NNJA 1HR0M 3A46A 4G4QA 3SAUA 1TDZA 4LF6M 4LF4M 2UUCM 1IBKM 1TDHA 3GQ3A 3U6SA 1FJGM 5FLXS 1MX0A 4LFAM 2F5OA 3U6QA 1K3XA 4K0KM 4JI1M 3GPUA 2VQFM 4DR3M 4DV3M 4B3MM 1N36M 4OX9M 3VK8A 1L2DA 3SASA 4G4NA 1IBLM 3GP1A 1N33M 1Z5BA 4DR4M 2F5PA 3U6MA 4NXMM 3VK7A 5BR8M 4JI2M 1Z5CA 2VQEM 4JI5M 4DR2M 4GKKM 3SBJA 1HNXM 4PDIA 1L1TA 5IT9S 4G4OA 4YY3M 4PD2A 5ITXE 1R2YA 4B3RM 4LFBM 1Q39A 2F5QA 4B3SM 1R2ZA 4PCZA 5ITQA 4DV1M 4X64M 4JV5M 3U6PA 4KHPM 5ITUA 4DUYM 1HNZM 1IBMM 3SARA 5A2QS 4ITQA 1XNRM 1HNWM 5ITRA 3J7AS 1Q3BA 1EE8A 4DR1M 2ZBKB 3T1HM 2UUBM 5LMUM 1K3WA 1N32M 1L2CA 4YHHM 4DV4M 4LFCM 1MU5A 4DR5M 3GPYA 1XC8A 1PJIA 2HHHM 2UU9M 4LF9M 2F4VM 4DR6M 4GKJM 3A45A 3T1YM 3C58A 1XMQM 3GPXA 1L2BA 4JI7M 3SAVA 3SAWA 3GPPA 2OPFA 1XMOM 2F5SA 3TWLA 3J80S 2XZFA 3JAMS 3OTOM 4JI6M 4JI0M 4AQYM 5ITXA 1I94M 3U6LA 2ZM6M 4PDGA 4DV5M 1PM5A 4G4RA 4NRVA 4DV7M 4DV6M 3TWMA 3W0FA 2HKJA 3GO8A 1Q3CA 3DOAA 4X62M 4JYAM 4LF5M 3U6OA 3U6EA 4LF7M 5ITTA 5IWAM 2EA0A 1XNQM 1Z5AA 4MB7A 3TWKA 1KFVA 4NRWA 4X65M 2Q2EB 3U6CA 3U6DA 5ITYA 1N34M 4NXNM 4JI3M 2XZUA 4LF8M 3GQ4A 2UXDM 4B3TM 2E5LM 2UUAM 2F5NA 5LMNM
chains in the Genus database with same CATH superfamily
1Z59A 2G8LA 1J5EM 2JA2A 3BOSA 3ZH9B 4JI4M 4GHLA 2FH0A 2OQ4A 2UXBM 1IN8A 1NSFA 1TH4A 3KOYE 3WHLA 4X66M 1OAIA 4DBGB 4F2LA 5FTNA 3AOGA 4L78A 5KQ8A 1OTRA 4RNAA 4LF6M 1YLAA 1IBKM 2XFSA 2EO2A 3GRUA 1TDHA 1SXJB 1DO2A 3GQ3A 1PJTA 1C1KA 2CHQA 5FLXS 1GO5A 3K8ZA 7CATA 1K3XA 4I81A 4KO8A 1QAQA 1ZV1A 1GJTA 2DVWB 2WSEF 2KHHA 2VQFM 3I51A 4DR3M 4DV3M 4QHSA 2KNVA 4ZPXA 1F4IA 2AHMA 3U60A 2ZANA 3K92A 1L2DA 3SASA 4P16A 3KSJA 1Z5BA 5EXSA 1GKIA 4IJEA 3T38A 3FTEA 4CJ6A 3U6MA 5EP3A 4M9ZA 5BR8M 3GLGA 3VK7A 4JI2M 2KW0A 1OJLA 1IN5A 3PNVA 4Z8XA 2ZTCA 2LH0A 3VKGA 2JUJA 2MGWA 1NJFA 1L8QA 3H4MA 5IT9S 1QZMA 2DI0A 4IBEA 4LJ5A 2F5QA 2O5RA 1YSYA 2YNMD 4LJ4A 2R62A 4MGYE 3U6PA 2J7NA 5BPVA 3I4VA 1S3SA 1WGLA 4FVMA 4GIPA 5EP1A 2DWLA 3DA1A 4FWDA 5ITRA 2X8AA 2QNJA 1QDTA 3U5ZA 3HJQA 3KP1E 2UUBM 3T1HM 1ZAEA 1H6UA 5LMUM 1JQJC 2RGHA 3LCUA 4LJ8A 1E32A 1YUBA 2DWZB 1YE9A 5E26A 1L2CA 4LFCM 2F4VM 4AI6A 3K1JA 4LF9M 2LHCA 4QHTA 1EIJA 3LMMA 1TH2A 2ERCA 5F3WA 2W82A 1NNUC 2Z3XA 2DWMA 4JI7M 4MH0E 3SAVA 1N78A 1D0KA 3C3DA 3QYBA 2OPFA 8CATA 1XMOM 1VG5A 2MROB 3UK6A 2BWEA 2OO9A 2LWXA 4AZFA 2DAKA 1DGFA 3LQQA 3B7ZA 3OTOM 2LVPC 1A5TA 2BJWA 2X4AA 1OIPA 3DZDA 5ITXA 3U6LA 4R3DA 1N75A 2RGOA 3EIHA 3FYDA 2ZM6M 4DV5M 2CP8A 2R65A 2QPAA 3FTDA 4OW0A 5DYGA 3HHXA 4I4LA 2HKJA 3KS8A 5KPTA 1R7RA 1JR3A 3HU1A 1Q3CA 2K47A 3TE6A 4F1IA 4REZA 4JYAM 4IBIA 3VLFB 3W68A 4LF7M 4LGMA 3HWSA 1IXZA 4IBGA 2DAMA 5IWAM 1BVSA 1XXHE 2R44A 1KFVA 3KOXE 3KSXA 3D8LA 3U61B 1N34M 1IM2A 3FKEA 4NXNM 2BWBA 4JI3M 2KEBA 4D80A 2QCUA 1JR3E 2CHGA 2Z7JA 2C98A 2E5LM 2C96A 2DXIA 3GRVA 1VEJA 3LVWA 2OOAA 4MGHA 1L1ZA 1IN6A 2XF3A 3E21A 2L4FA 3UJNA 4AG6A 1PJJA 2LVOC 3FYCA 1G41A 2QP9X 2VIIA 3QWLA 1QYRA 4JI8M 4GITA 3SATA 1VEKA 4KODA 3GQ5A 5IZ7D 3IG5A 2J7OA 4II7A 4WW0A 3RFWA 2V1CA 2WSCF 4MGZE 3U60B 3M6AA 4B7FA 2L09A 4KT0F 1MX0A 3VDPA 3I4YA 4CHTB 5DNYA 1DGHB 3PNYA 1WXQA 4LZJA 4WURA 5EJCA 3T15A 4A3VB 4LZZA 3UMMA 3HJSA 3SFZA 3TPZA 4B3MM 2KDLA 2KZSA 3J27B 1NY5A 1R4GA 2CUZA 1ZMUA 4XBOA 4G4NA 1NV8A 2H1RA 3HX3A 1IBLM 1N33M 5KQDA 2JY6B 4DR4M 1QVRA 2ZTDA 2F5PA 1TR8A 4NXMM 4AKGA 3L25A 3VFDA 1OFHA 1IFYA 3FUXA 4JI5M 2EKFA 3HY5A 3GLHA 3KS4A 4FWHA 2XLJA 4EIWA 2C9CA 4DR2M 3L2AA 4PDIA 3BBZA 2CRUA 1D0LA 4YY3M 2CV0A 1R2YA 1WHCA 1Q39A 2P5TA 2HAKA 1WJ7A 2F5NA 4B3SM 2K0BX 2LVQD 1SXJD 2VDBB 5JI2E 3HKPA 2XSZD 2R46A 1D2NA 3B7NA 3GRYA 3LVVA 3NBXX 4DUYM 2DZOB 3A98B 5A2QS 3PFIA 1QQWA 5IREB 1XNRM 2LVAA 4G3OA 2B3TA 4AKIA 1LTMA 1Q3BA 2Z8YM 2CEAA 2ZBKB 1OQYA 2DAGA 3GLIA 2K9DA 1NO1A 3L28A 1IN4A 2DZNB 3CGWA 1IN7A 2GNOA 4AW4A 1IY2A 1R6BX 2ZAMA 4IBFA 2L7HA 4R7GA 4DR5M 4FCTA 1XC8A 2O01F 2UU9M 2CFOA 3B7QA 4DR6M 4GKJM 3T1YM 4LRTA 3K9OA 3C58A 1G4AE 2GQFA 5KPZA 1HQCA 1IXSA 2XH9A 3GPXA 1L2BA 2QBYB 3GLGE 1NVMA 3GPPA 1VQ1A 3TWLA 3HHZA 2M5ZA 2R6FA 3J80S 2XZFA 1G59A 3GLHB 2D7GA 3KOWE 2KNZA 2CV1A 2HWJA 4BBAA 1VEGA 1EFUB 4I8OA 3V76A 1VDDA 2HL7A 1GJSA 2R4JA 4M9SA 4PDGA 4G4RA 1PM5A 3FTFA 3MJ5A 1QANA 2VF8A 4I5SA 4DV7M 4P17A 4DV6M 1C7YA 1DO0A 3TWMA 4B7GA 1HT2E 1KYIA 2KA6B 2ZAOA 3U6OA 4QNRA 4AKHA 3U6EA 1G71A 1VDLA 4LRSA 1PRBA 1E9RA 4LJAA 1AUAA 2YR0A 2EKKA 3KW6A 4KLNA 3WHKA 1XNQM 4MB7A 3TWKA 1XXHB 3AOEC 1Q02A 3U6DA 1T6OA 5ITYA 4M0WA 2C9OA 1HJPA 3I04M 4UN2B 4LF8M 1OAOC 1NHWC 3GQ4A 2DKLA 1SXJC 2JNHA 4M0DA 4CIZA 3MK6A 2UUAM 3FUVA 4IIWA 4NL4H 5KPRA 3JR4A 4DV2M 5EQTA 1MN3A 3A42A 4DV0M 2UXCM 4QNMA 2DNAA 4DR7M 4DUZM 5C1BA 4GRIA 3FUTA 2DWNA 1NHGC 5FTJA 3HZJA 1QUSA 3J81S 3MHVC 4BB9A 3JR5A 1XB2B 5DFLA 1HR0M 3A46A 1TDZA 3D8BA 1GABA 2LTUA 1FNNA 2YQZA 4LJ6A 1AIPC 1V33A 3AKZA 2UUCM 3ZQJA 3U6SA 1FJGM 4FCVA 2APLA 2H5XA 4LFAM 4JXJA 2F5OA 2VF7A 4D81A 4K0KM 4JI1M 2R4EA 2FS1A 3QYEA 4GC5A 1Z6TA 3GRRA 4S12A 1P3QQ 1QAMA 4L15A 3VK8A 3Q8XA 3AV0A 3QAUA 3GP1A 5DYIA 3LW5F 3PVSA 3BXWA 3HHWA 2V1UA 4L4UA 3SYLA 1ZQ9A 3KDSE 2VQEM 1N77A 4NOOB 4GKKM 4IBJA 5FTMA 2JY7A 4PD2A 4LFBM 1QAOA 2C5RA 3W0LB 4L16A 4NSRA 4HEOA 4W5WA 3K2LA 4PCZA 1R2ZA 3SMSA 2X49A 4Q7JA 4B7HA 2DHYA 3B89A 3KXEC 2KNAA 4X64M 4JV5M 2FNAA 4NC6A 1IBMM 2EUCA 2XSZA 3L29A 1LV7A 4GC9A 3SHGB 1SXJA 1IXRC 3J7AS 1E94E 3AL0C 1GL6A 1IXSB 4LJ7A 4XK8F 2Y21A 2QBYA 2LVNC 1K3WA 2JZ1A 3E4RA 4DV4M 4B08A 1DGBA 1R5LA 3DFZA 3FE3A 3GPYA 2HHHM 3A45A 5FSWA 3R9XB 1OFIA 1G3IA 1G8PA 1ZMWA 4NSOB 3TL4X 1V34A 1SXJE 2D7HA 5EXTA 1NV9A 3GLGB 2DHRA 3CTWB 2N35A 1MJGM 4IBDA 3M0EA 2O25A 1V92A 3EIEA 3JAMS 3B74A 1I4WA 3THGA 4JI6M 1GVNA 1XHBA 2G3QA 1J7KA 2KXEA 2QZ4A 1I94M 3UZUA 4XGIA 2KRUA 1HQYE 3C3EA 4OVZA 3CF0A 4WP2A 1J09A 3KOZE 2CV2A 3UGJA 4JN6A 5EXPA 3GO8A 4L8RC 2YFQA 3FUWA 2JZ0A 3FRIA 3GLFA 1WGNA 2FFJA 2K6BA 2QQ8A 3B9PA 1QZEA 2MJ5B 1CUKA 2G5GX 5EXXA 1PJSA 3LQRA 3KFUG 4X65M 2Q2EB 1WIVA 3RGPA 2QHOB 2BNKA 3HU2A 2L4EA 1DGGA 2BJVA 2JY5A 3W67A 3ZCBB 5H37D 2WSFF 1NY6A 3F92A 4GMQA 2XGNA 4FD2A 4PT5A 3HGIA 4MM3B 1NJGA 2L2DA 3GLFE 1UFZA 5LMNM 3C9PA 3HU3A 4MGKE 2HCBA 2M60A 2JP7A 2XFTA 3K9PA 4CISA 3KVWA 1T43A 4RF1A 1K82A 1PGYA 1ZMVA 1NNJA 2KZUA 2V6ZM 4G4QA 3SAUA 4LG2A 1JR3D 2L6OA 1GLNA 4LF4M 4HLQA 3KP0E 3LCVB 4GHAA 3CF2A 4CGYB 1W5SA 3U6QA 3VKHA 2LBCA 3AOEA 3GPUA 3GLIB 1SG9A 3E9SA 4RF0A 3MMPA 2CWBA 2KRKA 1D0MA 4QOSA 4AG5A 5FTKA 1N36M 4Z6YA 3J7BA 4OX9M 1ORYB 4IBCA 3SYKA 3FTCA 4LGYA 3AFHA 3TQSA 3ZC7B 5C18A 1TH3A 3PXGA 5EP2A 3FD9A 2JXNA 1RU3A 5JI3E 1QDRA 2NQ8C 1IQPA 3U61A 2FOIC 3J2PB 4RKUF 2Y0TA 2Y0QA 3GLHE 3Q8GA 5EP4A 3H4JA 3SC3A 4L6V6 2Z4SA 4FCWA 1Z5CA 2R18A 1KSFX 2DAIA 3SBJA 1HNXM 4IBKA 2QENA 1L1TA 2MH8A 4G4OA 1W5TA 5ITXE 3HJ8A 4B3RM 4QOZC 3L27A 3NBIA 3U5ZB 5ITQA 2OOBA 4DV1M 4LY6A 3IG8A 2DENA 2Z4RA 3T6PA 4FWGA 2RRUA 4KHPM 2I7PA 5ITUA 1HNZM 2LXEA 3R8FA 1TF0B 3SARA 4ITQA 3E46A 1OKSA 3ILKA 1OIZA 1HNWM 4MGIE 1EE8A 1PJQA 1XXHA 4DR1M 1N32M 1TGUA 2D7EA 3RGSA 1DV0A 1XWIA 2DAEA 4YHHM 3GLFB 1MU5A 4D82A 2CE7A 3GLIE 1PJIA 4ANRA 2C99A 5E6JA 2DZLA 4BLCA 1QUTA 4LCBA 3IHPA 1XMQM 4IBBA 2R0IA 1TTEA 1WR1B 5L8RF 3SAWA 1IY1A 1GL7A 1UM8A 2A5YB 4IJFA 2F5SA 4G6ZA 4M9XA 2RKOA 2JY8A 3M7GA 5GKNA 2L7IA 4FW9A 4GH9A 2JWSA 4JI0M 3IECA 4AQYM 2I7NA 2LHGA 4HL4A 4GEWA 1HT1E 2LNHC 2J5YA 4NRVA 4LJ9A 3NWLA 3W0FA 1T3TA 5FTLA 2EJSA 3DOAA 4X62M 2XEPA 3SMPA 4LF5M 2Y20A 2FE8A 3HHYA 2R45A 2WZJA 3RE8A 5ITTA 4TUWA 2MR9A 2EA0A 3AJIB 1Y8GA 4OVZB 1Z5AA 4NRWA 4OU7A 4R71A 3L26A 3U6CA 1X37A 1DGHA 5KO3A 3CF6E 2XZUA 2QSFX 2UXDM 3FUUA 2CHVA 3FRHA 3I01M 4B3TM 1E9SA 1JB0F 3SHFA 4Y28F 1IY0A 3VDUA
chains in the Genus database with same CATH topology
1Z59A 2G8LA 1J5EM 2JA2A 3BOSA 3ZH9B 4JI4M 4GHLA 2OQ4A 2UXBM 1IN8A 1NSFA 1TH4A 3KOYE 3WHLA 4X66M 5FTNA 3AOGA 4L78A 5KQ8A 4LF6M 4RNAA 1IBKM 2XFSA 2EO2A 3GRUA 1TDHA 1SXJB 1DO2A 3GQ3A 1C1KA 2CHQA 5FLXS 3K8ZA 7CATA 1K3XA 4I81A 4KO8A 1QAQA 2DVWB 2VQFM 3I51A 4DR3M 4DV3M 4QHSA 4ZPXA 2AHMA 3U60A 2ZANA 3K92A 1L2DA 3SASA 4P16A 3KSJA 1Z5BA 5EXSA 1GKIA 4IJEA 3T38A 3FTEA 3U6MA 5EP3A 4M9ZA 5BR8M 3GLGA 3VK7A 4JI2M 2KW0A 1OJLA 1IN5A 3PNVA 4Z8XA 2LH0A 3VKGA 1NJFA 1L8QA 3H4MA 5IT9S 1QZMA 4LJ5A 4IBEA 2F5QA 2O5RA 1YSYA 2YNMD 4LJ4A 2R62A 4MGYE 3U6PA 2J7NA 5BPVA 3I4VA 1S3SA 4FVMA 4GIPA 5EP1A 2DWLA 3DA1A 4FWDA 5ITRA 2X8AA 3U5ZA 3HJQA 3KP1E 2UUBM 3T1HM 1ZAEA 1H6UA 5LMUM 1JQJC 2RGHA 4LJ8A 1L2CA 1E32A 1YUBA 2DWZB 1YE9A 5E26A 4LFCM 2F4VM 4AI6A 3K1JA 4LF9M 4QHTA 3LMMA 1TH2A 2ERCA 5F3WA 2W82A 1NNUC 2Z3XA 2DWMA 4JI7M 4MH0E 3SAVA 1N78A 2OPFA 8CATA 1XMOM 3UK6A 4AZFA 2LWXA 1DGFA 3LQQA 3OTOM 2X4AA 2BJWA 3DZDA 5ITXA 3U6LA 4R3DA 1N75A 2RGOA 3EIHA 3FYDA 2ZM6M 4DV5M 2R65A 2QPAA 3FTDA 4OW0A 5DYGA 3HHXA 4I4LA 2HKJA 3KS8A 5KPTA 1R7RA 1JR3A 3HU1A 1Q3CA 2K47A 3TE6A 4JYAM 4REZA 4IBIA 3VLFB 4LF7M 4LGMA 3HWSA 1IXZA 4IBGA 5IWAM 1KFVA 3KOXE 3KSXA 3D8LA 3U61B 1N34M 1IM2A 3FKEA 4NXNM 4JI3M 2KEBA 4D80A 2QCUA 2CHGA 2Z7JA 2C98A 2E5LM 2C96A 2DXIA 3GRVA 3LVWA 4MGHA 1L1ZA 1IN6A 2XF3A 3UJNA 4AG6A 1PJJA 3FYCA 1G41A 2QP9X 2VIIA 3QWLA 1QYRA 4JI8M 4GITA 3SATA 4KODA 3GQ5A 5IZ7D 3IG5A 2J7OA 4II7A 4WW0A 3RFWA 2V1CA 4MGZE 3U60B 3M6AA 4B7FA 2L09A 1MX0A 3VDPA 3I4YA 4CHTB 5DNYA 1DGHB 3PNYA 1WXQA 4LZJA 4WURA 5EJCA 3T15A 4A3VB 4LZZA 3UMMA 3HJSA 3SFZA 3TPZA 4B3MM 2KZSA 3J27B 1NY5A 2CUZA 4G4NA 4XBOA 1IBLM 2H1RA 1N33M 5KQDA 4DR4M 1QVRA 2F5PA 4NXMM 4AKGA 3L25A 3VFDA 1OFHA 3FUXA 4JI5M 3GLHA 3KS4A 4FWHA 2XLJA 4EIWA 2C9CA 4DR2M 3L2AA 4PDIA 2CV0A 4YY3M 1R2YA 1Q39A 2P5TA 4B3SM 1SXJD 5JI2E 3HKPA 2XSZD 2R46A 1D2NA 3GRYA 3LVVA 4DUYM 2DZOB 3A98B 5A2QS 3PFIA 1QQWA 5IREB 1XNRM 4AKIA 1Q3BA 2CEAA 2ZBKB 3GLIA 3L28A 1IN4A 2DZNB 1IN7A 4DR5M 4AW4A 1IY2A 1R6BX 2ZAMA 4IBFA 2L7HA 4R7GA 1XC8A 4FCTA 2UU9M 2CFOA 4DR6M 4GKJM 3T1YM 4LRTA 3C58A 1G4AE 5KPZA 1HQCA 2XH9A 3GPXA 1L2BA 2QBYB 1NVMA 3GPPA 3TWLA 3HHZA 2M5ZA 1G59A 3J80S 2XZFA 3GLHB 2D7GA 3KOWE 2CV1A 4BBAA 4I8OA 1VDDA 2HL7A 2R4JA 4M9SA 4PDGA 4G4RA 1PM5A 3FTFA 3MJ5A 1QANA 4I5SA 4DV7M 4DV6M 1DO0A 3TWMA 4B7GA 1HT2E 1KYIA 2KA6B 2ZAOA 3U6OA 4QNRA 4AKHA 3U6EA 4LRSA 1E9RA 4LJAA 2YR0A 3KW6A 4KLNA 1XNQM 3WHKA 4MB7A 3TWKA 1XXHB 3AOEC 3U6DA 5ITYA 4M0WA 2C9OA 4LF8M 1NHWC 3GQ4A 1SXJC 4M0DA 3MK6A 2UUAM 3FUVA 4IIWA 4NL4H 5KPRA 3JR4A 4DV2M 5EQTA 3A42A 2UXCM 4DV0M 4QNMA 4DR7M 4DUZM 5C1BA 4GRIA 3FUTA 2DWNA 1NHGC 5FTJA 3J81S 3MHVC 4BB9A 3JR5A 1HR0M 3A46A 1TDZA 3D8BA 4LJ6A 1FNNA 2YQZA 3AKZA 2UUCM 3U6SA 1FJGM 4FCVA 4LFAM 4JXJA 2F5OA 4D81A 4K0KM 4JI1M 2R4EA 4GC5A 1Z6TA 3GRRA 4S12A 1QAMA 4L15A 3VK8A 3Q8XA 3AV0A 3QAUA 3GP1A 5DYIA 3PVSA 3HHWA 2V1UA 4L4UA 3SYLA 1ZQ9A 3KDSE 2VQEM 1N77A 4NOOB 4GKKM 4IBJA 5FTMA 4PD2A 4LFBM 1QAOA 2C5RA 3W0LB 4L16A 4NSRA 4W5WA 1R2ZA 3K2LA 4PCZA 3SMSA 2X49A 4B7HA 3KXEC 4X64M 4JV5M 2FNAA 1IBMM 2EUCA 2XSZA 3L29A 1LV7A 4GC9A 3SHGB 1SXJA 1IXRC 3J7AS 1E94E 3AL0C 1GL6A 1IXSB 4LJ7A 2QBYA 2Y21A 1K3WA 3E4RA 4DV4M 4B08A 1DGBA 3GPYA 3DFZA 2HHHM 3A45A 5FSWA 3R9XB 1OFIA 1G3IA 1G8PA 4NSOB 3TL4X 1SXJE 2D7HA 5EXTA 3GLGB 2DHRA 3CTWB 4IBDA 3M0EA 3EIEA 3JAMS 1I4WA 3THGA 4JI6M 1GVNA 1XHBA 2KXEA 1J7KA 2QZ4A 1I94M 3UZUA 4XGIA 2KRUA 1HQYE 4OVZA 3CF0A 1J09A 3KOZE 2CV2A 3UGJA 4JN6A 5EXPA 3GO8A 4L8RC 2YFQA 3FUWA 3GLFA 2FFJA 3B9PA 5EXXA 2G5GX 3LQRA 3KFUG 4X65M 2Q2EB 3RGPA 2BNKA 3HU2A 5H37D 1DGGA 2BJVA 3ZCBB 1NY6A 4GMQA 2XGNA 4FD2A 4PT5A 3HGIA 4MM3B 1NJGA 5LMNM 3HU3A 4MGKE 2HCBA 2M60A 2XFTA 4CISA 3KVWA 4RF1A 1K82A 1NNJA 2KZUA 2V6ZM 4G4QA 3SAUA 4LG2A 1JR3D 2L6OA 1GLNA 4LF4M 4HLQA 3KP0E 4GHAA 3CF2A 4CGYB 1W5SA 3U6QA 3VKHA 3AOEA 3GPUA 3GLIB 3E9SA 4RF0A 4AG5A 2KRKA 4QOSA 5FTKA 1N36M 4Z6YA 3J7BA 4OX9M 1ORYB 4IBCA 3SYKA 3FTCA 4LGYA 3AFHA 3TQSA 3ZC7B 5C18A 1TH3A 3PXGA 5EP2A 3FD9A 5JI3E 2NQ8C 1IQPA 3U61A 2FOIC 3J2PB 2Y0TA 2Y0QA 5EP4A 3SC3A 2Z4SA 4FCWA 1Z5CA 2R18A 1KSFX 3SBJA 1HNXM 4IBKA 2QENA 1L1TA 4G4OA 1W5TA 5ITXE 3HJ8A 4B3RM 4QOZC 3L27A 3NBIA 3U5ZB 5ITQA 4DV1M 4LY6A 3IG8A 2Z4RA 4FWGA 4KHPM 2I7PA 5ITUA 1HNZM 2LXEA 3R8FA 3SARA 4ITQA 3ILKA 1HNWM 4MGIE 1EE8A 1XXHA 4DR1M 1N32M 1TGUA 2D7EA 3RGSA 1XWIA 4YHHM 3GLFB 1MU5A 4D82A 2CE7A 1PJIA 2C99A 5E6JA 4BLCA 4LCBA 1XMQM 4IBBA 3SAWA 1IY1A 1GL7A 1UM8A 2A5YB 4IJFA 2F5SA 4G6ZA 4M9XA 2RKOA 3M7GA 5GKNA 2L7IA 4FW9A 4GH9A 4JI0M 4AQYM 2I7NA 4HL4A 1HT1E 2LNHC 4NRVA 4LJ9A 3NWLA 3W0FA 1T3TA 5FTLA 3DOAA 4X62M 2XEPA 3SMPA 4LF5M 2Y20A 2FE8A 3HHYA 2R45A 3RE8A 5ITTA 4TUWA 2EA0A 3AJIB 4OVZB 1Z5AA 4NRWA 4OU7A 3L26A 3U6CA 1X37A 1DGHA 5KO3A 3CF6E 2XZUA 2UXDM 3FUUA 2CHVA 4B3TM 1E9SA 3SHFA 2F5NA 1IY0A 3VDUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JR4 A;  4DV2 M;  1L1Z A;  3A42 A;  2UXC M;  4DV0 M;  1Z59 A;  4DR7 M;  1PJJ A;  4DUZ M;  1J5E M;  4JI4 M;  2OQ4 A;  2UXB M;  4CIS A;  4JI8 M;  4X66 M;  3J81 S;  3SAT A;  3JR5 A;  1K82 A;  3GQ5 A;  1NNJ A;  1HR0 M;  3A46 A;  4G4Q A;  3SAU A;  1TDZ A;  4LF6 M;  4LF4 M;  2UUC M;  1IBK M;  1TDH A;  3GQ3 A;  3U6S A;  1FJG M;  5FLX S;  1MX0 A;  4LFA M;  2F5O A;  3U6Q A;  1K3X A;  4K0K M;  4JI1 M;  3GPU A;  2VQF M;  4DR3 M;  4DV3 M;  4B3M M;  1N36 M;  4OX9 M;  3VK8 A;  1L2D A;  3SAS A;  4G4N A;  1IBL M;  3GP1 A;  1N33 M;  1Z5B A;  4DR4 M;  2F5P A;  3U6M A;  4NXM M;  3VK7 A;  5BR8 M;  4JI2 M;  1Z5C A;  2VQE M;  4JI5 M;  4DR2 M;  4GKK M;  3SBJ A;  1HNX M;  4PDI A;  1L1T A;  5IT9 S;  4G4O A;  4YY3 M;  4PD2 A;  5ITX E;  1R2Y A;  4B3R M;  4LFB M;  1Q39 A;  2F5Q A;  4B3S M;  1R2Z A;  4PCZ A;  5ITQ A;  4DV1 M;  4X64 M;  4JV5 M;  3U6P A;  4KHP M;  5ITU A;  4DUY M;  1HNZ M;  1IBM M;  3SAR A;  5A2Q S;  4ITQ A;  1XNR M;  1HNW M;  5ITR A;  3J7A S;  1Q3B A;  1EE8 A;  4DR1 M;  2ZBK B;  3T1H M;  2UUB M;  5LMU M;  1K3W A;  1N32 M;  1L2C A;  4YHH M;  4DV4 M;  4LFC M;  1MU5 A;  4DR5 M;  3GPY A;  1XC8 A;  1PJI A;  2HHH M;  2UU9 M;  4LF9 M;  2F4V M;  4DR6 M;  4GKJ M;  3A45 A;  3T1Y M;  3C58 A;  1XMQ M;  3GPX A;  1L2B A;  4JI7 M;  3SAV A;  3SAW A;  3GPP A;  2OPF A;  1XMO M;  2F5S A;  3TWL A;  3J80 S;  2XZF A;  3JAM S;  3OTO M;  4JI6 M;  4JI0 M;  4AQY M;  5ITX A;  1I94 M;  3U6L A;  2ZM6 M;  4PDG A;  4DV5 M;  1PM5 A;  4G4R A;  4NRV A;  4DV7 M;  4DV6 M;  3TWM A;  3W0F A;  2HKJ A;  3GO8 A;  1Q3C A;  3DOA A;  4X62 M;  4JYA M;  4LF5 M;  3U6O A;  3U6E A;  4LF7 M;  5ITT A;  5IWA M;  2EA0 A;  1XNQ M;  1Z5A A;  4MB7 A;  3TWK A;  1KFV A;  4NRW A;  4X65 M;  2Q2E B;  3U6C A;  3U6D A;  5ITY A;  1N34 M;  4NXN M;  4JI3 M;  2XZU A;  4LF8 M;  3GQ4 A;  2UXD M;  4B3T M;  2E5L M;  2UUA M;  2F5N A;  5LMN M; 
#chains in the Genus database with same CATH topology
 1Z59 A;  2G8L A;  1J5E M;  2JA2 A;  3BOS A;  3ZH9 B;  4JI4 M;  4GHL A;  2FH0 A;  2OQ4 A;  2UXB M;  1IN8 A;  1NSF A;  1TH4 A;  3KOY E;  3WHL A;  4X66 M;  1OAI A;  4DBG B;  4F2L A;  5FTN A;  3AOG A;  4L78 A;  5KQ8 A;  1OTR A;  4RNA A;  4LF6 M;  1YLA A;  1IBK M;  2XFS A;  2EO2 A;  3GRU A;  1TDH A;  1SXJ B;  1DO2 A;  3GQ3 A;  1PJT A;  1C1K A;  2CHQ A;  5FLX S;  1GO5 A;  3K8Z A;  7CAT A;  1K3X A;  4I81 A;  4KO8 A;  1QAQ A;  1ZV1 A;  1GJT A;  2DVW B;  2WSE F;  2KHH A;  2VQF M;  3I51 A;  4DR3 M;  4DV3 M;  4QHS A;  2KNV A;  4ZPX A;  1F4I A;  2AHM A;  3U60 A;  2ZAN A;  3K92 A;  1L2D A;  3SAS A;  4P16 A;  3KSJ A;  1Z5B A;  5EXS A;  1GKI A;  4IJE A;  3T38 A;  3FTE A;  4CJ6 A;  3U6M A;  5EP3 A;  4M9Z A;  5BR8 M;  3GLG A;  3VK7 A;  4JI2 M;  2KW0 A;  1OJL A;  1IN5 A;  3PNV A;  4Z8X A;  2ZTC A;  2LH0 A;  3VKG A;  2JUJ A;  2MGW A;  1NJF A;  1L8Q A;  3H4M A;  5IT9 S;  1QZM A;  2DI0 A;  4IBE A;  4LJ5 A;  2F5Q A;  2O5R A;  1YSY A;  2YNM D;  4LJ4 A;  2R62 A;  4MGY E;  3U6P A;  2J7N A;  5BPV A;  3I4V A;  1S3S A;  1WGL A;  4FVM A;  4GIP A;  5EP1 A;  2DWL A;  3DA1 A;  4FWD A;  5ITR A;  2X8A A;  2QNJ A;  1QDT A;  3U5Z A;  3HJQ A;  3KP1 E;  2UUB M;  3T1H M;  1ZAE A;  1H6U A;  5LMU M;  1JQJ C;  2RGH A;  3LCU A;  4LJ8 A;  1E32 A;  1YUB A;  2DWZ B;  1YE9 A;  5E26 A;  1L2C A;  4LFC M;  2F4V M;  4AI6 A;  3K1J A;  4LF9 M;  2LHC A;  4QHT A;  1EIJ A;  3LMM A;  1TH2 A;  2ERC A;  5F3W A;  2W82 A;  1NNU C;  2Z3X A;  2DWM A;  4JI7 M;  4MH0 E;  3SAV A;  1N78 A;  1D0K A;  3C3D A;  3QYB A;  2OPF A;  8CAT A;  1XMO M;  1VG5 A;  2MRO B;  3UK6 A;  2BWE A;  2OO9 A;  2LWX A;  4AZF A;  2DAK A;  1DGF A;  3LQQ A;  3B7Z A;  3OTO M;  2LVP C;  1A5T A;  2BJW A;  2X4A A;  1OIP A;  3DZD A;  5ITX A;  3U6L A;  4R3D A;  1N75 A;  2RGO A;  3EIH A;  3FYD A;  2ZM6 M;  4DV5 M;  2CP8 A;  2R65 A;  2QPA A;  3FTD A;  4OW0 A;  5DYG A;  3HHX A;  4I4L A;  2HKJ A;  3KS8 A;  5KPT A;  1R7R A;  1JR3 A;  3HU1 A;  1Q3C A;  2K47 A;  3TE6 A;  4F1I A;  4REZ A;  4JYA M;  4IBI A;  3VLF B;  3W68 A;  4LF7 M;  4LGM A;  3HWS A;  1IXZ A;  4IBG A;  2DAM A;  5IWA M;  1BVS A;  1XXH E;  2R44 A;  1KFV A;  3KOX E;  3KSX A;  3D8L A;  3U61 B;  1N34 M;  1IM2 A;  3FKE A;  4NXN M;  2BWB A;  4JI3 M;  2KEB A;  4D80 A;  2QCU A;  1JR3 E;  2CHG A;  2Z7J A;  2C98 A;  2E5L M;  2C96 A;  2DXI A;  3GRV A;  1VEJ A;  3LVW A;  2OOA A;  4MGH A;  1L1Z A;  1IN6 A;  2XF3 A;  3E21 A;  2L4F A;  3UJN A;  4AG6 A;  1PJJ A;  2LVO C;  3FYC A;  1G41 A;  2QP9 X;  2VII A;  3QWL A;  1QYR A;  4JI8 M;  4GIT A;  3SAT A;  1VEK A;  4KOD A;  3GQ5 A;  5IZ7 D;  3IG5 A;  2J7O A;  4II7 A;  4WW0 A;  3RFW A;  2V1C A;  2WSC F;  4MGZ E;  3U60 B;  3M6A A;  4B7F A;  2L09 A;  4KT0 F;  1MX0 A;  3VDP A;  3I4Y A;  4CHT B;  5DNY A;  1DGH B;  3PNY A;  1WXQ A;  4LZJ A;  4WUR A;  5EJC A;  3T15 A;  4A3V B;  4LZZ A;  3UMM A;  3HJS A;  3SFZ A;  3TPZ A;  4B3M M;  2KDL A;  2KZS A;  3J27 B;  1NY5 A;  1R4G A;  2CUZ A;  1ZMU A;  4XBO A;  4G4N A;  1NV8 A;  2H1R A;  3HX3 A;  1IBL M;  1N33 M;  5KQD A;  2JY6 B;  4DR4 M;  1QVR A;  2ZTD A;  2F5P A;  1TR8 A;  4NXM M;  4AKG A;  3L25 A;  3VFD A;  1OFH A;  1IFY A;  3FUX A;  4JI5 M;  2EKF A;  3HY5 A;  3GLH A;  3KS4 A;  4FWH A;  2XLJ A;  4EIW A;  2C9C A;  4DR2 M;  3L2A A;  4PDI A;  3BBZ A;  2CRU A;  1D0L A;  4YY3 M;  2CV0 A;  1R2Y A;  1WHC A;  1Q39 A;  2P5T A;  2HAK A;  1WJ7 A;  2F5N A;  4B3S M;  2K0B X;  2LVQ D;  1SXJ D;  2VDB B;  5JI2 E;  3HKP A;  2XSZ D;  2R46 A;  1D2N A;  3B7N A;  3GRY A;  3LVV A;  3NBX X;  4DUY M;  2DZO B;  3A98 B;  5A2Q S;  3PFI A;  1QQW A;  5IRE B;  1XNR M;  2LVA A;  4G3O A;  2B3T A;  4AKI A;  1LTM A;  1Q3B A;  2Z8Y M;  2CEA A;  2ZBK B;  1OQY A;  2DAG A;  3GLI A;  2K9D A;  1NO1 A;  3L28 A;  1IN4 A;  2DZN B;  3CGW A;  1IN7 A;  2GNO A;  4AW4 A;  1IY2 A;  1R6B X;  2ZAM A;  4IBF A;  2L7H A;  4R7G A;  4DR5 M;  4FCT A;  1XC8 A;  2O01 F;  2UU9 M;  2CFO A;  3B7Q A;  4DR6 M;  4GKJ M;  3T1Y M;  4LRT A;  3K9O A;  3C58 A;  1G4A E;  2GQF A;  5KPZ A;  1HQC A;  1IXS A;  2XH9 A;  3GPX A;  1L2B A;  2QBY B;  3GLG E;  1NVM A;  3GPP A;  1VQ1 A;  3TWL A;  3HHZ A;  2M5Z A;  2R6F A;  3J80 S;  2XZF A;  1G59 A;  3GLH B;  2D7G A;  3KOW E;  2KNZ A;  2CV1 A;  2HWJ A;  4BBA A;  1VEG A;  1EFU B;  4I8O A;  3V76 A;  1VDD A;  2HL7 A;  1GJS A;  2R4J A;  4M9S A;  4PDG A;  4G4R A;  1PM5 A;  3FTF A;  3MJ5 A;  1QAN A;  2VF8 A;  4I5S A;  4DV7 M;  4P17 A;  4DV6 M;  1C7Y A;  1DO0 A;  3TWM A;  4B7G A;  1HT2 E;  1KYI A;  2KA6 B;  2ZAO A;  3U6O A;  4QNR A;  4AKH A;  3U6E A;  1G71 A;  1VDL A;  4LRS A;  1PRB A;  1E9R A;  4LJA A;  1AUA A;  2YR0 A;  2EKK A;  3KW6 A;  4KLN A;  3WHK A;  1XNQ M;  4MB7 A;  3TWK A;  1XXH B;  3AOE C;  1Q02 A;  3U6D A;  1T6O A;  5ITY A;  4M0W A;  2C9O A;  1HJP A;  3I04 M;  4UN2 B;  4LF8 M;  1OAO C;  1NHW C;  3GQ4 A;  2DKL A;  1SXJ C;  2JNH A;  4M0D A;  4CIZ A;  3MK6 A;  2UUA M;  3FUV A;  4IIW A;  4NL4 H;  5KPR A;  3JR4 A;  4DV2 M;  5EQT A;  1MN3 A;  3A42 A;  4DV0 M;  2UXC M;  4QNM A;  2DNA A;  4DR7 M;  4DUZ M;  5C1B A;  4GRI A;  3FUT A;  2DWN A;  1NHG C;  5FTJ A;  3HZJ A;  1QUS A;  3J81 S;  3MHV C;  4BB9 A;  3JR5 A;  1XB2 B;  5DFL A;  1HR0 M;  3A46 A;  1TDZ A;  3D8B A;  1GAB A;  2LTU A;  1FNN A;  2YQZ A;  4LJ6 A;  1AIP C;  1V33 A;  3AKZ A;  2UUC M;  3ZQJ A;  3U6S A;  1FJG M;  4FCV A;  2APL A;  2H5X A;  4LFA M;  4JXJ A;  2F5O A;  2VF7 A;  4D81 A;  4K0K M;  4JI1 M;  2R4E A;  2FS1 A;  3QYE A;  4GC5 A;  1Z6T A;  3GRR A;  4S12 A;  1P3Q Q;  1QAM A;  4L15 A;  3VK8 A;  3Q8X A;  3AV0 A;  3QAU A;  3GP1 A;  5DYI A;  3LW5 F;  3PVS A;  3BXW A;  3HHW A;  2V1U A;  4L4U A;  3SYL A;  1ZQ9 A;  3KDS E;  2VQE M;  1N77 A;  4NOO B;  4GKK M;  4IBJ A;  5FTM A;  2JY7 A;  4PD2 A;  4LFB M;  1QAO A;  2C5R A;  3W0L B;  4L16 A;  4NSR A;  4HEO A;  4W5W A;  3K2L A;  4PCZ A;  1R2Z A;  3SMS A;  2X49 A;  4Q7J A;  4B7H A;  2DHY A;  3B89 A;  3KXE C;  2KNA A;  4X64 M;  4JV5 M;  2FNA A;  4NC6 A;  1IBM M;  2EUC A;  2XSZ A;  3L29 A;  1LV7 A;  4GC9 A;  3SHG B;  1SXJ A;  1IXR C;  3J7A S;  1E94 E;  3AL0 C;  1GL6 A;  1IXS B;  4LJ7 A;  4XK8 F;  2Y21 A;  2QBY A;  2LVN C;  1K3W A;  2JZ1 A;  3E4R A;  4DV4 M;  4B08 A;  1DGB A;  1R5L A;  3DFZ A;  3FE3 A;  3GPY A;  2HHH M;  3A45 A;  5FSW A;  3R9X B;  1OFI A;  1G3I A;  1G8P A;  1ZMW A;  4NSO B;  3TL4 X;  1V34 A;  1SXJ E;  2D7H A;  5EXT A;  1NV9 A;  3GLG B;  2DHR A;  3CTW B;  2N35 A;  1MJG M;  4IBD A;  3M0E A;  2O25 A;  1V92 A;  3EIE A;  3JAM S;  3B74 A;  1I4W A;  3THG A;  4JI6 M;  1GVN A;  1XHB A;  2G3Q A;  1J7K A;  2KXE A;  2QZ4 A;  1I94 M;  3UZU A;  4XGI A;  2KRU A;  1HQY E;  3C3E A;  4OVZ A;  3CF0 A;  4WP2 A;  1J09 A;  3KOZ E;  2CV2 A;  3UGJ A;  4JN6 A;  5EXP A;  3GO8 A;  4L8R C;  2YFQ A;  3FUW A;  2JZ0 A;  3FRI A;  3GLF A;  1WGN A;  2FFJ A;  2K6B A;  2QQ8 A;  3B9P A;  1QZE A;  2MJ5 B;  1CUK A;  2G5G X;  5EXX A;  1PJS A;  3LQR A;  3KFU G;  4X65 M;  2Q2E B;  1WIV A;  3RGP A;  2QHO B;  2BNK A;  3HU2 A;  2L4E A;  1DGG A;  2BJV A;  2JY5 A;  3W67 A;  3ZCB B;  5H37 D;  2WSF F;  1NY6 A;  3F92 A;  4GMQ A;  2XGN A;  4FD2 A;  4PT5 A;  3HGI A;  4MM3 B;  1NJG A;  2L2D A;  3GLF E;  1UFZ A;  5LMN M;  3C9P A;  3HU3 A;  4MGK E;  2HCB A;  2M60 A;  2JP7 A;  2XFT A;  3K9P A;  4CIS A;  3KVW A;  1T43 A;  4RF1 A;  1K82 A;  1PGY A;  1ZMV A;  1NNJ A;  2KZU A;  2V6Z M;  4G4Q A;  3SAU A;  4LG2 A;  1JR3 D;  2L6O A;  1GLN A;  4LF4 M;  4HLQ A;  3KP0 E;  3LCV B;  4GHA A;  3CF2 A;  4CGY B;  1W5S A;  3U6Q A;  3VKH A;  2LBC A;  3AOE A;  3GPU A;  3GLI B;  1SG9 A;  3E9S A;  4RF0 A;  3MMP A;  2CWB A;  2KRK A;  1D0M A;  4QOS A;  4AG5 A;  5FTK A;  1N36 M;  4Z6Y A;  3J7B A;  4OX9 M;  1ORY B;  4IBC A;  3SYK A;  3FTC A;  4LGY A;  3AFH A;  3TQS A;  3ZC7 B;  5C18 A;  1TH3 A;  3PXG A;  5EP2 A;  3FD9 A;  2JXN A;  1RU3 A;  5JI3 E;  1QDR A;  2NQ8 C;  1IQP A;  3U61 A;  2FOI C;  3J2P B;  4RKU F;  2Y0T A;  2Y0Q A;  3GLH E;  3Q8G A;  5EP4 A;  3H4J A;  3SC3 A;  4L6V 6;  2Z4S A;  4FCW A;  1Z5C A;  2R18 A;  1KSF X;  2DAI A;  3SBJ A;  1HNX M;  4IBK A;  2QEN A;  1L1T A;  2MH8 A;  4G4O A;  1W5T A;  5ITX E;  3HJ8 A;  4B3R M;  4QOZ C;  3L27 A;  3NBI A;  3U5Z B;  5ITQ A;  2OOB A;  4DV1 M;  4LY6 A;  3IG8 A;  2DEN A;  2Z4R A;  3T6P A;  4FWG A;  2RRU A;  4KHP M;  2I7P A;  5ITU A;  1HNZ M;  2LXE A;  3R8F A;  1TF0 B;  3SAR A;  4ITQ A;  3E46 A;  1OKS A;  3ILK A;  1OIZ A;  1HNW M;  4MGI E;  1EE8 A;  1PJQ A;  1XXH A;  4DR1 M;  1N32 M;  1TGU A;  2D7E A;  3RGS A;  1DV0 A;  1XWI A;  2DAE A;  4YHH M;  3GLF B;  1MU5 A;  4D82 A;  2CE7 A;  3GLI E;  1PJI A;  4ANR A;  2C99 A;  5E6J A;  2DZL A;  4BLC A;  1QUT A;  4LCB A;  3IHP A;  1XMQ M;  4IBB A;  2R0I A;  1TTE A;  1WR1 B;  5L8R F;  3SAW A;  1IY1 A;  1GL7 A;  1UM8 A;  2A5Y B;  4IJF A;  2F5S A;  4G6Z A;  4M9X A;  2RKO A;  2JY8 A;  3M7G A;  5GKN A;  2L7I A;  4FW9 A;  4GH9 A;  2JWS A;  4JI0 M;  3IEC A;  4AQY M;  2I7N A;  2LHG A;  4HL4 A;  4GEW A;  1HT1 E;  2LNH C;  2J5Y A;  4NRV A;  4LJ9 A;  3NWL A;  3W0F A;  1T3T A;  5FTL A;  2EJS A;  3DOA A;  4X62 M;  2XEP A;  3SMP A;  4LF5 M;  2Y20 A;  2FE8 A;  3HHY A;  2R45 A;  2WZJ A;  3RE8 A;  5ITT A;  4TUW A;  2MR9 A;  2EA0 A;  3AJI B;  1Y8G A;  4OVZ B;  1Z5A A;  4NRW A;  4OU7 A;  4R71 A;  3L26 A;  3U6C A;  1X37 A;  1DGH A;  5KO3 A;  3CF6 E;  2XZU A;  2QSF X;  2UXD M;  3FUU A;  2CHV A;  3FRH A;  3I01 M;  4B3T M;  1E9S A;  1JB0 F;  3SHF A;  4Y28 F;  1IY0 A;  3VDU A; 
#chains in the Genus database with same CATH homology
 1Z59 A;  2G8L A;  1J5E M;  2JA2 A;  3BOS A;  3ZH9 B;  4JI4 M;  4GHL A;  2OQ4 A;  2UXB M;  1IN8 A;  1NSF A;  1TH4 A;  3KOY E;  3WHL A;  4X66 M;  5FTN A;  3AOG A;  4L78 A;  5KQ8 A;  4LF6 M;  4RNA A;  1IBK M;  2XFS A;  2EO2 A;  3GRU A;  1TDH A;  1SXJ B;  1DO2 A;  3GQ3 A;  1C1K A;  2CHQ A;  5FLX S;  3K8Z A;  7CAT A;  1K3X A;  4I81 A;  4KO8 A;  1QAQ A;  2DVW B;  2VQF M;  3I51 A;  4DR3 M;  4DV3 M;  4QHS A;  4ZPX A;  2AHM A;  3U60 A;  2ZAN A;  3K92 A;  1L2D A;  3SAS A;  4P16 A;  3KSJ A;  1Z5B A;  5EXS A;  1GKI A;  4IJE A;  3T38 A;  3FTE A;  3U6M A;  5EP3 A;  4M9Z A;  5BR8 M;  3GLG A;  3VK7 A;  4JI2 M;  2KW0 A;  1OJL A;  1IN5 A;  3PNV A;  4Z8X A;  2LH0 A;  3VKG A;  1NJF A;  1L8Q A;  3H4M A;  5IT9 S;  1QZM A;  4LJ5 A;  4IBE A;  2F5Q A;  2O5R A;  1YSY A;  2YNM D;  4LJ4 A;  2R62 A;  4MGY E;  3U6P A;  2J7N A;  5BPV A;  3I4V A;  1S3S A;  4FVM A;  4GIP A;  5EP1 A;  2DWL A;  3DA1 A;  4FWD A;  5ITR A;  2X8A A;  3U5Z A;  3HJQ A;  3KP1 E;  2UUB M;  3T1H M;  1ZAE A;  1H6U A;  5LMU M;  1JQJ C;  2RGH A;  4LJ8 A;  1L2C A;  1E32 A;  1YUB A;  2DWZ B;  1YE9 A;  5E26 A;  4LFC M;  2F4V M;  4AI6 A;  3K1J A;  4LF9 M;  4QHT A;  3LMM A;  1TH2 A;  2ERC A;  5F3W A;  2W82 A;  1NNU C;  2Z3X A;  2DWM A;  4JI7 M;  4MH0 E;  3SAV A;  1N78 A;  2OPF A;  8CAT A;  1XMO M;  3UK6 A;  4AZF A;  2LWX A;  1DGF A;  3LQQ A;  3OTO M;  2X4A A;  2BJW A;  3DZD A;  5ITX A;  3U6L A;  4R3D A;  1N75 A;  2RGO A;  3EIH A;  3FYD A;  2ZM6 M;  4DV5 M;  2R65 A;  2QPA A;  3FTD A;  4OW0 A;  5DYG A;  3HHX A;  4I4L A;  2HKJ A;  3KS8 A;  5KPT A;  1R7R A;  1JR3 A;  3HU1 A;  1Q3C A;  2K47 A;  3TE6 A;  4JYA M;  4REZ A;  4IBI A;  3VLF B;  4LF7 M;  4LGM A;  3HWS A;  1IXZ A;  4IBG A;  5IWA M;  1KFV A;  3KOX E;  3KSX A;  3D8L A;  3U61 B;  1N34 M;  1IM2 A;  3FKE A;  4NXN M;  4JI3 M;  2KEB A;  4D80 A;  2QCU A;  2CHG A;  2Z7J A;  2C98 A;  2E5L M;  2C96 A;  2DXI A;  3GRV A;  3LVW A;  4MGH A;  1L1Z A;  1IN6 A;  2XF3 A;  3UJN A;  4AG6 A;  1PJJ A;  3FYC A;  1G41 A;  2QP9 X;  2VII A;  3QWL A;  1QYR A;  4JI8 M;  4GIT A;  3SAT A;  4KOD A;  3GQ5 A;  5IZ7 D;  3IG5 A;  2J7O A;  4II7 A;  4WW0 A;  3RFW A;  2V1C A;  4MGZ E;  3U60 B;  3M6A A;  4B7F A;  2L09 A;  1MX0 A;  3VDP A;  3I4Y A;  4CHT B;  5DNY A;  1DGH B;  3PNY A;  1WXQ A;  4LZJ A;  4WUR A;  5EJC A;  3T15 A;  4A3V B;  4LZZ A;  3UMM A;  3HJS A;  3SFZ A;  3TPZ A;  4B3M M;  2KZS A;  3J27 B;  1NY5 A;  2CUZ A;  4G4N A;  4XBO A;  1IBL M;  2H1R A;  1N33 M;  5KQD A;  4DR4 M;  1QVR A;  2F5P A;  4NXM M;  4AKG A;  3L25 A;  3VFD A;  1OFH A;  3FUX A;  4JI5 M;  3GLH A;  3KS4 A;  4FWH A;  2XLJ A;  4EIW A;  2C9C A;  4DR2 M;  3L2A A;  4PDI A;  2CV0 A;  4YY3 M;  1R2Y A;  1Q39 A;  2P5T A;  4B3S M;  1SXJ D;  5JI2 E;  3HKP A;  2XSZ D;  2R46 A;  1D2N A;  3GRY A;  3LVV A;  4DUY M;  2DZO B;  3A98 B;  5A2Q S;  3PFI A;  1QQW A;  5IRE B;  1XNR M;  4AKI A;  1Q3B A;  2CEA A;  2ZBK B;  3GLI A;  3L28 A;  1IN4 A;  2DZN B;  1IN7 A;  4DR5 M;  4AW4 A;  1IY2 A;  1R6B X;  2ZAM A;  4IBF A;  2L7H A;  4R7G A;  1XC8 A;  4FCT A;  2UU9 M;  2CFO A;  4DR6 M;  4GKJ M;  3T1Y M;  4LRT A;  3C58 A;  1G4A E;  5KPZ A;  1HQC A;  2XH9 A;  3GPX A;  1L2B A;  2QBY B;  1NVM A;  3GPP A;  3TWL A;  3HHZ A;  2M5Z A;  1G59 A;  3J80 S;  2XZF A;  3GLH B;  2D7G A;  3KOW E;  2CV1 A;  4BBA A;  4I8O A;  1VDD A;  2HL7 A;  2R4J A;  4M9S A;  4PDG A;  4G4R A;  1PM5 A;  3FTF A;  3MJ5 A;  1QAN A;  4I5S A;  4DV7 M;  4DV6 M;  1DO0 A;  3TWM A;  4B7G A;  1HT2 E;  1KYI A;  2KA6 B;  2ZAO A;  3U6O A;  4QNR A;  4AKH A;  3U6E A;  4LRS A;  1E9R A;  4LJA A;  2YR0 A;  3KW6 A;  4KLN A;  1XNQ M;  3WHK A;  4MB7 A;  3TWK A;  1XXH B;  3AOE C;  3U6D A;  5ITY A;  4M0W A;  2C9O A;  4LF8 M;  1NHW C;  3GQ4 A;  1SXJ C;  4M0D A;  3MK6 A;  2UUA M;  3FUV A;  4IIW A;  4NL4 H;  5KPR A;  3JR4 A;  4DV2 M;  5EQT A;  3A42 A;  2UXC M;  4DV0 M;  4QNM A;  4DR7 M;  4DUZ M;  5C1B A;  4GRI A;  3FUT A;  2DWN A;  1NHG C;  5FTJ A;  3J81 S;  3MHV C;  4BB9 A;  3JR5 A;  1HR0 M;  3A46 A;  1TDZ A;  3D8B A;  4LJ6 A;  1FNN A;  2YQZ A;  3AKZ A;  2UUC M;  3U6S A;  1FJG M;  4FCV A;  4LFA M;  4JXJ A;  2F5O A;  4D81 A;  4K0K M;  4JI1 M;  2R4E A;  4GC5 A;  1Z6T A;  3GRR A;  4S12 A;  1QAM A;  4L15 A;  3VK8 A;  3Q8X A;  3AV0 A;  3QAU A;  3GP1 A;  5DYI A;  3PVS A;  3HHW A;  2V1U A;  4L4U A;  3SYL A;  1ZQ9 A;  3KDS E;  2VQE M;  1N77 A;  4NOO B;  4GKK M;  4IBJ A;  5FTM A;  4PD2 A;  4LFB M;  1QAO A;  2C5R A;  3W0L B;  4L16 A;  4NSR A;  4W5W A;  1R2Z A;  3K2L A;  4PCZ A;  3SMS A;  2X49 A;  4B7H A;  3KXE C;  4X64 M;  4JV5 M;  2FNA A;  1IBM M;  2EUC A;  2XSZ A;  3L29 A;  1LV7 A;  4GC9 A;  3SHG B;  1SXJ A;  1IXR C;  3J7A S;  1E94 E;  3AL0 C;  1GL6 A;  1IXS B;  4LJ7 A;  2QBY A;  2Y21 A;  1K3W A;  3E4R A;  4DV4 M;  4B08 A;  1DGB A;  3GPY A;  3DFZ A;  2HHH M;  3A45 A;  5FSW A;  3R9X B;  1OFI A;  1G3I A;  1G8P A;  4NSO B;  3TL4 X;  1SXJ E;  2D7H A;  5EXT A;  3GLG B;  2DHR A;  3CTW B;  4IBD A;  3M0E A;  3EIE A;  3JAM S;  1I4W A;  3THG A;  4JI6 M;  1GVN A;  1XHB A;  2KXE A;  1J7K A;  2QZ4 A;  1I94 M;  3UZU A;  4XGI A;  2KRU A;  1HQY E;  4OVZ A;  3CF0 A;  1J09 A;  3KOZ E;  2CV2 A;  3UGJ A;  4JN6 A;  5EXP A;  3GO8 A;  4L8R C;  2YFQ A;  3FUW A;  3GLF A;  2FFJ A;  3B9P A;  5EXX A;  2G5G X;  3LQR A;  3KFU G;  4X65 M;  2Q2E B;  3RGP A;  2BNK A;  3HU2 A;  5H37 D;  1DGG A;  2BJV A;  3ZCB B;  1NY6 A;  4GMQ A;  2XGN A;  4FD2 A;  4PT5 A;  3HGI A;  4MM3 B;  1NJG A;  5LMN M;  3HU3 A;  4MGK E;  2HCB A;  2M60 A;  2XFT A;  4CIS A;  3KVW A;  4RF1 A;  1K82 A;  1NNJ A;  2KZU A;  2V6Z M;  4G4Q A;  3SAU A;  4LG2 A;  1JR3 D;  2L6O A;  1GLN A;  4LF4 M;  4HLQ A;  3KP0 E;  4GHA A;  3CF2 A;  4CGY B;  1W5S A;  3U6Q A;  3VKH A;  3AOE A;  3GPU A;  3GLI B;  3E9S A;  4RF0 A;  4AG5 A;  2KRK A;  4QOS A;  5FTK A;  1N36 M;  4Z6Y A;  3J7B A;  4OX9 M;  1ORY B;  4IBC A;  3SYK A;  3FTC A;  4LGY A;  3AFH A;  3TQS A;  3ZC7 B;  5C18 A;  1TH3 A;  3PXG A;  5EP2 A;  3FD9 A;  5JI3 E;  2NQ8 C;  1IQP A;  3U61 A;  2FOI C;  3J2P B;  2Y0T A;  2Y0Q A;  5EP4 A;  3SC3 A;  2Z4S A;  4FCW A;  1Z5C A;  2R18 A;  1KSF X;  3SBJ A;  1HNX M;  4IBK A;  2QEN A;  1L1T A;  4G4O A;  1W5T A;  5ITX E;  3HJ8 A;  4B3R M;  4QOZ C;  3L27 A;  3NBI A;  3U5Z B;  5ITQ A;  4DV1 M;  4LY6 A;  3IG8 A;  2Z4R A;  4FWG A;  4KHP M;  2I7P A;  5ITU A;  1HNZ M;  2LXE A;  3R8F A;  3SAR A;  4ITQ A;  3ILK A;  1HNW M;  4MGI E;  1EE8 A;  1XXH A;  4DR1 M;  1N32 M;  1TGU A;  2D7E A;  3RGS A;  1XWI A;  4YHH M;  3GLF B;  1MU5 A;  4D82 A;  2CE7 A;  1PJI A;  2C99 A;  5E6J A;  4BLC A;  4LCB A;  1XMQ M;  4IBB A;  3SAW A;  1IY1 A;  1GL7 A;  1UM8 A;  2A5Y B;  4IJF A;  2F5S A;  4G6Z A;  4M9X A;  2RKO A;  3M7G A;  5GKN A;  2L7I A;  4FW9 A;  4GH9 A;  4JI0 M;  4AQY M;  2I7N A;  4HL4 A;  1HT1 E;  2LNH C;  4NRV A;  4LJ9 A;  3NWL A;  3W0F A;  1T3T A;  5FTL A;  3DOA A;  4X62 M;  2XEP A;  3SMP A;  4LF5 M;  2Y20 A;  2FE8 A;  3HHY A;  2R45 A;  3RE8 A;  5ITT A;  4TUW A;  2EA0 A;  3AJI B;  4OVZ B;  1Z5A A;  4NRW A;  4OU7 A;  3L26 A;  3U6C A;  1X37 A;  1DGH A;  5KO3 A;  3CF6 E;  2XZU A;  2UXD M;  3FUU A;  2CHV A;  4B3T M;  1E9S A;  3SHF A;  2F5N A;  1IY0 A;  3VDU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...