4DV2M

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule keywords 16S rRNA
molecule tags Ribosome
total genus 24
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4dv2M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4dv2M02
3DOAA 1N34M 4B3RM 3SASA 3C58A 3GPXA 4LF6M 2ZBKB 4LF5M 1XNQM 2UXCM 4DV3M 3J80S 5ITTA 1EE8A 1TDZA 1IBKM 1R2ZA 1PJIA 1N36M 1TDHA 3J81S 5ITXE 2OPFA 4GKKM 3U6SA 4G4OA 4DR4M 1XNRM 1L1ZA 4DUYM 4DV5M 1R2YA 4JI5M 3T1YM 3A42A 1HR0M 4NXNM 4ITQA 3U6QA 1K82A 2E5LM 2HHHM 3TWLA 4JYAM 4NRVA 4CISA 4LF7M 1HNZM 2UUAM 3VK8A 3U6EA 4DUZM 1Q3BA 4X62M 4B3TM 4G4QA 1Z5BA 1K3XA 4JI2M 4DV4M 2ZM6M 3U6LA 1FJGM 1L2BA 5LMUM 2Q2EB 4DV0M 1Q39A 1IBLM 2UUBM 4KHPM 5ITRA 4JI3M 2VQEM 4YY3M 4YHHM 1KFVA 4DR7M 4JV5M 3OTOM 5ITXA 1PJJA 1Q3CA 2UUCM 5LMNM 2VQFM 4DV6M 4JI7M 5A2QS 2F4VM 3SAWA 3W0FA 4G4RA 4DR3M 4LF9M 3SAUA 3GPPA 1XMQM 3JAMS 4B3MM 4LFBM 4LFAM 4DV1M 2XZUA 3U6DA 5FLXS 4DR2M 1Z5CA 3GP1A 3GO8A 2F5QA 5IWAM 4AQYM 4K0KM 5BR8M 1L2DA 4DR1M 4DR6M 3A45A 3U6PA 1J5EM 4NXMM 1HNXM 1K3WA 4PCZA 2UU9M 4B3SM 4X66M 1N33M 3JR4A 4LF8M 3A46A 3U6CA 3J7AS 2UXDM 3TWKA 1XMOM 3GQ3A 4PDIA 4PDGA 3T1HM 4MB7A 5ITUA 2F5NA 1N32M 4JI8M 3GPUA 1HNWM 4G4NA 3GQ5A 1Z5AA 3GPYA 1XC8A 4JI6M 4NRWA 3SBJA 1L2CA 5ITQA 2XZFA 3JR5A 1I94M 3U6MA 4DR5M 5ITYA 1PM5A 4X65M 2F5PA 2EA0A 4DV2M 1L1TA 1IBMM 3SATA 4JI4M 2F5OA 2F5SA 3GQ4A 4LFCM 2HKJA 1MU5A 4DV7M 4GKJM 4PD2A 3SARA 4LF4M 4OX9M 5IT9S 1MX0A 3VK7A 4JI0M 3TWMA 3SAVA 2OQ4A 1NNJA 1Z59A 2UXBM 3U6OA 4JI1M 4X64M
chains in the Genus database with same CATH superfamily
3SMPA 3W67A 2C9OA 3C3EA 3SASA 1G41A 2ZBKB 3FTCA 3HJSA 3LVWA 2UXCM 3FYCA 5JI2E 4L4UA 5ITTA 3GLFE 3E9SA 4LRTA 2WZJA 2K6BA 1UFZA 3B7ZA 4G4OA 3AL0C 4B7HA 1XNRM 1L1ZA 3KOWE 3GRYA 1R2YA 3H4MA 4GHAA 3HHWA 3HKPA 1IN7A 4HEOA 3GLHA 3PVSA 4XK8F 4NXNM 4CJ6A 4ITQA 4AKHA 1HT1E 2E5LM 3TWLA 4NRVA 4GITA 1FNNA 4MGZE 1YSYA 3VK8A 3D8BA 2XF3A 2K0BX 2KA6B 2XSZA 4B3TM 2O5RA 4QOSA 3T38A 4G4QA 2LHGA 1QZMA 2EKFA 2J7OA 4TUWA 3FE3A 1VEJA 1K3XA 3DA1A 3V76A 4JI2M 3QYEA 4DV4M 4MGKE 2R62A 3HU1A 4MH0E 3U60B 5LMUM 3W68A 3UK6A 3J27B 1VQ1A 1OKSA 1R5LA 4FWGA 4JI3M 2OOAA 2KDLA 2KRKA 1IN6A 2MROB 2YNMD 1PJJA 2V1UA 1Q3CA 2QNJA 3TL4X 5LMNM 4JI7M 3R9XB 2C9CA 1OJLA 3LW5F 4Y28F 2JNHA 1Q02A 1N75A 1QUSA 2ZAMA 3JAMS 3I01M 3UGJA 2QSFX 2FOIC 4DV1M 3TPZA 1GLNA 4CIZA 1IM2A 1YE9A 5FLXS 1KYIA 4D80A 5IWAM 2M60A 3HJQA 3J7BA 2QZ4A 1L2DA 2R45A 4KLNA 1XXHB 2V6ZM 5EJCA 1PRBA 1KSFX 3FD9A 4WW0A 3U6PA 1J5EM 1HNXM 2HWJA 2JZ0A 1J09A 3FRIA 4PCZA 4X66M 1N33M 1IXSB 3K9OA 4M0WA 4LF8M 4GC9A 3HHZA 3LVVA 4RF1A 2L4FA 3GRRA 4L15A 4PDGA 3T1HM 4AG6A 2XH9A 3U61B 1N32M 1F4IA 3GPUA 3Q8XA 3SYLA 1IXRC 1IN8A 4G4NA 3M7GA 3FTEA 2EUCA 3LCVB 2ERCA 1RU3A 4D81A 3QWLA 4B7FA 3KVWA 3FUWA 2DVWB 4FCWA 2G5GX 3FTFA 2RKOA 3KW6A 4CGYB 3FKEA 1XB2B 4QNMA 3D8LA 2C98A 4FCTA 1E32A 4FVMA 3HX3A 2LVQD 1GL6A 2A5YB 3KP1E 4L16A 4DR5M 2LHCA 3B89A 2BNKA 2F5PA 2EA0A 2J5YA 2F5OA 2F5SA 2JWSA 4AZFA 1OQYA 1NO1A 2JY8A 5EP3A 3SYKA 4P16A 1GJTA 3VK7A 4LJ9A 2WSCF 4JN6A 3GLIA 4WURA 2DWNA 2VDBB 4LCBA 3U6OA 1G59A 4LGYA 2JY7A 4JI1M 1SXJE 4QHSA 3T6PA 2ZAOA 4IBBA 3WHKA 1SXJA 1D0KA 1N34M 4B3RM 1DGGA 3C58A 3E21A 3GPXA 4LF5M 4AKGA 1DO2A 1XNQM 5E26A 1XWIA 3KXEC 3SHFA 3J80S 1PJSA 1NHWC 2RGHA 2C5RA 1R2ZA 3ZC7B 4IBIA 1N36M 4L6V6 3J81S 5ITXE 3C3DA 4GKKM 3CF2A 1QAMA 1IY2A 5EQTA 3GLGA 1J7KA 7CATA 3A42A 3FUTA 2XLJA 2CUZA 3KOYE 4JYAM 1GVNA 1Y8GA 1GJSA 3IHPA 1OAOC 2LXEA 3GRUA 3IECA 4DUZM 2QBYA 4FD2A 3HY5A 3KS8A 1OIZA 2NQ8C 2EJSA 2XEPA 3K2LA 2BJWA 1N77A 1DGHB 1GKIA 1XXHE 1PGYA 2BWEA 3U5ZA 3FUUA 2HCBA 1H6UA 1ORYB 3VKGA 4M9ZA 4FWHA 2CHGA 2JP7A 3U6LA 2G8LA 2KNVA 2Y20A 1GABA 4LJAA 2MJ5B 2Q2EB 2DZOB 1Q39A 2UUBM 4G3OA 3KOXE 3GLFA 1IFYA 1KFVA 2Z4SA 1YLAA 3RGSA 1PJTA 2D7HA 4MGHA 3IG5A 2QCUA 2VQFM 2F4VM 3SAWA 2YR0A 2FNAA 1AUAA 4LF9M 2KW0A 3SAUA 4B3MM 2GQFA 1A5TA 1IXZA 1V33A 2XZUA 1QQWA 4RKUF 1AIPC 3HHXA 4DR2M 5FTKA 3GO8A 2XFSA 5KPZA 2F5QA 2KNZA 2LWXA 4GIPA 5BR8M 4NSOB 3M6AA 4GMQA 4DR1M 3A45A 4DR6M 3RGPA 4UN2B 4I8OA 1E9SA 3PNYA 3MK6A 1QUTA 3VLFB 3M0EA 1WGLA 3JR4A 2JY6B 2RRUA 3FTDA 3A46A 3U6CA 5DYIA 4I5SA 2DAIA 3B9PA 3PXGA 1IN4A 2KEBA 5E6JA 4W5WA 2Z7JA 1WIVA 1T3TA 5DNYA 3LQRA 4RNAA 1NJFA 2XFTA 1MJGM 3LQQA 3F92A 3I4VA 5EXSA 2L2DA 2C99A 2R46A 2WSFF 3FUXA 3QAUA 1NY5A 2WSEF 2GNOA 4GRIA 3SHGB 3AFHA 1XC8A 4AG5A 2DAGA 2DAEA 1C7YA 1L2CA 1QVRA 2XZFA 2CE7A 1G8PA 1C1KA 2L4EA 4LZJA 3JR5A 2CP8A 2CV2A 5H37D 4BLCA 5EXPA 2X4AA 5ITYA 2CWBA 4OVZB 4L78A 4QHTA 1L1TA 1IBMM 4JI4M 1GO5A 2CFOA 1DGBA 2APLA 4LJ5A 1V92A 2J7NA 3GRVA 1QANA 1TGUA 2P5TA 2ZANA 4GKJM 4AKIA 3AJIB 4REZA 3SARA 2KZSA 2DWZB 3CGWA 3I04M 3KP0E 4Z8XA 4JI0M 1JQJC 3TWMA 2OQ4A 3K9PA 4GHLA 1Z59A 2KHHA 2DENA 2XGNA 2DKLA 1TF0B 2R4EA 2VF8A 3NWLA 3NBXX 2L6OA 4FCVA 4KO8A 1D0MA 2JY5A 4G6ZA 4LJ6A 2CV1A 4KT0F 4LF6M 5FTMA 4IBGA 1W5TA 4DV3M 1EE8A 2DHYA 1IBKM 4MGIE 2K47A 4WP2A 4LJ4A 4GC5A 1NV8A 1TDHA 1P3QQ 3U6SA 4HLQA 3HWSA 4DV5M 3VKHA 3T1YM 1GL7A 1NNUC 2CRUA 4FWDA 4XBOA 2ZTCA 3GLHB 3HZJA 4LJ8A 4NL4H 1TH3A 5EXXA 5IZ7D 1HR0M 2R65A 3FRHA 3MHVC 1JB0F 3U6QA 3R8FA 4LGMA 1XHBA 1K82A 2X49A 2HHHM 4LY6A 4LF7M 5C18A 1X37A 1HNZM 4M9SA 2JZ1A 2Z4RA 3AOEA 3U6EA 1QZEA 2QENA 2LBCA 2MR9A 2ZTDA 2Y0TA 4XGIA 3W0LB 1NJGA 3IG8A 3B7QA 2OO9A 2FH0A 1TR8A 3E46A 2CHQA 1L2BA 1SXJC 2BWBA 2CEAA 1DO0A 4DV0M 3U60A 4KHPM 4ANRA 1HQCA 3CF6E 5ITRA 4YHHM 2CHVA 2VQEM 4DR7M 3I4YA 2LVPC 3CF0A 4MM3B 3SMSA 5ITXA 3OTOM 1IY0A 3THGA 4I81A 2UUCM 5EXTA 4DV6M 2YQZA 4LG2A 3K1JA 2O25A 3W0FA 4DR3M 1D2NA 3BBZA 3AKZA 4LFBM 4OW0A 8CATA 4LFAM 3L28A 3HGIA 3U6DA 2DAMA 1Z5CA 2OOBA 3GP1A 4IJFA 3ZQJA 2R6FA 4AQYM 3VDUA 3ZH9B 1OFHA 4K0KM 2FS1A 1IN5A 1XXHA 1NHGC 2DZNB 1OFIA 4NXMM 2LVAA 2UU9M 4AI6A 1OTRA 4CHTB 4IJEA 1IY1A 3J7AS 2DNAA 2LVOC 1IXSA 3TWKA 1CUKA 1HT2E 3KS4A 3GQ3A 1XMOM 3DZDA 4MB7A 2VF7A 2Z8YM 5ITUA 2F5NA 1JR3E 1N78A 4JI8M 1HNWM 3GQ5A 1Z5AA 4QOZC 4RF0A 2B3TA 1Z6TA 4I4LA 1E94E 3L27A 1V34A 4NC6A 1T43A 3BOSA 4FW9A 5ITQA 2LNHC 5EP4A 2QQ8A 4R71A 1SG9A 3B7NA 4B08A 3Q8GA 2KRUA 3J2PB 3L25A 4X65M 3LCUA 4DV2M 4MGYE 3SATA 1JR3D 3QYBA 5DYGA 2L7HA 2V1CA 5FTJA 4HL4A 3MJ5A 3GQ4A 2HL7A 2HKJA 4L8RC 2L09A 3L2AA 4LF4M 5IT9S 4OX9M 3GLHE 3B74A 4P17A 3GLIB 3H4JA 2C96A 4AW4A 3C9PA 3SAVA 2R0IA 2EO2A 3DFZA 3UZUA 4F1IA 1NNJA 1OAIA 1NSFA 2LH0A 5BPVA 3RE8A 1WJ7A 5C1BA 5KPTA 3SFZA 2CV0A 1SXJB 4IIWA 2YFQA 4B7GA 4X64M 3AOGA 5FTNA 1YUBA 3NBIA 3DOAA 2H1RA 3HJ8A 3UMMA 3ZCBB 4A3VB 2QPAA 1DGFA 5EP1A 1G4AE 2JUJA 3HU3A 4NSRA 3T15A 1TDZA 2MH8A 1PJQA 2Y0QA 3FUVA 1PJIA 1LV7A 5F3WA 3GLGB 2OPFA 4DR4M 3L29A 4Q7JA 5EP2A 1IQPA 4DUYM 2XSZD 4JI5M 1DV0A 1NV9A 1MN3A 4LZZA 5FSWA 1TH4A 2H5XA 4LRSA 1QAOA 4CISA 1QYRA 4PT5A 2QBYB 2UUAM 3RFWA 3TQSA 1LTMA 1Q3BA 3A98B 5JI3E 4X62M 1TTEA 2G3QA 1D0LA 3HU2A 3U5ZB 4IBCA 1T6OA 3EIHA 1DGHA 1Z5BA 2DWLA 5FTLA 5DFLA 5GKNA 2ZM6M 2EKKA 1FJGM 4F2LA 2RGOA 3GLFB 2I7PA 3HHYA 4D82A 1IBLM 1ZMWA 4IBKA 5IREB 1NVMA 5L8RF 1QDRA 4YY3M 2DAKA 2D7GA 4JV5M 2L7IA 3TE6A 4S12A 4OU7A 1VG5A 1R7RA 4NOOB 3KOZE 4BBAA 5A2QS 4G4RA 2BJVA 4IBEA 1EFUB 1R6BX 3GPPA 1XMQM 3L26A 2DI0A 4GEWA 2O01F 3K92A 1NY6A 3KSXA 1QDTA 2JA2A 3VFDA 1WXQA 3KDSE 3PFIA 3PNVA 2FFJA 1G71A 1W5SA 1EIJA 2M5ZA 2DZLA 3AOEC 2KNAA 4GH9A 5KQDA 5KQ8A 1K3WA 2K9DA 4KODA 2LVNC 4B3SM 3WHLA 3MMPA 2R44A 1HQYE 1OIPA 2R18A 2D7EA 3KFUG 2UXDM 4PDIA 1WHCA 3K8ZA 2MGWA 4R3DA 2I7NA 4Z6YA 1TH2A 3GLIE 2JXNA 2LTUA 5KO3A 1VDDA 3KSJA 1WGNA 1G3IA 1UM8A 2FE8A 3GPYA 5KPRA 1R4GA 4IBJA 1QAQA 4JI6M 4IBFA 4NRWA 1ZMUA 2DHRA 2QHOB 3I51A 4BB9A 4M9XA 3SBJA 2HAKA 4II7A 4EIWA 1ZMVA 1L8QA 3CTWB 3FYDA 1HJPA 3U6MA 1I94M 4IBDA 2VIIA 2AHMA 1I4WA 1VDLA 2KZUA 1PM5A 4M0DA 1WR1B 1VEKA 3GLGE 2Z3XA 4OVZA 1VEGA 4ZPXA 2QP9X 3BXWA 1MU5A 3AV0A 4DBGB 4DV7M 4LFCM 4LJ7A 4JXJA 1SXJD 4PD2A 3UJNA 4R7GA 3E4RA 1MX0A 1ZAEA 2W82A 4QNRA 3VDPA 2KXEA 2DXIA 1ZQ9A 1E9RA 2UXBM 3EIEA 1JR3A 3U61A 1BVSA 2N35A 2DWMA 1ZV1A 2X8AA 3SC3A 2R4JA 3LMMA 3ILKA 1S3SA 2Y21A
chains in the Genus database with same CATH topology
3SMPA 2C9OA 3SASA 1G41A 2ZBKB 3FTCA 3HJSA 3LVWA 2UXCM 3FYCA 5JI2E 4L4UA 5ITTA 3E9SA 4LRTA 4G4OA 3AL0C 4B7HA 1XNRM 1L1ZA 3KOWE 3GRYA 1R2YA 3H4MA 4GHAA 3HHWA 3HKPA 1IN7A 4AKHA 3GLHA 3PVSA 4NXNM 4ITQA 1HT1E 2E5LM 3TWLA 4NRVA 4GITA 1FNNA 4MGZE 1YSYA 3VK8A 3D8BA 2XF3A 2KA6B 2XSZA 4B3TM 2O5RA 4QOSA 3T38A 4G4QA 1QZMA 2J7OA 4TUWA 1K3XA 3DA1A 4JI2M 4DV4M 4MGKE 2R62A 3HU1A 4MH0E 3U60B 5LMUM 3UK6A 3J27B 4FWGA 4JI3M 2KRKA 1IN6A 2YNMD 1PJJA 2V1UA 1Q3CA 3TL4X 5LMNM 4JI7M 3R9XB 2C9CA 1OJLA 1N75A 2ZAMA 3JAMS 3UGJA 2FOIC 4DV1M 3TPZA 1GLNA 1IM2A 1YE9A 5FLXS 1KYIA 4D80A 5IWAM 2M60A 3HJQA 3J7BA 2QZ4A 1L2DA 2R45A 4KLNA 1XXHB 2V6ZM 5EJCA 1KSFX 3FD9A 4WW0A 3U6PA 1J5EM 1HNXM 1J09A 4PCZA 4X66M 1N33M 1IXSB 4M0WA 4LF8M 4GC9A 3HHZA 3LVVA 4RF1A 3GRRA 4L15A 4PDGA 3T1HM 4AG6A 2XH9A 3U61B 1N32M 3GPUA 3Q8XA 3SYLA 1IXRC 1IN8A 4G4NA 3M7GA 3FTEA 2EUCA 2ERCA 4D81A 3QWLA 4B7FA 3KVWA 3FUWA 2DVWB 4FCWA 2G5GX 3FTFA 2RKOA 3KW6A 4CGYB 3FKEA 4QNMA 3D8LA 2C98A 4FCTA 1E32A 4FVMA 4L16A 4DR5M 1GL6A 2A5YB 3KP1E 2BNKA 2F5PA 2EA0A 2F5OA 2F5SA 4AZFA 5EP3A 3SYKA 4P16A 3VK7A 4LJ9A 4JN6A 3GLIA 4WURA 2DWNA 4LCBA 3U6OA 1G59A 4LGYA 4JI1M 1SXJE 4QHSA 2ZAOA 4IBBA 3WHKA 1SXJA 1N34M 4B3RM 1DGGA 3C58A 3GPXA 4LF5M 4AKGA 1DO2A 1XNQM 5E26A 1XWIA 3KXEC 3SHFA 3J80S 1NHWC 2RGHA 2C5RA 1R2ZA 3ZC7B 4IBIA 1N36M 3J81S 5ITXE 4GKKM 3CF2A 1QAMA 1IY2A 5EQTA 3GLGA 1J7KA 7CATA 3A42A 3FUTA 2XLJA 2CUZA 3KOYE 4JYAM 1GVNA 3GRUA 2LXEA 4DUZM 2QBYA 4FD2A 3KS8A 2XEPA 2NQ8C 3K2LA 2BJWA 1N77A 1DGHB 1GKIA 3U5ZA 3FUUA 2HCBA 1H6UA 1ORYB 3VKGA 4M9ZA 4FWHA 2CHGA 3U6LA 2G8LA 2Y20A 4LJAA 2Q2EB 2DZOB 1Q39A 2UUBM 3GLFA 3KOXE 1KFVA 2Z4SA 3RGSA 2D7HA 4MGHA 3IG5A 2QCUA 2VQFM 2F4VM 3SAWA 2YR0A 2FNAA 4LF9M 2KW0A 3SAUA 4B3MM 1IXZA 2XZUA 1QQWA 3HHXA 4DR2M 5FTKA 3GO8A 2XFSA 5KPZA 2F5QA 2LWXA 4GIPA 5BR8M 4NSOB 3M6AA 4GMQA 4DR1M 3A45A 4DR6M 3RGPA 4I8OA 1E9SA 3PNYA 3MK6A 3VLFB 3M0EA 3JR4A 3FTDA 3A46A 3U6CA 5DYIA 4I5SA 3B9PA 3PXGA 1IN4A 2KEBA 5E6JA 4W5WA 2Z7JA 1T3TA 5DNYA 3LQRA 4RNAA 1NJFA 2XFTA 3LQQA 3I4VA 5EXSA 2C99A 2R46A 3FUXA 3QAUA 1NY5A 4GRIA 3SHGB 3AFHA 1XC8A 4AG5A 1L2CA 1QVRA 2XZFA 2CE7A 1G8PA 1C1KA 3JR5A 4LZJA 2CV2A 5H37D 4BLCA 5EXPA 2X4AA 5ITYA 4OVZB 4L78A 4QHTA 1L1TA 1IBMM 4JI4M 2CFOA 1DGBA 4LJ5A 3GRVA 2J7NA 1QANA 1TGUA 2P5TA 2ZANA 4GKJM 4AKIA 3AJIB 4REZA 3SARA 2KZSA 2DWZB 4Z8XA 3KP0E 4JI0M 1JQJC 3TWMA 2OQ4A 4GHLA 1Z59A 2XGNA 2R4EA 3NWLA 2L6OA 4FCVA 4KO8A 4G6ZA 4LJ6A 2CV1A 4LF6M 5FTMA 4IBGA 1W5TA 4DV3M 1EE8A 1IBKM 4MGIE 2K47A 4LJ4A 4GC5A 1TDHA 3U6SA 4HLQA 3HWSA 4DV5M 3VKHA 3T1YM 1GL7A 1NNUC 4FWDA 4XBOA 4NL4H 3GLHB 4LJ8A 1TH3A 5EXXA 5IZ7D 1HR0M 2R65A 3MHVC 3U6QA 3R8FA 4LGMA 1XHBA 1K82A 2X49A 2HHHM 4LY6A 4LF7M 5C18A 1X37A 1HNZM 4M9SA 2Z4RA 3AOEA 3U6EA 2QENA 2Y0TA 4XGIA 3W0LB 1NJGA 3IG8A 2CHQA 1L2BA 1SXJC 2CEAA 1DO0A 4DV0M 3U60A 4KHPM 1HQCA 3CF6E 5ITRA 4YHHM 2CHVA 2VQEM 4DR7M 3I4YA 3CF0A 4MM3B 3SMSA 3OTOM 5ITXA 1IY0A 3THGA 4I81A 2UUCM 5EXTA 4DV6M 2YQZA 4LG2A 3K1JA 3W0FA 4DR3M 1D2NA 3AKZA 4LFBM 4OW0A 8CATA 4LFAM 3L28A 3HGIA 3U6DA 1Z5CA 3GP1A 4IJFA 4AQYM 3VDUA 3ZH9B 1OFHA 4K0KM 4NXMM 1IN5A 1XXHA 1NHGC 2DZNB 1OFIA 2UU9M 4AI6A 4CHTB 4IJEA 1IY1A 3J7AS 3TWKA 1HT2E 3KS4A 3GQ3A 1XMOM 3DZDA 4MB7A 5ITUA 2F5NA 1N78A 4JI8M 1HNWM 3GQ5A 1Z5AA 4QOZC 4RF0A 1Z6TA 4I4LA 1E94E 3L27A 3BOSA 4FW9A 5ITQA 2LNHC 5EP4A 4B08A 2KRUA 3J2PB 3L25A 4X65M 4DV2M 4MGYE 3SATA 1JR3D 5DYGA 2L7HA 2V1CA 5FTJA 4HL4A 3MJ5A 3GQ4A 2HL7A 2HKJA 4L8RC 2L09A 3L2AA 4LF4M 5IT9S 4OX9M 3GLIB 4AW4A 2C96A 3SAVA 2EO2A 3DFZA 3UZUA 1NNJA 1NSFA 2LH0A 5BPVA 3RE8A 5C1BA 5KPTA 3SFZA 2CV0A 1SXJB 4IIWA 2YFQA 4B7GA 4X64M 3AOGA 5FTNA 1YUBA 3NBIA 3DOAA 2H1RA 3HJ8A 3UMMA 3ZCBB 4A3VB 2QPAA 1DGFA 5EP1A 1G4AE 3HU3A 4NSRA 3T15A 1TDZA 2Y0QA 3FUVA 1PJIA 1LV7A 5F3WA 3GLGB 2OPFA 4DR4M 3L29A 4DUYM 5EP2A 1IQPA 2XSZD 4JI5M 4LZZA 5FSWA 1TH4A 4LRSA 1QAOA 4CISA 1QYRA 4PT5A 2QBYB 2UUAM 3RFWA 3TQSA 1Q3BA 3A98B 5JI3E 4X62M 3HU2A 3U5ZB 4IBCA 3EIHA 1DGHA 1Z5BA 2DWLA 5FTLA 5GKNA 2ZM6M 1FJGM 2RGOA 3GLFB 2I7PA 3HHYA 4D82A 1IBLM 4IBKA 5IREB 1NVMA 4YY3M 4JV5M 2D7GA 2L7IA 3TE6A 4S12A 4OU7A 1R7RA 4NOOB 3KOZE 4BBAA 5A2QS 4G4RA 2BJVA 4IBEA 1R6BX 3GPPA 1XMQM 3L26A 3K92A 1NY6A 3KSXA 2JA2A 3VFDA 1WXQA 3KDSE 3PFIA 3PNVA 2FFJA 1W5SA 2M5ZA 3AOEC 4GH9A 5KQDA 5KQ8A 1K3WA 4KODA 4B3SM 3WHLA 1HQYE 2R18A 2UXDM 2D7EA 3KFUG 4PDIA 3K8ZA 4R3DA 2I7NA 4Z6YA 1TH2A 5KO3A 1VDDA 3KSJA 1G3IA 1UM8A 2FE8A 3GPYA 5KPRA 4IBJA 1QAQA 4JI6M 4IBFA 4NRWA 2DHRA 3I51A 4BB9A 4M9XA 3SBJA 4II7A 4EIWA 1L8QA 3CTWB 3FYDA 1I94M 3U6MA 4IBDA 2VIIA 2AHMA 1I4WA 2KZUA 1PM5A 4M0DA 2Z3XA 4OVZA 4ZPXA 2QP9X 4LFCM 1MU5A 3AV0A 4DV7M 4LJ7A 4JXJA 1SXJD 4PD2A 3UJNA 4R7GA 3E4RA 1MX0A 1ZAEA 2W82A 4QNRA 3VDPA 2KXEA 2DXIA 1ZQ9A 1E9RA 2UXBM 3EIEA 1JR3A 3U61A 2DWMA 2X8AA 3SC3A 2R4JA 3LMMA 3ILKA 1S3SA 2Y21A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DOA A;  1N34 M;  4B3R M;  3SAS A;  3C58 A;  3GPX A;  4LF6 M;  2ZBK B;  4LF5 M;  1XNQ M;  2UXC M;  4DV3 M;  3J80 S;  5ITT A;  1EE8 A;  1TDZ A;  1IBK M;  1R2Z A;  1PJI A;  1N36 M;  1TDH A;  3J81 S;  5ITX E;  2OPF A;  4GKK M;  3U6S A;  4G4O A;  4DR4 M;  1XNR M;  1L1Z A;  4DUY M;  4DV5 M;  1R2Y A;  4JI5 M;  3T1Y M;  3A42 A;  1HR0 M;  4NXN M;  4ITQ A;  3U6Q A;  1K82 A;  2E5L M;  2HHH M;  3TWL A;  4JYA M;  4NRV A;  4CIS A;  4LF7 M;  1HNZ M;  2UUA M;  3VK8 A;  3U6E A;  4DUZ M;  1Q3B A;  4X62 M;  4B3T M;  4G4Q A;  1Z5B A;  1K3X A;  4JI2 M;  4DV4 M;  2ZM6 M;  3U6L A;  1FJG M;  1L2B A;  5LMU M;  2Q2E B;  4DV0 M;  1Q39 A;  1IBL M;  2UUB M;  4KHP M;  5ITR A;  4JI3 M;  2VQE M;  4YY3 M;  4YHH M;  1KFV A;  4DR7 M;  4JV5 M;  3OTO M;  5ITX A;  1PJJ A;  1Q3C A;  2UUC M;  5LMN M;  2VQF M;  4DV6 M;  4JI7 M;  5A2Q S;  2F4V M;  3SAW A;  3W0F A;  4G4R A;  4DR3 M;  4LF9 M;  3SAU A;  3GPP A;  1XMQ M;  3JAM S;  4B3M M;  4LFB M;  4LFA M;  4DV1 M;  2XZU A;  3U6D A;  5FLX S;  4DR2 M;  1Z5C A;  3GP1 A;  3GO8 A;  2F5Q A;  5IWA M;  4AQY M;  4K0K M;  5BR8 M;  1L2D A;  4DR1 M;  4DR6 M;  3A45 A;  3U6P A;  1J5E M;  4NXM M;  1HNX M;  1K3W A;  4PCZ A;  2UU9 M;  4B3S M;  4X66 M;  1N33 M;  3JR4 A;  4LF8 M;  3A46 A;  3U6C A;  3J7A S;  2UXD M;  3TWK A;  1XMO M;  3GQ3 A;  4PDI A;  4PDG A;  3T1H M;  4MB7 A;  5ITU A;  2F5N A;  1N32 M;  4JI8 M;  3GPU A;  1HNW M;  4G4N A;  3GQ5 A;  1Z5A A;  3GPY A;  1XC8 A;  4JI6 M;  4NRW A;  3SBJ A;  1L2C A;  5ITQ A;  2XZF A;  3JR5 A;  1I94 M;  3U6M A;  4DR5 M;  5ITY A;  1PM5 A;  4X65 M;  2F5P A;  2EA0 A;  4DV2 M;  1L1T A;  1IBM M;  3SAT A;  4JI4 M;  2F5O A;  2F5S A;  3GQ4 A;  4LFC M;  2HKJ A;  1MU5 A;  4DV7 M;  4GKJ M;  4PD2 A;  3SAR A;  4LF4 M;  4OX9 M;  5IT9 S;  1MX0 A;  3VK7 A;  4JI0 M;  3TWM A;  3SAV A;  2OQ4 A;  1NNJ A;  1Z59 A;  2UXB M;  3U6O A;  4JI1 M;  4X64 M; 
#chains in the Genus database with same CATH topology
 3SMP A;  3W67 A;  2C9O A;  3C3E A;  3SAS A;  1G41 A;  2ZBK B;  3FTC A;  3HJS A;  3LVW A;  2UXC M;  3FYC A;  5JI2 E;  4L4U A;  5ITT A;  3GLF E;  3E9S A;  4LRT A;  2WZJ A;  2K6B A;  1UFZ A;  3B7Z A;  4G4O A;  3AL0 C;  4B7H A;  1XNR M;  1L1Z A;  3KOW E;  3GRY A;  1R2Y A;  3H4M A;  4GHA A;  3HHW A;  3HKP A;  1IN7 A;  4HEO A;  3GLH A;  3PVS A;  4XK8 F;  4NXN M;  4CJ6 A;  4ITQ A;  4AKH A;  1HT1 E;  2E5L M;  3TWL A;  4NRV A;  4GIT A;  1FNN A;  4MGZ E;  1YSY A;  3VK8 A;  3D8B A;  2XF3 A;  2K0B X;  2KA6 B;  2XSZ A;  4B3T M;  2O5R A;  4QOS A;  3T38 A;  4G4Q A;  2LHG A;  1QZM A;  2EKF A;  2J7O A;  4TUW A;  3FE3 A;  1VEJ A;  1K3X A;  3DA1 A;  3V76 A;  4JI2 M;  3QYE A;  4DV4 M;  4MGK E;  2R62 A;  3HU1 A;  4MH0 E;  3U60 B;  5LMU M;  3W68 A;  3UK6 A;  3J27 B;  1VQ1 A;  1OKS A;  1R5L A;  4FWG A;  4JI3 M;  2OOA A;  2KDL A;  2KRK A;  1IN6 A;  2MRO B;  2YNM D;  1PJJ A;  2V1U A;  1Q3C A;  2QNJ A;  3TL4 X;  5LMN M;  4JI7 M;  3R9X B;  2C9C A;  1OJL A;  3LW5 F;  4Y28 F;  2JNH A;  1Q02 A;  1N75 A;  1QUS A;  2ZAM A;  3JAM S;  3I01 M;  3UGJ A;  2QSF X;  2FOI C;  4DV1 M;  3TPZ A;  1GLN A;  4CIZ A;  1IM2 A;  1YE9 A;  5FLX S;  1KYI A;  4D80 A;  5IWA M;  2M60 A;  3HJQ A;  3J7B A;  2QZ4 A;  1L2D A;  2R45 A;  4KLN A;  1XXH B;  2V6Z M;  5EJC A;  1PRB A;  1KSF X;  3FD9 A;  4WW0 A;  3U6P A;  1J5E M;  1HNX M;  2HWJ A;  2JZ0 A;  1J09 A;  3FRI A;  4PCZ A;  4X66 M;  1N33 M;  1IXS B;  3K9O A;  4M0W A;  4LF8 M;  4GC9 A;  3HHZ A;  3LVV A;  4RF1 A;  2L4F A;  3GRR A;  4L15 A;  4PDG A;  3T1H M;  4AG6 A;  2XH9 A;  3U61 B;  1N32 M;  1F4I A;  3GPU A;  3Q8X A;  3SYL A;  1IXR C;  1IN8 A;  4G4N A;  3M7G A;  3FTE A;  2EUC A;  3LCV B;  2ERC A;  1RU3 A;  4D81 A;  3QWL A;  4B7F A;  3KVW A;  3FUW A;  2DVW B;  4FCW A;  2G5G X;  3FTF A;  2RKO A;  3KW6 A;  4CGY B;  3FKE A;  1XB2 B;  4QNM A;  3D8L A;  2C98 A;  4FCT A;  1E32 A;  4FVM A;  3HX3 A;  2LVQ D;  1GL6 A;  2A5Y B;  3KP1 E;  4L16 A;  4DR5 M;  2LHC A;  3B89 A;  2BNK A;  2F5P A;  2EA0 A;  2J5Y A;  2F5O A;  2F5S A;  2JWS A;  4AZF A;  1OQY A;  1NO1 A;  2JY8 A;  5EP3 A;  3SYK A;  4P16 A;  1GJT A;  3VK7 A;  4LJ9 A;  2WSC F;  4JN6 A;  3GLI A;  4WUR A;  2DWN A;  2VDB B;  4LCB A;  3U6O A;  1G59 A;  4LGY A;  2JY7 A;  4JI1 M;  1SXJ E;  4QHS A;  3T6P A;  2ZAO A;  4IBB A;  3WHK A;  1SXJ A;  1D0K A;  1N34 M;  4B3R M;  1DGG A;  3C58 A;  3E21 A;  3GPX A;  4LF5 M;  4AKG A;  1DO2 A;  1XNQ M;  5E26 A;  1XWI A;  3KXE C;  3SHF A;  3J80 S;  1PJS A;  1NHW C;  2RGH A;  2C5R A;  1R2Z A;  3ZC7 B;  4IBI A;  1N36 M;  4L6V 6;  3J81 S;  5ITX E;  3C3D A;  4GKK M;  3CF2 A;  1QAM A;  1IY2 A;  5EQT A;  3GLG A;  1J7K A;  7CAT A;  3A42 A;  3FUT A;  2XLJ A;  2CUZ A;  3KOY E;  4JYA M;  1GVN A;  1Y8G A;  1GJS A;  3IHP A;  1OAO C;  2LXE A;  3GRU A;  3IEC A;  4DUZ M;  2QBY A;  4FD2 A;  3HY5 A;  3KS8 A;  1OIZ A;  2NQ8 C;  2EJS A;  2XEP A;  3K2L A;  2BJW A;  1N77 A;  1DGH B;  1GKI A;  1XXH E;  1PGY A;  2BWE A;  3U5Z A;  3FUU A;  2HCB A;  1H6U A;  1ORY B;  3VKG A;  4M9Z A;  4FWH A;  2CHG A;  2JP7 A;  3U6L A;  2G8L A;  2KNV A;  2Y20 A;  1GAB A;  4LJA A;  2MJ5 B;  2Q2E B;  2DZO B;  1Q39 A;  2UUB M;  4G3O A;  3KOX E;  3GLF A;  1IFY A;  1KFV A;  2Z4S A;  1YLA A;  3RGS A;  1PJT A;  2D7H A;  4MGH A;  3IG5 A;  2QCU A;  2VQF M;  2F4V M;  3SAW A;  2YR0 A;  2FNA A;  1AUA A;  4LF9 M;  2KW0 A;  3SAU A;  4B3M M;  2GQF A;  1A5T A;  1IXZ A;  1V33 A;  2XZU A;  1QQW A;  4RKU F;  1AIP C;  3HHX A;  4DR2 M;  5FTK A;  3GO8 A;  2XFS A;  5KPZ A;  2F5Q A;  2KNZ A;  2LWX A;  4GIP A;  5BR8 M;  4NSO B;  3M6A A;  4GMQ A;  4DR1 M;  3A45 A;  4DR6 M;  3RGP A;  4UN2 B;  4I8O A;  1E9S A;  3PNY A;  3MK6 A;  1QUT A;  3VLF B;  3M0E A;  1WGL A;  3JR4 A;  2JY6 B;  2RRU A;  3FTD A;  3A46 A;  3U6C A;  5DYI A;  4I5S A;  2DAI A;  3B9P A;  3PXG A;  1IN4 A;  2KEB A;  5E6J A;  4W5W A;  2Z7J A;  1WIV A;  1T3T A;  5DNY A;  3LQR A;  4RNA A;  1NJF A;  2XFT A;  1MJG M;  3LQQ A;  3F92 A;  3I4V A;  5EXS A;  2L2D A;  2C99 A;  2R46 A;  2WSF F;  3FUX A;  3QAU A;  1NY5 A;  2WSE F;  2GNO A;  4GRI A;  3SHG B;  3AFH A;  1XC8 A;  4AG5 A;  2DAG A;  2DAE A;  1C7Y A;  1L2C A;  1QVR A;  2XZF A;  2CE7 A;  1G8P A;  1C1K A;  2L4E A;  4LZJ A;  3JR5 A;  2CP8 A;  2CV2 A;  5H37 D;  4BLC A;  5EXP A;  2X4A A;  5ITY A;  2CWB A;  4OVZ B;  4L78 A;  4QHT A;  1L1T A;  1IBM M;  4JI4 M;  1GO5 A;  2CFO A;  1DGB A;  2APL A;  4LJ5 A;  1V92 A;  2J7N A;  3GRV A;  1QAN A;  1TGU A;  2P5T A;  2ZAN A;  4GKJ M;  4AKI A;  3AJI B;  4REZ A;  3SAR A;  2KZS A;  2DWZ B;  3CGW A;  3I04 M;  3KP0 E;  4Z8X A;  4JI0 M;  1JQJ C;  3TWM A;  2OQ4 A;  3K9P A;  4GHL A;  1Z59 A;  2KHH A;  2DEN A;  2XGN A;  2DKL A;  1TF0 B;  2R4E A;  2VF8 A;  3NWL A;  3NBX X;  2L6O A;  4FCV A;  4KO8 A;  1D0M A;  2JY5 A;  4G6Z A;  4LJ6 A;  2CV1 A;  4KT0 F;  4LF6 M;  5FTM A;  4IBG A;  1W5T A;  4DV3 M;  1EE8 A;  2DHY A;  1IBK M;  4MGI E;  2K47 A;  4WP2 A;  4LJ4 A;  4GC5 A;  1NV8 A;  1TDH A;  1P3Q Q;  3U6S A;  4HLQ A;  3HWS A;  4DV5 M;  3VKH A;  3T1Y M;  1GL7 A;  1NNU C;  2CRU A;  4FWD A;  4XBO A;  2ZTC A;  3GLH B;  3HZJ A;  4LJ8 A;  4NL4 H;  1TH3 A;  5EXX A;  5IZ7 D;  1HR0 M;  2R65 A;  3FRH A;  3MHV C;  1JB0 F;  3U6Q A;  3R8F A;  4LGM A;  1XHB A;  1K82 A;  2X49 A;  2HHH M;  4LY6 A;  4LF7 M;  5C18 A;  1X37 A;  1HNZ M;  4M9S A;  2JZ1 A;  2Z4R A;  3AOE A;  3U6E A;  1QZE A;  2QEN A;  2LBC A;  2MR9 A;  2ZTD A;  2Y0T A;  4XGI A;  3W0L B;  1NJG A;  3IG8 A;  3B7Q A;  2OO9 A;  2FH0 A;  1TR8 A;  3E46 A;  2CHQ A;  1L2B A;  1SXJ C;  2BWB A;  2CEA A;  1DO0 A;  4DV0 M;  3U60 A;  4KHP M;  4ANR A;  1HQC A;  3CF6 E;  5ITR A;  4YHH M;  2CHV A;  2VQE M;  4DR7 M;  3I4Y A;  2LVP C;  3CF0 A;  4MM3 B;  3SMS A;  5ITX A;  3OTO M;  1IY0 A;  3THG A;  4I81 A;  2UUC M;  5EXT A;  4DV6 M;  2YQZ A;  4LG2 A;  3K1J A;  2O25 A;  3W0F A;  4DR3 M;  1D2N A;  3BBZ A;  3AKZ A;  4LFB M;  4OW0 A;  8CAT A;  4LFA M;  3L28 A;  3HGI A;  3U6D A;  2DAM A;  1Z5C A;  2OOB A;  3GP1 A;  4IJF A;  3ZQJ A;  2R6F A;  4AQY M;  3VDU A;  3ZH9 B;  1OFH A;  4K0K M;  2FS1 A;  1IN5 A;  1XXH A;  1NHG C;  2DZN B;  1OFI A;  4NXM M;  2LVA A;  2UU9 M;  4AI6 A;  1OTR A;  4CHT B;  4IJE A;  1IY1 A;  3J7A S;  2DNA A;  2LVO C;  1IXS A;  3TWK A;  1CUK A;  1HT2 E;  3KS4 A;  3GQ3 A;  1XMO M;  3DZD A;  4MB7 A;  2VF7 A;  2Z8Y M;  5ITU A;  2F5N A;  1JR3 E;  1N78 A;  4JI8 M;  1HNW M;  3GQ5 A;  1Z5A A;  4QOZ C;  4RF0 A;  2B3T A;  1Z6T A;  4I4L A;  1E94 E;  3L27 A;  1V34 A;  4NC6 A;  1T43 A;  3BOS A;  4FW9 A;  5ITQ A;  2LNH C;  5EP4 A;  2QQ8 A;  4R71 A;  1SG9 A;  3B7N A;  4B08 A;  3Q8G A;  2KRU A;  3J2P B;  3L25 A;  4X65 M;  3LCU A;  4DV2 M;  4MGY E;  3SAT A;  1JR3 D;  3QYB A;  5DYG A;  2L7H A;  2V1C A;  5FTJ A;  4HL4 A;  3MJ5 A;  3GQ4 A;  2HL7 A;  2HKJ A;  4L8R C;  2L09 A;  3L2A A;  4LF4 M;  5IT9 S;  4OX9 M;  3GLH E;  3B74 A;  4P17 A;  3GLI B;  3H4J A;  2C96 A;  4AW4 A;  3C9P A;  3SAV A;  2R0I A;  2EO2 A;  3DFZ A;  3UZU A;  4F1I A;  1NNJ A;  1OAI A;  1NSF A;  2LH0 A;  5BPV A;  3RE8 A;  1WJ7 A;  5C1B A;  5KPT A;  3SFZ A;  2CV0 A;  1SXJ B;  4IIW A;  2YFQ A;  4B7G A;  4X64 M;  3AOG A;  5FTN A;  1YUB A;  3NBI A;  3DOA A;  2H1R A;  3HJ8 A;  3UMM A;  3ZCB B;  4A3V B;  2QPA A;  1DGF A;  5EP1 A;  1G4A E;  2JUJ A;  3HU3 A;  4NSR A;  3T15 A;  1TDZ A;  2MH8 A;  1PJQ A;  2Y0Q A;  3FUV A;  1PJI A;  1LV7 A;  5F3W A;  3GLG B;  2OPF A;  4DR4 M;  3L29 A;  4Q7J A;  5EP2 A;  1IQP A;  4DUY M;  2XSZ D;  4JI5 M;  1DV0 A;  1NV9 A;  1MN3 A;  4LZZ A;  5FSW A;  1TH4 A;  2H5X A;  4LRS A;  1QAO A;  4CIS A;  1QYR A;  4PT5 A;  2QBY B;  2UUA M;  3RFW A;  3TQS A;  1LTM A;  1Q3B A;  3A98 B;  5JI3 E;  4X62 M;  1TTE A;  2G3Q A;  1D0L A;  3HU2 A;  3U5Z B;  4IBC A;  1T6O A;  3EIH A;  1DGH A;  1Z5B A;  2DWL A;  5FTL A;  5DFL A;  5GKN A;  2ZM6 M;  2EKK A;  1FJG M;  4F2L A;  2RGO A;  3GLF B;  2I7P A;  3HHY A;  4D82 A;  1IBL M;  1ZMW A;  4IBK A;  5IRE B;  1NVM A;  5L8R F;  1QDR A;  4YY3 M;  2DAK A;  2D7G A;  4JV5 M;  2L7I A;  3TE6 A;  4S12 A;  4OU7 A;  1VG5 A;  1R7R A;  4NOO B;  3KOZ E;  4BBA A;  5A2Q S;  4G4R A;  2BJV A;  4IBE A;  1EFU B;  1R6B X;  3GPP A;  1XMQ M;  3L26 A;  2DI0 A;  4GEW A;  2O01 F;  3K92 A;  1NY6 A;  3KSX A;  1QDT A;  2JA2 A;  3VFD A;  1WXQ A;  3KDS E;  3PFI A;  3PNV A;  2FFJ A;  1G71 A;  1W5S A;  1EIJ A;  2M5Z A;  2DZL A;  3AOE C;  2KNA A;  4GH9 A;  5KQD A;  5KQ8 A;  1K3W A;  2K9D A;  4KOD A;  2LVN C;  4B3S M;  3WHL A;  3MMP A;  2R44 A;  1HQY E;  1OIP A;  2R18 A;  2D7E A;  3KFU G;  2UXD M;  4PDI A;  1WHC A;  3K8Z A;  2MGW A;  4R3D A;  2I7N A;  4Z6Y A;  1TH2 A;  3GLI E;  2JXN A;  2LTU A;  5KO3 A;  1VDD A;  3KSJ A;  1WGN A;  1G3I A;  1UM8 A;  2FE8 A;  3GPY A;  5KPR A;  1R4G A;  4IBJ A;  1QAQ A;  4JI6 M;  4IBF A;  4NRW A;  1ZMU A;  2DHR A;  2QHO B;  3I51 A;  4BB9 A;  4M9X A;  3SBJ A;  2HAK A;  4II7 A;  4EIW A;  1ZMV A;  1L8Q A;  3CTW B;  3FYD A;  1HJP A;  3U6M A;  1I94 M;  4IBD A;  2VII A;  2AHM A;  1I4W A;  1VDL A;  2KZU A;  1PM5 A;  4M0D A;  1WR1 B;  1VEK A;  3GLG E;  2Z3X A;  4OVZ A;  1VEG A;  4ZPX A;  2QP9 X;  3BXW A;  1MU5 A;  3AV0 A;  4DBG B;  4DV7 M;  4LFC M;  4LJ7 A;  4JXJ A;  1SXJ D;  4PD2 A;  3UJN A;  4R7G A;  3E4R A;  1MX0 A;  1ZAE A;  2W82 A;  4QNR A;  3VDP A;  2KXE A;  2DXI A;  1ZQ9 A;  1E9R A;  2UXB M;  3EIE A;  1JR3 A;  3U61 A;  1BVS A;  2N35 A;  2DWM A;  1ZV1 A;  2X8A A;  3SC3 A;  2R4J A;  3LMM A;  3ILK A;  1S3S A;  2Y21 A; 
#chains in the Genus database with same CATH homology
 3SMP A;  2C9O A;  3SAS A;  1G41 A;  2ZBK B;  3FTC A;  3HJS A;  3LVW A;  2UXC M;  3FYC A;  5JI2 E;  4L4U A;  5ITT A;  3E9S A;  4LRT A;  4G4O A;  3AL0 C;  4B7H A;  1XNR M;  1L1Z A;  3KOW E;  3GRY A;  1R2Y A;  3H4M A;  4GHA A;  3HHW A;  3HKP A;  1IN7 A;  4AKH A;  3GLH A;  3PVS A;  4NXN M;  4ITQ A;  1HT1 E;  2E5L M;  3TWL A;  4NRV A;  4GIT A;  1FNN A;  4MGZ E;  1YSY A;  3VK8 A;  3D8B A;  2XF3 A;  2KA6 B;  2XSZ A;  4B3T M;  2O5R A;  4QOS A;  3T38 A;  4G4Q A;  1QZM A;  2J7O A;  4TUW A;  1K3X A;  3DA1 A;  4JI2 M;  4DV4 M;  4MGK E;  2R62 A;  3HU1 A;  4MH0 E;  3U60 B;  5LMU M;  3UK6 A;  3J27 B;  4FWG A;  4JI3 M;  2KRK A;  1IN6 A;  2YNM D;  1PJJ A;  2V1U A;  1Q3C A;  3TL4 X;  5LMN M;  4JI7 M;  3R9X B;  2C9C A;  1OJL A;  1N75 A;  2ZAM A;  3JAM S;  3UGJ A;  2FOI C;  4DV1 M;  3TPZ A;  1GLN A;  1IM2 A;  1YE9 A;  5FLX S;  1KYI A;  4D80 A;  5IWA M;  2M60 A;  3HJQ A;  3J7B A;  2QZ4 A;  1L2D A;  2R45 A;  4KLN A;  1XXH B;  2V6Z M;  5EJC A;  1KSF X;  3FD9 A;  4WW0 A;  3U6P A;  1J5E M;  1HNX M;  1J09 A;  4PCZ A;  4X66 M;  1N33 M;  1IXS B;  4M0W A;  4LF8 M;  4GC9 A;  3HHZ A;  3LVV A;  4RF1 A;  3GRR A;  4L15 A;  4PDG A;  3T1H M;  4AG6 A;  2XH9 A;  3U61 B;  1N32 M;  3GPU A;  3Q8X A;  3SYL A;  1IXR C;  1IN8 A;  4G4N A;  3M7G A;  3FTE A;  2EUC A;  2ERC A;  4D81 A;  3QWL A;  4B7F A;  3KVW A;  3FUW A;  2DVW B;  4FCW A;  2G5G X;  3FTF A;  2RKO A;  3KW6 A;  4CGY B;  3FKE A;  4QNM A;  3D8L A;  2C98 A;  4FCT A;  1E32 A;  4FVM A;  4L16 A;  4DR5 M;  1GL6 A;  2A5Y B;  3KP1 E;  2BNK A;  2F5P A;  2EA0 A;  2F5O A;  2F5S A;  4AZF A;  5EP3 A;  3SYK A;  4P16 A;  3VK7 A;  4LJ9 A;  4JN6 A;  3GLI A;  4WUR A;  2DWN A;  4LCB A;  3U6O A;  1G59 A;  4LGY A;  4JI1 M;  1SXJ E;  4QHS A;  2ZAO A;  4IBB A;  3WHK A;  1SXJ A;  1N34 M;  4B3R M;  1DGG A;  3C58 A;  3GPX A;  4LF5 M;  4AKG A;  1DO2 A;  1XNQ M;  5E26 A;  1XWI A;  3KXE C;  3SHF A;  3J80 S;  1NHW C;  2RGH A;  2C5R A;  1R2Z A;  3ZC7 B;  4IBI A;  1N36 M;  3J81 S;  5ITX E;  4GKK M;  3CF2 A;  1QAM A;  1IY2 A;  5EQT A;  3GLG A;  1J7K A;  7CAT A;  3A42 A;  3FUT A;  2XLJ A;  2CUZ A;  3KOY E;  4JYA M;  1GVN A;  3GRU A;  2LXE A;  4DUZ M;  2QBY A;  4FD2 A;  3KS8 A;  2XEP A;  2NQ8 C;  3K2L A;  2BJW A;  1N77 A;  1DGH B;  1GKI A;  3U5Z A;  3FUU A;  2HCB A;  1H6U A;  1ORY B;  3VKG A;  4M9Z A;  4FWH A;  2CHG A;  3U6L A;  2G8L A;  2Y20 A;  4LJA A;  2Q2E B;  2DZO B;  1Q39 A;  2UUB M;  3GLF A;  3KOX E;  1KFV A;  2Z4S A;  3RGS A;  2D7H A;  4MGH A;  3IG5 A;  2QCU A;  2VQF M;  2F4V M;  3SAW A;  2YR0 A;  2FNA A;  4LF9 M;  2KW0 A;  3SAU A;  4B3M M;  1IXZ A;  2XZU A;  1QQW A;  3HHX A;  4DR2 M;  5FTK A;  3GO8 A;  2XFS A;  5KPZ A;  2F5Q A;  2LWX A;  4GIP A;  5BR8 M;  4NSO B;  3M6A A;  4GMQ A;  4DR1 M;  3A45 A;  4DR6 M;  3RGP A;  4I8O A;  1E9S A;  3PNY A;  3MK6 A;  3VLF B;  3M0E A;  3JR4 A;  3FTD A;  3A46 A;  3U6C A;  5DYI A;  4I5S A;  3B9P A;  3PXG A;  1IN4 A;  2KEB A;  5E6J A;  4W5W A;  2Z7J A;  1T3T A;  5DNY A;  3LQR A;  4RNA A;  1NJF A;  2XFT A;  3LQQ A;  3I4V A;  5EXS A;  2C99 A;  2R46 A;  3FUX A;  3QAU A;  1NY5 A;  4GRI A;  3SHG B;  3AFH A;  1XC8 A;  4AG5 A;  1L2C A;  1QVR A;  2XZF A;  2CE7 A;  1G8P A;  1C1K A;  3JR5 A;  4LZJ A;  2CV2 A;  5H37 D;  4BLC A;  5EXP A;  2X4A A;  5ITY A;  4OVZ B;  4L78 A;  4QHT A;  1L1T A;  1IBM M;  4JI4 M;  2CFO A;  1DGB A;  4LJ5 A;  3GRV A;  2J7N A;  1QAN A;  1TGU A;  2P5T A;  2ZAN A;  4GKJ M;  4AKI A;  3AJI B;  4REZ A;  3SAR A;  2KZS A;  2DWZ B;  4Z8X A;  3KP0 E;  4JI0 M;  1JQJ C;  3TWM A;  2OQ4 A;  4GHL A;  1Z59 A;  2XGN A;  2R4E A;  3NWL A;  2L6O A;  4FCV A;  4KO8 A;  4G6Z A;  4LJ6 A;  2CV1 A;  4LF6 M;  5FTM A;  4IBG A;  1W5T A;  4DV3 M;  1EE8 A;  1IBK M;  4MGI E;  2K47 A;  4LJ4 A;  4GC5 A;  1TDH A;  3U6S A;  4HLQ A;  3HWS A;  4DV5 M;  3VKH A;  3T1Y M;  1GL7 A;  1NNU C;  4FWD A;  4XBO A;  4NL4 H;  3GLH B;  4LJ8 A;  1TH3 A;  5EXX A;  5IZ7 D;  1HR0 M;  2R65 A;  3MHV C;  3U6Q A;  3R8F A;  4LGM A;  1XHB A;  1K82 A;  2X49 A;  2HHH M;  4LY6 A;  4LF7 M;  5C18 A;  1X37 A;  1HNZ M;  4M9S A;  2Z4R A;  3AOE A;  3U6E A;  2QEN A;  2Y0T A;  4XGI A;  3W0L B;  1NJG A;  3IG8 A;  2CHQ A;  1L2B A;  1SXJ C;  2CEA A;  1DO0 A;  4DV0 M;  3U60 A;  4KHP M;  1HQC A;  3CF6 E;  5ITR A;  4YHH M;  2CHV A;  2VQE M;  4DR7 M;  3I4Y A;  3CF0 A;  4MM3 B;  3SMS A;  3OTO M;  5ITX A;  1IY0 A;  3THG A;  4I81 A;  2UUC M;  5EXT A;  4DV6 M;  2YQZ A;  4LG2 A;  3K1J A;  3W0F A;  4DR3 M;  1D2N A;  3AKZ A;  4LFB M;  4OW0 A;  8CAT A;  4LFA M;  3L28 A;  3HGI A;  3U6D A;  1Z5C A;  3GP1 A;  4IJF A;  4AQY M;  3VDU A;  3ZH9 B;  1OFH A;  4K0K M;  4NXM M;  1IN5 A;  1XXH A;  1NHG C;  2DZN B;  1OFI A;  2UU9 M;  4AI6 A;  4CHT B;  4IJE A;  1IY1 A;  3J7A S;  3TWK A;  1HT2 E;  3KS4 A;  3GQ3 A;  1XMO M;  3DZD A;  4MB7 A;  5ITU A;  2F5N A;  1N78 A;  4JI8 M;  1HNW M;  3GQ5 A;  1Z5A A;  4QOZ C;  4RF0 A;  1Z6T A;  4I4L A;  1E94 E;  3L27 A;  3BOS A;  4FW9 A;  5ITQ A;  2LNH C;  5EP4 A;  4B08 A;  2KRU A;  3J2P B;  3L25 A;  4X65 M;  4DV2 M;  4MGY E;  3SAT A;  1JR3 D;  5DYG A;  2L7H A;  2V1C A;  5FTJ A;  4HL4 A;  3MJ5 A;  3GQ4 A;  2HL7 A;  2HKJ A;  4L8R C;  2L09 A;  3L2A A;  4LF4 M;  5IT9 S;  4OX9 M;  3GLI B;  4AW4 A;  2C96 A;  3SAV A;  2EO2 A;  3DFZ A;  3UZU A;  1NNJ A;  1NSF A;  2LH0 A;  5BPV A;  3RE8 A;  5C1B A;  5KPT A;  3SFZ A;  2CV0 A;  1SXJ B;  4IIW A;  2YFQ A;  4B7G A;  4X64 M;  3AOG A;  5FTN A;  1YUB A;  3NBI A;  3DOA A;  2H1R A;  3HJ8 A;  3UMM A;  3ZCB B;  4A3V B;  2QPA A;  1DGF A;  5EP1 A;  1G4A E;  3HU3 A;  4NSR A;  3T15 A;  1TDZ A;  2Y0Q A;  3FUV A;  1PJI A;  1LV7 A;  5F3W A;  3GLG B;  2OPF A;  4DR4 M;  3L29 A;  4DUY M;  5EP2 A;  1IQP A;  2XSZ D;  4JI5 M;  4LZZ A;  5FSW A;  1TH4 A;  4LRS A;  1QAO A;  4CIS A;  1QYR A;  4PT5 A;  2QBY B;  2UUA M;  3RFW A;  3TQS A;  1Q3B A;  3A98 B;  5JI3 E;  4X62 M;  3HU2 A;  3U5Z B;  4IBC A;  3EIH A;  1DGH A;  1Z5B A;  2DWL A;  5FTL A;  5GKN A;  2ZM6 M;  1FJG M;  2RGO A;  3GLF B;  2I7P A;  3HHY A;  4D82 A;  1IBL M;  4IBK A;  5IRE B;  1NVM A;  4YY3 M;  4JV5 M;  2D7G A;  2L7I A;  3TE6 A;  4S12 A;  4OU7 A;  1R7R A;  4NOO B;  3KOZ E;  4BBA A;  5A2Q S;  4G4R A;  2BJV A;  4IBE A;  1R6B X;  3GPP A;  1XMQ M;  3L26 A;  3K92 A;  1NY6 A;  3KSX A;  2JA2 A;  3VFD A;  1WXQ A;  3KDS E;  3PFI A;  3PNV A;  2FFJ A;  1W5S A;  2M5Z A;  3AOE C;  4GH9 A;  5KQD A;  5KQ8 A;  1K3W A;  4KOD A;  4B3S M;  3WHL A;  1HQY E;  2R18 A;  2UXD M;  2D7E A;  3KFU G;  4PDI A;  3K8Z A;  4R3D A;  2I7N A;  4Z6Y A;  1TH2 A;  5KO3 A;  1VDD A;  3KSJ A;  1G3I A;  1UM8 A;  2FE8 A;  3GPY A;  5KPR A;  4IBJ A;  1QAQ A;  4JI6 M;  4IBF A;  4NRW A;  2DHR A;  3I51 A;  4BB9 A;  4M9X A;  3SBJ A;  4II7 A;  4EIW A;  1L8Q A;  3CTW B;  3FYD A;  1I94 M;  3U6M A;  4IBD A;  2VII A;  2AHM A;  1I4W A;  2KZU A;  1PM5 A;  4M0D A;  2Z3X A;  4OVZ A;  4ZPX A;  2QP9 X;  4LFC M;  1MU5 A;  3AV0 A;  4DV7 M;  4LJ7 A;  4JXJ A;  1SXJ D;  4PD2 A;  3UJN A;  4R7G A;  3E4R A;  1MX0 A;  1ZAE A;  2W82 A;  4QNR A;  3VDP A;  2KXE A;  2DXI A;  1ZQ9 A;  1E9R A;  2UXB M;  3EIE A;  1JR3 A;  3U61 A;  2DWM A;  2X8A A;  3SC3 A;  2R4J A;  3LMM A;  3ILK A;  1S3S A;  2Y21 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...