4DV2Q

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
99
structure length
99
Chain Sequence
b'PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 16
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dv2Q00
2DUDA 4O2DA 2XTIA 4JI1L 1AE2A 2PI2A 2Z0SA 4A76A 4A3MG 4HIMA 3K0XA 1TWHH 3T1HL 2OTLA 3MEFA 5C44H 2JQOA 2ZTCA 4GN5A 2B3GA 4IPHA 3Q8DA 4DR3L 1HNWQ 2R7ZH 4DV0L 4JI3L 4IFDI 3KF6B 3SGIA 3RZOH 3WWVA 1Q7YC 1JJCB 1CUKA 1OXVA 4DV0Q 4A3EG 2B29A 1Q82C 2VQFL 5FLMG 1SFOH 1PH9A 3ICEA 3F2DA 2NZHA 4POGA 1L1OB 2BH2A 3EBEA 2VQFQ 2OWOA 1XMOL 1YIJA 3I2ZA 5C0XG 4XIGS 3DLLA 3CPWA 5GADC 1XMOQ 2K5HA 2BA0A 1XPRA 1O7IA 2IX0A 4YCUA 1FVIA 2VL6A 2WAQE 2ES2A 4X65L 1IBMQ 5C3EH 3GTKH 4GLAC 4A3DG 2BA1A 2KBNA 3K7AH 3EIVA 1QZGA 1NMGA 4P73A 2N3SA 3M9BA 4C3HH 5IYCG 2B63G 2GVAA 1WCMG 3G4SA 3CD6A 1VQGA 3NBHB 1X56A 4JI8L 1HJPA 1V1QA 2YV5A 1HNXQ 1NY4A 4MZ9A 3HFZB 2VS1A 3K7UC 2VQEL 1U5KA 4JI8Q 2ATWA 3M4PA 4R4QA 5HGQA 2VUMG 2K5VA 3NEMA 1L0WA 3PF4A 2AHOB 2RHQB 1PV4A 1YJWA 3CMAA 2RHSB 1HR0L 3K80C 4DR7Q 2NVQH 2IHFA 1SMXA 4PMWA 3GTMH 2YTVA 4JC0A 2QEXA 1HR0Q 3BJUA 3UDIA 1AE3A 1M90C 4IFDJ 4EQ5A 2YYZA 1HNZL 2UXBL 1LM0A 3GTQH 4DV6Q 1PH6A 3H3VH 3S14H 1VQEA 3PV0A 4B3SQ 3CC7A 4QIWE 1UWVA 1Z9FA 3GD7A 3OW2A 5JJKA 4NXMQ 1KQSA 2JA7H 3HOZG 4J15A 1VQ6A 1RIPA 1JJ2A 1KL9A 3UDXA 1MJEA 2KCTA 1KIXA 1SN8A 1N33L 4JG2A 4A3KH 2F3IA 4BBSG 5JJIA 3DM3A 4MTNA 4JV5L 2WB1G 2KCMA 2IT1A 3H0GH 3ULJA 1VQ7A 4QY7A 2R92G 1GVPA 4TQUS 4A3IG 5IYBG 4GN4B 4DV3L 4YWKA 3OYYA 1I94L 1IYJB 1OXXK 2JA8H 3TS2A 3PO2G 4A3FG 1N34L 1I94Q 2LXKA 1YJ9A 5JEAG 4DKAC 2E5LL 2R93H 3PF5A 5FJ8G 1PHJA 3G6EA 4ME3A 1VQOA 5LMNQ 1X54A 2Q2IA 2I5MX 4GN3B 4B3MQ 2RCNA 4JOIC 2HHHL 1K83H 4DV7L 2ALYB 1EOVA 4HJ8A 3NELA 1A62A 1NMFA 3U50C 5M3MG 1VQ4A 1U0LA 4DV7Q 4APVA 2HHHQ 1VQIA 2UUCL 3F2BA 2K75A 1Q1BA 5JEAJ 2N78A 1S3OA 4IPGA 4JI2Q 1C7YA 2UUCQ 4KHPQ 4LFBL 4NXNL 1L1OA 3L7ZC 3RLFA 4BXXH 4BY7H 3CC4A 4NXNQ 3A5ZB 4LF6L 2JEAI 4GOPC 3RNUA 3I4NH 3W5OA 1A8VA 1MJCA 4DUZQ 5IP9G 3U58A 3HOXG 1H95A 2AWNA 5IY0A 2Q2TA 1PH5A 2JA5H 4A3BH 5C4XG 4P75A 3E9HA 1Y1WG 1FJGL 1RL2A 4DR4L 1A0IA 1J5EL 5C4JH 4JI7Q 4A3CG 1Y1VH 5GAGC 1EQRA 2WP8J 1FJGQ 3F8TA 4DR4Q 1NBWA 3H15A 4KHZA 2OTJA 4LFAL 4DR6Q 3BZKA 1UE6A 1QUQB 4P74A 4YCWA 3TS0A 3PO3G 5C0XI 3A74A 4A3LG 1KRSA 4A3MH 4LFAQ 1KC8C 1GM5A 1CSQA 1LUZA 4R1JA 4UP8A 2VW9A 1VQDA 2BH8A 2QA4A 3HOVG 4P72A 4DK6C 3CCLA 1HNWL 1PYSB 2Q2UA 5IYDH 1VQFA 3RN2A 3CW2C 2ASBA 1YHQA 5IP7G 1Q46A 1X65A 4A3EH 4LUZA 5FLMH 1HZBA 5M3FG 4A93H 3U4ZA 3CCEA 1S72A 4PZ7A 1BBWA 5IYDG 5LMNW 4OX9Q 3HKSA 4ALPA 1EWIA 1IZ6A 4JI4Q 1G6PA 4Y7NH 2CFMA 3ULLA 3AYHB 4A3JG 2A19A 1XMQQ 4R4IA 3MXNB 4DV2L 1Q1EA 3CQZH 3M7NA 1IBML 1SLJA 3T1YQ 4GKJL 1X6OA 4A3DH 4JBKA 4DV2Q 1ASZA 3M4OH 4GKJQ 3GTPH 4B3TQ 2MO1A 4JBWA 1Z47A 1QVCA 2R7DA 1X3EA 1WYDA 3G71A 1HNXL 1XNRL 1N9WA 1L2FA 2ZTDA 4DR2Q 2D62A 1B7YB 3STBD 3ZJYC 5C0XJ 2R7ZG 2VUMH 1C0AA 1IBKL 1XNRQ 1XTDA 1CKMA 2VNUD 1VQLA 4UP7A 1IBKQ 1TWAH 4DR7L 2F4VL 2GN5A 3PIOA 4HIKA 1UE7A 4JI5Q 2F4VQ 5E7NA 4DNIA 3I7FA 3A5UA 2D0OA 2K14A 3GO5A 4EX5A 1Q8KA 3M85A 4DV6L 4GNXC 2Z6KC 2PMZE 1IXRA 4B3SL 3PCOB 3U4VA 1NJIC 1CKNA 4L5RC 2IY5B 4LF9Q 1VQBA 2ZTEA 4JI0L 2KHIA 3I4MH 3M3YH 4KLKA 3KOJA 4DPGA 4BY1G 4YY3Q 4JI6Q 4NXML 2UU9Q 1VCIA 3HOZH 1T9HA 1E1TA 4JI0Q 4R4TA 2OCEA 2VY3A 3KFUA 4LUOA 1KRTA 4BBSH 4P71A 2PQAA 1VQ8A 3HOWH 1VQPA 1IBLL 1PH3A 4K0KL 4RMFA 3CF5A 1Q12A 1K8AC 4IPCA 5JJLA 3E0EA 2WFWA 1IBLQ 4LUVA 3D31A 1WFQA 4K0KQ 2DGYA 3F1ZA 4YHHQ 3FP9A 3PUYA 1E24A 5AJ3Q 4IOAA 2R7FA 4X62Q 1Q81C 3CCQA 3PO2H 1YHBA 1QUQA 2Y0SG 2K5NA 4JBMA 1N36Q 2LSSA 2FXQA 2MNAA 1K73C 2AMCB 4YCVA 3HOUG 4HJ9A 2E2JH 1FGUA 5FJ8H 2WB1E 1VQCA 1BKBA 4NPSA 5H1SE 3UDFA 1DGSA 2ZJPA 2JA6G 1B70B 1E7ZA 5GROA 4HJAA 4OWXB 5LMNL 4B3ML 3PSIA 3B6YA 3PUZA 4R4OA 3J80c 3RR5A 3KDFB 5GAEC 1HZCA 2QGQA 1D7QA 4IJHA 5M3MH 3TQYA 1YZ6A 3E9IA 1ASYA 2YTYA 1LYLA 1EIYB 3NENA 4GOPB 4DR1Q 4A3KG 1UE1A 1OTCA 1VQ9A 4X6AH 4JI2L 4KHPL 4AIMA 1K8GA 1S40A 1VQNA 1CSPA 1YBYA 2AKWB 3CMEA 4QQBX 1CKNB 1A63A 2CCZA 5EAYA 4QGUA 4DR5Q 4A3GH 3TRZA 3HOXH 3OTOQ 4DUZL 1OXSC 4LNQA 5C4XH 1SROA 1E1OA 3EN2A 2JA8G 3PUVA 1XJVA 4C3IH 3KJPA 3J7A5 4B3RQ 2PQAB 4JI7L 4DUYL 4HJ7A 1N8RC 4X64L 2IHEA 4AYBG 3S1MH 4FDBA 3J80i 3JAMc 2MQHA 4X64Q 4DUYQ 4DR6L 1SE8A 3KF8B 4OONA 4UP9A 1B8AA 1TWFH 4A3LH 4WJ4A 2HIVA 5IWAQ 1VQHA 4QJFA 1XPUA 4WJ3M 3AFQA 1VQMA 4KI0A 3GTGH 2UUAL 3CCMA 5M5YH 2A1AA 3STBC 1R9TH 2UXCL 3FKIG 4LFCQ 1JB7A 3CC2A 2EIFA 2UUAQ 3RLOA 4A4IA 3HOYG 2UXCQ 3PIPA 3UDGA 4OXPA 4LF7L 4DAMA 2D0PA 3HKZG 2I0QA 4BY7G 1GO3E 3W1BA 1MIUA 2NZOA 4LF7Q 4GLXA 4BBRG 4L5SA 4DV4Q 2K52A 3CXCA 4DV5Q 1J6QA 1KD1C 4IPDA 3CCJA 2JA5G 4A3BG 1PA6A 2RF4A 1Y14B 4OX9L 2ID0A 2F52A 1NE3A 1XNQQ 2CWAA 1Y1VG 2XGTA 5BR8Q 2LXJA 3CCSA 4IOCA 3JAMi 4JI4L 1JT8A 3BZCA 1XMQL 2ZJRA 1GKHA 1JE5A 5K36G 5HY6A 3RZDH 4DK3C 4LF8Q 3T1YL 1WJJA 3S16H 2KENA 1PFSA 4YWLA 4JI1Q 2CWPA 4LW1A 4RG1A 3F2CA 4B3TL 1SR3A 3UE1A 5IYCH 2B63H 1D8LA 2ZM6L 3FHWA 2Q2HA 1WCMH 3T1HQ 1K9MC 1EFWA 1UE5A 2K4KA 4DR2L 5C44G 2ZM6Q 4QL5A 1PH4A 3PUWA 2JA9A 1XPOA 2OQKA 1NTGA 3LGJA 4DR3Q 4JI3Q 4JOIA 1PH7A 2WAQG 3S2DH 1YHAA 3ERSX 1HZAA 3S1NH 2CQOA 1PH1A 4A93G 1K3RA 2NVTH 4LF5L 3K81C 2JE6I 4GNXB 2GVBA 1C9OA 3KLWA 4JI5L 3GTJH 5FLXc 1VQ5A 3KDFA 1AH9A 4LF5Q 3I55A 2JEBI 2HT1A 5GAHC 3ULPA 1YJNA 4AQYL 5GQOA 3PUXA 1P8LA 2E2IH 3AFPA 1EUJA 4YWMA 4GOPA 4AQYQ 1KXLA 4X65Q 1L1OC 2JK8A 4OWWB 4LF9L 4JYAL 1GD7A 1OXUA 5C3EG 4BY1H 3G48A 4JI6L 2L15A 4YY3L 3H3VI 2UU9L 4JYAQ 3L2PA 4IO9A 3AEVA 1G51A 3IRBA 4IFDG 3S2HH 3GTOH 3KYHC 2VZAA 1X3GA 3W1GA 2VQEQ 1CKOA 1X9NA 2CKZB 3D0FA 3M4QA 4MNOA 2I5HA 2JJQA 3CP0A 2PNHA 3ER0A 4AH6A 4UY8C 3AQQA 2I5LX 4YHHL 2R92H 5AJ3L 1BVSA 1MKHA 4POFA 4X62L 3S24A 3CCVA 1I50H 4X66L 5IYBH 4HIOA 3RN5A 4A3IH 1M1KC 1QVFA 1N36L 3VDYA 3HOUH 1EYGA 4X66Q 2YU9H 1KHIA 2HIXA 1WI5A 1I3QH 4XTCS 4A3FH 1HNZQ 5IE8A 2EXDA 2JA6H 4DV1L 2UXBQ 3BU2A 3J7ZC 4LWCA 4DV1Q 1KAWA 3I4MG 4Y52H 5LMUL 1W3SA 1HH2P 1V9PA 1WOCA 1X3FA 2Y0SE 3CCUA 3GDEA 3TREA 2JA7G 5LMUQ 2EQSA 2K50A 2PI2E 1VQKA 2KHJA 4DR1L 2IX1A 1TWGH 3HOWG 4L5TA 1N33Q 3UE0A 3CAMA 3S1QH 4A75A 3KJOA 4UPAA 4JV5Q 2NN6I 3PGZA 1G291 1YVCA 3CPFA 3H0GG 4DR5L 2YTXA 4C3JH 1UEBA 3OTOL 5ELNA 3JC66 2AWOA 4NB3A 1E3PA 1TWCH 5ELOA 5IP9H 4DV3Q 1PH2A 2E2HH 2ZJQA 2OQ0A 2R6GA 3S17H 5M5WH 1IL2A 2A8VA 4B3RL 1BBUA 4HJ5A 1N34Q 1Y1WH 2UUBL 2N8NA 3I56A 5J3BA 1P16A 4OO1I 1PVOA 2E5LQ 1YEZA 3TEHB 1Q86C 4A3CH 1FL0A 4H02A 2UUBQ 4IJLA 2R93G 3RLNA 2UXDL 1QZHA 4GLVB 3J81c 3S15H 3KF6A 1YITA 1EIFA 1V43A 5IWAL 4BA2I 4R4CA 4GKKL 3S1RH 3PO3H 2NVYH 2UXDQ 1JJGA 4TVAB 4PG3A 1I5FA 1E22A 4GKKQ 3FKIH 4GS3A 1SRUA 3CCRA 5DLQE 2H5XA 4LFCL 1LTLA 1OXTA 3I4OA 4JCVE 1HZ9A 3J81j 1PH8A 3GTLH 3HOYH 1I6HH 1HR0W 2NN6G 1VQJA 4AYBE 4GNXA 2Z6KA 1W2BA 4LF4L 2MO0A 4A3JH 1QVGA 2NVXH 4LFBQ 3HOVH 4A3GG 4LF4Q 4BBRH 4DV4L 4BA1I 4DV5L 4LF6Q 2HQLA 5IP7H 4BXXG 3L0OA 4OWTB 3I4NG 3A0JA 5IT9c 4PZ8A 4PZ6A 2C35B 5M3FH 2N49A 1X55A 3K8AA 1YNXA 4OO1G 4HIDA 1EQQA 1N32L 2E8GA 1VS0A 1VQAA 2MFIA 4JBJA 1PYBA 5BR8L 4DAYB 1XNQL 1YI2A 1J5EQ 1JMCA 2V1CC 1N32Q 5M5XH 3J81i 3HKZE 4L5QA 4O0AA 1TXYA 4LF8L 1K0RA 4C2MH
chains in the Genus database with same CATH superfamily
4RCNA 3ERQA 4KMUC 1KLGD 1AE2A 2PI2A 4A3MG 4HIMA 3HP3A 5BN3A 1TWHH 2Z1CA 2R7ZB 4FVMA 1WD0A 2OTLA 2PQEA 2JQOA 1DJRD 3Q8DA 1SFOB 1KABA 1HNWQ 3KF6B 1F9QA 3ONAB 1STEA 4A3EG 1PH9A 5IOCA 3QWNA 4POGA 1L1OB 2OWOA 3GTKB 1XMOL 1YIJA 3RMHA 3DLLA 1LTAD 2WKDA 5GADC 4FF4A 3TZUA 2B2TC 1SMYD 4BY1B 1FVIA 2XIWA 2MUYA 2KBNA 3BZDB 3EIVA 3KBGA 2RSNA 3M9BA 5D65A 4C3HH 2EJMA 3CD6A 3NBHB 3IL8A 3V2TA 2ICEC 1GXDC 4MZ9A 3HFZB 2VS1A 1VMCA 3K7UC 4C56C 3OWFA 2AHOB 4MTKA 2IW3A 1PV4A 4DK0A 5CV7A 1HR0L 4DR7Q 2NVQH 3P7JA 2F0KA 2QEXA 3BJUA 2KQ3A 5IGCA 5IODA 1HNZL 4IUUA 3AU7A 3GTQH 2GA4B 3IFDA 5KNBA 3S14H 1VQEA 5CR3A 1UWVA 1F2LA 1AN8A 5JJKA 2CHBD 1TKWB 4DNRB 2JA7H 5KNDA 1VQ6A 1KL9A 1SXTA 1KIXA 1SYFA 2F3IA 1SNMA 3DM3A 4MTNA 5FKAC 5FO9B 2R92G 2WACA 3ND8A 1T5XD 4FYDA 4WRDA 4CJ2C 4CDDC 2A6ED 2EJFC 2MJ8A 4DAPA 5JEAG 2F1MA 5JVH3 3PF5A 1PHJA 2QDLA 4ME3A 1VQOA 3K0YA 2I5MX 4GN3B 2F0PA 1WTQA 2HHHL 3NELA 1A62A 2A73B 3H09A 5M3MG 1VQ4A 1U0LA 4DV7Q 1VQIA 3CU7A 3F2BA 2K75A 5JEAJ 1KNAA 4JI2Q 4IPGA 1TY0A 2UUCQ 1F2ZA 4NXNL 3NQIA 1MHWC 1XYIA 2JEAI 3I4NH 2L4NA 2HCIA 5C4JB 1A8VA 1Y1VB 4DUZQ 2AWNA 5IY0A 1PH5A 5C4XG 4ZQ3A 1A0IA 3MXPA 1NBWA 4RHRA 4DR6Q 1UE6A 1QUQB 4JK1C 1GM5A 4R1JA 2N88A 4UP8A 3C2PA 4H13C 3HOVG 4P72A 4DGZA 2R61A 3CW2C 5IP7G 1Q46A 1X65A 4KJNA 5CBAE 4Y7NB 5FLMH 3OIPA 4ABNA 5M3FG 5ELFA 3U4ZA 1A2UA 3CQZB 1JWMD 4TSSA 1IZ6A 3SK8A 2L12A 5EKKA 3MXNB 4DV2L 1R4PB 3SVMA 4RGMA 4JBKA 1EL0A 4X3UA 4U673 3T51B 1WTWA 1WYDA 1N9WA 4QIWB 2D62A 1B7YB 3ZJYC 5C0XJ 2G5DA 1EYAA 2QDBA 4NMZA 1IBKL 5DM73 5CC4A 1B9MA 3GTMB 4UP7A 3N52A 1A2TA 2F4VL 4RWSC 1EWCA 3PIOA 4HIKA 4LAAA 1QILA 3EVQA 4JI5Q 3NTIA 5FO7B 3GO5A 4N8FA 1IYUA 3K57A 3M85A 1RODA 2Z6KC 1I4HA 2HQEA 2EYFA 4MHEA 3M3YH 4NXML 3HOZH 4DPGA 3DM1A 2J4XA 5IGGA 2UU9Q 1H9SA 1VCIA 1CA5A 1E1TA 4R4TA 3M7GA 2M2LA 4LUOA 4G7OC 4R9WA 2PQAA 1F2MA 4QMGA 1XXGA 2O5IC 3CF5A 4K0KL 2FMMA 3D6CA 1MI2A 5AJ3Q 4ME5A 1Q81C 2PZTA 2BCOA 1YHBA 3N6RA 2FXQA 1K73C 1CK1A 4YCVA 2EY2A 3DHQA 3NTHA 4HJAA 4LK1C 5IIFA 1VQCA 1DGSA 5GROA 5LMNL 1S5CD 4B3ML 3B6YA 3PUZA 2QGQA 3E5SA 3SE0A 1D7QA 3TQYA 1YZ6A 2K5WA 4QUFA 4X6AH 4MIUA 4GOPB 1RTNA 1K0SA 4AIMA 2BOSA 1SNDA 1CKNB 4C3IB 2Z4HA 2MP1A 1OXSC 1JWSD 1E1OA 2NB0A 3EN2A 2M9VA 2JA8G 1U9RA 1BNZA 1O7ZA 2WINB 4AYBG 1R9TB 4FDBA 3PQIA 3MTSA 2IJ0A 3HZXA 1UEAB 2BDOA 2HIVA 4QJFA 5LL6S 4CKCA 3AMUA 3CCMA 1ILPA 1EEID 4LFCQ 5EBDA 2EIFA 1A3UA 4A4IA 3PIPA 4OXPA 1SEBD 4DAMA 3HKZG 2JN4A 2F0MA 3GV3A 2DJFC 4L5SA 4DV4Q 2K52A 3CXCA 1KD1C 4RH6A 4IPDA 2JA5G 4A3BG 2A69C 1Y14B 3S16B 2E74C 4KD4A 2F0DA 2LXJA 4JI4L 5EPJA 2SNSA 4ILWA 5K36G 4F87A 3T1YL 3GTPB 2F03A 4YWLA 4DAVA 2CWPA 2HCCA 4HAEA 4RG1A 3F2CA 1U4RA 4ODGA 3UE1A 2Q2HA 5CGKA 1EFWA 3V96A 1PZID 2K4KA 3Q6SA 1I4XA 4QL5A 1LTRD 1PH4A 2NVTB 1PH7A 3S2DH 3OW7A 1HZAA 1V1PB 4K5VA 1PZKD 5L37A 2I07B 2EYMA 2JE6I 4GNXB 1ILQA 2F3VA 5CV5A 4AQYL 1K8MA 1PTOF 1PTOB 1EUJA 5TSSA 5E4WC 3GTOB 1KDBA 1GD7A 3FDTA 4BY1H 2L15A 5KYLA 4JYAQ 4RAUC 3AEVA 4IO9A 3AB9A 4C3HG 3SHLA 5CV9A 4KN7C 3NTKA 2Y0SB 4A3IB 1A6XA 4RGOS 1WTRA 4O1NA 4RHSA 3M4QA 4MNOA 3C1FA 2JJQA 3CP0A 4PMCA 4AH6A 2J0TD 2CQAA 2R92H 1BVSA 4X62L 3RN5A 3CCVA 1I50H 1M1KC 2KCCA 2QCPX 3HOUH 1II3A 4X66Q 1KHIA 3IKJA 1WI5A 1HNZQ 5IE8A 3BU2A 1SJHD 4FF1A 3VA5A 3I4MG 5EJWA 1STBA 3BDOA 1C8CA 1LLRD 1WOCA 3GDEA 3TREA 2JA7G 2PI2E 2KHJA 2IX1A 4XT1B 2F0JA 2WV6D 1TWCB 2OT2A 3HOXB 3R8BA 3NE5B 2YTXA 2DNCA 3JC66 1MGSA 4NB3A 1E3PA 5ELOA 2E2HH 1MD2D 4IN3A 5JOBA 2OQ0A 1PH2A 2ZJQA 1X32A 3BYYB 3DEPA 4G7HC 3PMFA 3S1RB 3PO3B 4F7XA 4FO2A 1Q86C 1TWFB 3FKIB 1ZYRC 4DXGA 1PLFA 3DWAA 2UUBQ 1QWYA 4MN3A 3RLNA 3HOYB 2UXDL 1I6HB 2XN9C 3S15H 3KF6A 1JJGA 2NVYH 4PG3A 4GKKQ 4XYQA 1G2SA 3D8GA 3EJIA 4JCVE 3GTLH 1PTOD 3LX0A 1NNXA 4AYBE 1QJOA 4LF4L 2MO0A 1AFPA 1QVGA 3HOVH 2Q8TA 2F0SA 3HS0C 4EGVA 4A3GG 4IUPA 2ZXRA 4KJOA 4NDXA 5ELEA 5IP7H 2K5QA 3I4NG 4OWTB 2XWJB 2C35B 5M3FH 4A3JB 4XDXA 2E8GA 3NBHA 3RZDB 4DAYB 2EXZA 1O78A 5M5XH 3HKZE 2DUDA 4HSVA 2Z8LA 2RKSA 3K0XA 3VYSA 3RZOB 3MEFA 1PYWD 1KDAA 2ZTCA 4GN5A 1B3QA 4X3TA 2C9OA 4JI3L 4F8MA 4L63B 3BS1A 1JJCB 1NR2A 4DV0Q 1OXVA 1HRJA 1NAPA 1Q82C 1ML0D 5FLMG 3ICEA 2BH2A 2VQFQ 4XIGS 3J80E 3CPWA 3K7AB 5IGDA 2K5HA 2BA0A 3P20A 1O7IA 4I7AA 4ZRZA 2VL6A 2ES2A 4GLAC 1QZGA 5IYCG 4GZYC 2H4OA 2GVAA 1SYCA 4JI8L 1SYEA 3D4WA 1NY4A 5AFWA 3FPUB 3MVVA 3M4PA 2K5VA 3NEMA 3PF4A 1DYQA 3CMAA 2D9UA 1BF4A 1GHKA 2L9HA 1SMXA 3GTMH 2YTVA 4JC0A 1JICA 1M90C 1EFID 2YYZA 1AW7A 3SR1A 4ZYSA 2UXBL 2A74C 4K8IA 2V4DA 1BXTA 1PH6A 3OW2A 4A3KB 3P75A 4NXMQ 1DCZA 4KKUA 5ELCA 3HOZG 3H0GB 1DOLA 3S1QB 1RIPA 2D2CC 2K6AA 2PZWA 1MJEA 4TKOB 1XX8A 5DAUA 2HDLA 1N33L 4JG2A 3J7AF 1B4OA 2FMCA 2KCMA 3NWTA 3ULJA 1QCBD 4TQUS 5M5WB 4GN4B 3OYYA 1I94L 1IYJB 2JA8H 1EEFD 1I4GA 4A3FG 1GUNA 1I4PA 2JXMB 2LXKA 2NUCA 4KN4C 1YJ9A 2E5LL 1X3QA 2KEDA 2R93H 3DUZA 2TSSA 1RDPD 3TMEA 5LMNQ 2Q2IA 4B3MQ 2RCNA 1K83H 4KY5A 1GUWA 1IKMA 3BDCA 5A35A 4APVA 4BY7B 1Q1BA 2N78A 1S3OA 4BBRB 4KHVA 4RKBA 3DWQA 3TBIB 1Q90A 3L7ZC 3MXNA 3RNUA 3FPPA 1H95A 2JA5H 4A3BH 4P75A 1Y1WG 3URYA 2K33A 1SMYC 5C3XA 1FJGL 3HGBA 4DR4L 3MXUA 4A3MB 4CDEC 5GAGC 1EQRA 2WP8J 3F8TA 1S5BD 2EY5A 4LFAL 1ICWA 1EIGA 3OMGA 3A56A 5C44B 2KOLA 3I90A 4IUVA 1A3TA 4A3EB 1TQOA 2WKCA 4XQJA 4A93B 2EYOA 1PYSB 2Q2UA 4RCOA 3RN2A 2RDGA 3EROA 2ASBA 2JP1A 4LUZA 2E2DC 3WOEA 1X3PA 4I65A 3M4YA 4PZ7A 1BBWA 5IYDG 3JAML 4P2CB 3GV6A 4ALPA 1EWIA 4JI4Q 1JQYD 1O7LA 5C3EB 3ULLA 3S9WA 5C4HA 3M7NA 1IBML 3T1YQ 1GJXA 1X6OA 4A3DH 1WVLA 3MWYW 4GKJQ 1Y69U 3GTPH 2A5HA 3UI2A 1XNRL 2ZTDA 1L2FA 5D14A 1HTLD 1HQRD 3SDZA 2R7ZG 2VUMH 5EQ0A 2VNUD 3HEJA 1TWAH 2KA7A 2A6EC 5K5PA 2K7VA 1J8IA 1EU4A 5E7NA 4DNIA 2XSCA 3A55A 2K14A 2F0FA 2RBMA 4DV6L 2PMZE 3U4VA 1CKNA 4L5RC 3HOWB 3I4MH 3KOJA 4BY1G 4JI0Q 1PFMA 2OCEA 3NWSA 3A8IE 4BBSH 4B9WA 2B2YA 1B2TA 2AQ2B 1PH3A 4RMFA 2KUMA 2WFWA 1IBLQ 4LUVA 2PNRC 4DFAA 1E0BA 1EYDA 2KEEA 3FP9A 2E2JB 1RCVD 4X62Q 4CJ0B 1QNKA 3PO2H 4JBMA 2K5NA 3G6JB 2LSSA 1CZGA 1EY9A 4OIJA 4UDUC 3HOUG 2L0CA 1FGUA 3UDFA 2BDNA 1DXMA 3PSIA 3DMUA 3J80c 5GAEC 3HG9A 1XWEA 4X3KA 1ASYA 3J7YW 1UE1A 2ZXOA 4KHPL 1BR9A 1SSOA 1K8GA 2KJXA 3OHXC 4K5WA 1YBYA 3VYTA 5A2QE 1GUGA 1WTPA 1QOHA 4A3GH 4RGNA 2K5DA 1H9RA 3HOXH 2EVBA 1SROA 3PUVA 3R93A 3J7A5 2IX3A 4ZCKA 4JI7L 1PRTF 3L3OC 2SNMA 1PRTB 4BS9A 5M5YB 1EY0A 2BE5D 4DUYQ 2MQHA 4X64Q 2F0NA 1SE8A 4UP9A 4UHVA 1B53A 1TWFH 4A3LH 5FOBB 4FP5D 4N8X1 4J1MA 4WJ3M 3AFQA 1V1PA 4K14A 4KI0A 3GTGH 5ISRA 2A1AA 2UXCL 2FINB 2UUAQ 1ESRA 3EQLC 4ID6A 3W1BA 4LF7Q 4GLXA 1J6QA 2O4XA 1JCKB 3CCJA 3QJYA 2RF4A 4OX9L 3GQBA 1SNQA 5JPMC 3J81L 1Y1VG 5EKLA 3CCSA 4F88A 3JAMi 3KK7A 3BZCA 4ZUIA 2Z9HA 2B63B 3RZDH 3I4LA 4EQOA 1WTOA 1WCMB 1PFSA 1HUNA 3CHBD 1STGA 5IYCH 1ZXTA 1UE5A 4OEMB 2ZM6Q 5IT9L 3PUWA 4H44C 3LGJA 5CV6A 4JI3Q 4JOIA 2WAQG 2HD3A 1WTVA 1YHAA 3ERSX 2XVSA 4WORA 3S1NH 2CQOA 1D5MC 1Y8NB 2E2IB 3KLWA 2QILA 3GTJH 2P5ZX 5G3LF 1EY5A 3GP7A 3KDFA 1AH9A 4LF5Q 2HT1A 5GAHC 3PIO3 5GQOA 2ZT9C 2VB3X 3PUXA 1E2ZA 1P8LA 3NQTA 4KY6A 4JW0A 5D3IB 2JK8A 5CORA 4OWWB 1BO0A 3G48A 4YY3L 2RCFA 1EQVA 2WB1B 2NBFA 4IFDG 1EZ6A 1S5FD 2AQ3B 1UUPA 3KYHC 2VZAA 1C48A 4CGYB 1CKOA 3TP5A 4HTHA 3MFGA 2Q8RE 2CKZB 3ER0A 2PNHA 4UY8C 2MPMA 3AQQA 4YHHL 4OELB 3KF8A 1N36L 3VDYA 1BCPF 3TP7A 1ENAA 1BCPB 3MEHA 4A3FH 1I3QH 1CFMA 3QIAA 2EXDA 4ZLTF 4DV1L 1QE6A 2UXBQ 1AP0A 1YNJD 4G7ZC 1W3SA 3U9OA 3QR8A 5LMUQ 3Q24A 1IW7D 1FNUA 2K50A 3NXWA 1TWGH 3OWEB 4C3JB 4L5TA 1G91A 1N33Q 3DWPA 3CAMA 3UE0A 4DAYA 3S1QH 4UPAA 2NTSA 3PGZA 4Z9CB 1G291 1YVCA 3D4RA 4AYBB 4QF4A 4K8JA 1EZ8A 2F0QA 4OIKA 3WDNA 1D5ZC 2F0LA 5M5WH 3S1MB 1BBUA 1Y1WH 5COYA 4OO1I 2E5LQ 1YEZA 1W6KA 1FL0A 4IJLA 2R93G 1QZHA 1EIFA 5IWAL 1ENFA 1G8ZD 1LV9A 3NHHA 5G3LD 2A68D 1R4QB 1K3BC 1O80A 3CCRA 2FHTA 1LTLA 2CVRA 1PH8A 1HR0W 1AZPA 2EPBA 1VQJA 2SOBA 2NYZD 1W2BA 2EE1A 2K01A 4BBRH 2QW7A 3PIP3 2O2LD 1VDZA 2X6LA 4BA1I 1CTMA 3A7LA 3L0OA 3A0JA 4PZ8A 3O13A 4PZ6A 2Q8IB 1EY8A 2N49A 1X55A 3K8AA 1FYCA 1NSNS 3OIQA 4HIDA 1EQQA 2F0VA 1XNQL 1VQAA 1N32L 5BR8L 2OEOA 5IYDH 1JMCA 3J81i 1LACA 3VR2A 2B2YC 4O0AA 4K6LA 4LF8L 4C2MH 2EZVA 4O2DA 1HHVA 5C5LA 2XTIA 2F0WA 3FEWX 1U4LA 1BCPD 2Z0SA 4A76A 3TZDA 1LT3D 3T1HL 5C44H 1PDQA 2NWGA 3J7AV 2LY7A 5T1IA 2B3GA 4DR3L 1RJTA 2ICIA 2R7ZH 3K5MA 1LTSD 4IFDI 3SGIA 3WWVA 1Q7YC 2B29A 2KECA 1SFOH 2F0OA 2Z6BA 1NCVA 4CDFC 3D4DA 4CJ1B 1XMOQ 2IX0A 2WAQE 3K59A 2EYHA 1IBMQ 5C3EH 3GTKH 4K5XA 3D3RA 2E76C 4A3DG 3S2HB 3I70A 1IL8A 2N3SA 1BBXC 1LABA 4BWGB 4KKSA 2PZUA 1I6VC 2YV5A 2VQEL 1CZWA 2ATWA 1U5KA 2NVQB 4R4QA 5HGQA 2VUMG 2N55A 5FK9C 3TSSA 2RHSB 4DN4M 1ESFA 3C3LA 2WIIB 3GTQB 4PMWA 3BYTB 1F77A 2LKVA 1HR0Q 3T53B 2JA6B 1AE3A 4EQ5A 4FNFA 3X3NA 3SK5A 2CW0D 2JA7B 4DV6Q 1SE4A 4QIWE 3R3OA 1Z9FA 3GD7A 3QOJA 1WTXA 3TN2A 1PTOC 2R3ZA 1I4QA 4Q0FA 5CV4A 2B2WC 1KQSA 1ZKOA 4J15A 4BBSG 5JJIA 4H7BA 4HN7A 1DOMA 1KAAA 5JJZA 1VQ7A 4XYOA 4A3IG 4DV3L 1TS4A 4YWKA 2F0UA 1OXXK 3PO2G 4RGTA 2A6HD 4DK1A 1CM9A 4EQPA 1PZJD 4HR7B 3G6EA 1CHQD 2EYJA 1X54A 4JOIC 4DV7L 1JE4A 1EOVA 2HHHQ 2NVXB 3QO2A 2UUCL 3BG3A 4KHPQ 4LFBL 1C7YA 1L1OA 3RLFA 4BXXH 1H9SB 3CC4A 4NXNQ 4LF6L 1TS2A 3W5OA 1MJCA 2B8GA 1EQTA 3QOLA 3HOXG 4OO1H 2Q2TA 3E9HA 1JC7A 5DEHA 2B39A 1J5EL 3CRLC 5C4JH 4JI7Q 1Y1VH 3H15A 4KHZA 2OTJA 5EPKA 3KLSX 4P74A 4IUNA 4YCWA 2OF1A 1TT2A 1STAA 3TS0A 3PO3G 4A3LG 4XQQA 1LUZA 3A8KE 5I9OA 3KLRA 1GUSA 2BH8A 2QA4A 4C1NI 1STNA 1CQVA 1MSGA 1VQFA 3Q23A 2JYOA 3E6ZX 1S5DD 4WJWA 1JOKA 5LMNW 4OX9Q 4OGQC 3HKSA 3OSOA 4CBVA 1G6PA 4Y7NH 2CFMA 2G9DA 3AYHB 4A3JG 2A19A 2K1BA 4R4IA 3CQZH 1SLJA 5I2YA 4E6IA 1SDFA 4DV2Q 1GOZA 3QB3A 1ASZA 1U4MA 3MFYA 3BDLA 2PMZB 2MO1A 1Z47A 3KBXA 2R7DA 1XTCD 4IFDH 2KCNA 1HNXL 3STBD 3VYUA 1KTKA 4CDCC 1XTDA 4TRDA 1VQLA 1IBKQ 5I9PA 2QKIC 1ONLA 1Q3LA 1UE7A 1FD7D 3EFXD 2I46A 2F4VQ 4EVOA 4J8QA 2CH4A 2D0OA 3M3YB 1Q8KA 1SYGA 1HTPA 4B3SL 3PCOB 5C4ZA 2LS01 4CKEA 1SJED 1VQBA 3MXGA 3BVGA 2KHIA 2L1BA 3CRKC 3K6OA 4KLKA 1SAPA 4YY3Q 1T9HA 5J39A 1LO5D 4FF3A 2VY3A 4IQZA 3KFUA 1KRTA 1VQ8A 1VQPA 2XWBB 1CHPD 3RD4A 1K8AC 1W6JA 4IPCA 3E0EA 1VF5C 3D31A 5E4XA 4K0KQ 3F1ZA 4YHHQ 1K28A 4L6TB 3CCQA 1Z6HA 1QUQA 3NK9A 1Y8PB 1N36Q 2MNAA 3CKIB 5FJ8H 5H1SE 2ZJPA 2L55A 1ET6A 1E7ZA 4OWXB 2O5JC 2RA4A 1HZCA 1YNND 2DY8A 3SEBA 2YTYA 1LYLA 1VMPA 3NENA 4B9XA 1EIYB 4A3KG 1OTCA 1D1IA 1S40A 1VQNA 1Q8IA 1CSPA 2AKWB 4ZUJA 5KEEA 2MGSA 3TRZA 3MAQA 2EJGC 4IUTA 1XJVA 1UNSA 4C3IH 4IZ8A 3KJPA 1OO9B 2F4IA 4Q5VA 4HJ7A 2IHEA 2X69A 3S1MH 5DNFA 4HSPA 4OHJA 5LL6X 1M8AA 1M4VA 1WD1A 2F0EA 1B8AA 4WJ4A 5IWAQ 1VQHA 2TMPA 1XPUA 1I4RA 1VQMA 1IKLA 1R9TH 4G57A 4WFN3 5EGTA 2D5DA 5C5MA 2K32A 1PFNA 1F9SA 4ZKBB 2D0PA 1MBYA 4BY7G 1C4QA 3A7AB 1GO3E 4JPBW 1MIUA 2NZOA 1G6ZA 1JOOA 4BBRG 2PW5A 1ENCA 1A3VA 2ID0A 2F52A 3ND9A 4U68A 1XNQQ 2CWAA 2XGTA 5BR8Q 1JT8A 1XMQL 2ZJRA 1GKHA 3C46A 1JE5A 3U9SA 5HY6A 4DK3C 3M4OB 4LF8Q 3S16H 3Q22A 3TDQA 4LW1A 4B3TL 1SR3A 1FR3A 1RTOA 1A15A 3S2DB 3FHWA 3T1HQ 1K9MC 4HMJA 4DR2L 5C44G 5EKIA 3D6WA 2JA9A 1XPOA 2OQKA 1NTGA 4DR3Q 1HA5A 2VB2X 1TR5A 4A93G 2IWHA 2FFKB 3OPOA 1ZEQX 5IGEA 2NVTH 1C9OA 4C1NK 3I55A 2DJGC 2JEBI 1H9JA 3ULPA 5CYUA 3I72A 3DEOA 3AFPA 4GOPA 2RDHA 1B1ZA 4AQYQ 1L1OC 4JYAL 4LF9L 5C3EG 1JORA 4FXDA 4JI6L 3H3VI 3MA2B 1PTOH 1G51A 3S2HH 1HXYD 3GTOH 2EY1A 2R92B 5EBCA 2VQEQ 1I50B 3TP6A 3HOUB 2I5HA 2EY6A 1S5ED 3G7LA 3QG1A 5FLXL 2HUGA 4A3IH 4X66L 1QVFA 2RSOA 1CA6A 2BE5C 2PO4A 4XTCS 2JA6H 3J7ZC 1JOQA 5M3MB 1KAWA 5KNCA 2C5CA 5F2DA 3ITPA 4Y52H 1L0YB 1SE2A 1V9PA 1X3FA 1B44D 1HPCA 4J6HA 3CCUA 4IALA 5HGTA 4CKBA 1VQKA 4DR1L 1D6EC 1NR4A 3NPPA 3HOWG 5I6YA 4A75A 2E2HB 3KJOA 2ZXPA 2NN6I 3OMCA 2NTTA 5C4XB 4QUCA 1D1KA 4DR5L 1GUOA 3HRZC 1STYA 3F2UA 3OTOL 4OL7A 1RKNA 2AWOA 1TWCH 4DV3Q 3A8JE 3K5NA 4B3RL 4ZAIA 3S15B 1KNEA 4HJ5A 2UUBL 1HFNA 2NVYB 1EY4A 3I56A 1P16A 4DXFA 1PVOA 3TEHB 2SEBD 4H02A 2DN8A 4GLVB 3GTLB 5EPLA 1YITA 1V1OA 4PNYA 1V43A 5J1ZA 4GKKL 1MSHA 3S1RH 3PO3H 2UXDQ 1BOSA 4TVAB 1I5FA 1E22A 3HOVB 1EY6A 3FKIH 1Y8OB 1OXTA 3J81j 3HOYH 1HZ9A 1I6HH 4KV6A 4GNXA 4LFBQ 2NVXH 5M3FB 4LF4Q 4L8JA 4BXXG 4LF6Q 4DV5L 2LFNA 4KD3A 5M5XB 2B2WA 1TY2A 4OO1G 1BUVT 4JBJA 2MFIA 1EU3A 1J5EQ 2F0GA 2IPKD 4L5QA 1TXYA 4A3JH 1LT6D 4M8AA 1PRTC 1PMRA 4JI1L 5KRUA 4K6DA 1U4PA 4HCEA 2WAQB 1SNOA 1SBBB 5DM63 5KYIA 5FO8B 4IPHA 1D2BA 4KKTA 3T13A 2B2UA 2EYLA 4DV0L 3RZOH 2X6GA 1CUKA 4KY7A 2VQFL 1AZQA 3F2DA 2NZHA 5KIXA 3EBEA 4RFBA 1YNJC 5CV8A 3I2ZA 5C0XG 1XPRA 4K2LA 4YCUA 1CT1D 1PFBA 4X65L 1IW7C 2BA1A 3Q0AA 3K7AH 2B63G 1NMGA 4P73A 5E3FA 1WCMG 3G4SA 1K8OA 1VQGA 1X56A 1HJPA 3H94A 1V1QA 1PRTD 5T1GA 3I73A 1CI3M 1HNXQ 1JWUD 4JI8Q 1L0WA 3IAYA 2RHQB 3IFTA 1BQQT 2VXWA 4EQNA 1YJWA 1O7YA 3I91A 1RD9D 3K80C 3H91A 2IHFA 2YU9B 1EOTA 4FXKC 1TS5A 3P1HA 1LTBD 5LHY1 3UDIA 3JAME 4IFDJ 1QG7A 2DNEA 1B3AA 4V190 2F0IA 1LM0A 5BN4A 2A68C 3H3VH 3PV0A 4B3SQ 3CC7A 3R2TA 1IHZA 2H1EA 1DONA 1LTTD 2PPBC 4PV1C 1JJ2A 3UDXA 2KCTA 1SN8A 4A3KH 1SYBA 4JV5L 2WB1G 2IT1A 4IUQA 3H0GH 2JA8B 4QY7A 4NW2A 3S17B 1GVPA 4NKLA 5IYBG 3VYRA 3W2DA 4XT3B 5M9OA 2R93B 3NP8A 3TS2A 1N34L 4H0LC 2ENBA 1I94Q 5BN5A 2PYKA 1K83B 4DKAC 5FJ8G 2F0HA 1BCPC 1LTGD 4G4KA 2ALYB 4HJ8A 1NMFA 3U50C 3E3XA 3HKZB 2NN6H 3K5LA 2SDFA 1UAPA 1HUMA 2JA5B 4A3BB 5FLXE 4N9PA 4C3JG 4BY7H 3C1EA 3A5ZB 4GOPC 1BDOA 3U58A 3T56B 5IP9G 2L11A 4V0BA 2F3WA 4RKLA 1RL2A 4C3IG 1LTID 5ELDA 3J80L 4A3CG 1FJGQ 1JR0D 4DR4Q 2K28A 2QEJC 2MHVA 3BZKA 2EOTA 1TWHB 5C0XI 1RF2D 3A74A 3BVMA 1B50A 1KRSA 4A3MH 4LFAQ 1KC8C 2AUJD 1CSQA 4X3SA 2LMCB 5C3WA 3MHBA 2VW9A 1VQDA 2PCFB 3SXHA 4DK6C 3CCLA 1HNWL 2L5TA 1EWHA 3K58A 1YHQA 1TU2B 4A3EH 1HZBA 4A93H 2CH4W 3CCEA 1S72A 2CW0C 3V05A 4A3DB 3KLSA 5C6AA 2OXPA 4NP5A 1XMQQ 1DD2A 3X3MA 1ICFB 1Q1EA 4ZKCB 4GKJL 4C3HB 2B8FA 1E2WA 3M4OH 2VUMB 1G2TA 4K2KA 4B3TQ 4JBWA 4HEDA 2M00A 1QVCA 1X3EA 1DM0B 1TWAB 3G71A 4DR2Q 1C0AA 1XNRQ 1CKMA 4LJZC 3RUZA 4DR7L 3VA7A 3ZYYX 2GN5A 2A6HC 5HURA 2B2VA 3J81E 3I7FA 3S14B 2KVMA 3A5UA 2A69D 3I4MB 3VR5A 2PW7A 4EX5A 4GNXC 1HCZA 1IXRA 4HMIA 4FXGC 4N9TA 1NJIC 1B9NA 4BBSB 2K05A 4LF9Q 2ZTEA 4JI0L 2IY5B 5I6WA 4JI6Q 1FGBD 3OOCA 3EA6A 4P71A 4R8IA 3HOWH 5IT9E 3NBIA 2EDGA 1IBLL 4ULLA 3PO2B 1Q12A 5JJLA 3KUPA 1WFQA 4M1UB 1S4ZA 2DGYA 2E75C 1E2VA 3PUYA 1E24A 4IOAA 2R7FA 4XXEA 2Y0SG 2J7ZA 2HDMA 4DNTB 2AMCB 5IGBA 3FVQA 5JEAH 4HJ9A 1SNPA 2E2JH 2WB1E 4NPSA 1BKBA 2JA6G 2XRSD 1KLUD 1B70B 2F0TA 3I3CA 2RVLA 2B2UC 2K04A 4R4OA 3RR5A 3KDFB 1H9KA 3MZ5A 3WOFA 4IJHA 5M3MH 1EY7A 3E9IA 4IURA 4A3GB 4DR1Q 1VQ9A 2B2TA 4JI2L 3DXJC 5IGFA 3I4NB 4QQBX 3CMEA 4HCSA 1A63A 2CCZA 5EAYA 4QGUA 4DR5Q 1HFGA 3OTOQ 4DUZL 4LNQA 3E0JA 3SK6A 5C4XH 1FNWA 4DU9A 1J9OA 3MC0B 4B3RQ 2PQAB 3NSWA 3W3AA 4DUYL 1N8RC 4X64L 1D5XC 3GTGB 3FRPB 2NZ1D 5ELBA 3A54A 5E1FA 3J80i 3JAMc 2EYPA 4DR6L 2AQ1B 3KF8B 4OONA 4DF7A 3L9AX 4R8NA 2KHSA 2UUAL 5M5YH 3STBC 2XNAC 3FKIG 1TS3A 1JB7A 1SE3A 3CC2A 4QB4A 3RLOA 3HOYG 2UXCQ 3UDGA 4LF7L 1JB3A 2K03A 2I0QA 3TP8A 1T5EA 4S3SA 4DV5Q 1QNUA 2Z4IA 1PA6A 4O42A 1AEXA 1PXUA 2G9HD 1NE3A 4B08A 1GHJA 4IOCA 5I2XA 5C0XH 1RHPA 2DY7A 2JSOA 1WJJA 2KENA 4JI1Q 1ZYRD 2RDFA 1DZ1A 4QCLA 2B63H 1D8LA 2ZM6L 5JPNC 1WCMH 1F9PA 5JVG3 3S1NB 4ZK9B 4KTAA 3GTJB 1H9MA 1PH1A 1LT5D 1K3RA 4LF5L 3K81C 2GVBA 4JI5L 3VR6A 5FLXc 1VQ5A 1TVXA 3LWEA 4LMQD 2XRQD 1YJNA 3LWUA 3R2IA 2E2IH 1YNNC 4YWMA 1WTHA 3BVZA 3HOZB 4X65Q 1KXLA 1OXUA 5KGUA 2UU9L 3L2PA 4DA2A 3IRBA 1FNVA 5J22A 4RA8A 1X3GA 3W1GA 3VR3A 5A2QL 1X9NA 3D0FA 3VR4A 1ET9A 1STHA 2I5LX 4A3FB 1I3QB 5AJ3L 1LT4D 1DOKA 1MKHA 4POFA 3S24A 1CQFA 5IYBH 4KK7A 4HIOA 4I7ZC 1EYGA 2YU9H 1KDCA 1HQMC 2HIXA 1VF7A 1V8QA 3H3VC 4LWCA 4DV1Q 1F2YA 1TWGB 5JAVA 1NUCA 5I4DA 5LMUL 3LNNA 1HH2P 2Y0SE 1EYCA 3H6MA 2EQSA 5CMDA 1IYVA 4JV5Q 3CPFA 4PMBA 3H0GG 4PQXA 1Y1WB 2QF7A 4C3JH 1UEBA 4FF2A 5ELNA 1SYDA 5IP9H 3S17H 2R6GA 3NUCA 1IL2A 2A8VA 1GUTA 1N34Q 4YIJA 2N8NA 5J3BA 2RQXA 4CHTB 4A3CH 4UAIA 3T4AC 1TIID 3J81c 4BA2I 2AUKA 4R4CA 1QB5D 4GS3A 1SRUA 5DLQE 2H5XA 4LFCL 3I4OA 1EIHA 3I8ZA 2B2VC 2NN6G 2IL8A 2Z6KA 1L0XB 5NUCA 4XQNA 3K5OA 1HA6A 4DV4L 4JVZA 3SK4A 2HQLA 5IT9c 3FMCA 1YNXA 4C2MB 1VS0A 1F9RA 1PYBA 5D3DA 3T16A 1YI2A 2V1CC 1N32Q 5K36H 1Z7TA 5CBEE 1SNCA 2FJ2A 1K0RA
chains in the Genus database with same CATH topology
2DUDA 4O2DA 2XTIA 4JI1L 1AE2A 2PI2A 2Z0SA 4A76A 4A3MG 4HIMA 3K0XA 1TWHH 3T1HL 2OTLA 3MEFA 5C44H 2JQOA 2ZTCA 4GN5A 2B3GA 4IPHA 3Q8DA 4DR3L 1HNWQ 2R7ZH 4DV0L 4JI3L 4IFDI 3KF6B 3SGIA 3RZOH 3WWVA 1Q7YC 1JJCB 1CUKA 1OXVA 4DV0Q 4A3EG 2B29A 1Q82C 2VQFL 5FLMG 1SFOH 1PH9A 3ICEA 3F2DA 2NZHA 4POGA 1L1OB 2BH2A 3EBEA 2VQFQ 2OWOA 1XMOL 1YIJA 3I2ZA 5C0XG 4XIGS 3DLLA 3CPWA 5GADC 1XMOQ 2K5HA 2BA0A 1XPRA 1O7IA 2IX0A 4YCUA 1FVIA 2VL6A 2WAQE 2ES2A 4X65L 1IBMQ 5C3EH 3GTKH 4GLAC 4A3DG 2BA1A 2KBNA 3K7AH 3EIVA 1QZGA 1NMGA 4P73A 2N3SA 3M9BA 4C3HH 5IYCG 2B63G 2GVAA 1WCMG 3G4SA 3CD6A 1VQGA 3NBHB 1X56A 4JI8L 1HJPA 1V1QA 2YV5A 1HNXQ 1NY4A 4MZ9A 3HFZB 2VS1A 3K7UC 2VQEL 1U5KA 4JI8Q 2ATWA 3M4PA 4R4QA 5HGQA 2VUMG 2K5VA 3NEMA 1L0WA 3PF4A 2AHOB 2RHQB 1PV4A 1YJWA 3CMAA 2RHSB 1HR0L 3K80C 4DR7Q 2NVQH 2IHFA 1SMXA 4PMWA 3GTMH 2YTVA 4JC0A 2QEXA 1HR0Q 3BJUA 3UDIA 1AE3A 1M90C 4IFDJ 4EQ5A 2YYZA 1HNZL 2UXBL 1LM0A 3GTQH 4DV6Q 1PH6A 3H3VH 3S14H 1VQEA 3PV0A 4B3SQ 3CC7A 4QIWE 1UWVA 1Z9FA 3GD7A 3OW2A 5JJKA 4NXMQ 1KQSA 2JA7H 3HOZG 4J15A 1VQ6A 1RIPA 1JJ2A 1KL9A 3UDXA 1MJEA 2KCTA 1KIXA 1SN8A 1N33L 4JG2A 4A3KH 2F3IA 4BBSG 5JJIA 3DM3A 4MTNA 4JV5L 2WB1G 2KCMA 2IT1A 3H0GH 3ULJA 1VQ7A 4QY7A 2R92G 1GVPA 4TQUS 4A3IG 5IYBG 4GN4B 4DV3L 4YWKA 3OYYA 1I94L 1IYJB 1OXXK 2JA8H 3TS2A 3PO2G 4A3FG 1N34L 1I94Q 2LXKA 1YJ9A 5JEAG 4DKAC 2E5LL 2R93H 3PF5A 5FJ8G 1PHJA 3G6EA 4ME3A 1VQOA 5LMNQ 1X54A 2Q2IA 2I5MX 4GN3B 4B3MQ 2RCNA 4JOIC 2HHHL 1K83H 4DV7L 2ALYB 1EOVA 4HJ8A 3NELA 1A62A 1NMFA 3U50C 5M3MG 1VQ4A 1U0LA 4DV7Q 4APVA 2HHHQ 1VQIA 2UUCL 3F2BA 2K75A 1Q1BA 5JEAJ 2N78A 1S3OA 4IPGA 4JI2Q 1C7YA 2UUCQ 4KHPQ 4LFBL 4NXNL 1L1OA 3L7ZC 3RLFA 4BXXH 4BY7H 3CC4A 4NXNQ 3A5ZB 4LF6L 2JEAI 4GOPC 3RNUA 3I4NH 3W5OA 1A8VA 1MJCA 4DUZQ 5IP9G 3U58A 3HOXG 1H95A 2AWNA 5IY0A 2Q2TA 1PH5A 2JA5H 4A3BH 5C4XG 4P75A 3E9HA 1Y1WG 1FJGL 1RL2A 4DR4L 1A0IA 1J5EL 5C4JH 4JI7Q 4A3CG 1Y1VH 5GAGC 1EQRA 2WP8J 1FJGQ 3F8TA 4DR4Q 1NBWA 3H15A 4KHZA 2OTJA 4LFAL 4DR6Q 3BZKA 1UE6A 1QUQB 4P74A 4YCWA 3TS0A 3PO3G 5C0XI 3A74A 4A3LG 1KRSA 4A3MH 4LFAQ 1KC8C 1GM5A 1CSQA 1LUZA 4R1JA 4UP8A 2VW9A 1VQDA 2BH8A 2QA4A 3HOVG 4P72A 4DK6C 3CCLA 1HNWL 1PYSB 2Q2UA 5IYDH 1VQFA 3RN2A 3CW2C 2ASBA 1YHQA 5IP7G 1Q46A 1X65A 4A3EH 4LUZA 5FLMH 1HZBA 5M3FG 4A93H 3U4ZA 3CCEA 1S72A 4PZ7A 1BBWA 5IYDG 5LMNW 4OX9Q 3HKSA 4ALPA 1EWIA 1IZ6A 4JI4Q 1G6PA 4Y7NH 2CFMA 3ULLA 3AYHB 4A3JG 2A19A 1XMQQ 4R4IA 3MXNB 4DV2L 1Q1EA 3CQZH 3M7NA 1IBML 1SLJA 3T1YQ 4GKJL 1X6OA 4A3DH 4JBKA 4DV2Q 1ASZA 3M4OH 4GKJQ 3GTPH 4B3TQ 2MO1A 4JBWA 1Z47A 1QVCA 2R7DA 1X3EA 1WYDA 3G71A 1HNXL 1XNRL 1N9WA 1L2FA 2ZTDA 4DR2Q 2D62A 1B7YB 3STBD 3ZJYC 5C0XJ 2R7ZG 2VUMH 1C0AA 1IBKL 1XNRQ 1XTDA 1CKMA 2VNUD 1VQLA 4UP7A 1IBKQ 1TWAH 4DR7L 2F4VL 2GN5A 3PIOA 4HIKA 1UE7A 4JI5Q 2F4VQ 5E7NA 4DNIA 3I7FA 3A5UA 2D0OA 2K14A 3GO5A 4EX5A 1Q8KA 3M85A 4DV6L 4GNXC 2Z6KC 2PMZE 1IXRA 4B3SL 3PCOB 3U4VA 1NJIC 1CKNA 4L5RC 2IY5B 4LF9Q 1VQBA 2ZTEA 4JI0L 2KHIA 3I4MH 3M3YH 4KLKA 3KOJA 4DPGA 4BY1G 4YY3Q 4JI6Q 4NXML 2UU9Q 1VCIA 3HOZH 1T9HA 1E1TA 4JI0Q 4R4TA 2OCEA 2VY3A 3KFUA 4LUOA 1KRTA 4BBSH 4P71A 2PQAA 1VQ8A 3HOWH 1VQPA 1IBLL 1PH3A 4K0KL 4RMFA 3CF5A 1Q12A 1K8AC 4IPCA 5JJLA 3E0EA 2WFWA 1IBLQ 4LUVA 3D31A 1WFQA 4K0KQ 2DGYA 3F1ZA 4YHHQ 3FP9A 3PUYA 1E24A 5AJ3Q 4IOAA 2R7FA 4X62Q 1Q81C 3CCQA 3PO2H 1YHBA 1QUQA 2Y0SG 2K5NA 4JBMA 1N36Q 2LSSA 2FXQA 2MNAA 1K73C 2AMCB 4YCVA 3HOUG 4HJ9A 2E2JH 1FGUA 5FJ8H 2WB1E 1VQCA 1BKBA 4NPSA 5H1SE 3UDFA 1DGSA 2ZJPA 2JA6G 1B70B 1E7ZA 5GROA 4HJAA 4OWXB 5LMNL 4B3ML 3PSIA 3B6YA 3PUZA 4R4OA 3J80c 3RR5A 3KDFB 5GAEC 1HZCA 2QGQA 1D7QA 4IJHA 5M3MH 3TQYA 1YZ6A 3E9IA 1ASYA 2YTYA 1LYLA 1EIYB 3NENA 4GOPB 4DR1Q 4A3KG 1UE1A 1OTCA 1VQ9A 4X6AH 4JI2L 4KHPL 4AIMA 1K8GA 1S40A 1VQNA 1CSPA 1YBYA 2AKWB 3CMEA 4QQBX 1CKNB 1A63A 2CCZA 5EAYA 4QGUA 4DR5Q 4A3GH 3TRZA 3HOXH 3OTOQ 4DUZL 1OXSC 4LNQA 5C4XH 1SROA 1E1OA 3EN2A 2JA8G 3PUVA 1XJVA 4C3IH 3KJPA 3J7A5 4B3RQ 2PQAB 4JI7L 4DUYL 4HJ7A 1N8RC 4X64L 2IHEA 4AYBG 3S1MH 4FDBA 3J80i 3JAMc 2MQHA 4X64Q 4DUYQ 4DR6L 1SE8A 3KF8B 4OONA 4UP9A 1B8AA 1TWFH 4A3LH 4WJ4A 2HIVA 5IWAQ 1VQHA 4QJFA 1XPUA 4WJ3M 3AFQA 1VQMA 4KI0A 3GTGH 2UUAL 3CCMA 5M5YH 2A1AA 3STBC 1R9TH 2UXCL 3FKIG 4LFCQ 1JB7A 3CC2A 2EIFA 2UUAQ 3RLOA 4A4IA 3HOYG 2UXCQ 3PIPA 3UDGA 4OXPA 4LF7L 4DAMA 2D0PA 3HKZG 2I0QA 4BY7G 1GO3E 3W1BA 1MIUA 2NZOA 4LF7Q 4GLXA 4BBRG 4L5SA 4DV4Q 2K52A 3CXCA 4DV5Q 1J6QA 1KD1C 4IPDA 3CCJA 2JA5G 4A3BG 1PA6A 2RF4A 1Y14B 4OX9L 2ID0A 2F52A 1NE3A 1XNQQ 2CWAA 1Y1VG 2XGTA 5BR8Q 2LXJA 3CCSA 4IOCA 3JAMi 4JI4L 1JT8A 3BZCA 1XMQL 2ZJRA 1GKHA 1JE5A 5K36G 5HY6A 3RZDH 4DK3C 4LF8Q 3T1YL 1WJJA 3S16H 2KENA 1PFSA 4YWLA 4JI1Q 2CWPA 4LW1A 4RG1A 3F2CA 4B3TL 1SR3A 3UE1A 5IYCH 2B63H 1D8LA 2ZM6L 3FHWA 2Q2HA 1WCMH 3T1HQ 1K9MC 1EFWA 1UE5A 2K4KA 4DR2L 5C44G 2ZM6Q 4QL5A 1PH4A 3PUWA 2JA9A 1XPOA 2OQKA 1NTGA 3LGJA 4DR3Q 4JI3Q 4JOIA 1PH7A 2WAQG 3S2DH 1YHAA 3ERSX 1HZAA 3S1NH 2CQOA 1PH1A 4A93G 1K3RA 2NVTH 4LF5L 3K81C 2JE6I 4GNXB 2GVBA 1C9OA 3KLWA 4JI5L 3GTJH 5FLXc 1VQ5A 3KDFA 1AH9A 4LF5Q 3I55A 2JEBI 2HT1A 5GAHC 3ULPA 1YJNA 4AQYL 5GQOA 3PUXA 1P8LA 2E2IH 3AFPA 1EUJA 4YWMA 4GOPA 4AQYQ 1KXLA 4X65Q 1L1OC 2JK8A 4OWWB 4LF9L 4JYAL 1GD7A 1OXUA 5C3EG 4BY1H 3G48A 4JI6L 2L15A 4YY3L 3H3VI 2UU9L 4JYAQ 3L2PA 4IO9A 3AEVA 1G51A 3IRBA 4IFDG 3S2HH 3GTOH 3KYHC 2VZAA 1X3GA 3W1GA 2VQEQ 1CKOA 1X9NA 2CKZB 3D0FA 3M4QA 4MNOA 2I5HA 2JJQA 3CP0A 2PNHA 3ER0A 4AH6A 4UY8C 3AQQA 2I5LX 4YHHL 2R92H 5AJ3L 1BVSA 1MKHA 4POFA 4X62L 3S24A 3CCVA 1I50H 4X66L 5IYBH 4HIOA 3RN5A 4A3IH 1M1KC 1QVFA 1N36L 3VDYA 3HOUH 1EYGA 4X66Q 2YU9H 1KHIA 2HIXA 1WI5A 1I3QH 4XTCS 4A3FH 1HNZQ 5IE8A 2EXDA 2JA6H 4DV1L 2UXBQ 3BU2A 3J7ZC 4LWCA 4DV1Q 1KAWA 3I4MG 4Y52H 5LMUL 1W3SA 1HH2P 1V9PA 1WOCA 1X3FA 2Y0SE 3CCUA 3GDEA 3TREA 2JA7G 5LMUQ 2EQSA 2K50A 2PI2E 1VQKA 2KHJA 4DR1L 2IX1A 1TWGH 3HOWG 4L5TA 1N33Q 3UE0A 3CAMA 3S1QH 4A75A 3KJOA 4UPAA 4JV5Q 2NN6I 3PGZA 1G291 1YVCA 3CPFA 3H0GG 4DR5L 2YTXA 4C3JH 1UEBA 3OTOL 5ELNA 3JC66 2AWOA 4NB3A 1E3PA 1TWCH 5ELOA 5IP9H 4DV3Q 1PH2A 2E2HH 2ZJQA 2OQ0A 2R6GA 3S17H 5M5WH 1IL2A 2A8VA 4B3RL 1BBUA 4HJ5A 1N34Q 1Y1WH 2UUBL 2N8NA 3I56A 5J3BA 1P16A 4OO1I 1PVOA 2E5LQ 1YEZA 3TEHB 1Q86C 4A3CH 1FL0A 4H02A 2UUBQ 4IJLA 2R93G 3RLNA 2UXDL 1QZHA 4GLVB 3J81c 3S15H 3KF6A 1YITA 1EIFA 1V43A 5IWAL 4BA2I 4R4CA 4GKKL 3S1RH 3PO3H 2NVYH 2UXDQ 1JJGA 4TVAB 4PG3A 1I5FA 1E22A 4GKKQ 3FKIH 4GS3A 1SRUA 3CCRA 5DLQE 2H5XA 4LFCL 1LTLA 1OXTA 3I4OA 4JCVE 1HZ9A 3J81j 1PH8A 3GTLH 3HOYH 1I6HH 1HR0W 2NN6G 1VQJA 4AYBE 4GNXA 2Z6KA 1W2BA 4LF4L 2MO0A 4A3JH 1QVGA 2NVXH 4LFBQ 3HOVH 4A3GG 4LF4Q 4BBRH 4DV4L 4BA1I 4DV5L 4LF6Q 2HQLA 5IP7H 4BXXG 3L0OA 4OWTB 3I4NG 3A0JA 5IT9c 4PZ8A 4PZ6A 2C35B 5M3FH 2N49A 1X55A 3K8AA 1YNXA 4OO1G 4HIDA 1EQQA 1N32L 2E8GA 1VS0A 1VQAA 2MFIA 4JBJA 1PYBA 5BR8L 4DAYB 1XNQL 1YI2A 1J5EQ 1JMCA 2V1CC 1N32Q 5M5XH 3J81i 3HKZE 4L5QA 4O0AA 1TXYA 4LF8L 1K0RA 4C2MH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DUD A;  4O2D A;  2XTI A;  4JI1 L;  1AE2 A;  2PI2 A;  2Z0S A;  4A76 A;  4A3M G;  4HIM A;  3K0X A;  1TWH H;  3T1H L;  2OTL A;  3MEF A;  5C44 H;  2JQO A;  2ZTC A;  4GN5 A;  2B3G A;  4IPH A;  3Q8D A;  4DR3 L;  1HNW Q;  2R7Z H;  4DV0 L;  4JI3 L;  4IFD I;  3KF6 B;  3SGI A;  3RZO H;  3WWV A;  1Q7Y C;  1JJC B;  1CUK A;  1OXV A;  4DV0 Q;  4A3E G;  2B29 A;  1Q82 C;  2VQF L;  5FLM G;  1SFO H;  1PH9 A;  3ICE A;  3F2D A;  2NZH A;  4POG A;  1L1O B;  2BH2 A;  3EBE A;  2VQF Q;  2OWO A;  1XMO L;  1YIJ A;  3I2Z A;  5C0X G;  4XIG S;  3DLL A;  3CPW A;  5GAD C;  1XMO Q;  2K5H A;  2BA0 A;  1XPR A;  1O7I A;  2IX0 A;  4YCU A;  1FVI A;  2VL6 A;  2WAQ E;  2ES2 A;  4X65 L;  1IBM Q;  5C3E H;  3GTK H;  4GLA C;  4A3D G;  2BA1 A;  2KBN A;  3K7A H;  3EIV A;  1QZG A;  1NMG A;  4P73 A;  2N3S A;  3M9B A;  4C3H H;  5IYC G;  2B63 G;  2GVA A;  1WCM G;  3G4S A;  3CD6 A;  1VQG A;  3NBH B;  1X56 A;  4JI8 L;  1HJP A;  1V1Q A;  2YV5 A;  1HNX Q;  1NY4 A;  4MZ9 A;  3HFZ B;  2VS1 A;  3K7U C;  2VQE L;  1U5K A;  4JI8 Q;  2ATW A;  3M4P A;  4R4Q A;  5HGQ A;  2VUM G;  2K5V A;  3NEM A;  1L0W A;  3PF4 A;  2AHO B;  2RHQ B;  1PV4 A;  1YJW A;  3CMA A;  2RHS B;  1HR0 L;  3K80 C;  4DR7 Q;  2NVQ H;  2IHF A;  1SMX A;  4PMW A;  3GTM H;  2YTV A;  4JC0 A;  2QEX A;  1HR0 Q;  3BJU A;  3UDI A;  1AE3 A;  1M90 C;  4IFD J;  4EQ5 A;  2YYZ A;  1HNZ L;  2UXB L;  1LM0 A;  3GTQ H;  4DV6 Q;  1PH6 A;  3H3V H;  3S14 H;  1VQE A;  3PV0 A;  4B3S Q;  3CC7 A;  4QIW E;  1UWV A;  1Z9F A;  3GD7 A;  3OW2 A;  5JJK A;  4NXM Q;  1KQS A;  2JA7 H;  3HOZ G;  4J15 A;  1VQ6 A;  1RIP A;  1JJ2 A;  1KL9 A;  3UDX A;  1MJE A;  2KCT A;  1KIX A;  1SN8 A;  1N33 L;  4JG2 A;  4A3K H;  2F3I A;  4BBS G;  5JJI A;  3DM3 A;  4MTN A;  4JV5 L;  2WB1 G;  2KCM A;  2IT1 A;  3H0G H;  3ULJ A;  1VQ7 A;  4QY7 A;  2R92 G;  1GVP A;  4TQU S;  4A3I G;  5IYB G;  4GN4 B;  4DV3 L;  4YWK A;  3OYY A;  1I94 L;  1IYJ B;  1OXX K;  2JA8 H;  3TS2 A;  3PO2 G;  4A3F G;  1N34 L;  1I94 Q;  2LXK A;  1YJ9 A;  5JEA G;  4DKA C;  2E5L L;  2R93 H;  3PF5 A;  5FJ8 G;  1PHJ A;  3G6E A;  4ME3 A;  1VQO A;  5LMN Q;  1X54 A;  2Q2I A;  2I5M X;  4GN3 B;  4B3M Q;  2RCN A;  4JOI C;  2HHH L;  1K83 H;  4DV7 L;  2ALY B;  1EOV A;  4HJ8 A;  3NEL A;  1A62 A;  1NMF A;  3U50 C;  5M3M G;  1VQ4 A;  1U0L A;  4DV7 Q;  4APV A;  2HHH Q;  1VQI A;  2UUC L;  3F2B A;  2K75 A;  1Q1B A;  5JEA J;  2N78 A;  1S3O A;  4IPG A;  4JI2 Q;  1C7Y A;  2UUC Q;  4KHP Q;  4LFB L;  4NXN L;  1L1O A;  3L7Z C;  3RLF A;  4BXX H;  4BY7 H;  3CC4 A;  4NXN Q;  3A5Z B;  4LF6 L;  2JEA I;  4GOP C;  3RNU A;  3I4N H;  3W5O A;  1A8V A;  1MJC A;  4DUZ Q;  5IP9 G;  3U58 A;  3HOX G;  1H95 A;  2AWN A;  5IY0 A;  2Q2T A;  1PH5 A;  2JA5 H;  4A3B H;  5C4X G;  4P75 A;  3E9H A;  1Y1W G;  1FJG L;  1RL2 A;  4DR4 L;  1A0I A;  1J5E L;  5C4J H;  4JI7 Q;  4A3C G;  1Y1V H;  5GAG C;  1EQR A;  2WP8 J;  1FJG Q;  3F8T A;  4DR4 Q;  1NBW A;  3H15 A;  4KHZ A;  2OTJ A;  4LFA L;  4DR6 Q;  3BZK A;  1UE6 A;  1QUQ B;  4P74 A;  4YCW A;  3TS0 A;  3PO3 G;  5C0X I;  3A74 A;  4A3L G;  1KRS A;  4A3M H;  4LFA Q;  1KC8 C;  1GM5 A;  1CSQ A;  1LUZ A;  4R1J A;  4UP8 A;  2VW9 A;  1VQD A;  2BH8 A;  2QA4 A;  3HOV G;  4P72 A;  4DK6 C;  3CCL A;  1HNW L;  1PYS B;  2Q2U A;  5IYD H;  1VQF A;  3RN2 A;  3CW2 C;  2ASB A;  1YHQ A;  5IP7 G;  1Q46 A;  1X65 A;  4A3E H;  4LUZ A;  5FLM H;  1HZB A;  5M3F G;  4A93 H;  3U4Z A;  3CCE A;  1S72 A;  4PZ7 A;  1BBW A;  5IYD G;  5LMN W;  4OX9 Q;  3HKS A;  4ALP A;  1EWI A;  1IZ6 A;  4JI4 Q;  1G6P A;  4Y7N H;  2CFM A;  3ULL A;  3AYH B;  4A3J G;  2A19 A;  1XMQ Q;  4R4I A;  3MXN B;  4DV2 L;  1Q1E A;  3CQZ H;  3M7N A;  1IBM L;  1SLJ A;  3T1Y Q;  4GKJ L;  1X6O A;  4A3D H;  4JBK A;  4DV2 Q;  1ASZ A;  3M4O H;  4GKJ Q;  3GTP H;  4B3T Q;  2MO1 A;  4JBW A;  1Z47 A;  1QVC A;  2R7D A;  1X3E A;  1WYD A;  3G71 A;  1HNX L;  1XNR L;  1N9W A;  1L2F A;  2ZTD A;  4DR2 Q;  2D62 A;  1B7Y B;  3STB D;  3ZJY C;  5C0X J;  2R7Z G;  2VUM H;  1C0A A;  1IBK L;  1XNR Q;  1XTD A;  1CKM A;  2VNU D;  1VQL A;  4UP7 A;  1IBK Q;  1TWA H;  4DR7 L;  2F4V L;  2GN5 A;  3PIO A;  4HIK A;  1UE7 A;  4JI5 Q;  2F4V Q;  5E7N A;  4DNI A;  3I7F A;  3A5U A;  2D0O A;  2K14 A;  3GO5 A;  4EX5 A;  1Q8K A;  3M85 A;  4DV6 L;  4GNX C;  2Z6K C;  2PMZ E;  1IXR A;  4B3S L;  3PCO B;  3U4V A;  1NJI C;  1CKN A;  4L5R C;  2IY5 B;  4LF9 Q;  1VQB A;  2ZTE A;  4JI0 L;  2KHI A;  3I4M H;  3M3Y H;  4KLK A;  3KOJ A;  4DPG A;  4BY1 G;  4YY3 Q;  4JI6 Q;  4NXM L;  2UU9 Q;  1VCI A;  3HOZ H;  1T9H A;  1E1T A;  4JI0 Q;  4R4T A;  2OCE A;  2VY3 A;  3KFU A;  4LUO A;  1KRT A;  4BBS H;  4P71 A;  2PQA A;  1VQ8 A;  3HOW H;  1VQP A;  1IBL L;  1PH3 A;  4K0K L;  4RMF A;  3CF5 A;  1Q12 A;  1K8A C;  4IPC A;  5JJL A;  3E0E A;  2WFW A;  1IBL Q;  4LUV A;  3D31 A;  1WFQ A;  4K0K Q;  2DGY A;  3F1Z A;  4YHH Q;  3FP9 A;  3PUY A;  1E24 A;  5AJ3 Q;  4IOA A;  2R7F A;  4X62 Q;  1Q81 C;  3CCQ A;  3PO2 H;  1YHB A;  1QUQ A;  2Y0S G;  2K5N A;  4JBM A;  1N36 Q;  2LSS A;  2FXQ A;  2MNA A;  1K73 C;  2AMC B;  4YCV A;  3HOU G;  4HJ9 A;  2E2J H;  1FGU A;  5FJ8 H;  2WB1 E;  1VQC A;  1BKB A;  4NPS A;  5H1S E;  3UDF A;  1DGS A;  2ZJP A;  2JA6 G;  1B70 B;  1E7Z A;  5GRO A;  4HJA A;  4OWX B;  5LMN L;  4B3M L;  3PSI A;  3B6Y A;  3PUZ A;  4R4O A;  3J80 c;  3RR5 A;  3KDF B;  5GAE C;  1HZC A;  2QGQ A;  1D7Q A;  4IJH A;  5M3M H;  3TQY A;  1YZ6 A;  3E9I A;  1ASY A;  2YTY A;  1LYL A;  1EIY B;  3NEN A;  4GOP B;  4DR1 Q;  4A3K G;  1UE1 A;  1OTC A;  1VQ9 A;  4X6A H;  4JI2 L;  4KHP L;  4AIM A;  1K8G A;  1S40 A;  1VQN A;  1CSP A;  1YBY A;  2AKW B;  3CME A;  4QQB X;  1CKN B;  1A63 A;  2CCZ A;  5EAY A;  4QGU A;  4DR5 Q;  4A3G H;  3TRZ A;  3HOX H;  3OTO Q;  4DUZ L;  1OXS C;  4LNQ A;  5C4X H;  1SRO A;  1E1O A;  3EN2 A;  2JA8 G;  3PUV A;  1XJV A;  4C3I H;  3KJP A;  3J7A 5;  4B3R Q;  2PQA B;  4JI7 L;  4DUY L;  4HJ7 A;  1N8R C;  4X64 L;  2IHE A;  4AYB G;  3S1M H;  4FDB A;  3J80 i;  3JAM c;  2MQH A;  4X64 Q;  4DUY Q;  4DR6 L;  1SE8 A;  3KF8 B;  4OON A;  4UP9 A;  1B8A A;  1TWF H;  4A3L H;  4WJ4 A;  2HIV A;  5IWA Q;  1VQH A;  4QJF A;  1XPU A;  4WJ3 M;  3AFQ A;  1VQM A;  4KI0 A;  3GTG H;  2UUA L;  3CCM A;  5M5Y H;  2A1A A;  3STB C;  1R9T H;  2UXC L;  3FKI G;  4LFC Q;  1JB7 A;  3CC2 A;  2EIF A;  2UUA Q;  3RLO A;  4A4I A;  3HOY G;  2UXC Q;  3PIP A;  3UDG A;  4OXP A;  4LF7 L;  4DAM A;  2D0P A;  3HKZ G;  2I0Q A;  4BY7 G;  1GO3 E;  3W1B A;  1MIU A;  2NZO A;  4LF7 Q;  4GLX A;  4BBR G;  4L5S A;  4DV4 Q;  2K52 A;  3CXC A;  4DV5 Q;  1J6Q A;  1KD1 C;  4IPD A;  3CCJ A;  2JA5 G;  4A3B G;  1PA6 A;  2RF4 A;  1Y14 B;  4OX9 L;  2ID0 A;  2F52 A;  1NE3 A;  1XNQ Q;  2CWA A;  1Y1V G;  2XGT A;  5BR8 Q;  2LXJ A;  3CCS A;  4IOC A;  3JAM i;  4JI4 L;  1JT8 A;  3BZC A;  1XMQ L;  2ZJR A;  1GKH A;  1JE5 A;  5K36 G;  5HY6 A;  3RZD H;  4DK3 C;  4LF8 Q;  3T1Y L;  1WJJ A;  3S16 H;  2KEN A;  1PFS A;  4YWL A;  4JI1 Q;  2CWP A;  4LW1 A;  4RG1 A;  3F2C A;  4B3T L;  1SR3 A;  3UE1 A;  5IYC H;  2B63 H;  1D8L A;  2ZM6 L;  3FHW A;  2Q2H A;  1WCM H;  3T1H Q;  1K9M C;  1EFW A;  1UE5 A;  2K4K A;  4DR2 L;  5C44 G;  2ZM6 Q;  4QL5 A;  1PH4 A;  3PUW A;  2JA9 A;  1XPO A;  2OQK A;  1NTG A;  3LGJ A;  4DR3 Q;  4JI3 Q;  4JOI A;  1PH7 A;  2WAQ G;  3S2D H;  1YHA A;  3ERS X;  1HZA A;  3S1N H;  2CQO A;  1PH1 A;  4A93 G;  1K3R A;  2NVT H;  4LF5 L;  3K81 C;  2JE6 I;  4GNX B;  2GVB A;  1C9O A;  3KLW A;  4JI5 L;  3GTJ H;  5FLX c;  1VQ5 A;  3KDF A;  1AH9 A;  4LF5 Q;  3I55 A;  2JEB I;  2HT1 A;  5GAH C;  3ULP A;  1YJN A;  4AQY L;  5GQO A;  3PUX A;  1P8L A;  2E2I H;  3AFP A;  1EUJ A;  4YWM A;  4GOP A;  4AQY Q;  1KXL A;  4X65 Q;  1L1O C;  2JK8 A;  4OWW B;  4LF9 L;  4JYA L;  1GD7 A;  1OXU A;  5C3E G;  4BY1 H;  3G48 A;  4JI6 L;  2L15 A;  4YY3 L;  3H3V I;  2UU9 L;  4JYA Q;  3L2P A;  4IO9 A;  3AEV A;  1G51 A;  3IRB A;  4IFD G;  3S2H H;  3GTO H;  3KYH C;  2VZA A;  1X3G A;  3W1G A;  2VQE Q;  1CKO A;  1X9N A;  2CKZ B;  3D0F A;  3M4Q A;  4MNO A;  2I5H A;  2JJQ A;  3CP0 A;  2PNH A;  3ER0 A;  4AH6 A;  4UY8 C;  3AQQ A;  2I5L X;  4YHH L;  2R92 H;  5AJ3 L;  1BVS A;  1MKH A;  4POF A;  4X62 L;  3S24 A;  3CCV A;  1I50 H;  4X66 L;  5IYB H;  4HIO A;  3RN5 A;  4A3I H;  1M1K C;  1QVF A;  1N36 L;  3VDY A;  3HOU H;  1EYG A;  4X66 Q;  2YU9 H;  1KHI A;  2HIX A;  1WI5 A;  1I3Q H;  4XTC S;  4A3F H;  1HNZ Q;  5IE8 A;  2EXD A;  2JA6 H;  4DV1 L;  2UXB Q;  3BU2 A;  3J7Z C;  4LWC A;  4DV1 Q;  1KAW A;  3I4M G;  4Y52 H;  5LMU L;  1W3S A;  1HH2 P;  1V9P A;  1WOC A;  1X3F A;  2Y0S E;  3CCU A;  3GDE A;  3TRE A;  2JA7 G;  5LMU Q;  2EQS A;  2K50 A;  2PI2 E;  1VQK A;  2KHJ A;  4DR1 L;  2IX1 A;  1TWG H;  3HOW G;  4L5T A;  1N33 Q;  3UE0 A;  3CAM A;  3S1Q H;  4A75 A;  3KJO A;  4UPA A;  4JV5 Q;  2NN6 I;  3PGZ A;  1G29 1;  1YVC A;  3CPF A;  3H0G G;  4DR5 L;  2YTX A;  4C3J H;  1UEB A;  3OTO L;  5ELN A;  3JC6 6;  2AWO A;  4NB3 A;  1E3P A;  1TWC H;  5ELO A;  5IP9 H;  4DV3 Q;  1PH2 A;  2E2H H;  2ZJQ A;  2OQ0 A;  2R6G A;  3S17 H;  5M5W H;  1IL2 A;  2A8V A;  4B3R L;  1BBU A;  4HJ5 A;  1N34 Q;  1Y1W H;  2UUB L;  2N8N A;  3I56 A;  5J3B A;  1P16 A;  4OO1 I;  1PVO A;  2E5L Q;  1YEZ A;  3TEH B;  1Q86 C;  4A3C H;  1FL0 A;  4H02 A;  2UUB Q;  4IJL A;  2R93 G;  3RLN A;  2UXD L;  1QZH A;  4GLV B;  3J81 c;  3S15 H;  3KF6 A;  1YIT A;  1EIF A;  1V43 A;  5IWA L;  4BA2 I;  4R4C A;  4GKK L;  3S1R H;  3PO3 H;  2NVY H;  2UXD Q;  1JJG A;  4TVA B;  4PG3 A;  1I5F A;  1E22 A;  4GKK Q;  3FKI H;  4GS3 A;  1SRU A;  3CCR A;  5DLQ E;  2H5X A;  4LFC L;  1LTL A;  1OXT A;  3I4O A;  4JCV E;  1HZ9 A;  3J81 j;  1PH8 A;  3GTL H;  3HOY H;  1I6H H;  1HR0 W;  2NN6 G;  1VQJ A;  4AYB E;  4GNX A;  2Z6K A;  1W2B A;  4LF4 L;  2MO0 A;  4A3J H;  1QVG A;  2NVX H;  4LFB Q;  3HOV H;  4A3G G;  4LF4 Q;  4BBR H;  4DV4 L;  4BA1 I;  4DV5 L;  4LF6 Q;  2HQL A;  5IP7 H;  4BXX G;  3L0O A;  4OWT B;  3I4N G;  3A0J A;  5IT9 c;  4PZ8 A;  4PZ6 A;  2C35 B;  5M3F H;  2N49 A;  1X55 A;  3K8A A;  1YNX A;  4OO1 G;  4HID A;  1EQQ A;  1N32 L;  2E8G A;  1VS0 A;  1VQA A;  2MFI A;  4JBJ A;  1PYB A;  5BR8 L;  4DAY B;  1XNQ L;  1YI2 A;  1J5E Q;  1JMC A;  2V1C C;  1N32 Q;  5M5X H;  3J81 i;  3HKZ E;  4L5Q A;  4O0A A;  1TXY A;  4LF8 L;  1K0R A;  4C2M H; 
#chains in the Genus database with same CATH topology
 4RCN A;  3ERQ A;  4KMU C;  1KLG D;  1AE2 A;  2PI2 A;  4A3M G;  4HIM A;  3HP3 A;  5BN3 A;  1TWH H;  2Z1C A;  2R7Z B;  4FVM A;  1WD0 A;  2OTL A;  2PQE A;  2JQO A;  1DJR D;  3Q8D A;  1SFO B;  1KAB A;  1HNW Q;  3KF6 B;  1F9Q A;  3ONA B;  1STE A;  4A3E G;  1PH9 A;  5IOC A;  3QWN A;  4POG A;  1L1O B;  2OWO A;  3GTK B;  1XMO L;  1YIJ A;  3RMH A;  3DLL A;  1LTA D;  2WKD A;  5GAD C;  4FF4 A;  3TZU A;  2B2T C;  1SMY D;  4BY1 B;  1FVI A;  2XIW A;  2MUY A;  2KBN A;  3BZD B;  3EIV A;  3KBG A;  2RSN A;  3M9B A;  5D65 A;  4C3H H;  2EJM A;  3CD6 A;  3NBH B;  3IL8 A;  3V2T A;  2ICE C;  1GXD C;  4MZ9 A;  3HFZ B;  2VS1 A;  1VMC A;  3K7U C;  4C56 C;  3OWF A;  2AHO B;  4MTK A;  2IW3 A;  1PV4 A;  4DK0 A;  5CV7 A;  1HR0 L;  4DR7 Q;  2NVQ H;  3P7J A;  2F0K A;  2QEX A;  3BJU A;  2KQ3 A;  5IGC A;  5IOD A;  1HNZ L;  4IUU A;  3AU7 A;  3GTQ H;  2GA4 B;  3IFD A;  5KNB A;  3S14 H;  1VQE A;  5CR3 A;  1UWV A;  1F2L A;  1AN8 A;  5JJK A;  2CHB D;  1TKW B;  4DNR B;  2JA7 H;  5KND A;  1VQ6 A;  1KL9 A;  1SXT A;  1KIX A;  1SYF A;  2F3I A;  1SNM A;  3DM3 A;  4MTN A;  5FKA C;  5FO9 B;  2R92 G;  2WAC A;  3ND8 A;  1T5X D;  4FYD A;  4WRD A;  4CJ2 C;  4CDD C;  2A6E D;  2EJF C;  2MJ8 A;  4DAP A;  5JEA G;  2F1M A;  5JVH 3;  3PF5 A;  1PHJ A;  2QDL A;  4ME3 A;  1VQO A;  3K0Y A;  2I5M X;  4GN3 B;  2F0P A;  1WTQ A;  2HHH L;  3NEL A;  1A62 A;  2A73 B;  3H09 A;  5M3M G;  1VQ4 A;  1U0L A;  4DV7 Q;  1VQI A;  3CU7 A;  3F2B A;  2K75 A;  5JEA J;  1KNA A;  4JI2 Q;  4IPG A;  1TY0 A;  2UUC Q;  1F2Z A;  4NXN L;  3NQI A;  1MHW C;  1XYI A;  2JEA I;  3I4N H;  2L4N A;  2HCI A;  5C4J B;  1A8V A;  1Y1V B;  4DUZ Q;  2AWN A;  5IY0 A;  1PH5 A;  5C4X G;  4ZQ3 A;  1A0I A;  3MXP A;  1NBW A;  4RHR A;  4DR6 Q;  1UE6 A;  1QUQ B;  4JK1 C;  1GM5 A;  4R1J A;  2N88 A;  4UP8 A;  3C2P A;  4H13 C;  3HOV G;  4P72 A;  4DGZ A;  2R61 A;  3CW2 C;  5IP7 G;  1Q46 A;  1X65 A;  4KJN A;  5CBA E;  4Y7N B;  5FLM H;  3OIP A;  4ABN A;  5M3F G;  5ELF A;  3U4Z A;  1A2U A;  3CQZ B;  1JWM D;  4TSS A;  1IZ6 A;  3SK8 A;  2L12 A;  5EKK A;  3MXN B;  4DV2 L;  1R4P B;  3SVM A;  4RGM A;  4JBK A;  1EL0 A;  4X3U A;  4U67 3;  3T51 B;  1WTW A;  1WYD A;  1N9W A;  4QIW B;  2D62 A;  1B7Y B;  3ZJY C;  5C0X J;  2G5D A;  1EYA A;  2QDB A;  4NMZ A;  1IBK L;  5DM7 3;  5CC4 A;  1B9M A;  3GTM B;  4UP7 A;  3N52 A;  1A2T A;  2F4V L;  4RWS C;  1EWC A;  3PIO A;  4HIK A;  4LAA A;  1QIL A;  3EVQ A;  4JI5 Q;  3NTI A;  5FO7 B;  3GO5 A;  4N8F A;  1IYU A;  3K57 A;  3M85 A;  1ROD A;  2Z6K C;  1I4H A;  2HQE A;  2EYF A;  4MHE A;  3M3Y H;  4NXM L;  3HOZ H;  4DPG A;  3DM1 A;  2J4X A;  5IGG A;  2UU9 Q;  1H9S A;  1VCI A;  1CA5 A;  1E1T A;  4R4T A;  3M7G A;  2M2L A;  4LUO A;  4G7O C;  4R9W A;  2PQA A;  1F2M A;  4QMG A;  1XXG A;  2O5I C;  3CF5 A;  4K0K L;  2FMM A;  3D6C A;  1MI2 A;  5AJ3 Q;  4ME5 A;  1Q81 C;  2PZT A;  2BCO A;  1YHB A;  3N6R A;  2FXQ A;  1K73 C;  1CK1 A;  4YCV A;  2EY2 A;  3DHQ A;  3NTH A;  4HJA A;  4LK1 C;  5IIF A;  1VQC A;  1DGS A;  5GRO A;  5LMN L;  1S5C D;  4B3M L;  3B6Y A;  3PUZ A;  2QGQ A;  3E5S A;  3SE0 A;  1D7Q A;  3TQY A;  1YZ6 A;  2K5W A;  4QUF A;  4X6A H;  4MIU A;  4GOP B;  1RTN A;  1K0S A;  4AIM A;  2BOS A;  1SND A;  1CKN B;  4C3I B;  2Z4H A;  2MP1 A;  1OXS C;  1JWS D;  1E1O A;  2NB0 A;  3EN2 A;  2M9V A;  2JA8 G;  1U9R A;  1BNZ A;  1O7Z A;  2WIN B;  4AYB G;  1R9T B;  4FDB A;  3PQI A;  3MTS A;  2IJ0 A;  3HZX A;  1UEA B;  2BDO A;  2HIV A;  4QJF A;  5LL6 S;  4CKC A;  3AMU A;  3CCM A;  1ILP A;  1EEI D;  4LFC Q;  5EBD A;  2EIF A;  1A3U A;  4A4I A;  3PIP A;  4OXP A;  1SEB D;  4DAM A;  3HKZ G;  2JN4 A;  2F0M A;  3GV3 A;  2DJF C;  4L5S A;  4DV4 Q;  2K52 A;  3CXC A;  1KD1 C;  4RH6 A;  4IPD A;  2JA5 G;  4A3B G;  2A69 C;  1Y14 B;  3S16 B;  2E74 C;  4KD4 A;  2F0D A;  2LXJ A;  4JI4 L;  5EPJ A;  2SNS A;  4ILW A;  5K36 G;  4F87 A;  3T1Y L;  3GTP B;  2F03 A;  4YWL A;  4DAV A;  2CWP A;  2HCC A;  4HAE A;  4RG1 A;  3F2C A;  1U4R A;  4ODG A;  3UE1 A;  2Q2H A;  5CGK A;  1EFW A;  3V96 A;  1PZI D;  2K4K A;  3Q6S A;  1I4X A;  4QL5 A;  1LTR D;  1PH4 A;  2NVT B;  1PH7 A;  3S2D H;  3OW7 A;  1HZA A;  1V1P B;  4K5V A;  1PZK D;  5L37 A;  2I07 B;  2EYM A;  2JE6 I;  4GNX B;  1ILQ A;  2F3V A;  5CV5 A;  4AQY L;  1K8M A;  1PTO F;  1PTO B;  1EUJ A;  5TSS A;  5E4W C;  3GTO B;  1KDB A;  1GD7 A;  3FDT A;  4BY1 H;  2L15 A;  5KYL A;  4JYA Q;  4RAU C;  3AEV A;  4IO9 A;  3AB9 A;  4C3H G;  3SHL A;  5CV9 A;  4KN7 C;  3NTK A;  2Y0S B;  4A3I B;  1A6X A;  4RGO S;  1WTR A;  4O1N A;  4RHS A;  3M4Q A;  4MNO A;  3C1F A;  2JJQ A;  3CP0 A;  4PMC A;  4AH6 A;  2J0T D;  2CQA A;  2R92 H;  1BVS A;  4X62 L;  3RN5 A;  3CCV A;  1I50 H;  1M1K C;  2KCC A;  2QCP X;  3HOU H;  1II3 A;  4X66 Q;  1KHI A;  3IKJ A;  1WI5 A;  1HNZ Q;  5IE8 A;  3BU2 A;  1SJH D;  4FF1 A;  3VA5 A;  3I4M G;  5EJW A;  1STB A;  3BDO A;  1C8C A;  1LLR D;  1WOC A;  3GDE A;  3TRE A;  2JA7 G;  2PI2 E;  2KHJ A;  2IX1 A;  4XT1 B;  2F0J A;  2WV6 D;  1TWC B;  2OT2 A;  3HOX B;  3R8B A;  3NE5 B;  2YTX A;  2DNC A;  3JC6 6;  1MGS A;  4NB3 A;  1E3P A;  5ELO A;  2E2H H;  1MD2 D;  4IN3 A;  5JOB A;  2OQ0 A;  1PH2 A;  2ZJQ A;  1X32 A;  3BYY B;  3DEP A;  4G7H C;  3PMF A;  3S1R B;  3PO3 B;  4F7X A;  4FO2 A;  1Q86 C;  1TWF B;  3FKI B;  1ZYR C;  4DXG A;  1PLF A;  3DWA A;  2UUB Q;  1QWY A;  4MN3 A;  3RLN A;  3HOY B;  2UXD L;  1I6H B;  2XN9 C;  3S15 H;  3KF6 A;  1JJG A;  2NVY H;  4PG3 A;  4GKK Q;  4XYQ A;  1G2S A;  3D8G A;  3EJI A;  4JCV E;  3GTL H;  1PTO D;  3LX0 A;  1NNX A;  4AYB E;  1QJO A;  4LF4 L;  2MO0 A;  1AFP A;  1QVG A;  3HOV H;  2Q8T A;  2F0S A;  3HS0 C;  4EGV A;  4A3G G;  4IUP A;  2ZXR A;  4KJO A;  4NDX A;  5ELE A;  5IP7 H;  2K5Q A;  3I4N G;  4OWT B;  2XWJ B;  2C35 B;  5M3F H;  4A3J B;  4XDX A;  2E8G A;  3NBH A;  3RZD B;  4DAY B;  2EXZ A;  1O78 A;  5M5X H;  3HKZ E;  2DUD A;  4HSV A;  2Z8L A;  2RKS A;  3K0X A;  3VYS A;  3RZO B;  3MEF A;  1PYW D;  1KDA A;  2ZTC A;  4GN5 A;  1B3Q A;  4X3T A;  2C9O A;  4JI3 L;  4F8M A;  4L63 B;  3BS1 A;  1JJC B;  1NR2 A;  4DV0 Q;  1OXV A;  1HRJ A;  1NAP A;  1Q82 C;  1ML0 D;  5FLM G;  3ICE A;  2BH2 A;  2VQF Q;  4XIG S;  3J80 E;  3CPW A;  3K7A B;  5IGD A;  2K5H A;  2BA0 A;  3P20 A;  1O7I A;  4I7A A;  4ZRZ A;  2VL6 A;  2ES2 A;  4GLA C;  1QZG A;  5IYC G;  4GZY C;  2H4O A;  2GVA A;  1SYC A;  4JI8 L;  1SYE A;  3D4W A;  1NY4 A;  5AFW A;  3FPU B;  3MVV A;  3M4P A;  2K5V A;  3NEM A;  3PF4 A;  1DYQ A;  3CMA A;  2D9U A;  1BF4 A;  1GHK A;  2L9H A;  1SMX A;  3GTM H;  2YTV A;  4JC0 A;  1JIC A;  1M90 C;  1EFI D;  2YYZ A;  1AW7 A;  3SR1 A;  4ZYS A;  2UXB L;  2A74 C;  4K8I A;  2V4D A;  1BXT A;  1PH6 A;  3OW2 A;  4A3K B;  3P75 A;  4NXM Q;  1DCZ A;  4KKU A;  5ELC A;  3HOZ G;  3H0G B;  1DOL A;  3S1Q B;  1RIP A;  2D2C C;  2K6A A;  2PZW A;  1MJE A;  4TKO B;  1XX8 A;  5DAU A;  2HDL A;  1N33 L;  4JG2 A;  3J7A F;  1B4O A;  2FMC A;  2KCM A;  3NWT A;  3ULJ A;  1QCB D;  4TQU S;  5M5W B;  4GN4 B;  3OYY A;  1I94 L;  1IYJ B;  2JA8 H;  1EEF D;  1I4G A;  4A3F G;  1GUN A;  1I4P A;  2JXM B;  2LXK A;  2NUC A;  4KN4 C;  1YJ9 A;  2E5L L;  1X3Q A;  2KED A;  2R93 H;  3DUZ A;  2TSS A;  1RDP D;  3TME A;  5LMN Q;  2Q2I A;  4B3M Q;  2RCN A;  1K83 H;  4KY5 A;  1GUW A;  1IKM A;  3BDC A;  5A35 A;  4APV A;  4BY7 B;  1Q1B A;  2N78 A;  1S3O A;  4BBR B;  4KHV A;  4RKB A;  3DWQ A;  3TBI B;  1Q90 A;  3L7Z C;  3MXN A;  3RNU A;  3FPP A;  1H95 A;  2JA5 H;  4A3B H;  4P75 A;  1Y1W G;  3URY A;  2K33 A;  1SMY C;  5C3X A;  1FJG L;  3HGB A;  4DR4 L;  3MXU A;  4A3M B;  4CDE C;  5GAG C;  1EQR A;  2WP8 J;  3F8T A;  1S5B D;  2EY5 A;  4LFA L;  1ICW A;  1EIG A;  3OMG A;  3A56 A;  5C44 B;  2KOL A;  3I90 A;  4IUV A;  1A3T A;  4A3E B;  1TQO A;  2WKC A;  4XQJ A;  4A93 B;  2EYO A;  1PYS B;  2Q2U A;  4RCO A;  3RN2 A;  2RDG A;  3ERO A;  2ASB A;  2JP1 A;  4LUZ A;  2E2D C;  3WOE A;  1X3P A;  4I65 A;  3M4Y A;  4PZ7 A;  1BBW A;  5IYD G;  3JAM L;  4P2C B;  3GV6 A;  4ALP A;  1EWI A;  4JI4 Q;  1JQY D;  1O7L A;  5C3E B;  3ULL A;  3S9W A;  5C4H A;  3M7N A;  1IBM L;  3T1Y Q;  1GJX A;  1X6O A;  4A3D H;  1WVL A;  3MWY W;  4GKJ Q;  1Y69 U;  3GTP H;  2A5H A;  3UI2 A;  1XNR L;  2ZTD A;  1L2F A;  5D14 A;  1HTL D;  1HQR D;  3SDZ A;  2R7Z G;  2VUM H;  5EQ0 A;  2VNU D;  3HEJ A;  1TWA H;  2KA7 A;  2A6E C;  5K5P A;  2K7V A;  1J8I A;  1EU4 A;  5E7N A;  4DNI A;  2XSC A;  3A55 A;  2K14 A;  2F0F A;  2RBM A;  4DV6 L;  2PMZ E;  3U4V A;  1CKN A;  4L5R C;  3HOW B;  3I4M H;  3KOJ A;  4BY1 G;  4JI0 Q;  1PFM A;  2OCE A;  3NWS A;  3A8I E;  4BBS H;  4B9W A;  2B2Y A;  1B2T A;  2AQ2 B;  1PH3 A;  4RMF A;  2KUM A;  2WFW A;  1IBL Q;  4LUV A;  2PNR C;  4DFA A;  1E0B A;  1EYD A;  2KEE A;  3FP9 A;  2E2J B;  1RCV D;  4X62 Q;  4CJ0 B;  1QNK A;  3PO2 H;  4JBM A;  2K5N A;  3G6J B;  2LSS A;  1CZG A;  1EY9 A;  4OIJ A;  4UDU C;  3HOU G;  2L0C A;  1FGU A;  3UDF A;  2BDN A;  1DXM A;  3PSI A;  3DMU A;  3J80 c;  5GAE C;  3HG9 A;  1XWE A;  4X3K A;  1ASY A;  3J7Y W;  1UE1 A;  2ZXO A;  4KHP L;  1BR9 A;  1SSO A;  1K8G A;  2KJX A;  3OHX C;  4K5W A;  1YBY A;  3VYT A;  5A2Q E;  1GUG A;  1WTP A;  1QOH A;  4A3G H;  4RGN A;  2K5D A;  1H9R A;  3HOX H;  2EVB A;  1SRO A;  3PUV A;  3R93 A;  3J7A 5;  2IX3 A;  4ZCK A;  4JI7 L;  1PRT F;  3L3O C;  2SNM A;  1PRT B;  4BS9 A;  5M5Y B;  1EY0 A;  2BE5 D;  4DUY Q;  2MQH A;  4X64 Q;  2F0N A;  1SE8 A;  4UP9 A;  4UHV A;  1B53 A;  1TWF H;  4A3L H;  5FOB B;  4FP5 D;  4N8X 1;  4J1M A;  4WJ3 M;  3AFQ A;  1V1P A;  4K14 A;  4KI0 A;  3GTG H;  5ISR A;  2A1A A;  2UXC L;  2FIN B;  2UUA Q;  1ESR A;  3EQL C;  4ID6 A;  3W1B A;  4LF7 Q;  4GLX A;  1J6Q A;  2O4X A;  1JCK B;  3CCJ A;  3QJY A;  2RF4 A;  4OX9 L;  3GQB A;  1SNQ A;  5JPM C;  3J81 L;  1Y1V G;  5EKL A;  3CCS A;  4F88 A;  3JAM i;  3KK7 A;  3BZC A;  4ZUI A;  2Z9H A;  2B63 B;  3RZD H;  3I4L A;  4EQO A;  1WTO A;  1WCM B;  1PFS A;  1HUN A;  3CHB D;  1STG A;  5IYC H;  1ZXT A;  1UE5 A;  4OEM B;  2ZM6 Q;  5IT9 L;  3PUW A;  4H44 C;  3LGJ A;  5CV6 A;  4JI3 Q;  4JOI A;  2WAQ G;  2HD3 A;  1WTV A;  1YHA A;  3ERS X;  2XVS A;  4WOR A;  3S1N H;  2CQO A;  1D5M C;  1Y8N B;  2E2I B;  3KLW A;  2QIL A;  3GTJ H;  2P5Z X;  5G3L F;  1EY5 A;  3GP7 A;  3KDF A;  1AH9 A;  4LF5 Q;  2HT1 A;  5GAH C;  3PIO 3;  5GQO A;  2ZT9 C;  2VB3 X;  3PUX A;  1E2Z A;  1P8L A;  3NQT A;  4KY6 A;  4JW0 A;  5D3I B;  2JK8 A;  5COR A;  4OWW B;  1BO0 A;  3G48 A;  4YY3 L;  2RCF A;  1EQV A;  2WB1 B;  2NBF A;  4IFD G;  1EZ6 A;  1S5F D;  2AQ3 B;  1UUP A;  3KYH C;  2VZA A;  1C48 A;  4CGY B;  1CKO A;  3TP5 A;  4HTH A;  3MFG A;  2Q8R E;  2CKZ B;  3ER0 A;  2PNH A;  4UY8 C;  2MPM A;  3AQQ A;  4YHH L;  4OEL B;  3KF8 A;  1N36 L;  3VDY A;  1BCP F;  3TP7 A;  1ENA A;  1BCP B;  3MEH A;  4A3F H;  1I3Q H;  1CFM A;  3QIA A;  2EXD A;  4ZLT F;  4DV1 L;  1QE6 A;  2UXB Q;  1AP0 A;  1YNJ D;  4G7Z C;  1W3S A;  3U9O A;  3QR8 A;  5LMU Q;  3Q24 A;  1IW7 D;  1FNU A;  2K50 A;  3NXW A;  1TWG H;  3OWE B;  4C3J B;  4L5T A;  1G91 A;  1N33 Q;  3DWP A;  3CAM A;  3UE0 A;  4DAY A;  3S1Q H;  4UPA A;  2NTS A;  3PGZ A;  4Z9C B;  1G29 1;  1YVC A;  3D4R A;  4AYB B;  4QF4 A;  4K8J A;  1EZ8 A;  2F0Q A;  4OIK A;  3WDN A;  1D5Z C;  2F0L A;  5M5W H;  3S1M B;  1BBU A;  1Y1W H;  5COY A;  4OO1 I;  2E5L Q;  1YEZ A;  1W6K A;  1FL0 A;  4IJL A;  2R93 G;  1QZH A;  1EIF A;  5IWA L;  1ENF A;  1G8Z D;  1LV9 A;  3NHH A;  5G3L D;  2A68 D;  1R4Q B;  1K3B C;  1O80 A;  3CCR A;  2FHT A;  1LTL A;  2CVR A;  1PH8 A;  1HR0 W;  1AZP A;  2EPB A;  1VQJ A;  2SOB A;  2NYZ D;  1W2B A;  2EE1 A;  2K01 A;  4BBR H;  2QW7 A;  3PIP 3;  2O2L D;  1VDZ A;  2X6L A;  4BA1 I;  1CTM A;  3A7L A;  3L0O A;  3A0J A;  4PZ8 A;  3O13 A;  4PZ6 A;  2Q8I B;  1EY8 A;  2N49 A;  1X55 A;  3K8A A;  1FYC A;  1NSN S;  3OIQ A;  4HID A;  1EQQ A;  2F0V A;  1XNQ L;  1VQA A;  1N32 L;  5BR8 L;  2OEO A;  5IYD H;  1JMC A;  3J81 i;  1LAC A;  3VR2 A;  2B2Y C;  4O0A A;  4K6L A;  4LF8 L;  4C2M H;  2EZV A;  4O2D A;  1HHV A;  5C5L A;  2XTI A;  2F0W A;  3FEW X;  1U4L A;  1BCP D;  2Z0S A;  4A76 A;  3TZD A;  1LT3 D;  3T1H L;  5C44 H;  1PDQ A;  2NWG A;  3J7A V;  2LY7 A;  5T1I A;  2B3G A;  4DR3 L;  1RJT A;  2ICI A;  2R7Z H;  3K5M A;  1LTS D;  4IFD I;  3SGI A;  3WWV A;  1Q7Y C;  2B29 A;  2KEC A;  1SFO H;  2F0O A;  2Z6B A;  1NCV A;  4CDF C;  3D4D A;  4CJ1 B;  1XMO Q;  2IX0 A;  2WAQ E;  3K59 A;  2EYH A;  1IBM Q;  5C3E H;  3GTK H;  4K5X A;  3D3R A;  2E76 C;  4A3D G;  3S2H B;  3I70 A;  1IL8 A;  2N3S A;  1BBX C;  1LAB A;  4BWG B;  4KKS A;  2PZU A;  1I6V C;  2YV5 A;  2VQE L;  1CZW A;  2ATW A;  1U5K A;  2NVQ B;  4R4Q A;  5HGQ A;  2VUM G;  2N55 A;  5FK9 C;  3TSS A;  2RHS B;  4DN4 M;  1ESF A;  3C3L A;  2WII B;  3GTQ B;  4PMW A;  3BYT B;  1F77 A;  2LKV A;  1HR0 Q;  3T53 B;  2JA6 B;  1AE3 A;  4EQ5 A;  4FNF A;  3X3N A;  3SK5 A;  2CW0 D;  2JA7 B;  4DV6 Q;  1SE4 A;  4QIW E;  3R3O A;  1Z9F A;  3GD7 A;  3QOJ A;  1WTX A;  3TN2 A;  1PTO C;  2R3Z A;  1I4Q A;  4Q0F A;  5CV4 A;  2B2W C;  1KQS A;  1ZKO A;  4J15 A;  4BBS G;  5JJI A;  4H7B A;  4HN7 A;  1DOM A;  1KAA A;  5JJZ A;  1VQ7 A;  4XYO A;  4A3I G;  4DV3 L;  1TS4 A;  4YWK A;  2F0U A;  1OXX K;  3PO2 G;  4RGT A;  2A6H D;  4DK1 A;  1CM9 A;  4EQP A;  1PZJ D;  4HR7 B;  3G6E A;  1CHQ D;  2EYJ A;  1X54 A;  4JOI C;  4DV7 L;  1JE4 A;  1EOV A;  2HHH Q;  2NVX B;  3QO2 A;  2UUC L;  3BG3 A;  4KHP Q;  4LFB L;  1C7Y A;  1L1O A;  3RLF A;  4BXX H;  1H9S B;  3CC4 A;  4NXN Q;  4LF6 L;  1TS2 A;  3W5O A;  1MJC A;  2B8G A;  1EQT A;  3QOL A;  3HOX G;  4OO1 H;  2Q2T A;  3E9H A;  1JC7 A;  5DEH A;  2B39 A;  1J5E L;  3CRL C;  5C4J H;  4JI7 Q;  1Y1V H;  3H15 A;  4KHZ A;  2OTJ A;  5EPK A;  3KLS X;  4P74 A;  4IUN A;  4YCW A;  2OF1 A;  1TT2 A;  1STA A;  3TS0 A;  3PO3 G;  4A3L G;  4XQQ A;  1LUZ A;  3A8K E;  5I9O A;  3KLR A;  1GUS A;  2BH8 A;  2QA4 A;  4C1N I;  1STN A;  1CQV A;  1MSG A;  1VQF A;  3Q23 A;  2JYO A;  3E6Z X;  1S5D D;  4WJW A;  1JOK A;  5LMN W;  4OX9 Q;  4OGQ C;  3HKS A;  3OSO A;  4CBV A;  1G6P A;  4Y7N H;  2CFM A;  2G9D A;  3AYH B;  4A3J G;  2A19 A;  2K1B A;  4R4I A;  3CQZ H;  1SLJ A;  5I2Y A;  4E6I A;  1SDF A;  4DV2 Q;  1GOZ A;  3QB3 A;  1ASZ A;  1U4M A;  3MFY A;  3BDL A;  2PMZ B;  2MO1 A;  1Z47 A;  3KBX A;  2R7D A;  1XTC D;  4IFD H;  2KCN A;  1HNX L;  3STB D;  3VYU A;  1KTK A;  4CDC C;  1XTD A;  4TRD A;  1VQL A;  1IBK Q;  5I9P A;  2QKI C;  1ONL A;  1Q3L A;  1UE7 A;  1FD7 D;  3EFX D;  2I46 A;  2F4V Q;  4EVO A;  4J8Q A;  2CH4 A;  2D0O A;  3M3Y B;  1Q8K A;  1SYG A;  1HTP A;  4B3S L;  3PCO B;  5C4Z A;  2LS0 1;  4CKE A;  1SJE D;  1VQB A;  3MXG A;  3BVG A;  2KHI A;  2L1B A;  3CRK C;  3K6O A;  4KLK A;  1SAP A;  4YY3 Q;  1T9H A;  5J39 A;  1LO5 D;  4FF3 A;  2VY3 A;  4IQZ A;  3KFU A;  1KRT A;  1VQ8 A;  1VQP A;  2XWB B;  1CHP D;  3RD4 A;  1K8A C;  1W6J A;  4IPC A;  3E0E A;  1VF5 C;  3D31 A;  5E4X A;  4K0K Q;  3F1Z A;  4YHH Q;  1K28 A;  4L6T B;  3CCQ A;  1Z6H A;  1QUQ A;  3NK9 A;  1Y8P B;  1N36 Q;  2MNA A;  3CKI B;  5FJ8 H;  5H1S E;  2ZJP A;  2L55 A;  1ET6 A;  1E7Z A;  4OWX B;  2O5J C;  2RA4 A;  1HZC A;  1YNN D;  2DY8 A;  3SEB A;  2YTY A;  1LYL A;  1VMP A;  3NEN A;  4B9X A;  1EIY B;  4A3K G;  1OTC A;  1D1I A;  1S40 A;  1VQN A;  1Q8I A;  1CSP A;  2AKW B;  4ZUJ A;  5KEE A;  2MGS A;  3TRZ A;  3MAQ A;  2EJG C;  4IUT A;  1XJV A;  1UNS A;  4C3I H;  4IZ8 A;  3KJP A;  1OO9 B;  2F4I A;  4Q5V A;  4HJ7 A;  2IHE A;  2X69 A;  3S1M H;  5DNF A;  4HSP A;  4OHJ A;  5LL6 X;  1M8A A;  1M4V A;  1WD1 A;  2F0E A;  1B8A A;  4WJ4 A;  5IWA Q;  1VQH A;  2TMP A;  1XPU A;  1I4R A;  1VQM A;  1IKL A;  1R9T H;  4G57 A;  4WFN 3;  5EGT A;  2D5D A;  5C5M A;  2K32 A;  1PFN A;  1F9S A;  4ZKB B;  2D0P A;  1MBY A;  4BY7 G;  1C4Q A;  3A7A B;  1GO3 E;  4JPB W;  1MIU A;  2NZO A;  1G6Z A;  1JOO A;  4BBR G;  2PW5 A;  1ENC A;  1A3V A;  2ID0 A;  2F52 A;  3ND9 A;  4U68 A;  1XNQ Q;  2CWA A;  2XGT A;  5BR8 Q;  1JT8 A;  1XMQ L;  2ZJR A;  1GKH A;  3C46 A;  1JE5 A;  3U9S A;  5HY6 A;  4DK3 C;  3M4O B;  4LF8 Q;  3S16 H;  3Q22 A;  3TDQ A;  4LW1 A;  4B3T L;  1SR3 A;  1FR3 A;  1RTO A;  1A15 A;  3S2D B;  3FHW A;  3T1H Q;  1K9M C;  4HMJ A;  4DR2 L;  5C44 G;  5EKI A;  3D6W A;  2JA9 A;  1XPO A;  2OQK A;  1NTG A;  4DR3 Q;  1HA5 A;  2VB2 X;  1TR5 A;  4A93 G;  2IWH A;  2FFK B;  3OPO A;  1ZEQ X;  5IGE A;  2NVT H;  1C9O A;  4C1N K;  3I55 A;  2DJG C;  2JEB I;  1H9J A;  3ULP A;  5CYU A;  3I72 A;  3DEO A;  3AFP A;  4GOP A;  2RDH A;  1B1Z A;  4AQY Q;  1L1O C;  4JYA L;  4LF9 L;  5C3E G;  1JOR A;  4FXD A;  4JI6 L;  3H3V I;  3MA2 B;  1PTO H;  1G51 A;  3S2H H;  1HXY D;  3GTO H;  2EY1 A;  2R92 B;  5EBC A;  2VQE Q;  1I50 B;  3TP6 A;  3HOU B;  2I5H A;  2EY6 A;  1S5E D;  3G7L A;  3QG1 A;  5FLX L;  2HUG A;  4A3I H;  4X66 L;  1QVF A;  2RSO A;  1CA6 A;  2BE5 C;  2PO4 A;  4XTC S;  2JA6 H;  3J7Z C;  1JOQ A;  5M3M B;  1KAW A;  5KNC A;  2C5C A;  5F2D A;  3ITP A;  4Y52 H;  1L0Y B;  1SE2 A;  1V9P A;  1X3F A;  1B44 D;  1HPC A;  4J6H A;  3CCU A;  4IAL A;  5HGT A;  4CKB A;  1VQK A;  4DR1 L;  1D6E C;  1NR4 A;  3NPP A;  3HOW G;  5I6Y A;  4A75 A;  2E2H B;  3KJO A;  2ZXP A;  2NN6 I;  3OMC A;  2NTT A;  5C4X B;  4QUC A;  1D1K A;  4DR5 L;  1GUO A;  3HRZ C;  1STY A;  3F2U A;  3OTO L;  4OL7 A;  1RKN A;  2AWO A;  1TWC H;  4DV3 Q;  3A8J E;  3K5N A;  4B3R L;  4ZAI A;  3S15 B;  1KNE A;  4HJ5 A;  2UUB L;  1HFN A;  2NVY B;  1EY4 A;  3I56 A;  1P16 A;  4DXF A;  1PVO A;  3TEH B;  2SEB D;  4H02 A;  2DN8 A;  4GLV B;  3GTL B;  5EPL A;  1YIT A;  1V1O A;  4PNY A;  1V43 A;  5J1Z A;  4GKK L;  1MSH A;  3S1R H;  3PO3 H;  2UXD Q;  1BOS A;  4TVA B;  1I5F A;  1E22 A;  3HOV B;  1EY6 A;  3FKI H;  1Y8O B;  1OXT A;  3J81 j;  3HOY H;  1HZ9 A;  1I6H H;  4KV6 A;  4GNX A;  4LFB Q;  2NVX H;  5M3F B;  4LF4 Q;  4L8J A;  4BXX G;  4LF6 Q;  4DV5 L;  2LFN A;  4KD3 A;  5M5X B;  2B2W A;  1TY2 A;  4OO1 G;  1BUV T;  4JBJ A;  2MFI A;  1EU3 A;  1J5E Q;  2F0G A;  2IPK D;  4L5Q A;  1TXY A;  4A3J H;  1LT6 D;  4M8A A;  1PRT C;  1PMR A;  4JI1 L;  5KRU A;  4K6D A;  1U4P A;  4HCE A;  2WAQ B;  1SNO A;  1SBB B;  5DM6 3;  5KYI A;  5FO8 B;  4IPH A;  1D2B A;  4KKT A;  3T13 A;  2B2U A;  2EYL A;  4DV0 L;  3RZO H;  2X6G A;  1CUK A;  4KY7 A;  2VQF L;  1AZQ A;  3F2D A;  2NZH A;  5KIX A;  3EBE A;  4RFB A;  1YNJ C;  5CV8 A;  3I2Z A;  5C0X G;  1XPR A;  4K2L A;  4YCU A;  1CT1 D;  1PFB A;  4X65 L;  1IW7 C;  2BA1 A;  3Q0A A;  3K7A H;  2B63 G;  1NMG A;  4P73 A;  5E3F A;  1WCM G;  3G4S A;  1K8O A;  1VQG A;  1X56 A;  1HJP A;  3H94 A;  1V1Q A;  1PRT D;  5T1G A;  3I73 A;  1CI3 M;  1HNX Q;  1JWU D;  4JI8 Q;  1L0W A;  3IAY A;  2RHQ B;  3IFT A;  1BQQ T;  2VXW A;  4EQN A;  1YJW A;  1O7Y A;  3I91 A;  1RD9 D;  3K80 C;  3H91 A;  2IHF A;  2YU9 B;  1EOT A;  4FXK C;  1TS5 A;  3P1H A;  1LTB D;  5LHY 1;  3UDI A;  3JAM E;  4IFD J;  1QG7 A;  2DNE A;  1B3A A;  4V19 0;  2F0I A;  1LM0 A;  5BN4 A;  2A68 C;  3H3V H;  3PV0 A;  4B3S Q;  3CC7 A;  3R2T A;  1IHZ A;  2H1E A;  1DON A;  1LTT D;  2PPB C;  4PV1 C;  1JJ2 A;  3UDX A;  2KCT A;  1SN8 A;  4A3K H;  1SYB A;  4JV5 L;  2WB1 G;  2IT1 A;  4IUQ A;  3H0G H;  2JA8 B;  4QY7 A;  4NW2 A;  3S17 B;  1GVP A;  4NKL A;  5IYB G;  3VYR A;  3W2D A;  4XT3 B;  5M9O A;  2R93 B;  3NP8 A;  3TS2 A;  1N34 L;  4H0L C;  2ENB A;  1I94 Q;  5BN5 A;  2PYK A;  1K83 B;  4DKA C;  5FJ8 G;  2F0H A;  1BCP C;  1LTG D;  4G4K A;  2ALY B;  4HJ8 A;  1NMF A;  3U50 C;  3E3X A;  3HKZ B;  2NN6 H;  3K5L A;  2SDF A;  1UAP A;  1HUM A;  2JA5 B;  4A3B B;  5FLX E;  4N9P A;  4C3J G;  4BY7 H;  3C1E A;  3A5Z B;  4GOP C;  1BDO A;  3U58 A;  3T56 B;  5IP9 G;  2L11 A;  4V0B A;  2F3W A;  4RKL A;  1RL2 A;  4C3I G;  1LTI D;  5ELD A;  3J80 L;  4A3C G;  1FJG Q;  1JR0 D;  4DR4 Q;  2K28 A;  2QEJ C;  2MHV A;  3BZK A;  2EOT A;  1TWH B;  5C0X I;  1RF2 D;  3A74 A;  3BVM A;  1B50 A;  1KRS A;  4A3M H;  4LFA Q;  1KC8 C;  2AUJ D;  1CSQ A;  4X3S A;  2LMC B;  5C3W A;  3MHB A;  2VW9 A;  1VQD A;  2PCF B;  3SXH A;  4DK6 C;  3CCL A;  1HNW L;  2L5T A;  1EWH A;  3K58 A;  1YHQ A;  1TU2 B;  4A3E H;  1HZB A;  4A93 H;  2CH4 W;  3CCE A;  1S72 A;  2CW0 C;  3V05 A;  4A3D B;  3KLS A;  5C6A A;  2OXP A;  4NP5 A;  1XMQ Q;  1DD2 A;  3X3M A;  1ICF B;  1Q1E A;  4ZKC B;  4GKJ L;  4C3H B;  2B8F A;  1E2W A;  3M4O H;  2VUM B;  1G2T A;  4K2K A;  4B3T Q;  4JBW A;  4HED A;  2M00 A;  1QVC A;  1X3E A;  1DM0 B;  1TWA B;  3G71 A;  4DR2 Q;  1C0A A;  1XNR Q;  1CKM A;  4LJZ C;  3RUZ A;  4DR7 L;  3VA7 A;  3ZYY X;  2GN5 A;  2A6H C;  5HUR A;  2B2V A;  3J81 E;  3I7F A;  3S14 B;  2KVM A;  3A5U A;  2A69 D;  3I4M B;  3VR5 A;  2PW7 A;  4EX5 A;  4GNX C;  1HCZ A;  1IXR A;  4HMI A;  4FXG C;  4N9T A;  1NJI C;  1B9N A;  4BBS B;  2K05 A;  4LF9 Q;  2ZTE A;  4JI0 L;  2IY5 B;  5I6W A;  4JI6 Q;  1FGB D;  3OOC A;  3EA6 A;  4P71 A;  4R8I A;  3HOW H;  5IT9 E;  3NBI A;  2EDG A;  1IBL L;  4ULL A;  3PO2 B;  1Q12 A;  5JJL A;  3KUP A;  1WFQ A;  4M1U B;  1S4Z A;  2DGY A;  2E75 C;  1E2V A;  3PUY A;  1E24 A;  4IOA A;  2R7F A;  4XXE A;  2Y0S G;  2J7Z A;  2HDM A;  4DNT B;  2AMC B;  5IGB A;  3FVQ A;  5JEA H;  4HJ9 A;  1SNP A;  2E2J H;  2WB1 E;  4NPS A;  1BKB A;  2JA6 G;  2XRS D;  1KLU D;  1B70 B;  2F0T A;  3I3C A;  2RVL A;  2B2U C;  2K04 A;  4R4O A;  3RR5 A;  3KDF B;  1H9K A;  3MZ5 A;  3WOF A;  4IJH A;  5M3M H;  1EY7 A;  3E9I A;  4IUR A;  4A3G B;  4DR1 Q;  1VQ9 A;  2B2T A;  4JI2 L;  3DXJ C;  5IGF A;  3I4N B;  4QQB X;  3CME A;  4HCS A;  1A63 A;  2CCZ A;  5EAY A;  4QGU A;  4DR5 Q;  1HFG A;  3OTO Q;  4DUZ L;  4LNQ A;  3E0J A;  3SK6 A;  5C4X H;  1FNW A;  4DU9 A;  1J9O A;  3MC0 B;  4B3R Q;  2PQA B;  3NSW A;  3W3A A;  4DUY L;  1N8R C;  4X64 L;  1D5X C;  3GTG B;  3FRP B;  2NZ1 D;  5ELB A;  3A54 A;  5E1F A;  3J80 i;  3JAM c;  2EYP A;  4DR6 L;  2AQ1 B;  3KF8 B;  4OON A;  4DF7 A;  3L9A X;  4R8N A;  2KHS A;  2UUA L;  5M5Y H;  3STB C;  2XNA C;  3FKI G;  1TS3 A;  1JB7 A;  1SE3 A;  3CC2 A;  4QB4 A;  3RLO A;  3HOY G;  2UXC Q;  3UDG A;  4LF7 L;  1JB3 A;  2K03 A;  2I0Q A;  3TP8 A;  1T5E A;  4S3S A;  4DV5 Q;  1QNU A;  2Z4I A;  1PA6 A;  4O42 A;  1AEX A;  1PXU A;  2G9H D;  1NE3 A;  4B08 A;  1GHJ A;  4IOC A;  5I2X A;  5C0X H;  1RHP A;  2DY7 A;  2JSO A;  1WJJ A;  2KEN A;  4JI1 Q;  1ZYR D;  2RDF A;  1DZ1 A;  4QCL A;  2B63 H;  1D8L A;  2ZM6 L;  5JPN C;  1WCM H;  1F9P A;  5JVG 3;  3S1N B;  4ZK9 B;  4KTA A;  3GTJ B;  1H9M A;  1PH1 A;  1LT5 D;  1K3R A;  4LF5 L;  3K81 C;  2GVB A;  4JI5 L;  3VR6 A;  5FLX c;  1VQ5 A;  1TVX A;  3LWE A;  4LMQ D;  2XRQ D;  1YJN A;  3LWU A;  3R2I A;  2E2I H;  1YNN C;  4YWM A;  1WTH A;  3BVZ A;  3HOZ B;  4X65 Q;  1KXL A;  1OXU A;  5KGU A;  2UU9 L;  3L2P A;  4DA2 A;  3IRB A;  1FNV A;  5J22 A;  4RA8 A;  1X3G A;  3W1G A;  3VR3 A;  5A2Q L;  1X9N A;  3D0F A;  3VR4 A;  1ET9 A;  1STH A;  2I5L X;  4A3F B;  1I3Q B;  5AJ3 L;  1LT4 D;  1DOK A;  1MKH A;  4POF A;  3S24 A;  1CQF A;  5IYB H;  4KK7 A;  4HIO A;  4I7Z C;  1EYG A;  2YU9 H;  1KDC A;  1HQM C;  2HIX A;  1VF7 A;  1V8Q A;  3H3V C;  4LWC A;  4DV1 Q;  1F2Y A;  1TWG B;  5JAV A;  1NUC A;  5I4D A;  5LMU L;  3LNN A;  1HH2 P;  2Y0S E;  1EYC A;  3H6M A;  2EQS A;  5CMD A;  1IYV A;  4JV5 Q;  3CPF A;  4PMB A;  3H0G G;  4PQX A;  1Y1W B;  2QF7 A;  4C3J H;  1UEB A;  4FF2 A;  5ELN A;  1SYD A;  5IP9 H;  3S17 H;  2R6G A;  3NUC A;  1IL2 A;  2A8V A;  1GUT A;  1N34 Q;  4YIJ A;  2N8N A;  5J3B A;  2RQX A;  4CHT B;  4A3C H;  4UAI A;  3T4A C;  1TII D;  3J81 c;  4BA2 I;  2AUK A;  4R4C A;  1QB5 D;  4GS3 A;  1SRU A;  5DLQ E;  2H5X A;  4LFC L;  3I4O A;  1EIH A;  3I8Z A;  2B2V C;  2NN6 G;  2IL8 A;  2Z6K A;  1L0X B;  5NUC A;  4XQN A;  3K5O A;  1HA6 A;  4DV4 L;  4JVZ A;  3SK4 A;  2HQL A;  5IT9 c;  3FMC A;  1YNX A;  4C2M B;  1VS0 A;  1F9R A;  1PYB A;  5D3D A;  3T16 A;  1YI2 A;  2V1C C;  1N32 Q;  5K36 H;  1Z7T A;  5CBE E;  1SNC A;  2FJ2 A;  1K0R A; 
#chains in the Genus database with same CATH homology
 2DUD A;  4O2D A;  2XTI A;  4JI1 L;  1AE2 A;  2PI2 A;  2Z0S A;  4A76 A;  4A3M G;  4HIM A;  3K0X A;  1TWH H;  3T1H L;  2OTL A;  3MEF A;  5C44 H;  2JQO A;  2ZTC A;  4GN5 A;  2B3G A;  4IPH A;  3Q8D A;  4DR3 L;  1HNW Q;  2R7Z H;  4DV0 L;  4JI3 L;  4IFD I;  3KF6 B;  3SGI A;  3RZO H;  3WWV A;  1Q7Y C;  1JJC B;  1CUK A;  1OXV A;  4DV0 Q;  4A3E G;  2B29 A;  1Q82 C;  2VQF L;  5FLM G;  1SFO H;  1PH9 A;  3ICE A;  3F2D A;  2NZH A;  4POG A;  1L1O B;  2BH2 A;  3EBE A;  2VQF Q;  2OWO A;  1XMO L;  1YIJ A;  3I2Z A;  5C0X G;  4XIG S;  3DLL A;  3CPW A;  5GAD C;  1XMO Q;  2K5H A;  2BA0 A;  1XPR A;  1O7I A;  2IX0 A;  4YCU A;  1FVI A;  2VL6 A;  2WAQ E;  2ES2 A;  4X65 L;  1IBM Q;  5C3E H;  3GTK H;  4GLA C;  4A3D G;  2BA1 A;  2KBN A;  3K7A H;  3EIV A;  1QZG A;  1NMG A;  4P73 A;  2N3S A;  3M9B A;  4C3H H;  5IYC G;  2B63 G;  2GVA A;  1WCM G;  3G4S A;  3CD6 A;  1VQG A;  3NBH B;  1X56 A;  4JI8 L;  1HJP A;  1V1Q A;  2YV5 A;  1HNX Q;  1NY4 A;  4MZ9 A;  3HFZ B;  2VS1 A;  3K7U C;  2VQE L;  1U5K A;  4JI8 Q;  2ATW A;  3M4P A;  4R4Q A;  5HGQ A;  2VUM G;  2K5V A;  3NEM A;  1L0W A;  3PF4 A;  2AHO B;  2RHQ B;  1PV4 A;  1YJW A;  3CMA A;  2RHS B;  1HR0 L;  3K80 C;  4DR7 Q;  2NVQ H;  2IHF A;  1SMX A;  4PMW A;  3GTM H;  2YTV A;  4JC0 A;  2QEX A;  1HR0 Q;  3BJU A;  3UDI A;  1AE3 A;  1M90 C;  4IFD J;  4EQ5 A;  2YYZ A;  1HNZ L;  2UXB L;  1LM0 A;  3GTQ H;  4DV6 Q;  1PH6 A;  3H3V H;  3S14 H;  1VQE A;  3PV0 A;  4B3S Q;  3CC7 A;  4QIW E;  1UWV A;  1Z9F A;  3GD7 A;  3OW2 A;  5JJK A;  4NXM Q;  1KQS A;  2JA7 H;  3HOZ G;  4J15 A;  1VQ6 A;  1RIP A;  1JJ2 A;  1KL9 A;  3UDX A;  1MJE A;  2KCT A;  1KIX A;  1SN8 A;  1N33 L;  4JG2 A;  4A3K H;  2F3I A;  4BBS G;  5JJI A;  3DM3 A;  4MTN A;  4JV5 L;  2WB1 G;  2KCM A;  2IT1 A;  3H0G H;  3ULJ A;  1VQ7 A;  4QY7 A;  2R92 G;  1GVP A;  4TQU S;  4A3I G;  5IYB G;  4GN4 B;  4DV3 L;  4YWK A;  3OYY A;  1I94 L;  1IYJ B;  1OXX K;  2JA8 H;  3TS2 A;  3PO2 G;  4A3F G;  1N34 L;  1I94 Q;  2LXK A;  1YJ9 A;  5JEA G;  4DKA C;  2E5L L;  2R93 H;  3PF5 A;  5FJ8 G;  1PHJ A;  3G6E A;  4ME3 A;  1VQO A;  5LMN Q;  1X54 A;  2Q2I A;  2I5M X;  4GN3 B;  4B3M Q;  2RCN A;  4JOI C;  2HHH L;  1K83 H;  4DV7 L;  2ALY B;  1EOV A;  4HJ8 A;  3NEL A;  1A62 A;  1NMF A;  3U50 C;  5M3M G;  1VQ4 A;  1U0L A;  4DV7 Q;  4APV A;  2HHH Q;  1VQI A;  2UUC L;  3F2B A;  2K75 A;  1Q1B A;  5JEA J;  2N78 A;  1S3O A;  4IPG A;  4JI2 Q;  1C7Y A;  2UUC Q;  4KHP Q;  4LFB L;  4NXN L;  1L1O A;  3L7Z C;  3RLF A;  4BXX H;  4BY7 H;  3CC4 A;  4NXN Q;  3A5Z B;  4LF6 L;  2JEA I;  4GOP C;  3RNU A;  3I4N H;  3W5O A;  1A8V A;  1MJC A;  4DUZ Q;  5IP9 G;  3U58 A;  3HOX G;  1H95 A;  2AWN A;  5IY0 A;  2Q2T A;  1PH5 A;  2JA5 H;  4A3B H;  5C4X G;  4P75 A;  3E9H A;  1Y1W G;  1FJG L;  1RL2 A;  4DR4 L;  1A0I A;  1J5E L;  5C4J H;  4JI7 Q;  4A3C G;  1Y1V H;  5GAG C;  1EQR A;  2WP8 J;  1FJG Q;  3F8T A;  4DR4 Q;  1NBW A;  3H15 A;  4KHZ A;  2OTJ A;  4LFA L;  4DR6 Q;  3BZK A;  1UE6 A;  1QUQ B;  4P74 A;  4YCW A;  3TS0 A;  3PO3 G;  5C0X I;  3A74 A;  4A3L G;  1KRS A;  4A3M H;  4LFA Q;  1KC8 C;  1GM5 A;  1CSQ A;  1LUZ A;  4R1J A;  4UP8 A;  2VW9 A;  1VQD A;  2BH8 A;  2QA4 A;  3HOV G;  4P72 A;  4DK6 C;  3CCL A;  1HNW L;  1PYS B;  2Q2U A;  5IYD H;  1VQF A;  3RN2 A;  3CW2 C;  2ASB A;  1YHQ A;  5IP7 G;  1Q46 A;  1X65 A;  4A3E H;  4LUZ A;  5FLM H;  1HZB A;  5M3F G;  4A93 H;  3U4Z A;  3CCE A;  1S72 A;  4PZ7 A;  1BBW A;  5IYD G;  5LMN W;  4OX9 Q;  3HKS A;  4ALP A;  1EWI A;  1IZ6 A;  4JI4 Q;  1G6P A;  4Y7N H;  2CFM A;  3ULL A;  3AYH B;  4A3J G;  2A19 A;  1XMQ Q;  4R4I A;  3MXN B;  4DV2 L;  1Q1E A;  3CQZ H;  3M7N A;  1IBM L;  1SLJ A;  3T1Y Q;  4GKJ L;  1X6O A;  4A3D H;  4JBK A;  4DV2 Q;  1ASZ A;  3M4O H;  4GKJ Q;  3GTP H;  4B3T Q;  2MO1 A;  4JBW A;  1Z47 A;  1QVC A;  2R7D A;  1X3E A;  1WYD A;  3G71 A;  1HNX L;  1XNR L;  1N9W A;  1L2F A;  2ZTD A;  4DR2 Q;  2D62 A;  1B7Y B;  3STB D;  3ZJY C;  5C0X J;  2R7Z G;  2VUM H;  1C0A A;  1IBK L;  1XNR Q;  1XTD A;  1CKM A;  2VNU D;  1VQL A;  4UP7 A;  1IBK Q;  1TWA H;  4DR7 L;  2F4V L;  2GN5 A;  3PIO A;  4HIK A;  1UE7 A;  4JI5 Q;  2F4V Q;  5E7N A;  4DNI A;  3I7F A;  3A5U A;  2D0O A;  2K14 A;  3GO5 A;  4EX5 A;  1Q8K A;  3M85 A;  4DV6 L;  4GNX C;  2Z6K C;  2PMZ E;  1IXR A;  4B3S L;  3PCO B;  3U4V A;  1NJI C;  1CKN A;  4L5R C;  2IY5 B;  4LF9 Q;  1VQB A;  2ZTE A;  4JI0 L;  2KHI A;  3I4M H;  3M3Y H;  4KLK A;  3KOJ A;  4DPG A;  4BY1 G;  4YY3 Q;  4JI6 Q;  4NXM L;  2UU9 Q;  1VCI A;  3HOZ H;  1T9H A;  1E1T A;  4JI0 Q;  4R4T A;  2OCE A;  2VY3 A;  3KFU A;  4LUO A;  1KRT A;  4BBS H;  4P71 A;  2PQA A;  1VQ8 A;  3HOW H;  1VQP A;  1IBL L;  1PH3 A;  4K0K L;  4RMF A;  3CF5 A;  1Q12 A;  1K8A C;  4IPC A;  5JJL A;  3E0E A;  2WFW A;  1IBL Q;  4LUV A;  3D31 A;  1WFQ A;  4K0K Q;  2DGY A;  3F1Z A;  4YHH Q;  3FP9 A;  3PUY A;  1E24 A;  5AJ3 Q;  4IOA A;  2R7F A;  4X62 Q;  1Q81 C;  3CCQ A;  3PO2 H;  1YHB A;  1QUQ A;  2Y0S G;  2K5N A;  4JBM A;  1N36 Q;  2LSS A;  2FXQ A;  2MNA A;  1K73 C;  2AMC B;  4YCV A;  3HOU G;  4HJ9 A;  2E2J H;  1FGU A;  5FJ8 H;  2WB1 E;  1VQC A;  1BKB A;  4NPS A;  5H1S E;  3UDF A;  1DGS A;  2ZJP A;  2JA6 G;  1B70 B;  1E7Z A;  5GRO A;  4HJA A;  4OWX B;  5LMN L;  4B3M L;  3PSI A;  3B6Y A;  3PUZ A;  4R4O A;  3J80 c;  3RR5 A;  3KDF B;  5GAE C;  1HZC A;  2QGQ A;  1D7Q A;  4IJH A;  5M3M H;  3TQY A;  1YZ6 A;  3E9I A;  1ASY A;  2YTY A;  1LYL A;  1EIY B;  3NEN A;  4GOP B;  4DR1 Q;  4A3K G;  1UE1 A;  1OTC A;  1VQ9 A;  4X6A H;  4JI2 L;  4KHP L;  4AIM A;  1K8G A;  1S40 A;  1VQN A;  1CSP A;  1YBY A;  2AKW B;  3CME A;  4QQB X;  1CKN B;  1A63 A;  2CCZ A;  5EAY A;  4QGU A;  4DR5 Q;  4A3G H;  3TRZ A;  3HOX H;  3OTO Q;  4DUZ L;  1OXS C;  4LNQ A;  5C4X H;  1SRO A;  1E1O A;  3EN2 A;  2JA8 G;  3PUV A;  1XJV A;  4C3I H;  3KJP A;  3J7A 5;  4B3R Q;  2PQA B;  4JI7 L;  4DUY L;  4HJ7 A;  1N8R C;  4X64 L;  2IHE A;  4AYB G;  3S1M H;  4FDB A;  3J80 i;  3JAM c;  2MQH A;  4X64 Q;  4DUY Q;  4DR6 L;  1SE8 A;  3KF8 B;  4OON A;  4UP9 A;  1B8A A;  1TWF H;  4A3L H;  4WJ4 A;  2HIV A;  5IWA Q;  1VQH A;  4QJF A;  1XPU A;  4WJ3 M;  3AFQ A;  1VQM A;  4KI0 A;  3GTG H;  2UUA L;  3CCM A;  5M5Y H;  2A1A A;  3STB C;  1R9T H;  2UXC L;  3FKI G;  4LFC Q;  1JB7 A;  3CC2 A;  2EIF A;  2UUA Q;  3RLO A;  4A4I A;  3HOY G;  2UXC Q;  3PIP A;  3UDG A;  4OXP A;  4LF7 L;  4DAM A;  2D0P A;  3HKZ G;  2I0Q A;  4BY7 G;  1GO3 E;  3W1B A;  1MIU A;  2NZO A;  4LF7 Q;  4GLX A;  4BBR G;  4L5S A;  4DV4 Q;  2K52 A;  3CXC A;  4DV5 Q;  1J6Q A;  1KD1 C;  4IPD A;  3CCJ A;  2JA5 G;  4A3B G;  1PA6 A;  2RF4 A;  1Y14 B;  4OX9 L;  2ID0 A;  2F52 A;  1NE3 A;  1XNQ Q;  2CWA A;  1Y1V G;  2XGT A;  5BR8 Q;  2LXJ A;  3CCS A;  4IOC A;  3JAM i;  4JI4 L;  1JT8 A;  3BZC A;  1XMQ L;  2ZJR A;  1GKH A;  1JE5 A;  5K36 G;  5HY6 A;  3RZD H;  4DK3 C;  4LF8 Q;  3T1Y L;  1WJJ A;  3S16 H;  2KEN A;  1PFS A;  4YWL A;  4JI1 Q;  2CWP A;  4LW1 A;  4RG1 A;  3F2C A;  4B3T L;  1SR3 A;  3UE1 A;  5IYC H;  2B63 H;  1D8L A;  2ZM6 L;  3FHW A;  2Q2H A;  1WCM H;  3T1H Q;  1K9M C;  1EFW A;  1UE5 A;  2K4K A;  4DR2 L;  5C44 G;  2ZM6 Q;  4QL5 A;  1PH4 A;  3PUW A;  2JA9 A;  1XPO A;  2OQK A;  1NTG A;  3LGJ A;  4DR3 Q;  4JI3 Q;  4JOI A;  1PH7 A;  2WAQ G;  3S2D H;  1YHA A;  3ERS X;  1HZA A;  3S1N H;  2CQO A;  1PH1 A;  4A93 G;  1K3R A;  2NVT H;  4LF5 L;  3K81 C;  2JE6 I;  4GNX B;  2GVB A;  1C9O A;  3KLW A;  4JI5 L;  3GTJ H;  5FLX c;  1VQ5 A;  3KDF A;  1AH9 A;  4LF5 Q;  3I55 A;  2JEB I;  2HT1 A;  5GAH C;  3ULP A;  1YJN A;  4AQY L;  5GQO A;  3PUX A;  1P8L A;  2E2I H;  3AFP A;  1EUJ A;  4YWM A;  4GOP A;  4AQY Q;  1KXL A;  4X65 Q;  1L1O C;  2JK8 A;  4OWW B;  4LF9 L;  4JYA L;  1GD7 A;  1OXU A;  5C3E G;  4BY1 H;  3G48 A;  4JI6 L;  2L15 A;  4YY3 L;  3H3V I;  2UU9 L;  4JYA Q;  3L2P A;  4IO9 A;  3AEV A;  1G51 A;  3IRB A;  4IFD G;  3S2H H;  3GTO H;  3KYH C;  2VZA A;  1X3G A;  3W1G A;  2VQE Q;  1CKO A;  1X9N A;  2CKZ B;  3D0F A;  3M4Q A;  4MNO A;  2I5H A;  2JJQ A;  3CP0 A;  2PNH A;  3ER0 A;  4AH6 A;  4UY8 C;  3AQQ A;  2I5L X;  4YHH L;  2R92 H;  5AJ3 L;  1BVS A;  1MKH A;  4POF A;  4X62 L;  3S24 A;  3CCV A;  1I50 H;  4X66 L;  5IYB H;  4HIO A;  3RN5 A;  4A3I H;  1M1K C;  1QVF A;  1N36 L;  3VDY A;  3HOU H;  1EYG A;  4X66 Q;  2YU9 H;  1KHI A;  2HIX A;  1WI5 A;  1I3Q H;  4XTC S;  4A3F H;  1HNZ Q;  5IE8 A;  2EXD A;  2JA6 H;  4DV1 L;  2UXB Q;  3BU2 A;  3J7Z C;  4LWC A;  4DV1 Q;  1KAW A;  3I4M G;  4Y52 H;  5LMU L;  1W3S A;  1HH2 P;  1V9P A;  1WOC A;  1X3F A;  2Y0S E;  3CCU A;  3GDE A;  3TRE A;  2JA7 G;  5LMU Q;  2EQS A;  2K50 A;  2PI2 E;  1VQK A;  2KHJ A;  4DR1 L;  2IX1 A;  1TWG H;  3HOW G;  4L5T A;  1N33 Q;  3UE0 A;  3CAM A;  3S1Q H;  4A75 A;  3KJO A;  4UPA A;  4JV5 Q;  2NN6 I;  3PGZ A;  1G29 1;  1YVC A;  3CPF A;  3H0G G;  4DR5 L;  2YTX A;  4C3J H;  1UEB A;  3OTO L;  5ELN A;  3JC6 6;  2AWO A;  4NB3 A;  1E3P A;  1TWC H;  5ELO A;  5IP9 H;  4DV3 Q;  1PH2 A;  2E2H H;  2ZJQ A;  2OQ0 A;  2R6G A;  3S17 H;  5M5W H;  1IL2 A;  2A8V A;  4B3R L;  1BBU A;  4HJ5 A;  1N34 Q;  1Y1W H;  2UUB L;  2N8N A;  3I56 A;  5J3B A;  1P16 A;  4OO1 I;  1PVO A;  2E5L Q;  1YEZ A;  3TEH B;  1Q86 C;  4A3C H;  1FL0 A;  4H02 A;  2UUB Q;  4IJL A;  2R93 G;  3RLN A;  2UXD L;  1QZH A;  4GLV B;  3J81 c;  3S15 H;  3KF6 A;  1YIT A;  1EIF A;  1V43 A;  5IWA L;  4BA2 I;  4R4C A;  4GKK L;  3S1R H;  3PO3 H;  2NVY H;  2UXD Q;  1JJG A;  4TVA B;  4PG3 A;  1I5F A;  1E22 A;  4GKK Q;  3FKI H;  4GS3 A;  1SRU A;  3CCR A;  5DLQ E;  2H5X A;  4LFC L;  1LTL A;  1OXT A;  3I4O A;  4JCV E;  1HZ9 A;  3J81 j;  1PH8 A;  3GTL H;  3HOY H;  1I6H H;  1HR0 W;  2NN6 G;  1VQJ A;  4AYB E;  4GNX A;  2Z6K A;  1W2B A;  4LF4 L;  2MO0 A;  4A3J H;  1QVG A;  2NVX H;  4LFB Q;  3HOV H;  4A3G G;  4LF4 Q;  4BBR H;  4DV4 L;  4BA1 I;  4DV5 L;  4LF6 Q;  2HQL A;  5IP7 H;  4BXX G;  3L0O A;  4OWT B;  3I4N G;  3A0J A;  5IT9 c;  4PZ8 A;  4PZ6 A;  2C35 B;  5M3F H;  2N49 A;  1X55 A;  3K8A A;  1YNX A;  4OO1 G;  4HID A;  1EQQ A;  1N32 L;  2E8G A;  1VS0 A;  1VQA A;  2MFI A;  4JBJ A;  1PYB A;  5BR8 L;  4DAY B;  1XNQ L;  1YI2 A;  1J5E Q;  1JMC A;  2V1C C;  1N32 Q;  5M5X H;  3J81 i;  3HKZ E;  4L5Q A;  4O0A A;  1TXY A;  4LF8 L;  1K0R A;  4C2M H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...