4DV2Q

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 16
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dv2Q00
1YVCA 3PUYA 1G51A 1WOCA 3PIPA 3U58A 3HOVH 4DV2Q 3S1NH 4UP9A 1A62A 5IWAQ 1XNRL 2JA6H 1X54A 4YCVA 3M4OH 1AH9A 4R1JA 1X3FA 1X55A 2JEBI 3EBEA 4JBJA 3NEMA 4NXNL 1WFQA 1YJNA 1VQKA 1SFOH 3AFPA 5BR8Q 1KQSA 2HHHQ 4JI8Q 4AIMA 1NMGA 2C35B 4QJFA 3H3VH 4K0KQ 1K9MC 4DR3Q 1HR0W 2VQFQ 3E9HA 1BBWA 1HNXL 1OXUA 1QVGA 1YHQA 2IY5B 1QUQB 4JI8L 2LSSA 3CMEA 2EXDA 3ULPA 2JEAI 2UU9Q 5EAYA 1IXRA 1V9PA 3J7ZC 4DV1L 1JT8A 2VZAA 1Q1EA 2Q2TA 1BVSA 1U0LA 2ZM6L 2KCTA 3PO2G 1I94Q 3I4MG 2VQEQ 1VQLA 3CCLA 1SRUA 2JK8A 1J5EQ 3E0EA 2NN6I 1K3RA 2R7ZH 1J6QA 2UXDL 5JJLA 1G6PA 3S1MH 5DLQE 3CCMA 2XGTA 4P75A 4POGA 5M5XH 4GKJQ 1Q12A 1CUKA 5M3MH 1VQ5A 3B6YA 3KFUA 1A0IA 1E1TA 4LF8Q 4GNXC 4A3BG 4DK6C 3PO2H 4LF6L 3I4MH 3DM3A 4UP7A 4JBWA 4LF7Q 2YTYA 3F2BA 4HJAA 3F1ZA 1FJGQ 3TQYA 2ATWA 1E22A 1HZAA 2K5HA 2KCMA 3UE1A 4H02A 3WWVA 1VQEA 4A3DH 3J80i 3HOXG 4JI4Q 2K5VA 1VS0A 1PH6A 5C3EG 4DV6Q 3BZKA 5H1SE 1FJGL 3W5OA 4BA1I 4OX9Q 3PUWA 4GOPC 2K5NA 1VQPA 3NENA 3VDYA 4AQYQ 4YWLA 1Q7YC 4POFA 2IX1A 4B3ML 4JYAQ 2JA6G 2PI2A 5C44H 3GTGH 3K0XA 1UE6A 1BBUA 4DR5Q 1KXLA 4LFAL 3H15A 2R92H 3PIOA 3ERSX 3T1YQ 4JI1L 1YEZA 3CPWA 2UXBL 2JA7H 3PF5A 2UXCQ 3A74A 3RN5A 4LFBL 4A3GG 3KYHC 1I6HH 5AJ3L 1L2FA 4DV0L 4LF7L 3RN2A 1S40A 4LF6Q 1I50H 4DUZL 1S72A 1XMOQ 4GN5A 3GDEA 4LF9L 1NY4A 5C4JH 2JA5H 1QZGA 2YYZA 4R4CA 2HIVA 5LMUQ 3RR5A 4GOPA 1QVFA 1XNQQ 3HOWH 4DPGA 1NBWA 3TEHB 1UEBA 5M3FG 3U50C 4A3JG 4J15A 3S1RH 4L5TA 5HY6A 4DR4Q 3K7AH 3JAMi 4MNOA 4HIDA 1Q46A 4IPDA 1KRTA 1HZ9A 1VQDA 3K81C 5C0XI 2ID0A 2B29A 1I94L 1E1OA 1R9TH 4XTCS 5BR8L 4DR4L 4NXMQ 1D7QA 1WJJA 3AEVA 4P73A 4JOIA 4NXNQ 3TS0A 2AKWB 1QVCA 1WI5A 2N8NA 1IBLQ 2BH2A 2HT1A 4A3LH 4DV7L 5M5WH 3J81c 1EUJA 4QGUA 2CWPA 5LMNQ 1UWVA 4QIWE 4OO1G 5JJKA 4IPCA 1JMCA 2D0PA 4DR3L 5FJ8H 4DV0Q 3OW2A 4DUZQ 4KLKA 1YITA 1YIJA 2DUDA 1TWHH 1A63A 3M4PA 3E9IA 1OXVA 1NTGA 2A19A 3KF8B 1N36L 2N78A 4JI1Q 3G71A 1VQ7A 1ASZA 1T9HA 5IP9G 1XPOA 4JI5Q 4DUYQ 1KRSA 1K8AC 2UXBQ 3T1YL 1EOVA 4BXXG 4PG3A 4B3RL 3RNUA 3RZDH 1HZCA 2R7ZG 3RLOA 4Y7NH 2JQOA 2IT1A 4BY7H 1EFWA 4DR1L 1AE3A 3U4VA 5C44G 5GAEC 1Y1WG 1JE5A 1YI2A 3CCQA 4BA2I 4LF5L 1YNXA 4L5QA 2CKZB 3I2ZA 1C7YA 1N34L 1VQBA 4B3RQ 3BZCA 3G4SA 3CCEA 1PH4A 2BA1A 4X66L 1FGUA 5ELNA 1HNZL 1N33Q 1IBKL 1TWAH 3H0GH 1Q8KA 4JV5Q 4XIGS 1V43A 1CSQA 4OX9L 2AMCB 4IPHA 3W1BA 5IT9c 4A3KG 4X65L 5IP7H 1Q86C 4LUOA 4GKJL 5LMNW 4A3BH 3IRBA 1C9OA 4GKKQ 4LF4L 4DR6L 1HR0L 1XJVA 4OWWB 4P71A 1EYGA 5ELOA 2ZTEA 4QY7A 4UPAA 1VQ9A 1CSPA 3MEFA 1Q81C 4P74A 1TWGH 4DR2L 2ZJQA 4BY7G 3RLFA 4HIKA 3J81i 2ZM6Q 3STBC 3L0OA 2NN6G 4DV3Q 5LMNL 4GLXA 1VQMA 3S2HH 5IYBG 4DR7Q 4GNXB 4IJLA 5IYCG 1N36Q 1TWCH 4A76A 4JOIC 5M5YH 1NJIC 3L7ZC 2VY3A 3OYYA 5IP7G 3G6EA 4Y52H 5HGQA 2Z6KC 1EWIA 3HKSA 3T1HL 1HNXQ 4EQ5A 4X62L 3KDFA 2IX0A 1WYDA 3LGJA 2B63G 5C4XG 5IP9H 4IFDG 2MO1A 1I3QH 1UE5A 4A3KH 5LMUL 2NVYH 1SE8A 2K4KA 2UU9L 4IFDJ 3KJOA 4A3EG 4OWTB 3HOYH 1VQ4A 4KHZA 4GN4B 4JI3L 5GADC 1XMQQ 4X62Q 2E2JH 1JJ2A 1S3OA 1CKNA 3UE0A 3HOUH 1KL9A 2YTXA 1U5KA 4LUVA 5IYCH 4DR2Q 4K0KL 4NB3A 1YJWA 1L1OB 1Y1WH 5JJIA 3JC66 3A5ZB 1N32Q 2JE6I 2Z0SA 2I5MX 3M9BA 1X9NA 3GTMH 1YHAA 5IYDG 4YHHL 4AYBE 1ASYA 4DV5L 1M1KC 3BJUA 4BBSG 4LF9Q 4TQUS 3GTOH 1PYSB 4R4TA 4IOCA 2BH8A 4DR5L 1B70B 2F52A 3CP0A 5M3FH 1XNQL 3S14H 1OXSC 2R93H 4A3EH 3HOYG 1VCIA 2OQ0A 1Z9FA 1FL0A 2B3GA 2H5XA 2VS1A 3F8TA 3NBHB 4LFAQ 4LFCL 4GKKL 5C3EH 2ASBA 3HOUG 1CKNB 3I7FA 1IBMQ 2WFWA 2ES2A 3HOZG 1K73C 4P72A 5AJ3Q 4BY1H 1B8AA 1P16A 1MIUA 3HKZG 4A3CG 1VQAA 3FKIH 3HKZE 3CW2C 1K83H 3ER0A 2I5LX 1E7ZA 1KHIA 4GLVB 2GVBA 4A3MH 2NVQH 4DNIA 3M7NA 1X6OA 1YBYA 2KHJA 3CPFA 2UUCL 1PVOA 2QGQA 2PMZE 1L0WA 4LF5Q 2DGYA 3GTKH 1VQHA 2Q2HA 1CKMA 1FVIA 1X3EA 3K7UC 1N34Q 4GOPB 1VQIA 2WP8J 4A4IA 1LUZA 4DV6L 5IE8A 1C0AA 2PI2E 2HQLA 4HJ8A 2EQSA 2GVAA 4WJ4A 3PUXA 1PH8A 1MKHA 3FKIG 5E7NA 5GROA 4HIMA 4JI7Q 2B63H 4BBRG 2VNUD 1IZ6A 1KAWA 2KHIA 3HFZB 4LFCQ 2CFMA 4IO9A 1IBML 2YV5A 3H0GG 3EIVA 1PH9A 3I55A 4KHPQ 3F2CA 4QL5A 4R4QA 1Y14B 1B7YB 4JBKA 4QQBX 2RF4A 1EQRA 4HJ9A 4JI6L 4DV1Q 3GO5A 4LNQA 4JI0L 1Y1VH 1VQFA 1P8LA 2JA7G 1VQOA 4FDBA 1CKOA 1N32L 1M90C 2UXDQ 4DV5Q 3CXCA 3CC7A 4YHHQ 2RHQB 3GD7A 5IY0A 3GTLH 4DK3C 3UDGA 2I5HA 3L2PA 3A0JA 3OTOL 2UUAQ 1VQNA 2OTLA 2QA4A 2VUMH 3S17H 2PQAB 4GN3B 4NXML 4DV7Q 3TRZA 2VL6A 5IYBH 1X65A 2AHOB 1MJCA 3I4NG 1SMXA 1VQCA 2K52A 4YWMA 4AH6A 1XNRQ 1HZBA 2PQAA 3CQZH 3GTJH 2Q2IA 4A3JH 1RIPA 3GTPH 4LW1A 2PNHA 4A3FH 3JAMc 1EIYB 1LYLA 3KDFB 5JEAJ 4UY8C 1K0RA 2XTIA 2UUBQ 1VQ6A 4DR6Q 5FLXc 4O0AA 4JI2L 4A3CH 1PH3A 3DLLA 4B3SQ 3F2DA 4HJ7A 3G48A 2F4VQ 2AWNA 3KF6A 3W1GA 4MTNA 4DR7L 2F3IA 1XMOL 3CC2A 4LWCA 2K75A 3CCVA 1PH5A 3HOZH 4DV2L 2FXQA 2WB1E 3M3YH 4HIOA 1SN8A 4KI0A 3U4ZA 3UDXA 4APVA 3PUZA 1EIFA 3BU2A 3S1QH 3PO3G 1W3SA 2A1AA 2MQHA 3I4OA 2NZHA 2E5LL 2OTJA 2OWOA 2UUAL 4DKAC 3S15H 4LF4Q 4MZ9A 1Z47A 3J80c 3ICEA 1QUQA 3CD6A 1X3GA 4JI6Q 2GN5A 4WJ3M 1OTCA 3D0FA 1GKHA 2L15A 2Y0SE 2MO0A 2R7FA 1K8GA 4OXPA 4JCVE 4AQYL 4JBMA 2JA9A 3PUVA 1N33L 1E24A 3H3VI 3CMAA 4DAYB 1LTLA 4C3IH 1PHJA 4B3MQ 3SGIA 1OXTA 3PGZA 1N9WA 4A3IG 1E3PA 4DV4L 1Y1VG 2WAQG 4BY1G 3UDFA 1GO3E 3ULJA 1HJPA 2ZJPA 3RZOH 2I0QA 1YJ9A 4JI4L 3K80C 1G291 1IYJB 2OQKA 4X64Q 2HIXA 1L1OC 1DGSA 5FLMG 3KJPA 2BA0A 4LUZA 1Q82C 2JJQA 4HJ5A 1PV4A 3CC4A 4A3GH 2ZTCA 3I4NH 1KD1C 4DUYL 3D31A 3KOJA 1IBLL 5K36G 2AWOA 1WCMG 1GD7A 4R4IA 4PMWA 1IL2A 3KF6B 1UE1A 2LXKA 3HOWG 2E2HH 1PYBA 1X56A 5GQOA 1SR3A 4YCWA 4AYBG 2E8GA 4B3SL 2JA8G 2NVXH 1QZHA 4TVAB 2D62A 3HOXH 4L5SA 3CCRA 1A8VA 3FHWA 5FLMH 1HNWQ 1J5EL 1TXYA 3CCUA 1NMFA 1XMQL 3J7A5 1NE3A 2RHSB 2EIFA 5FJ8G 2ALYB 2NZOA 3M85A 4JI3Q 4PZ7A 4A93H 2VQFL 4C2MH 3J81j 4RMFA 4R4OA 1W2BA 5M3MG 2KENA 2CCZA 2R92G 3PV0A 5GAHC 3T1HQ 3GTQH 2IHEA 2E2IH 3OTOQ 4OWXB 2JA8H 3RLNA 1SLJA 2LXJA 2KBNA 3M4QA 4JG2A 4UP8A 1KC8C 4LFBQ 2R93G 1V1QA 1EQQA 4BXXH 2HHHL 5C0XJ 1WCMH 3PO3H 4OONA 1XTDA 3I56A 3HOVG 4X6AH 1PA6A 4YCUA 4DV3L 1SROA 4PZ8A 2Z6KA 4NPSA 3AQQA 2WAQE 4GNXA 4JI0Q 2RCNA 3FP9A 5IWAL 4A3IH 2Q2UA 3CAMA 3PSIA 1HNWL 4IFDI 3AYHB 2R7DA 2V1CC 1LM0A 2VW9A 2CQOA 5C4XH 4A3MG 4X64L 1UE7A 1OXXK 4JC0A 1JB7A 4DAMA 2N3SA 3A5UA 4C3HH 4X65Q 3NELA 3ZJYC 1HR0Q 4A3LG 4JI7L 1HH2P 1RL2A 1AE2A 4IPGA 2UXCL 3MXNB 4IJHA 5JEAG 1PH7A 3CCSA 1PFSA 1YZ6A 4EX5A 4KHPL 1PH1A 4DV4Q 3KLWA 4PZ6A 4A75A 3EN2A 4A3FG 1L1OA 2VUMG 4JYAL 3UDIA 5C0XG 1IBKQ 1XPUA 1O7IA 3STBD 4JV5L 4X66Q 2ZJRA 4LF8L 4O2DA 4BBSH 5GAGC 3S16H 4YY3L 4B3TL 3PF4A 5IYDH 1JJGA 4ALPA 3Q8DA 2R6GA 3S24A 4C3JH 3TREA 2YTVA 3PCOB 3ULLA 1KIXA 4L5RC 2D0OA 2A8VA 3CF5A 2Y0SG 4DR1Q 4OO1I 2K50A 4YY3Q 2K14A 4B3TQ 1YHBA 2UUCQ 1D8LA 1PH2A 2N49A 3AFQA 1N8RC 3TS2A 4A3DG 1VQ8A 2OCEA 2ZTDA 1GVPA 1HNZQ 4ME3A 1BKBA 1TWFH 2MNAA 3CCJA 1XPRA 2E5LQ 3S2DH 4A93G 1VQGA 2JA5G 4JI5L 4YWKA 1JJCB 1VQJA 2MFIA 4IOAA 1H95A 2CWAA 4GLAC 2NVTH 1I5FA 3K8AA 4GS3A 4JI2Q 1GM5A 2UUBL 2WB1G 2IHFA 2F4VL 2QEXA 5J3BA 1MJEA 4RG1A 1Q1BA 4BBRH 2VQEL 2YU9H
chains in the Genus database with same CATH superfamily
1YVCA 1C4QA 1G51A 1WOCA 2SEBD 1BUVT 3HGBA 2Q8IB 3PIPA 4DV2Q 5T1GA 5C4JB 1A62A 3NSWA 3MHBA 2JA6H 1X3FA 1JICA 3EBEA 1BCPC 3NEMA 1SYEA 3R2TA 1H9JA 2E2JB 1SE4A 3HOUB 2B2TA 1ENCA 5IGEA 4AIMA 3H3VH 1BQQT 2LMCB 1IHZA 1HR0W 2VQFQ 1EU3A 3ONAB 1QVGA 2IY5B 2WKDA 1ESFA 1F9QA 1CHQD 1V9PA 1JT8A 1Q1EA 1BVSA 3I70A 5CORA 3PO2G 4HMIA 3K58A 5HURA 3E0EA 1L0YB 2NN6I 1J5EQ 1J6QA 5DLQE 4C3JG 2O5JC 4P75A 3LWEA 4POGA 5M5XH 2B2VC 4KHVA 3KLRA 2F0QA 2OT2A 3DM3A 4UP7A 4JBWA 1FJGQ 2F4IA 1CT1D 4G7OC 2K5HA 2KCMA 3E0JA 4H02A 3S16B 4A3DH 3HOXG 3RZDB 1RCVD 1XX8A 2DJGC 5C3EG 4DV6Q 2K05A 5FO8B 1GUTA 3VDYA 4AQYQ 4UHVA 2IX1A 1WD1A 2JA6G 1EY4A 2PI2A 1CQFA 2NN6H 3K0XA 1KXLA 4IQZA 4LFAL 2E76C 3K6OA 3KK7A 2R92H 1KTKA 2UXBL 2RDGA 3PF5A 1Z7TA 2UXCQ 3A74A 2NUCA 4DV0L 5EQ0A 3RN2A 1V1OA 4LF6Q 2K5QA 4DUZL 3V05A 1FR3A 3IAYA 3GDEA 4GOPA 2HIVA 1QVFA 3HOWH 3TEHB 3GTJB 1DJRD 3J81E 4A3JB 4J15A 2NVXB 5HY6A 3K7AH 3HOXB 4MNOA 3A8IE 4IPDA 5G3LF 3T51B 2K6AA 2B29A 1E1OA 1O7ZA 2O5IC 4P73A 4NXNQ 5IGCA 2WACA 4C2MB 2BH2A 1GHKA 4OEMB 4DV7L 4NDXA 1EUJA 3CRLC 3LX0A 1Q3LA 1UWVA 4PNYA 1JMCA 1Y1WB 5FJ8H 3SVMA 3M4PA 1CFMA 2A19A 3KF8B 3G71A 3I72A 4RKBA 1T9HA 5IP9G 4TRDA 1H9RA 2KHSA 3T1YL 3J7AF 3GTOB 3K5LA 3IFDA 4QB4A 5C5LA 1EFWA 3HP3A 5ELBA 2H4OA 3Q0AA 2F0VA 5GAEC 1Y1WG 1JE5A 4QIWB 3I2ZA 3D8GA 1AP0A 2QEJC 1HNZL 1TWAH 1FD7D 4NMZA 5IT9c 1RTOA 2HQEA 1I4XA 4ABNA 4JW0A 5LMNW 4A3BH 5EJWA 4GKKQ 4LF4L 4P71A 2IW3A 5ELOA 4QY7A 4CDDC 1KABA 3MEFA 3NTKA 1TWGH 3V96A 2ENBA 4DR2L 4DV3Q 3BS1A 2LKVA 4R9WA 2H1EA 1VQMA 3GQBA 5IYBG 3R2IA 4IJLA 2B2TC 2BDOA 2F0TA 2Y0SB 1TY2A 5EPJA 3T1HL 1ICFB 1E2VA 3KDFA 2IX0A 4K8JA 1WYDA 3V2TA 5C4XG 3L9AX 1I3QH 2MHVA 1SE8A 3KJOA 2ZXPA 3TP5A 3NWSA 2EZVA 5GADC 4X62Q 1SFOB 1VF7A 4A3FB 1JWUD 1KL9A 2YTXA 1U5KA 5M5WB 4NB3A 3EQLC 5C0XH 2J7ZA 3JC66 5JJIA 3M9BA 3GTMH 4ILWA 5JJZA 4DV5L 3M3YB 4IOCA 4DR5L 1B70B 2F52A 1FYCA 3IL8A 3KLSX 3TP6A 1PFMA 4HMJA 5C3EH 2WFWA 1NUCA 5C5MA 2K33A 1CZWA 3HKZE 3CW2C 1K83H 5M3MB 4HN7A 2I5LX 2NVQH 3HS0C 1ILPA 1X6OA 2V4DA 1PVOA 2UUCL 1JOOA 1HFGA 1F2LA 3EVQA 1L0WA 1O7YA 4RGTA 1X3EA 3K7UC 3R93A 5E4XA 1LUZA 4DV6L 1II3A 3GTLB 5IE8A 4ZLTF 2PI2E 4HJ8A 2GVAA 3DHQA 4KN4C 4FF1A 3FKIG 4HIMA 5GROA 2B63H 5KYLA 2YV5A 4XDXA 3I55A 3F2CA 4QL5A 1S4ZA 2RSOA 4RFBA 3W3AA 4LNQA 1K0SA 1VQFA 1P8LA 1D5MC 2UXDQ 3RMHA 5AFWA 3OPOA 4HAEA 5IY0A 1VQNA 3A0JA 1BCPD 4CDEC 4GN3B 4DV7Q 1X65A 1QE6A 1SXTA 2X6LA 2PQAA 1SNDA 3CQZH 1WTPA 1EIYB 2F0NA 3JAMc 3J80L 5LL6S 2XTIA 2L11A 3SDZA 5FLXc 3MA2B 4JI2L 1TU2B 1Y69U 4B3SQ 2F4VQ 3BG3A 3CC2A 1PH5A 2FXQA 2WB1E 3NTIA 2PO4A 2A68D 2EPBA 4F8MA 3I4OA 4OIKA 3I73A 4LF4Q 1WTRA 4H13C 2MPMA 1QUQA 2BE5C 2Y0SE 2R7FA 2XRQD 3C46A 3H3VI 4DAYB 2Q8RE 3EA6A 2NBFA 2Z9HA 4QF4A 4A3IG 1ONLA 2L1BA 4FXDA 3RZOH 2A69C 2I0QA 4JI4L 1G291 1B50A 4X64Q 5I9PA 1L1OC 1JE4A 4KKSA 4LUZA 1ILQA 2RKSA 2ZTCA 4DUYL 3D31A 2A6EC 1HA5A 4CHTB 1IBLL 4C3IB 4R4IA 2E2HH 1PYBA 4KD3A 3KF8A 4YCWA 4S3SA 4EQPA 2E74C 4TVAB 1ZYRC 4L5SA 4BBRB 5C4ZA 3FHWA 4FNFA 1HNWQ 1J5EL 1GJXA 5D65A 4ZAIA 2MJ8A 2ALYB 1LT4D 4XQJA 2YU9B 2J4XA 4JI3Q 1TS3A 4A93H 1CA5A 1VMPA 3PV0A 3T1HQ 2XWJB 2E2IH 2RA4A 1HQMC 2JN4A 3RLNA 3VYUA 3CKIB 1TWHB 4UP8A 3HOZB 3OIQA 4FP5D 1V1QA 2HHHL 1SNQA 3PO3H 1XTDA 4CDFC 4YCUA 1A6XA 2WAQE 1CK1A 4GNXA 2RCNA 5IWAL 2Q2UA 1EEID 1SAPA 4IFDI 4XXEA 3AYHB 5J1ZA 1TR5A 2CQOA 1UNSA 5C4XH 5BN4A 1UE7A 4JC0A 4C3HH 3NELA 4A3LG 2BCOA 4JI7L 1HH2P 1AE2A 5A2QE 1PH7A 3IKJA 4A3EB 2BDNA 4RGNA 5JOBA 3PIO3 1L1OA 1WTXA 5C0XG 1GXDC 1VDZA 1O7IA 2F0JA 3BDCA 3STBD 4X66Q 4IN3A 1T5EA 1QOHA 4YY3L 3PF4A 1JJGA 4ALPA 1CTMA 3KUPA 3ULLA 5I9OA 2FINB 2Y0SG 4ME5A 2BOSA 5EPLA 2UUCQ 1PH2A 1IKLA 3M4OB 1VQ8A 1EY6A 1HNZQ 3CCJA 1BKBA 1TWFH 2AUJD 4A93G 1EWCA 2KEDA 3F2UA 3U9OA 2UUBL 2WB1G 2F4VL 2R92B 3D6WA 4XQNA 3S1NH 2IJ0A 4UP9A 4YCVA 1EY5A 1AH9A 4JBJA 1O78A 1IYUA 3AFPA 4JI8Q 1SMYC 2C35B 1WCMB 4X3SA 4QJFA 2R3ZA 3DUZA 3HOWB 1K9MC 4HEDA 1WTHA 3URYA 3K0YA 1BBWA 1YHQA 4JI8L 2LSSA 3ULPA 2UU9Q 1IXRA 1HQRD 2VZAA 2Q2TA 1JCKB 1SNCA 3I4MG 2VQEQ 1VQLA 1CI3M 3GTPB 1SRUA 5IOCA 2JK8A 2PW5A 2MGSA 2SNMA 4GKJQ 3AB9A 2KCNA 1ZEQX 3KFUA 3QG1A 1MSGA 4B9XA 3K5NA 4GNXC 2WIIB 3PO2H 1JR0D 4OL7A 4LF6L 3I4MH 1EYAA 3NHHA 1LTID 2NWGA 2YTYA 4HJAA 3F1ZA 3S15B 3TQYA 2ATWA 1K28A 4FVMA 3KBXA 3J80i 4QMGA 3GV3A 1HFNA 3S1MB 1VS0A 2FMCA 3W5OA 5BN3A 1OO9B 3PUWA 1FJGL 1VQPA 3M4YA 3NENA 2F1MA 1ENFA 4YWLA 4PMBA 3NBHA 3VYRA 5C44H 3GTGH 3NWTA 1PDQA 3PIOA 4JI1L 1YEZA 2ZXOA 2CVRA 2XRSD 2EYLA 4TKOB 5FK9C 1C48A 2NVTB 3MZ5A 1U4MA 1GUSA 5AJ3L 3I3CA 1EL0A 3OIPA 2IWHA 2F0FA 3O13A 1S72A 1E2WA 4LF9L 5C4JH 5C3WA 1QZGA 2JA6B 4R4CA 3RR5A 1EYDA 2D2CC 2LY7A 4HIDA 1KRTA 3K5OA 3FVQA 1HZ9A 1VQDA 1Z6HA 3K81C 1TS4A 4KY5A 1I6HB 1R9TH 2C9OA 4UDUC 4MIUA 4NXMQ 4M1UB 2N8NA 4XQQA 2L0CA 5LMNQ 2CWPA 4OO1G 1WTVA 4DR3L 5TSSA 4DUZQ 1XWEA 1YIJA 3E9IA 1D6EC 1LT3D 5DAUA 1N36L 4K2KA 4I7AA 2B8FA 1EEFD 3H3VC 5E3FA 2CW0C 2UXBQ 1G91A 3DMUA 5IT9E 1TQOA 3RLOA 4Y7NH 2IT1A 2A6HC 1AE3A 3U4VA 1HHVA 1YI2A 4IUPA 4CJ1B 1C7YA 2AQ2B 1VQBA 4DNTB 4B3RQ 3BZCA 3G4SA 1W6KA 4KV6A 1TVXA 4X66L 1N33Q 1LABA 1M4VA 3I4NB 1Q8KA 4XIGS 1CSQA 4OX9L 2AMCB 4IPHA 3W1BA 5M9OA 4X65L 1JWMD 2OF1A 1Y8PB 2EYPA 5CYUA 1RHPA 1C9OA 4ZCKA 4K6DA 3C3LA 2AQ3B 1EFID 3D6CA 1A3VA 5FKAC 3J81i 3STBC 3L0OA 4GLXA 1QWYA 4IURA 2B63B 3JAME 1PTOC 3T13A 1PRTC 1N36Q 4KTAA 5M5YH 3L7ZC 1NJIC 2Z6KC 3HZXA 5KNBA 3HKSA 5I2XA 3S17B 5KRUA 4X62L 1B2TA 2B63G 2LFNA 2OXPA 2NVYH 1O80A 4IFDJ 3P1HA 4JI3L 4GN4B 1XMQQ 4OIJA 3DM1A 1S3OA 3DWAA 1WTWA 4FO2A 3D4DA 1FNVA 4LUVA 2WAQB 3L3OC 4BY1B 3QJYA 1Y1WH 3ND9A 3A5ZB 2JE6I 2Z0SA 2RSNA 4F88A 4YHHL 1GOZA 4AYBE 1G2SA 1M1KC 2DY7A 5J22A 3S14H 1PTOH 1W6JA 1OXSC 4J6HA 3HOYB 4KD4A 1Z9FA 3I90A 2B3GA 3F8TA 1SYCA 2EYHA 4LFAQ 4LFCL 3TMEA 4GKKL 5EKKA 2ASBA 3HOUG 4BBSB 3I7FA 2XN9C 3I8ZA 2R7ZB 4IZ8A 4P72A 1B8AA 1P16A 1MIUA 3HKZG 3GV6A 4HCEA 1E7ZA 4A3MH 5CV6A 5ELFA 1F77A 2WKCA 1EU4A 4OO1H 3CPFA 2PMZE 2Q2HA 3H91A 2TMPA 3M7GA 1EZ8A 1BF4A 1C0AA 1BCPB 3BYYB 4XT3B 1PH8A 5E7NA 3FKIB 2VNUD 2KHIA 3HFZB 3VR6A 1WVLA 3EIVA 4AYBB 4OHJA 3EROA 4KHPQ 4R4QA 3C1EA 1H9SB 1Y14B 4JBKA 2RF4A 2F3VA 4JI6L 2JA7G 4JI0L 2KA7A 4FDBA 1CKOA 2F0MA 4F87A 4DV5Q 1B3QA 3CXCA 1LTBD 3WOEA 3GD7A 5IT9L 3UDGA 2I5HA 2UUAQ 4JVZA 3CRKC 1I50B 4KJNA 2EY5A 4B08A 3D4RA 3TRZA 3FPUB 2VL6A 4HSVA 1SMXA 2K52A 4YWMA 3S1QB 2KQ3A 1XNRQ 1QILA 2PNRC 1BCPF 2Q2IA 1RJTA 4A3FH 1VQ6A 5JEAJ 2G9HD 1K0RA 4O0AA 4V190 4A3CH 1X32A 1PH3A 1IW7C 3F2DA 5D3DA 3C1FA 3GP7A 4LMQD 2AWNA 1PRTF 2F3IA 3HOZH 4ULLA 3CCVA 2Z1CA 1ICWA 3M3YH 4HIOA 1ESRA 1MI2A 4MHEA 1MBYA 1W3SA 2A1AA 1G6ZA 4MZ9A 1SNOA 3SK6A 1STAA 2B2WA 1IYVA 4GZYC 3JAML 3J80c 3CD6A 1MSHA 2G5DA 3T56B 4KMUC 2NTSA 1GKHA 3KBGA 4C3HB 1N33L 1E24A 3CMAA 1V1PA 3I91A 3SGIA 5IGDA 3PGZA 3LWUA 4DV4L 3FMCA 2WAQG 4BY1G 2NZ1D 5BN5A 1IKMA 2NTTA 1PRTB 2A5HA 3DWQA 4FF2A 3NTHA 2OQKA 2QF7A 3T16A 2HIXA 3OW7A 5FLMG 3KJPA 2BA0A 1TS2A 1GUGA 1Q82C 1PV4A 4A3GH 3S2DB 1B1ZA 3D3RA 3H0GB 3KOJA 5K36G 2E2DC 1TIID 1BOSA 3KF6B 4RCNA 5ELCA 2EE1A 3HOWG 2K5DA 3TZUA 1SR3A 1HPCA 4B3SL 2NVXH 2JA8G 2R61A 4Q0FA 1H9SA 1QZHA 3HOXH 1QB5D 1TXYA 1TT2A 1EZ6A 2QKIC 2P5ZX 1XMQL 3J7A5 2EIFA 3H94A 1A2TA 4PZ7A 4C2MH 5IODA 4G57A 2R92G 4N8X1 2PPBC 3GTQH 4WJWA 1QNKA 3OTOQ 2LXJA 3M4QA 3Q24A 2PZTA 4JG2A 1EQQA 4RKLA 1WCMH 4WRDA 4X6AH 3J7AV 1SROA 4LAAA 2Z6KA 4PZ8A 4NPSA 1G2TA 1DM0B 3NP8A 4A3IH 2V1CC 4IFDH 1LM0A 1M8AA 1LLRD 2VW9A 1A3UA 4A3MG 4X64L 1OXXK 1TKWB 2N3SA 4KY7A 4X65Q 3ZJYC 2IX3A 3EFXD 4IPGA 1ET9A 3TBIB 5JEAG 1MHWC 4KN7C 1YZ6A 4J8QA 5CV4A 3VYSA 3VR3A 3KLWA 4A75A 5C3XA 2VUMG 1TWAB 1IBKQ 2VB3X 3P75A 1XPUA 4JV5L 1U4LA 2DY8A 2R6GA 3S24A 3TREA 3PCOB 1KIXA 2D0OA 4CJ2C 1DOMA 4OO1I 2K50A 4WORA 3QWNA 4YY3Q 1B9NA 1YHBA 5LHY1 4RHRA 1N8RC 3S9WA 1ET6A 1DXMA 4ME3A 1XPRA 3X3MA 1EY0A 3GTKB 2JA5G 1IW7D 1JB3A 1VQJA 3SR1A 1F9SA 1UEAB 3G7LA 2CWAA 3NPPA 4GS3A 4JI2Q 1V8QA 2DN8A 5CMDA 5COYA 2JXMB 4RG1A 1Q1BA 1PZJD 4BBRH 2VQEL 4A3GG 2L9HA 3HOVH 1F2YA 4V0BA 2JA5B 4IUNA 5IWAQ 1LTAD 1SYGA 1SE3A 2I46A 4K14A 4R1JA 2JEBI 2JA8B 4NXNL 2F0UA 1YJNA 3A54A 1SFOH 5BR8Q 2HHHQ 4DR3Q 5DM73 1HTLD 3E9HA 1B9MA 4RAUC 1B3AA 3ERQA 1STHA 2JEAI 3PO3B 1Y8NB 5EAYA 3J7ZC 4DV1L 2ZM6L 1S5DD 1I94Q 2F3WA 5IGFA 4ZK9B 2VXWA 2RBMA 5JJLA 1NR4A 1K3RA 1G6PA 3TP8A 2NYZD 2EDGA 5C4XB 3CCMA 2XGTA 1S5BD 1Q12A 1K83B 5M3MH 1VQ5A 1A0IA 2NVQB 2DJFC 1BNZA 2F0GA 1EQVA 1GUWA 4DK6C 1LTTD 4J1MA 1EQTA 3QOJA 4LF7Q 3FRPB 1PMRA 1HZAA 3UE1A 2Z4IA 3WWVA 4JI4Q 4ZQ3A 1JOQA 2K5VA 4H7BA 1UAPA 5H1SE 4BA1I 4OX9Q 1HA6A 2F0LA 4B3ML 1TS5A 4ZRZA 1UE6A 2N55A 1BBUA 5FO9B 5I6WA 3Q23A 4DR5Q 1R4QB 1TWFB 3H15A 4ID6A 4R8NA 2JA7H 2K03A 2CW0D 2XSCA 1B4OA 1KAAA 4LFBL 3KYHC 3OMCA 5F2DA 1KNAA 1CM9A 4IALA 1AW7A 1LTGD 1S40A 3S2HB 4CJ0B 1EYCA 4ZKCB 4GN5A 2QILA 5CBEE 4FXKC 3S1NB 1NY4A 4PV1C 2YYZA 5LMUQ 5CC4A 2PZUA 1XNQQ 4DPGA 1NBWA 1UEBA 5M3FG 1SBBB 1SMYD 2HDMA 3BZDB 3S1RH 2KCCA 1H9MA 4DR4Q 3JAMi 2FMMA 1PTOF 3E5SA 5C0XI 2ID0A 3BVZA 4XTCS 1J8IA 5BR8L 2B2UA 1D7QA 5IGGA 1WJJA 2Z8LA 4JOIA 4A3LH 1STEA 3CHBD 4C3HG 4UAIA 3NUCA 4QGUA 5ELEA 2D0PA 4DV0Q 3OW2A 4KLKA 1YITA 2DUDA 4NW2A 1EIHA 1A63A 1NTGA 2N78A 2R93B 1VQ7A 1XPOA 4JI5Q 4DUYQ 1K8AC 1LT6D 3VYTA 5L37A 4PG3A 3RNUA 4HCSA 2R7ZG 2JQOA 4BY7H 1NAPA 2RCFA 1BXTA 5C44G 1JOKA 2IPKD 5C6AA 4X3KA 1I4QA 2CKZB 4BWGB 4DGZA 1N34L 1LTSD 1VF5C 4DAPA 2BA1A 1FGUA 1IBKL 4JV5Q 2KJXA 4O1NA 2G9DA 1BO0A 4A3KG 1PFNA 2QDLA 5IP7H 3PQIA 4LUOA 4DR6L 4OGQC 1HR0L 1XJVA 4DFAA 1EYGA 2K28A 2ZTEA 4UPAA 1CSPA 1Q81C 4P74A 2ZJQA 4BY7G 4HIKA 2FJ2A 2ZM6Q 3NQIA 5LMNL 3Q6SA 4DR7Q 3NBIA 3Q22A 2NB0A 2A68C 1TWCH 3E3XA 4JOIC 3D4WA 5IP7G 3G6EA 1SNPA 5HGQA 3SXHA 1YNNC 1HNXQ 4EQ5A 4HR7B 1BBXC 2WV6D 1BDOA 3LGJA 4H0LC 5IP9H 3OHXC 2FHTA 1UE5A 3SK8A 5LMUL 1TWGB 2UU9L 1Y8OB 4KHZA 2E2JH 2WB1B 4IUTA 3HOUH 4BS9A 2VUMB 4I7ZC 3SEBA 2M00A 5IYCH 4K0KL 3WDNA 1YJWA 5CGKA 1L1OB 4XYQA 2WINB 4RH6A 1SYDA 1F2MA 2EY2A 2I5MX 1I6VC 1YHAA 5IYDG 1ASYA 4BBSG 4LF9Q 1AZPA 1PYSB 3H09A 2BH8A 1XNQL 2JYOA 2TSSA 5M3FH 2DNCA 4A3EH 3HOYG 1VCIA 3K57A 2OQ0A 1FL0A 1J9OA 3P20A 2XWBB 4RCOA 1IBMQ 2ES2A 2ICIA 5EBDA 5LL6X 4G7HC 1K73C 5IGBA 5M5XB 5A35A 1ZYRD 3QB3A 4GLVB 1KHIA 2GVBA 5G3LD 2L4NA 5KIXA 3BVMA 1LTRD 1YBYA 2KHJA 4JPBW 4XT1B 1SNMA 5EKLA 2QGQA 4LF5Q 4DAYA 1FNUA 1VQHA 3SE0A 1FVIA 1N34Q 4GOPB 1VQIA 2WP8J 2PMZB 4A3DB 4ZUIA 1XXGA 2B39A 4MTKA 4WJ4A 3PUXA 4JI7Q 4EQNA 5CR3A 2CFMA 4IO9A 3H0GG 3VA7A 2F0HA 1PYWD 5D3IB 4QQBX 3EJIA 2EVBA 4KK7A 4HJ9A 1CHPD 1ML0D 2OEOA 1NNXA 5ELDA 1YNND 3CC7A 4YHHQ 3AMUA 4A3KB 3GTLH 4QUCA 2SDFA 1U4PA 3L2PA 3OTOL 2OTLA 2QA4A 4K5WA 4RA8A 4R8IA 3S17H 2B8GA 4NXML 3VR4A 4IUQA 2AHOB 3I4NG 2NVYB 4AH6A 1HZBA 2RQXA 3GTJH 4N9PA 4A3JH 2IL8A 4EGVA 1RIPA 3GTPH 2PNHA 1QG7A 4K8IA 4UY8C 5DNFA 5EPKA 4N9TA 3DLLA 3G48A 1G8ZD 3H6MA 3KF6A 4MTNA 4DR7L 1XMOL 4LWCA 4CDCC 1K8MA 2A74C 3PUZA 1EIFA 3BU2A 3PO3G 2HDLA 2MQHA 2E5LL 2NZHA 5DEHA 3S15H 4MN3A 1Z47A 4A3IB 1L0XB 3BYTB 5JVH3 5A2QL 3OWEB 2F0IA 2GN5A 3SK5A 1OTCA 3FEWX 4OXPA 2JA9A 3NE5B 5ISRA 4C3IH 4B3MQ 1GHJA 2RVLA 3FDTA 3QOLA 2J0TD 1N9WA 4B9WA 3UDFA 1HJPA 1SSOA 1YJ9A 4G4KA 2F0OA 1IYJB 4A93B 3R8BA 3MAQA 4IUUA 1BR9A 2EXZA 1KD1C 1Y1VB 4KKUA 2AWOA 2K1BA 1WCMG 4PMWA 1IL2A 4I65A 1UE1A 1X56A 5GQOA 4AYBG 4A3BB 3TN2A 3DEPA 1WTOA 2Z6BA 3A8JE 4ZKBB 1A8VA 3J80E 5FLMH 1KDAA 1EY8A 4HTHA 3CCUA 3MXPA 4KKTA 2GA4B 1NE3A 1PXUA 2DNEA 2NZOA 3M85A 1SEBD 2QDBA 4EQOA 3I4LA 2F0WA 2MP1A 1W2BA 5I4DA 2CCZA 1STYA 5GAHC 4U68A 2E2HB 4OWXB 2JA8H 1SLJA 2KBNA 1KC8C 5DM63 1S5ED 5C0XJ 1CA6A 2HCIA 4OONA 1QJOA 5E1FA 5JEAH 1PA6A 4DV3L 1SDFA 1A2UA 4CBVA 3AQQA 2X6GA 3FP9A 3PSIA 4H44C 1HNWL 5K5PA 1T5XD 2L12A 1CQVA 2PZWA 1JB7A 4K2LA 1F9PA 4DAMA 2D9UA 3GTMB 4DA2A 4X3TA 3CCSA 2PCFB 1PH1A 3EN2A 3UDIA 2BE5D 4LF8L 1KLGD 3S16H 4B3TL 5FLXL 1YNJC 2A6HD 2XNAC 4QUFA 3VR5A 2YTVA 4K5VA 2F0KA 2LS01 5CV9A 3CF5A 2A8VA 4DXFA 4DR1Q 4FF4A 2K14A 1CZGA 1D8LA 2N49A 2OCEA 2ZTDA 1GVPA 1NSNS 3MXGA 2E5LQ 2MNAA 3R3OA 3S2DH 4A3GB 1VQGA 1DYQA 4YWKA 1JJCB 3G6JB 1DONA 1MGSA 4IOAA 1H95A 1I5FA 3K8AA 3P7JA 1GM5A 5HGTA 3HEJA 1MJEA 4IUVA 3A55A 3PUYA 5CV7A 1RDPD 3U58A 5T1IA 1XNRL 3AU7A 1X54A 1GUOA 3M4OH 4CKEA 2KVMA 4OELB 1X3QA 1X55A 3MC0B 1WFQA 1VQKA 3HG9A 1KQSA 1I4HA 1NMGA 3TDQA 4ZUJA 3W2DA 2F0PA 2Z4HA 4K0KQ 3S1RB 4DK1A 2JP1A 2O4XA 1HNXL 1GUNA 1OXUA 1QUQB 1LV9A 3RUZA 3CMEA 3TZDA 3SK4A 2EXDA 1PTOB 3HRZC 3RD4A 1U0LA 2AUKA 2KCTA 3C2PA 2FFKB 3CCLA 3HKZB 1WD0A 2O2LD 2R7ZH 2UXDL 3S1MH 1I4PA 1YNJD 2XVSA 1CUKA 4DF7A 1SYFA 3B6YA 4A3MB 1E1TA 4FXGC 4LF8Q 4A3BG 4LJZC 4RHSA 4C3JB 1C8CA 3F2BA 5JAVA 5KEEA 1E22A 5IIFA 1EIGA 1VQEA 2K5WA 1PH6A 3A7AB 4BY7B 3BZKA 5KNCA 4G7ZC 3A7LA 4GOPC 2K5NA 1RODA 1Q7YC 4JYAQ 4POFA 3K5MA 2CH4W 1JC7A 1SJED 2C5CA 5E4WC 3OSOA 1HUNA 3ERSX 3T1YQ 3CPWA 3A8KE 5JPMC 1K3BC 1SE2A 2EY6A 3RN5A 2CH4A 2MUYA 1I6HH 1L2FA 4JK1C 4LF7L 3WOFA 1I50H 2Q8TA 1XMOQ 5C44B 3GTGB 2JA5H 2HCCA 2PYKA 4PMCA 4E6IA 1MD2D 3DEOA 3SHLA 1EOTA 1TY0A 1K8OA 2HD3A 3U50C 4A3JG 4L5TA 2AQ1B 1PZKD 5KGUA 4RGOS 1Q46A 1O7LA 1I94L 5NUCA 2JSOA 1RF2D 4DR4L 3AEVA 5D14A 3K59A 3TS0A 2AKWB 1QVCA 1WI5A 3QR8A 1IBLQ 2HT1A 1QNUA 5I6YA 1JQYD 5M5WH 3J81c 4Y7NB 1A3TA 5JJKA 4QIWE 4IPCA 2E2IB 1TWHH 4YIJA 1S5CD 2B2YC 4X3UA 1OXVA 2EYFA 3BVGA 4JI1Q 4CKBA 1R9TB 1ASZA 1KNEA 1KRSA 1EOVA 1NR2A 4BXXG 1E2ZA 4B3RL 3RZDH 1HZCA 4NP5A 5CBAE 3NK9A 2A6ED 5CV5A 1F2ZA 1PFBA 4DR1L 2CHBD 2F0EA 1HXYD 2ICEC 4ODGA 1EY9A 3CCQA 4BA2I 4LF5L 1YNXA 4L5QA 4CGYB 3MWYW 1F9RA 2A69D 3CCEA 1PH4A 1DD2A 5ELNA 3H0GH 2ZT9C 1HCZA 1B53A 1V43A 1H9KA 1ENAA 2B2UC 4P2CB 5M5YB 4WFN3 1Q86C 5FOBB 4GKJL 2K01A 1XYIA 2L5TA 3IRBA 2JA7B 2F03A 3BDOA 4OWWB 2SNSA 3MEHA 3X3NA 2B2YA 1VQ9A 4C1NK 1AZQA 4K6LA 3RLFA 2NN6G 3FPPA 3MXUA 4K5XA 3T4AC 3S2HH 1DCZA 3K7AB 4GNXB 1STGA 2KOLA 5IYCG 3PIP3 4A76A 2QCPX 2VY3A 3OYYA 3GTQB 3NXWA 4Y52H 1STNA 4M8AA 1EWIA 1RD9D 2K7VA 3OWFA 1AEXA 1WTQA 4IFDG 2EYOA 2MO1A 3MVVA 4U673 3BDLA 4A3KH 2K4KA 4A3EG 4OWTB 3HOYH 3CQZB 1VQ4A 1JJ2A 1CKNA 3UE0A 4Q5VA 3LNNA 1DOKA 3N6RA 1SYBA 4DR2Q 5C4HA 4C1NI 1N32Q 1Q8IA 2CQAA 1X9NA 5EGTA 4L8JA 3BJUA 3GTOH 2N88A 4TQUS 4R4TA 1X3PA 3CP0A 2R93H 3TSSA 2F0DA 4FF3A 2H5XA 2VS1A 3NBHB 2K04A 1I4RA 1CKNB 2M2LA 1EY7A 3HOZG 5FO7B 3NQTA 5AJ3Q 4BY1H 2ZXRA 4A3CG 1VQAA 2D5DA 3J7YW 3FKIH 2EJMA 3ER0A 4O42A 4DNIA 3M7NA 2KEEA 3S14B 4ZYSA 2QW7A 3GTKH 1FGBD 1Q90A 2DGYA 3OMGA 1CKMA 2SOBA 3RZOB 5JPNC 1KDCA 5EBCA 4A4IA 3TP7A 2HQLA 3PMFA 2EYJA 1PZID 2EQSA 1MKHA 4DN4M 4BBRG 1IZ6A 1KAWA 3HOVB 4LFCQ 1IBML 1A15A 1PH9A 3DXJC 4KY6A 4Z9CB 1DOLA 1LT5D 1B7YB 1ZKOA 4C3IG 1EQRA 4DV1Q 3GO5A 1Y1VH 1VQOA 2PW7A 1N32L 1M90C 1E0BA 1D1IA 1TWCB 2RHQB 1I3QB 5K36H 4DK3C 1D2BA 3MFGA 2A73B 2PQAB 2RDFA 1D5ZC 1PTOD 4RWSC 1HTPA 4FYDA 5IYBH 1MJCA 1VQCA 4KJOA 4NKLA 3J81L 2B2VA 1KLUD 1KDBA 1QCBD 1U4RA 3ND8A 4LW1A 2VUMH 1LYLA 3KDFB 4C56C 2UUBQ 2B2WC 4DR6Q 1AFPA 4HJ7A 3W1GA 2K75A 5C3EB 4DV2L 1NCVA 1SN8A 3VR2A 2L55A 4KI0A 1PRTD 3U4ZA 3UDXA 4APVA 5M3FB 3S1QH 3A56A 2OTJA 2OWOA 4DNRB 4DKAC 5JVG3 2UUAL 4L6TB 3ICEA 4EVOA 1X3GA 4JI6Q 4XYOA 4WJ3M 2L15A 3D0FA 3TS2A 1STBA 2MO0A 1K8GA 4JBMA 4JCVE 4AQYL 3PUVA 1V1PB 1LTLA 5J39A 1PHJA 1OXTA 4DK0A 5I2YA 1E3PA 2KUMA 1Y1VG 3ZYYX 1GO3E 1LO5D 3ULJA 3QO2A 1D1KA 2ZJPA 1RKNA 3K80C 1DGSA 2F0SA 2RDHA 1B44D 1UUPA 2JJQA 4HJ5A 2EJFC 3CC4A 2M9VA 4N8FA 3I4NH 3N52A 3VA5A 4QCLA 5CV8A 1GD7A 1FNWA 3ITPA 5EKIA 2LXKA 2XIWA 3MFYA 2E8GA 1I4GA 1PLFA 2D62A 1ZXTA 3CCRA 1HUMA 1EWHA 1NMFA 2RHSB 1U9RA 5FJ8G 3QIAA 4DU9A 2VQFL 1XTCD 4RMFA 4R4OA 3J81j 3MTSA 3OOCA 5M3MG 2KENA 2IHEA 1LACA 4LFBQ 2R93G 4BXXH 3MXNA 5FLXE 1S5FD 3CU7A 3I56A 2EJGC 3HOVG 4DXGA 1HRJA 4JI0Q 2VB2X 3CAMA 2R7DA 4CKCA 1IL8A 4LK1C 2KECA 3E6ZX 4PQXA 3A5UA 1D5XC 1HR0Q 2I07B 1RL2A 3T53B 2UXCL 3MXNB 4L63B 4IJHA 4F7XA 2EOTA 1PFSA 3PO2B 4EX5A 4KHPL 3I4MB 4DV4Q 4RGMA 2EY1A 4PZ6A 3UI2A 4A3FG 4JYAL 1DZ1A 2ZJRA 2E75C 2PQEA 4O2DA 5GAGC 4BBSH 5IYDH 3DWPA 3Q8DA 4DAVA 4C3JH 1RTNA 4L5RC 2HUGA 2EYMA 1AN8A 4B3TQ 3AFQA 4A3DG 1R4PB 1JWSD 1JORA 1SJHD 4TSSA 4JI5L 1VMCA 2MFIA 3U9SA 4GLAC 5KYIA 2NVTH 3KLSA 3IFTA 4HSPA 2IHFA 2QEXA 2X69A 5J3BA 2K32A 5KNDA 2YU9H
chains in the Genus database with same CATH topology
1YVCA 3PUYA 1G51A 1WOCA 3PIPA 3U58A 3HOVH 4DV2Q 3S1NH 4UP9A 1A62A 5IWAQ 1XNRL 2JA6H 1X54A 4YCVA 3M4OH 1AH9A 4R1JA 1X3FA 1X55A 2JEBI 3EBEA 4JBJA 3NEMA 4NXNL 1WFQA 1YJNA 1VQKA 1SFOH 3AFPA 5BR8Q 1KQSA 2HHHQ 4JI8Q 4AIMA 1NMGA 2C35B 4QJFA 3H3VH 4K0KQ 1K9MC 4DR3Q 1HR0W 2VQFQ 3E9HA 1BBWA 1HNXL 1OXUA 1QVGA 1YHQA 2IY5B 1QUQB 4JI8L 2LSSA 3CMEA 2EXDA 3ULPA 2JEAI 2UU9Q 5EAYA 1IXRA 1V9PA 3J7ZC 4DV1L 1JT8A 2VZAA 1Q1EA 2Q2TA 1BVSA 1U0LA 2ZM6L 2KCTA 3PO2G 1I94Q 3I4MG 2VQEQ 1VQLA 3CCLA 1SRUA 2JK8A 1J5EQ 3E0EA 2NN6I 1K3RA 2R7ZH 1J6QA 2UXDL 5JJLA 1G6PA 3S1MH 5DLQE 3CCMA 2XGTA 4P75A 4POGA 5M5XH 4GKJQ 1Q12A 1CUKA 5M3MH 1VQ5A 3B6YA 3KFUA 1A0IA 1E1TA 4LF8Q 4GNXC 4A3BG 4DK6C 3PO2H 4LF6L 3I4MH 3DM3A 4UP7A 4JBWA 4LF7Q 2YTYA 3F2BA 4HJAA 3F1ZA 1FJGQ 3TQYA 2ATWA 1E22A 1HZAA 2K5HA 2KCMA 3UE1A 4H02A 3WWVA 1VQEA 4A3DH 3J80i 3HOXG 4JI4Q 2K5VA 1VS0A 1PH6A 5C3EG 4DV6Q 3BZKA 5H1SE 1FJGL 3W5OA 4BA1I 4OX9Q 3PUWA 4GOPC 2K5NA 1VQPA 3NENA 3VDYA 4AQYQ 4YWLA 1Q7YC 4POFA 2IX1A 4B3ML 4JYAQ 2JA6G 2PI2A 5C44H 3GTGH 3K0XA 1UE6A 1BBUA 4DR5Q 1KXLA 4LFAL 3H15A 2R92H 3PIOA 3ERSX 3T1YQ 4JI1L 1YEZA 3CPWA 2UXBL 2JA7H 3PF5A 2UXCQ 3A74A 3RN5A 4LFBL 4A3GG 3KYHC 1I6HH 5AJ3L 1L2FA 4DV0L 4LF7L 3RN2A 1S40A 4LF6Q 1I50H 4DUZL 1S72A 1XMOQ 4GN5A 3GDEA 4LF9L 1NY4A 5C4JH 2JA5H 1QZGA 2YYZA 4R4CA 2HIVA 5LMUQ 3RR5A 4GOPA 1QVFA 1XNQQ 3HOWH 4DPGA 1NBWA 3TEHB 1UEBA 5M3FG 3U50C 4A3JG 4J15A 3S1RH 4L5TA 5HY6A 4DR4Q 3K7AH 3JAMi 4MNOA 4HIDA 1Q46A 4IPDA 1KRTA 1HZ9A 1VQDA 3K81C 5C0XI 2ID0A 2B29A 1I94L 1E1OA 1R9TH 4XTCS 5BR8L 4DR4L 4NXMQ 1D7QA 1WJJA 3AEVA 4P73A 4JOIA 4NXNQ 3TS0A 2AKWB 1QVCA 1WI5A 2N8NA 1IBLQ 2BH2A 2HT1A 4A3LH 4DV7L 5M5WH 3J81c 1EUJA 4QGUA 2CWPA 5LMNQ 1UWVA 4QIWE 4OO1G 5JJKA 4IPCA 1JMCA 2D0PA 4DR3L 5FJ8H 4DV0Q 3OW2A 4DUZQ 4KLKA 1YITA 1YIJA 2DUDA 1TWHH 1A63A 3M4PA 3E9IA 1OXVA 1NTGA 2A19A 3KF8B 1N36L 2N78A 4JI1Q 3G71A 1VQ7A 1ASZA 1T9HA 5IP9G 1XPOA 4JI5Q 4DUYQ 1KRSA 1K8AC 2UXBQ 3T1YL 1EOVA 4BXXG 4PG3A 4B3RL 3RNUA 3RZDH 1HZCA 2R7ZG 3RLOA 4Y7NH 2JQOA 2IT1A 4BY7H 1EFWA 4DR1L 1AE3A 3U4VA 5C44G 5GAEC 1Y1WG 1JE5A 1YI2A 3CCQA 4BA2I 4LF5L 1YNXA 4L5QA 2CKZB 3I2ZA 1C7YA 1N34L 1VQBA 4B3RQ 3BZCA 3G4SA 3CCEA 1PH4A 2BA1A 4X66L 1FGUA 5ELNA 1HNZL 1N33Q 1IBKL 1TWAH 3H0GH 1Q8KA 4JV5Q 4XIGS 1V43A 1CSQA 4OX9L 2AMCB 4IPHA 3W1BA 5IT9c 4A3KG 4X65L 5IP7H 1Q86C 4LUOA 4GKJL 5LMNW 4A3BH 3IRBA 1C9OA 4GKKQ 4LF4L 4DR6L 1HR0L 1XJVA 4OWWB 4P71A 1EYGA 5ELOA 2ZTEA 4QY7A 4UPAA 1VQ9A 1CSPA 3MEFA 1Q81C 4P74A 1TWGH 4DR2L 2ZJQA 4BY7G 3RLFA 4HIKA 3J81i 2ZM6Q 3STBC 3L0OA 2NN6G 4DV3Q 5LMNL 4GLXA 1VQMA 3S2HH 5IYBG 4DR7Q 4GNXB 4IJLA 5IYCG 1N36Q 1TWCH 4A76A 4JOIC 5M5YH 1NJIC 3L7ZC 2VY3A 3OYYA 5IP7G 3G6EA 4Y52H 5HGQA 2Z6KC 1EWIA 3HKSA 3T1HL 1HNXQ 4EQ5A 4X62L 3KDFA 2IX0A 1WYDA 3LGJA 2B63G 5C4XG 5IP9H 4IFDG 2MO1A 1I3QH 1UE5A 4A3KH 5LMUL 2NVYH 1SE8A 2K4KA 2UU9L 4IFDJ 3KJOA 4A3EG 4OWTB 3HOYH 1VQ4A 4KHZA 4GN4B 4JI3L 5GADC 1XMQQ 4X62Q 2E2JH 1JJ2A 1S3OA 1CKNA 3UE0A 3HOUH 1KL9A 2YTXA 1U5KA 4LUVA 5IYCH 4DR2Q 4K0KL 4NB3A 1YJWA 1L1OB 1Y1WH 5JJIA 3JC66 3A5ZB 1N32Q 2JE6I 2Z0SA 2I5MX 3M9BA 1X9NA 3GTMH 1YHAA 5IYDG 4YHHL 4AYBE 1ASYA 4DV5L 1M1KC 3BJUA 4BBSG 4LF9Q 4TQUS 3GTOH 1PYSB 4R4TA 4IOCA 2BH8A 4DR5L 1B70B 2F52A 3CP0A 5M3FH 1XNQL 3S14H 1OXSC 2R93H 4A3EH 3HOYG 1VCIA 2OQ0A 1Z9FA 1FL0A 2B3GA 2H5XA 2VS1A 3F8TA 3NBHB 4LFAQ 4LFCL 4GKKL 5C3EH 2ASBA 3HOUG 1CKNB 3I7FA 1IBMQ 2WFWA 2ES2A 3HOZG 1K73C 4P72A 5AJ3Q 4BY1H 1B8AA 1P16A 1MIUA 3HKZG 4A3CG 1VQAA 3FKIH 3HKZE 3CW2C 1K83H 3ER0A 2I5LX 1E7ZA 1KHIA 4GLVB 2GVBA 4A3MH 2NVQH 4DNIA 3M7NA 1X6OA 1YBYA 2KHJA 3CPFA 2UUCL 1PVOA 2QGQA 2PMZE 1L0WA 4LF5Q 2DGYA 3GTKH 1VQHA 2Q2HA 1CKMA 1FVIA 1X3EA 3K7UC 1N34Q 4GOPB 1VQIA 2WP8J 4A4IA 1LUZA 4DV6L 5IE8A 1C0AA 2PI2E 2HQLA 4HJ8A 2EQSA 2GVAA 4WJ4A 3PUXA 1PH8A 1MKHA 3FKIG 5E7NA 5GROA 4HIMA 4JI7Q 2B63H 4BBRG 2VNUD 1IZ6A 1KAWA 2KHIA 3HFZB 4LFCQ 2CFMA 4IO9A 1IBML 2YV5A 3H0GG 3EIVA 1PH9A 3I55A 4KHPQ 3F2CA 4QL5A 4R4QA 1Y14B 1B7YB 4JBKA 4QQBX 2RF4A 1EQRA 4HJ9A 4JI6L 4DV1Q 3GO5A 4LNQA 4JI0L 1Y1VH 1VQFA 1P8LA 2JA7G 1VQOA 4FDBA 1CKOA 1N32L 1M90C 2UXDQ 4DV5Q 3CXCA 3CC7A 4YHHQ 2RHQB 3GD7A 5IY0A 3GTLH 4DK3C 3UDGA 2I5HA 3L2PA 3A0JA 3OTOL 2UUAQ 1VQNA 2OTLA 2QA4A 2VUMH 3S17H 2PQAB 4GN3B 4NXML 4DV7Q 3TRZA 2VL6A 5IYBH 1X65A 2AHOB 1MJCA 3I4NG 1SMXA 1VQCA 2K52A 4YWMA 4AH6A 1XNRQ 1HZBA 2PQAA 3CQZH 3GTJH 2Q2IA 4A3JH 1RIPA 3GTPH 4LW1A 2PNHA 4A3FH 3JAMc 1EIYB 1LYLA 3KDFB 5JEAJ 4UY8C 1K0RA 2XTIA 2UUBQ 1VQ6A 4DR6Q 5FLXc 4O0AA 4JI2L 4A3CH 1PH3A 3DLLA 4B3SQ 3F2DA 4HJ7A 3G48A 2F4VQ 2AWNA 3KF6A 3W1GA 4MTNA 4DR7L 2F3IA 1XMOL 3CC2A 4LWCA 2K75A 3CCVA 1PH5A 3HOZH 4DV2L 2FXQA 2WB1E 3M3YH 4HIOA 1SN8A 4KI0A 3U4ZA 3UDXA 4APVA 3PUZA 1EIFA 3BU2A 3S1QH 3PO3G 1W3SA 2A1AA 2MQHA 3I4OA 2NZHA 2E5LL 2OTJA 2OWOA 2UUAL 4DKAC 3S15H 4LF4Q 4MZ9A 1Z47A 3J80c 3ICEA 1QUQA 3CD6A 1X3GA 4JI6Q 2GN5A 4WJ3M 1OTCA 3D0FA 1GKHA 2L15A 2Y0SE 2MO0A 2R7FA 1K8GA 4OXPA 4JCVE 4AQYL 4JBMA 2JA9A 3PUVA 1N33L 1E24A 3H3VI 3CMAA 4DAYB 1LTLA 4C3IH 1PHJA 4B3MQ 3SGIA 1OXTA 3PGZA 1N9WA 4A3IG 1E3PA 4DV4L 1Y1VG 2WAQG 4BY1G 3UDFA 1GO3E 3ULJA 1HJPA 2ZJPA 3RZOH 2I0QA 1YJ9A 4JI4L 3K80C 1G291 1IYJB 2OQKA 4X64Q 2HIXA 1L1OC 1DGSA 5FLMG 3KJPA 2BA0A 4LUZA 1Q82C 2JJQA 4HJ5A 1PV4A 3CC4A 4A3GH 2ZTCA 3I4NH 1KD1C 4DUYL 3D31A 3KOJA 1IBLL 5K36G 2AWOA 1WCMG 1GD7A 4R4IA 4PMWA 1IL2A 3KF6B 1UE1A 2LXKA 3HOWG 2E2HH 1PYBA 1X56A 5GQOA 1SR3A 4YCWA 4AYBG 2E8GA 4B3SL 2JA8G 2NVXH 1QZHA 4TVAB 2D62A 3HOXH 4L5SA 3CCRA 1A8VA 3FHWA 5FLMH 1HNWQ 1J5EL 1TXYA 3CCUA 1NMFA 1XMQL 3J7A5 1NE3A 2RHSB 2EIFA 5FJ8G 2ALYB 2NZOA 3M85A 4JI3Q 4PZ7A 4A93H 2VQFL 4C2MH 3J81j 4RMFA 4R4OA 1W2BA 5M3MG 2KENA 2CCZA 2R92G 3PV0A 5GAHC 3T1HQ 3GTQH 2IHEA 2E2IH 3OTOQ 4OWXB 2JA8H 3RLNA 1SLJA 2LXJA 2KBNA 3M4QA 4JG2A 4UP8A 1KC8C 4LFBQ 2R93G 1V1QA 1EQQA 4BXXH 2HHHL 5C0XJ 1WCMH 3PO3H 4OONA 1XTDA 3I56A 3HOVG 4X6AH 1PA6A 4YCUA 4DV3L 1SROA 4PZ8A 2Z6KA 4NPSA 3AQQA 2WAQE 4GNXA 4JI0Q 2RCNA 3FP9A 5IWAL 4A3IH 2Q2UA 3CAMA 3PSIA 1HNWL 4IFDI 3AYHB 2R7DA 2V1CC 1LM0A 2VW9A 2CQOA 5C4XH 4A3MG 4X64L 1UE7A 1OXXK 4JC0A 1JB7A 4DAMA 2N3SA 3A5UA 4C3HH 4X65Q 3NELA 3ZJYC 1HR0Q 4A3LG 4JI7L 1HH2P 1RL2A 1AE2A 4IPGA 2UXCL 3MXNB 4IJHA 5JEAG 1PH7A 3CCSA 1PFSA 1YZ6A 4EX5A 4KHPL 1PH1A 4DV4Q 3KLWA 4PZ6A 4A75A 3EN2A 4A3FG 1L1OA 2VUMG 4JYAL 3UDIA 5C0XG 1IBKQ 1XPUA 1O7IA 3STBD 4JV5L 4X66Q 2ZJRA 4LF8L 4O2DA 4BBSH 5GAGC 3S16H 4YY3L 4B3TL 3PF4A 5IYDH 1JJGA 4ALPA 3Q8DA 2R6GA 3S24A 4C3JH 3TREA 2YTVA 3PCOB 3ULLA 1KIXA 4L5RC 2D0OA 2A8VA 3CF5A 2Y0SG 4DR1Q 4OO1I 2K50A 4YY3Q 2K14A 4B3TQ 1YHBA 2UUCQ 1D8LA 1PH2A 2N49A 3AFQA 1N8RC 3TS2A 4A3DG 1VQ8A 2OCEA 2ZTDA 1GVPA 1HNZQ 4ME3A 1BKBA 1TWFH 2MNAA 3CCJA 1XPRA 2E5LQ 3S2DH 4A93G 1VQGA 2JA5G 4JI5L 4YWKA 1JJCB 1VQJA 2MFIA 4IOAA 1H95A 2CWAA 4GLAC 2NVTH 1I5FA 3K8AA 4GS3A 4JI2Q 1GM5A 2UUBL 2WB1G 2IHFA 2F4VL 2QEXA 5J3BA 1MJEA 4RG1A 1Q1BA 4BBRH 2VQEL 2YU9H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YVC A;  3PUY A;  1G51 A;  1WOC A;  3PIP A;  3U58 A;  3HOV H;  4DV2 Q;  3S1N H;  4UP9 A;  1A62 A;  5IWA Q;  1XNR L;  2JA6 H;  1X54 A;  4YCV A;  3M4O H;  1AH9 A;  4R1J A;  1X3F A;  1X55 A;  2JEB I;  3EBE A;  4JBJ A;  3NEM A;  4NXN L;  1WFQ A;  1YJN A;  1VQK A;  1SFO H;  3AFP A;  5BR8 Q;  1KQS A;  2HHH Q;  4JI8 Q;  4AIM A;  1NMG A;  2C35 B;  4QJF A;  3H3V H;  4K0K Q;  1K9M C;  4DR3 Q;  1HR0 W;  2VQF Q;  3E9H A;  1BBW A;  1HNX L;  1OXU A;  1QVG A;  1YHQ A;  2IY5 B;  1QUQ B;  4JI8 L;  2LSS A;  3CME A;  2EXD A;  3ULP A;  2JEA I;  2UU9 Q;  5EAY A;  1IXR A;  1V9P A;  3J7Z C;  4DV1 L;  1JT8 A;  2VZA A;  1Q1E A;  2Q2T A;  1BVS A;  1U0L A;  2ZM6 L;  2KCT A;  3PO2 G;  1I94 Q;  3I4M G;  2VQE Q;  1VQL A;  3CCL A;  1SRU A;  2JK8 A;  1J5E Q;  3E0E A;  2NN6 I;  1K3R A;  2R7Z H;  1J6Q A;  2UXD L;  5JJL A;  1G6P A;  3S1M H;  5DLQ E;  3CCM A;  2XGT A;  4P75 A;  4POG A;  5M5X H;  4GKJ Q;  1Q12 A;  1CUK A;  5M3M H;  1VQ5 A;  3B6Y A;  3KFU A;  1A0I A;  1E1T A;  4LF8 Q;  4GNX C;  4A3B G;  4DK6 C;  3PO2 H;  4LF6 L;  3I4M H;  3DM3 A;  4UP7 A;  4JBW A;  4LF7 Q;  2YTY A;  3F2B A;  4HJA A;  3F1Z A;  1FJG Q;  3TQY A;  2ATW A;  1E22 A;  1HZA A;  2K5H A;  2KCM A;  3UE1 A;  4H02 A;  3WWV A;  1VQE A;  4A3D H;  3J80 i;  3HOX G;  4JI4 Q;  2K5V A;  1VS0 A;  1PH6 A;  5C3E G;  4DV6 Q;  3BZK A;  5H1S E;  1FJG L;  3W5O A;  4BA1 I;  4OX9 Q;  3PUW A;  4GOP C;  2K5N A;  1VQP A;  3NEN A;  3VDY A;  4AQY Q;  4YWL A;  1Q7Y C;  4POF A;  2IX1 A;  4B3M L;  4JYA Q;  2JA6 G;  2PI2 A;  5C44 H;  3GTG H;  3K0X A;  1UE6 A;  1BBU A;  4DR5 Q;  1KXL A;  4LFA L;  3H15 A;  2R92 H;  3PIO A;  3ERS X;  3T1Y Q;  4JI1 L;  1YEZ A;  3CPW A;  2UXB L;  2JA7 H;  3PF5 A;  2UXC Q;  3A74 A;  3RN5 A;  4LFB L;  4A3G G;  3KYH C;  1I6H H;  5AJ3 L;  1L2F A;  4DV0 L;  4LF7 L;  3RN2 A;  1S40 A;  4LF6 Q;  1I50 H;  4DUZ L;  1S72 A;  1XMO Q;  4GN5 A;  3GDE A;  4LF9 L;  1NY4 A;  5C4J H;  2JA5 H;  1QZG A;  2YYZ A;  4R4C A;  2HIV A;  5LMU Q;  3RR5 A;  4GOP A;  1QVF A;  1XNQ Q;  3HOW H;  4DPG A;  1NBW A;  3TEH B;  1UEB A;  5M3F G;  3U50 C;  4A3J G;  4J15 A;  3S1R H;  4L5T A;  5HY6 A;  4DR4 Q;  3K7A H;  3JAM i;  4MNO A;  4HID A;  1Q46 A;  4IPD A;  1KRT A;  1HZ9 A;  1VQD A;  3K81 C;  5C0X I;  2ID0 A;  2B29 A;  1I94 L;  1E1O A;  1R9T H;  4XTC S;  5BR8 L;  4DR4 L;  4NXM Q;  1D7Q A;  1WJJ A;  3AEV A;  4P73 A;  4JOI A;  4NXN Q;  3TS0 A;  2AKW B;  1QVC A;  1WI5 A;  2N8N A;  1IBL Q;  2BH2 A;  2HT1 A;  4A3L H;  4DV7 L;  5M5W H;  3J81 c;  1EUJ A;  4QGU A;  2CWP A;  5LMN Q;  1UWV A;  4QIW E;  4OO1 G;  5JJK A;  4IPC A;  1JMC A;  2D0P A;  4DR3 L;  5FJ8 H;  4DV0 Q;  3OW2 A;  4DUZ Q;  4KLK A;  1YIT A;  1YIJ A;  2DUD A;  1TWH H;  1A63 A;  3M4P A;  3E9I A;  1OXV A;  1NTG A;  2A19 A;  3KF8 B;  1N36 L;  2N78 A;  4JI1 Q;  3G71 A;  1VQ7 A;  1ASZ A;  1T9H A;  5IP9 G;  1XPO A;  4JI5 Q;  4DUY Q;  1KRS A;  1K8A C;  2UXB Q;  3T1Y L;  1EOV A;  4BXX G;  4PG3 A;  4B3R L;  3RNU A;  3RZD H;  1HZC A;  2R7Z G;  3RLO A;  4Y7N H;  2JQO A;  2IT1 A;  4BY7 H;  1EFW A;  4DR1 L;  1AE3 A;  3U4V A;  5C44 G;  5GAE C;  1Y1W G;  1JE5 A;  1YI2 A;  3CCQ A;  4BA2 I;  4LF5 L;  1YNX A;  4L5Q A;  2CKZ B;  3I2Z A;  1C7Y A;  1N34 L;  1VQB A;  4B3R Q;  3BZC A;  3G4S A;  3CCE A;  1PH4 A;  2BA1 A;  4X66 L;  1FGU A;  5ELN A;  1HNZ L;  1N33 Q;  1IBK L;  1TWA H;  3H0G H;  1Q8K A;  4JV5 Q;  4XIG S;  1V43 A;  1CSQ A;  4OX9 L;  2AMC B;  4IPH A;  3W1B A;  5IT9 c;  4A3K G;  4X65 L;  5IP7 H;  1Q86 C;  4LUO A;  4GKJ L;  5LMN W;  4A3B H;  3IRB A;  1C9O A;  4GKK Q;  4LF4 L;  4DR6 L;  1HR0 L;  1XJV A;  4OWW B;  4P71 A;  1EYG A;  5ELO A;  2ZTE A;  4QY7 A;  4UPA A;  1VQ9 A;  1CSP A;  3MEF A;  1Q81 C;  4P74 A;  1TWG H;  4DR2 L;  2ZJQ A;  4BY7 G;  3RLF A;  4HIK A;  3J81 i;  2ZM6 Q;  3STB C;  3L0O A;  2NN6 G;  4DV3 Q;  5LMN L;  4GLX A;  1VQM A;  3S2H H;  5IYB G;  4DR7 Q;  4GNX B;  4IJL A;  5IYC G;  1N36 Q;  1TWC H;  4A76 A;  4JOI C;  5M5Y H;  1NJI C;  3L7Z C;  2VY3 A;  3OYY A;  5IP7 G;  3G6E A;  4Y52 H;  5HGQ A;  2Z6K C;  1EWI A;  3HKS A;  3T1H L;  1HNX Q;  4EQ5 A;  4X62 L;  3KDF A;  2IX0 A;  1WYD A;  3LGJ A;  2B63 G;  5C4X G;  5IP9 H;  4IFD G;  2MO1 A;  1I3Q H;  1UE5 A;  4A3K H;  5LMU L;  2NVY H;  1SE8 A;  2K4K A;  2UU9 L;  4IFD J;  3KJO A;  4A3E G;  4OWT B;  3HOY H;  1VQ4 A;  4KHZ A;  4GN4 B;  4JI3 L;  5GAD C;  1XMQ Q;  4X62 Q;  2E2J H;  1JJ2 A;  1S3O A;  1CKN A;  3UE0 A;  3HOU H;  1KL9 A;  2YTX A;  1U5K A;  4LUV A;  5IYC H;  4DR2 Q;  4K0K L;  4NB3 A;  1YJW A;  1L1O B;  1Y1W H;  5JJI A;  3JC6 6;  3A5Z B;  1N32 Q;  2JE6 I;  2Z0S A;  2I5M X;  3M9B A;  1X9N A;  3GTM H;  1YHA A;  5IYD G;  4YHH L;  4AYB E;  1ASY A;  4DV5 L;  1M1K C;  3BJU A;  4BBS G;  4LF9 Q;  4TQU S;  3GTO H;  1PYS B;  4R4T A;  4IOC A;  2BH8 A;  4DR5 L;  1B70 B;  2F52 A;  3CP0 A;  5M3F H;  1XNQ L;  3S14 H;  1OXS C;  2R93 H;  4A3E H;  3HOY G;  1VCI A;  2OQ0 A;  1Z9F A;  1FL0 A;  2B3G A;  2H5X A;  2VS1 A;  3F8T A;  3NBH B;  4LFA Q;  4LFC L;  4GKK L;  5C3E H;  2ASB A;  3HOU G;  1CKN B;  3I7F A;  1IBM Q;  2WFW A;  2ES2 A;  3HOZ G;  1K73 C;  4P72 A;  5AJ3 Q;  4BY1 H;  1B8A A;  1P16 A;  1MIU A;  3HKZ G;  4A3C G;  1VQA A;  3FKI H;  3HKZ E;  3CW2 C;  1K83 H;  3ER0 A;  2I5L X;  1E7Z A;  1KHI A;  4GLV B;  2GVB A;  4A3M H;  2NVQ H;  4DNI A;  3M7N A;  1X6O A;  1YBY A;  2KHJ A;  3CPF A;  2UUC L;  1PVO A;  2QGQ A;  2PMZ E;  1L0W A;  4LF5 Q;  2DGY A;  3GTK H;  1VQH A;  2Q2H A;  1CKM A;  1FVI A;  1X3E A;  3K7U C;  1N34 Q;  4GOP B;  1VQI A;  2WP8 J;  4A4I A;  1LUZ A;  4DV6 L;  5IE8 A;  1C0A A;  2PI2 E;  2HQL A;  4HJ8 A;  2EQS A;  2GVA A;  4WJ4 A;  3PUX A;  1PH8 A;  1MKH A;  3FKI G;  5E7N A;  5GRO A;  4HIM A;  4JI7 Q;  2B63 H;  4BBR G;  2VNU D;  1IZ6 A;  1KAW A;  2KHI A;  3HFZ B;  4LFC Q;  2CFM A;  4IO9 A;  1IBM L;  2YV5 A;  3H0G G;  3EIV A;  1PH9 A;  3I55 A;  4KHP Q;  3F2C A;  4QL5 A;  4R4Q A;  1Y14 B;  1B7Y B;  4JBK A;  4QQB X;  2RF4 A;  1EQR A;  4HJ9 A;  4JI6 L;  4DV1 Q;  3GO5 A;  4LNQ A;  4JI0 L;  1Y1V H;  1VQF A;  1P8L A;  2JA7 G;  1VQO A;  4FDB A;  1CKO A;  1N32 L;  1M90 C;  2UXD Q;  4DV5 Q;  3CXC A;  3CC7 A;  4YHH Q;  2RHQ B;  3GD7 A;  5IY0 A;  3GTL H;  4DK3 C;  3UDG A;  2I5H A;  3L2P A;  3A0J A;  3OTO L;  2UUA Q;  1VQN A;  2OTL A;  2QA4 A;  2VUM H;  3S17 H;  2PQA B;  4GN3 B;  4NXM L;  4DV7 Q;  3TRZ A;  2VL6 A;  5IYB H;  1X65 A;  2AHO B;  1MJC A;  3I4N G;  1SMX A;  1VQC A;  2K52 A;  4YWM A;  4AH6 A;  1XNR Q;  1HZB A;  2PQA A;  3CQZ H;  3GTJ H;  2Q2I A;  4A3J H;  1RIP A;  3GTP H;  4LW1 A;  2PNH A;  4A3F H;  3JAM c;  1EIY B;  1LYL A;  3KDF B;  5JEA J;  4UY8 C;  1K0R A;  2XTI A;  2UUB Q;  1VQ6 A;  4DR6 Q;  5FLX c;  4O0A A;  4JI2 L;  4A3C H;  1PH3 A;  3DLL A;  4B3S Q;  3F2D A;  4HJ7 A;  3G48 A;  2F4V Q;  2AWN A;  3KF6 A;  3W1G A;  4MTN A;  4DR7 L;  2F3I A;  1XMO L;  3CC2 A;  4LWC A;  2K75 A;  3CCV A;  1PH5 A;  3HOZ H;  4DV2 L;  2FXQ A;  2WB1 E;  3M3Y H;  4HIO A;  1SN8 A;  4KI0 A;  3U4Z A;  3UDX A;  4APV A;  3PUZ A;  1EIF A;  3BU2 A;  3S1Q H;  3PO3 G;  1W3S A;  2A1A A;  2MQH A;  3I4O A;  2NZH A;  2E5L L;  2OTJ A;  2OWO A;  2UUA L;  4DKA C;  3S15 H;  4LF4 Q;  4MZ9 A;  1Z47 A;  3J80 c;  3ICE A;  1QUQ A;  3CD6 A;  1X3G A;  4JI6 Q;  2GN5 A;  4WJ3 M;  1OTC A;  3D0F A;  1GKH A;  2L15 A;  2Y0S E;  2MO0 A;  2R7F A;  1K8G A;  4OXP A;  4JCV E;  4AQY L;  4JBM A;  2JA9 A;  3PUV A;  1N33 L;  1E24 A;  3H3V I;  3CMA A;  4DAY B;  1LTL A;  4C3I H;  1PHJ A;  4B3M Q;  3SGI A;  1OXT A;  3PGZ A;  1N9W A;  4A3I G;  1E3P A;  4DV4 L;  1Y1V G;  2WAQ G;  4BY1 G;  3UDF A;  1GO3 E;  3ULJ A;  1HJP A;  2ZJP A;  3RZO H;  2I0Q A;  1YJ9 A;  4JI4 L;  3K80 C;  1G29 1;  1IYJ B;  2OQK A;  4X64 Q;  2HIX A;  1L1O C;  1DGS A;  5FLM G;  3KJP A;  2BA0 A;  4LUZ A;  1Q82 C;  2JJQ A;  4HJ5 A;  1PV4 A;  3CC4 A;  4A3G H;  2ZTC A;  3I4N H;  1KD1 C;  4DUY L;  3D31 A;  3KOJ A;  1IBL L;  5K36 G;  2AWO A;  1WCM G;  1GD7 A;  4R4I A;  4PMW A;  1IL2 A;  3KF6 B;  1UE1 A;  2LXK A;  3HOW G;  2E2H H;  1PYB A;  1X56 A;  5GQO A;  1SR3 A;  4YCW A;  4AYB G;  2E8G A;  4B3S L;  2JA8 G;  2NVX H;  1QZH A;  4TVA B;  2D62 A;  3HOX H;  4L5S A;  3CCR A;  1A8V A;  3FHW A;  5FLM H;  1HNW Q;  1J5E L;  1TXY A;  3CCU A;  1NMF A;  1XMQ L;  3J7A 5;  1NE3 A;  2RHS B;  2EIF A;  5FJ8 G;  2ALY B;  2NZO A;  3M85 A;  4JI3 Q;  4PZ7 A;  4A93 H;  2VQF L;  4C2M H;  3J81 j;  4RMF A;  4R4O A;  1W2B A;  5M3M G;  2KEN A;  2CCZ A;  2R92 G;  3PV0 A;  5GAH C;  3T1H Q;  3GTQ H;  2IHE A;  2E2I H;  3OTO Q;  4OWX B;  2JA8 H;  3RLN A;  1SLJ A;  2LXJ A;  2KBN A;  3M4Q A;  4JG2 A;  4UP8 A;  1KC8 C;  4LFB Q;  2R93 G;  1V1Q A;  1EQQ A;  4BXX H;  2HHH L;  5C0X J;  1WCM H;  3PO3 H;  4OON A;  1XTD A;  3I56 A;  3HOV G;  4X6A H;  1PA6 A;  4YCU A;  4DV3 L;  1SRO A;  4PZ8 A;  2Z6K A;  4NPS A;  3AQQ A;  2WAQ E;  4GNX A;  4JI0 Q;  2RCN A;  3FP9 A;  5IWA L;  4A3I H;  2Q2U A;  3CAM A;  3PSI A;  1HNW L;  4IFD I;  3AYH B;  2R7D A;  2V1C C;  1LM0 A;  2VW9 A;  2CQO A;  5C4X H;  4A3M G;  4X64 L;  1UE7 A;  1OXX K;  4JC0 A;  1JB7 A;  4DAM A;  2N3S A;  3A5U A;  4C3H H;  4X65 Q;  3NEL A;  3ZJY C;  1HR0 Q;  4A3L G;  4JI7 L;  1HH2 P;  1RL2 A;  1AE2 A;  4IPG A;  2UXC L;  3MXN B;  4IJH A;  5JEA G;  1PH7 A;  3CCS A;  1PFS A;  1YZ6 A;  4EX5 A;  4KHP L;  1PH1 A;  4DV4 Q;  3KLW A;  4PZ6 A;  4A75 A;  3EN2 A;  4A3F G;  1L1O A;  2VUM G;  4JYA L;  3UDI A;  5C0X G;  1IBK Q;  1XPU A;  1O7I A;  3STB D;  4JV5 L;  4X66 Q;  2ZJR A;  4LF8 L;  4O2D A;  4BBS H;  5GAG C;  3S16 H;  4YY3 L;  4B3T L;  3PF4 A;  5IYD H;  1JJG A;  4ALP A;  3Q8D A;  2R6G A;  3S24 A;  4C3J H;  3TRE A;  2YTV A;  3PCO B;  3ULL A;  1KIX A;  4L5R C;  2D0O A;  2A8V A;  3CF5 A;  2Y0S G;  4DR1 Q;  4OO1 I;  2K50 A;  4YY3 Q;  2K14 A;  4B3T Q;  1YHB A;  2UUC Q;  1D8L A;  1PH2 A;  2N49 A;  3AFQ A;  1N8R C;  3TS2 A;  4A3D G;  1VQ8 A;  2OCE A;  2ZTD A;  1GVP A;  1HNZ Q;  4ME3 A;  1BKB A;  1TWF H;  2MNA A;  3CCJ A;  1XPR A;  2E5L Q;  3S2D H;  4A93 G;  1VQG A;  2JA5 G;  4JI5 L;  4YWK A;  1JJC B;  1VQJ A;  2MFI A;  4IOA A;  1H95 A;  2CWA A;  4GLA C;  2NVT H;  1I5F A;  3K8A A;  4GS3 A;  4JI2 Q;  1GM5 A;  2UUB L;  2WB1 G;  2IHF A;  2F4V L;  2QEX A;  5J3B A;  1MJE A;  4RG1 A;  1Q1B A;  4BBR H;  2VQE L;  2YU9 H; 
#chains in the Genus database with same CATH topology
 1YVC A;  1C4Q A;  1G51 A;  1WOC A;  2SEB D;  1BUV T;  3HGB A;  2Q8I B;  3PIP A;  4DV2 Q;  5T1G A;  5C4J B;  1A62 A;  3NSW A;  3MHB A;  2JA6 H;  1X3F A;  1JIC A;  3EBE A;  1BCP C;  3NEM A;  1SYE A;  3R2T A;  1H9J A;  2E2J B;  1SE4 A;  3HOU B;  2B2T A;  1ENC A;  5IGE A;  4AIM A;  3H3V H;  1BQQ T;  2LMC B;  1IHZ A;  1HR0 W;  2VQF Q;  1EU3 A;  3ONA B;  1QVG A;  2IY5 B;  2WKD A;  1ESF A;  1F9Q A;  1CHQ D;  1V9P A;  1JT8 A;  1Q1E A;  1BVS A;  3I70 A;  5COR A;  3PO2 G;  4HMI A;  3K58 A;  5HUR A;  3E0E A;  1L0Y B;  2NN6 I;  1J5E Q;  1J6Q A;  5DLQ E;  4C3J G;  2O5J C;  4P75 A;  3LWE A;  4POG A;  5M5X H;  2B2V C;  4KHV A;  3KLR A;  2F0Q A;  2OT2 A;  3DM3 A;  4UP7 A;  4JBW A;  1FJG Q;  2F4I A;  1CT1 D;  4G7O C;  2K5H A;  2KCM A;  3E0J A;  4H02 A;  3S16 B;  4A3D H;  3HOX G;  3RZD B;  1RCV D;  1XX8 A;  2DJG C;  5C3E G;  4DV6 Q;  2K05 A;  5FO8 B;  1GUT A;  3VDY A;  4AQY Q;  4UHV A;  2IX1 A;  1WD1 A;  2JA6 G;  1EY4 A;  2PI2 A;  1CQF A;  2NN6 H;  3K0X A;  1KXL A;  4IQZ A;  4LFA L;  2E76 C;  3K6O A;  3KK7 A;  2R92 H;  1KTK A;  2UXB L;  2RDG A;  3PF5 A;  1Z7T A;  2UXC Q;  3A74 A;  2NUC A;  4DV0 L;  5EQ0 A;  3RN2 A;  1V1O A;  4LF6 Q;  2K5Q A;  4DUZ L;  3V05 A;  1FR3 A;  3IAY A;  3GDE A;  4GOP A;  2HIV A;  1QVF A;  3HOW H;  3TEH B;  3GTJ B;  1DJR D;  3J81 E;  4A3J B;  4J15 A;  2NVX B;  5HY6 A;  3K7A H;  3HOX B;  4MNO A;  3A8I E;  4IPD A;  5G3L F;  3T51 B;  2K6A A;  2B29 A;  1E1O A;  1O7Z A;  2O5I C;  4P73 A;  4NXN Q;  5IGC A;  2WAC A;  4C2M B;  2BH2 A;  1GHK A;  4OEM B;  4DV7 L;  4NDX A;  1EUJ A;  3CRL C;  3LX0 A;  1Q3L A;  1UWV A;  4PNY A;  1JMC A;  1Y1W B;  5FJ8 H;  3SVM A;  3M4P A;  1CFM A;  2A19 A;  3KF8 B;  3G71 A;  3I72 A;  4RKB A;  1T9H A;  5IP9 G;  4TRD A;  1H9R A;  2KHS A;  3T1Y L;  3J7A F;  3GTO B;  3K5L A;  3IFD A;  4QB4 A;  5C5L A;  1EFW A;  3HP3 A;  5ELB A;  2H4O A;  3Q0A A;  2F0V A;  5GAE C;  1Y1W G;  1JE5 A;  4QIW B;  3I2Z A;  3D8G A;  1AP0 A;  2QEJ C;  1HNZ L;  1TWA H;  1FD7 D;  4NMZ A;  5IT9 c;  1RTO A;  2HQE A;  1I4X A;  4ABN A;  4JW0 A;  5LMN W;  4A3B H;  5EJW A;  4GKK Q;  4LF4 L;  4P71 A;  2IW3 A;  5ELO A;  4QY7 A;  4CDD C;  1KAB A;  3MEF A;  3NTK A;  1TWG H;  3V96 A;  2ENB A;  4DR2 L;  4DV3 Q;  3BS1 A;  2LKV A;  4R9W A;  2H1E A;  1VQM A;  3GQB A;  5IYB G;  3R2I A;  4IJL A;  2B2T C;  2BDO A;  2F0T A;  2Y0S B;  1TY2 A;  5EPJ A;  3T1H L;  1ICF B;  1E2V A;  3KDF A;  2IX0 A;  4K8J A;  1WYD A;  3V2T A;  5C4X G;  3L9A X;  1I3Q H;  2MHV A;  1SE8 A;  3KJO A;  2ZXP A;  3TP5 A;  3NWS A;  2EZV A;  5GAD C;  4X62 Q;  1SFO B;  1VF7 A;  4A3F B;  1JWU D;  1KL9 A;  2YTX A;  1U5K A;  5M5W B;  4NB3 A;  3EQL C;  5C0X H;  2J7Z A;  3JC6 6;  5JJI A;  3M9B A;  3GTM H;  4ILW A;  5JJZ A;  4DV5 L;  3M3Y B;  4IOC A;  4DR5 L;  1B70 B;  2F52 A;  1FYC A;  3IL8 A;  3KLS X;  3TP6 A;  1PFM A;  4HMJ A;  5C3E H;  2WFW A;  1NUC A;  5C5M A;  2K33 A;  1CZW A;  3HKZ E;  3CW2 C;  1K83 H;  5M3M B;  4HN7 A;  2I5L X;  2NVQ H;  3HS0 C;  1ILP A;  1X6O A;  2V4D A;  1PVO A;  2UUC L;  1JOO A;  1HFG A;  1F2L A;  3EVQ A;  1L0W A;  1O7Y A;  4RGT A;  1X3E A;  3K7U C;  3R93 A;  5E4X A;  1LUZ A;  4DV6 L;  1II3 A;  3GTL B;  5IE8 A;  4ZLT F;  2PI2 E;  4HJ8 A;  2GVA A;  3DHQ A;  4KN4 C;  4FF1 A;  3FKI G;  4HIM A;  5GRO A;  2B63 H;  5KYL A;  2YV5 A;  4XDX A;  3I55 A;  3F2C A;  4QL5 A;  1S4Z A;  2RSO A;  4RFB A;  3W3A A;  4LNQ A;  1K0S A;  1VQF A;  1P8L A;  1D5M C;  2UXD Q;  3RMH A;  5AFW A;  3OPO A;  4HAE A;  5IY0 A;  1VQN A;  3A0J A;  1BCP D;  4CDE C;  4GN3 B;  4DV7 Q;  1X65 A;  1QE6 A;  1SXT A;  2X6L A;  2PQA A;  1SND A;  3CQZ H;  1WTP A;  1EIY B;  2F0N A;  3JAM c;  3J80 L;  5LL6 S;  2XTI A;  2L11 A;  3SDZ A;  5FLX c;  3MA2 B;  4JI2 L;  1TU2 B;  1Y69 U;  4B3S Q;  2F4V Q;  3BG3 A;  3CC2 A;  1PH5 A;  2FXQ A;  2WB1 E;  3NTI A;  2PO4 A;  2A68 D;  2EPB A;  4F8M A;  3I4O A;  4OIK A;  3I73 A;  4LF4 Q;  1WTR A;  4H13 C;  2MPM A;  1QUQ A;  2BE5 C;  2Y0S E;  2R7F A;  2XRQ D;  3C46 A;  3H3V I;  4DAY B;  2Q8R E;  3EA6 A;  2NBF A;  2Z9H A;  4QF4 A;  4A3I G;  1ONL A;  2L1B A;  4FXD A;  3RZO H;  2A69 C;  2I0Q A;  4JI4 L;  1G29 1;  1B50 A;  4X64 Q;  5I9P A;  1L1O C;  1JE4 A;  4KKS A;  4LUZ A;  1ILQ A;  2RKS A;  2ZTC A;  4DUY L;  3D31 A;  2A6E C;  1HA5 A;  4CHT B;  1IBL L;  4C3I B;  4R4I A;  2E2H H;  1PYB A;  4KD3 A;  3KF8 A;  4YCW A;  4S3S A;  4EQP A;  2E74 C;  4TVA B;  1ZYR C;  4L5S A;  4BBR B;  5C4Z A;  3FHW A;  4FNF A;  1HNW Q;  1J5E L;  1GJX A;  5D65 A;  4ZAI A;  2MJ8 A;  2ALY B;  1LT4 D;  4XQJ A;  2YU9 B;  2J4X A;  4JI3 Q;  1TS3 A;  4A93 H;  1CA5 A;  1VMP A;  3PV0 A;  3T1H Q;  2XWJ B;  2E2I H;  2RA4 A;  1HQM C;  2JN4 A;  3RLN A;  3VYU A;  3CKI B;  1TWH B;  4UP8 A;  3HOZ B;  3OIQ A;  4FP5 D;  1V1Q A;  2HHH L;  1SNQ A;  3PO3 H;  1XTD A;  4CDF C;  4YCU A;  1A6X A;  2WAQ E;  1CK1 A;  4GNX A;  2RCN A;  5IWA L;  2Q2U A;  1EEI D;  1SAP A;  4IFD I;  4XXE A;  3AYH B;  5J1Z A;  1TR5 A;  2CQO A;  1UNS A;  5C4X H;  5BN4 A;  1UE7 A;  4JC0 A;  4C3H H;  3NEL A;  4A3L G;  2BCO A;  4JI7 L;  1HH2 P;  1AE2 A;  5A2Q E;  1PH7 A;  3IKJ A;  4A3E B;  2BDN A;  4RGN A;  5JOB A;  3PIO 3;  1L1O A;  1WTX A;  5C0X G;  1GXD C;  1VDZ A;  1O7I A;  2F0J A;  3BDC A;  3STB D;  4X66 Q;  4IN3 A;  1T5E A;  1QOH A;  4YY3 L;  3PF4 A;  1JJG A;  4ALP A;  1CTM A;  3KUP A;  3ULL A;  5I9O A;  2FIN B;  2Y0S G;  4ME5 A;  2BOS A;  5EPL A;  2UUC Q;  1PH2 A;  1IKL A;  3M4O B;  1VQ8 A;  1EY6 A;  1HNZ Q;  3CCJ A;  1BKB A;  1TWF H;  2AUJ D;  4A93 G;  1EWC A;  2KED A;  3F2U A;  3U9O A;  2UUB L;  2WB1 G;  2F4V L;  2R92 B;  3D6W A;  4XQN A;  3S1N H;  2IJ0 A;  4UP9 A;  4YCV A;  1EY5 A;  1AH9 A;  4JBJ A;  1O78 A;  1IYU A;  3AFP A;  4JI8 Q;  1SMY C;  2C35 B;  1WCM B;  4X3S A;  4QJF A;  2R3Z A;  3DUZ A;  3HOW B;  1K9M C;  4HED A;  1WTH A;  3URY A;  3K0Y A;  1BBW A;  1YHQ A;  4JI8 L;  2LSS A;  3ULP A;  2UU9 Q;  1IXR A;  1HQR D;  2VZA A;  2Q2T A;  1JCK B;  1SNC A;  3I4M G;  2VQE Q;  1VQL A;  1CI3 M;  3GTP B;  1SRU A;  5IOC A;  2JK8 A;  2PW5 A;  2MGS A;  2SNM A;  4GKJ Q;  3AB9 A;  2KCN A;  1ZEQ X;  3KFU A;  3QG1 A;  1MSG A;  4B9X A;  3K5N A;  4GNX C;  2WII B;  3PO2 H;  1JR0 D;  4OL7 A;  4LF6 L;  3I4M H;  1EYA A;  3NHH A;  1LTI D;  2NWG A;  2YTY A;  4HJA A;  3F1Z A;  3S15 B;  3TQY A;  2ATW A;  1K28 A;  4FVM A;  3KBX A;  3J80 i;  4QMG A;  3GV3 A;  1HFN A;  3S1M B;  1VS0 A;  2FMC A;  3W5O A;  5BN3 A;  1OO9 B;  3PUW A;  1FJG L;  1VQP A;  3M4Y A;  3NEN A;  2F1M A;  1ENF A;  4YWL A;  4PMB A;  3NBH A;  3VYR A;  5C44 H;  3GTG H;  3NWT A;  1PDQ A;  3PIO A;  4JI1 L;  1YEZ A;  2ZXO A;  2CVR A;  2XRS D;  2EYL A;  4TKO B;  5FK9 C;  1C48 A;  2NVT B;  3MZ5 A;  1U4M A;  1GUS A;  5AJ3 L;  3I3C A;  1EL0 A;  3OIP A;  2IWH A;  2F0F A;  3O13 A;  1S72 A;  1E2W A;  4LF9 L;  5C4J H;  5C3W A;  1QZG A;  2JA6 B;  4R4C A;  3RR5 A;  1EYD A;  2D2C C;  2LY7 A;  4HID A;  1KRT A;  3K5O A;  3FVQ A;  1HZ9 A;  1VQD A;  1Z6H A;  3K81 C;  1TS4 A;  4KY5 A;  1I6H B;  1R9T H;  2C9O A;  4UDU C;  4MIU A;  4NXM Q;  4M1U B;  2N8N A;  4XQQ A;  2L0C A;  5LMN Q;  2CWP A;  4OO1 G;  1WTV A;  4DR3 L;  5TSS A;  4DUZ Q;  1XWE A;  1YIJ A;  3E9I A;  1D6E C;  1LT3 D;  5DAU A;  1N36 L;  4K2K A;  4I7A A;  2B8F A;  1EEF D;  3H3V C;  5E3F A;  2CW0 C;  2UXB Q;  1G91 A;  3DMU A;  5IT9 E;  1TQO A;  3RLO A;  4Y7N H;  2IT1 A;  2A6H C;  1AE3 A;  3U4V A;  1HHV A;  1YI2 A;  4IUP A;  4CJ1 B;  1C7Y A;  2AQ2 B;  1VQB A;  4DNT B;  4B3R Q;  3BZC A;  3G4S A;  1W6K A;  4KV6 A;  1TVX A;  4X66 L;  1N33 Q;  1LAB A;  1M4V A;  3I4N B;  1Q8K A;  4XIG S;  1CSQ A;  4OX9 L;  2AMC B;  4IPH A;  3W1B A;  5M9O A;  4X65 L;  1JWM D;  2OF1 A;  1Y8P B;  2EYP A;  5CYU A;  1RHP A;  1C9O A;  4ZCK A;  4K6D A;  3C3L A;  2AQ3 B;  1EFI D;  3D6C A;  1A3V A;  5FKA C;  3J81 i;  3STB C;  3L0O A;  4GLX A;  1QWY A;  4IUR A;  2B63 B;  3JAM E;  1PTO C;  3T13 A;  1PRT C;  1N36 Q;  4KTA A;  5M5Y H;  3L7Z C;  1NJI C;  2Z6K C;  3HZX A;  5KNB A;  3HKS A;  5I2X A;  3S17 B;  5KRU A;  4X62 L;  1B2T A;  2B63 G;  2LFN A;  2OXP A;  2NVY H;  1O80 A;  4IFD J;  3P1H A;  4JI3 L;  4GN4 B;  1XMQ Q;  4OIJ A;  3DM1 A;  1S3O A;  3DWA A;  1WTW A;  4FO2 A;  3D4D A;  1FNV A;  4LUV A;  2WAQ B;  3L3O C;  4BY1 B;  3QJY A;  1Y1W H;  3ND9 A;  3A5Z B;  2JE6 I;  2Z0S A;  2RSN A;  4F88 A;  4YHH L;  1GOZ A;  4AYB E;  1G2S A;  1M1K C;  2DY7 A;  5J22 A;  3S14 H;  1PTO H;  1W6J A;  1OXS C;  4J6H A;  3HOY B;  4KD4 A;  1Z9F A;  3I90 A;  2B3G A;  3F8T A;  1SYC A;  2EYH A;  4LFA Q;  4LFC L;  3TME A;  4GKK L;  5EKK A;  2ASB A;  3HOU G;  4BBS B;  3I7F A;  2XN9 C;  3I8Z A;  2R7Z B;  4IZ8 A;  4P72 A;  1B8A A;  1P16 A;  1MIU A;  3HKZ G;  3GV6 A;  4HCE A;  1E7Z A;  4A3M H;  5CV6 A;  5ELF A;  1F77 A;  2WKC A;  1EU4 A;  4OO1 H;  3CPF A;  2PMZ E;  2Q2H A;  3H91 A;  2TMP A;  3M7G A;  1EZ8 A;  1BF4 A;  1C0A A;  1BCP B;  3BYY B;  4XT3 B;  1PH8 A;  5E7N A;  3FKI B;  2VNU D;  2KHI A;  3HFZ B;  3VR6 A;  1WVL A;  3EIV A;  4AYB B;  4OHJ A;  3ERO A;  4KHP Q;  4R4Q A;  3C1E A;  1H9S B;  1Y14 B;  4JBK A;  2RF4 A;  2F3V A;  4JI6 L;  2JA7 G;  4JI0 L;  2KA7 A;  4FDB A;  1CKO A;  2F0M A;  4F87 A;  4DV5 Q;  1B3Q A;  3CXC A;  1LTB D;  3WOE A;  3GD7 A;  5IT9 L;  3UDG A;  2I5H A;  2UUA Q;  4JVZ A;  3CRK C;  1I50 B;  4KJN A;  2EY5 A;  4B08 A;  3D4R A;  3TRZ A;  3FPU B;  2VL6 A;  4HSV A;  1SMX A;  2K52 A;  4YWM A;  3S1Q B;  2KQ3 A;  1XNR Q;  1QIL A;  2PNR C;  1BCP F;  2Q2I A;  1RJT A;  4A3F H;  1VQ6 A;  5JEA J;  2G9H D;  1K0R A;  4O0A A;  4V19 0;  4A3C H;  1X32 A;  1PH3 A;  1IW7 C;  3F2D A;  5D3D A;  3C1F A;  3GP7 A;  4LMQ D;  2AWN A;  1PRT F;  2F3I A;  3HOZ H;  4ULL A;  3CCV A;  2Z1C A;  1ICW A;  3M3Y H;  4HIO A;  1ESR A;  1MI2 A;  4MHE A;  1MBY A;  1W3S A;  2A1A A;  1G6Z A;  4MZ9 A;  1SNO A;  3SK6 A;  1STA A;  2B2W A;  1IYV A;  4GZY C;  3JAM L;  3J80 c;  3CD6 A;  1MSH A;  2G5D A;  3T56 B;  4KMU C;  2NTS A;  1GKH A;  3KBG A;  4C3H B;  1N33 L;  1E24 A;  3CMA A;  1V1P A;  3I91 A;  3SGI A;  5IGD A;  3PGZ A;  3LWU A;  4DV4 L;  3FMC A;  2WAQ G;  4BY1 G;  2NZ1 D;  5BN5 A;  1IKM A;  2NTT A;  1PRT B;  2A5H A;  3DWQ A;  4FF2 A;  3NTH A;  2OQK A;  2QF7 A;  3T16 A;  2HIX A;  3OW7 A;  5FLM G;  3KJP A;  2BA0 A;  1TS2 A;  1GUG A;  1Q82 C;  1PV4 A;  4A3G H;  3S2D B;  1B1Z A;  3D3R A;  3H0G B;  3KOJ A;  5K36 G;  2E2D C;  1TII D;  1BOS A;  3KF6 B;  4RCN A;  5ELC A;  2EE1 A;  3HOW G;  2K5D A;  3TZU A;  1SR3 A;  1HPC A;  4B3S L;  2NVX H;  2JA8 G;  2R61 A;  4Q0F A;  1H9S A;  1QZH A;  3HOX H;  1QB5 D;  1TXY A;  1TT2 A;  1EZ6 A;  2QKI C;  2P5Z X;  1XMQ L;  3J7A 5;  2EIF A;  3H94 A;  1A2T A;  4PZ7 A;  4C2M H;  5IOD A;  4G57 A;  2R92 G;  4N8X 1;  2PPB C;  3GTQ H;  4WJW A;  1QNK A;  3OTO Q;  2LXJ A;  3M4Q A;  3Q24 A;  2PZT A;  4JG2 A;  1EQQ A;  4RKL A;  1WCM H;  4WRD A;  4X6A H;  3J7A V;  1SRO A;  4LAA A;  2Z6K A;  4PZ8 A;  4NPS A;  1G2T A;  1DM0 B;  3NP8 A;  4A3I H;  2V1C C;  4IFD H;  1LM0 A;  1M8A A;  1LLR D;  2VW9 A;  1A3U A;  4A3M G;  4X64 L;  1OXX K;  1TKW B;  2N3S A;  4KY7 A;  4X65 Q;  3ZJY C;  2IX3 A;  3EFX D;  4IPG A;  1ET9 A;  3TBI B;  5JEA G;  1MHW C;  4KN7 C;  1YZ6 A;  4J8Q A;  5CV4 A;  3VYS A;  3VR3 A;  3KLW A;  4A75 A;  5C3X A;  2VUM G;  1TWA B;  1IBK Q;  2VB3 X;  3P75 A;  1XPU A;  4JV5 L;  1U4L A;  2DY8 A;  2R6G A;  3S24 A;  3TRE A;  3PCO B;  1KIX A;  2D0O A;  4CJ2 C;  1DOM A;  4OO1 I;  2K50 A;  4WOR A;  3QWN A;  4YY3 Q;  1B9N A;  1YHB A;  5LHY 1;  4RHR A;  1N8R C;  3S9W A;  1ET6 A;  1DXM A;  4ME3 A;  1XPR A;  3X3M A;  1EY0 A;  3GTK B;  2JA5 G;  1IW7 D;  1JB3 A;  1VQJ A;  3SR1 A;  1F9S A;  1UEA B;  3G7L A;  2CWA A;  3NPP A;  4GS3 A;  4JI2 Q;  1V8Q A;  2DN8 A;  5CMD A;  5COY A;  2JXM B;  4RG1 A;  1Q1B A;  1PZJ D;  4BBR H;  2VQE L;  4A3G G;  2L9H A;  3HOV H;  1F2Y A;  4V0B A;  2JA5 B;  4IUN A;  5IWA Q;  1LTA D;  1SYG A;  1SE3 A;  2I46 A;  4K14 A;  4R1J A;  2JEB I;  2JA8 B;  4NXN L;  2F0U A;  1YJN A;  3A54 A;  1SFO H;  5BR8 Q;  2HHH Q;  4DR3 Q;  5DM7 3;  1HTL D;  3E9H A;  1B9M A;  4RAU C;  1B3A A;  3ERQ A;  1STH A;  2JEA I;  3PO3 B;  1Y8N B;  5EAY A;  3J7Z C;  4DV1 L;  2ZM6 L;  1S5D D;  1I94 Q;  2F3W A;  5IGF A;  4ZK9 B;  2VXW A;  2RBM A;  5JJL A;  1NR4 A;  1K3R A;  1G6P A;  3TP8 A;  2NYZ D;  2EDG A;  5C4X B;  3CCM A;  2XGT A;  1S5B D;  1Q12 A;  1K83 B;  5M3M H;  1VQ5 A;  1A0I A;  2NVQ B;  2DJF C;  1BNZ A;  2F0G A;  1EQV A;  1GUW A;  4DK6 C;  1LTT D;  4J1M A;  1EQT A;  3QOJ A;  4LF7 Q;  3FRP B;  1PMR A;  1HZA A;  3UE1 A;  2Z4I A;  3WWV A;  4JI4 Q;  4ZQ3 A;  1JOQ A;  2K5V A;  4H7B A;  1UAP A;  5H1S E;  4BA1 I;  4OX9 Q;  1HA6 A;  2F0L A;  4B3M L;  1TS5 A;  4ZRZ A;  1UE6 A;  2N55 A;  1BBU A;  5FO9 B;  5I6W A;  3Q23 A;  4DR5 Q;  1R4Q B;  1TWF B;  3H15 A;  4ID6 A;  4R8N A;  2JA7 H;  2K03 A;  2CW0 D;  2XSC A;  1B4O A;  1KAA A;  4LFB L;  3KYH C;  3OMC A;  5F2D A;  1KNA A;  1CM9 A;  4IAL A;  1AW7 A;  1LTG D;  1S40 A;  3S2H B;  4CJ0 B;  1EYC A;  4ZKC B;  4GN5 A;  2QIL A;  5CBE E;  4FXK C;  3S1N B;  1NY4 A;  4PV1 C;  2YYZ A;  5LMU Q;  5CC4 A;  2PZU A;  1XNQ Q;  4DPG A;  1NBW A;  1UEB A;  5M3F G;  1SBB B;  1SMY D;  2HDM A;  3BZD B;  3S1R H;  2KCC A;  1H9M A;  4DR4 Q;  3JAM i;  2FMM A;  1PTO F;  3E5S A;  5C0X I;  2ID0 A;  3BVZ A;  4XTC S;  1J8I A;  5BR8 L;  2B2U A;  1D7Q A;  5IGG A;  1WJJ A;  2Z8L A;  4JOI A;  4A3L H;  1STE A;  3CHB D;  4C3H G;  4UAI A;  3NUC A;  4QGU A;  5ELE A;  2D0P A;  4DV0 Q;  3OW2 A;  4KLK A;  1YIT A;  2DUD A;  4NW2 A;  1EIH A;  1A63 A;  1NTG A;  2N78 A;  2R93 B;  1VQ7 A;  1XPO A;  4JI5 Q;  4DUY Q;  1K8A C;  1LT6 D;  3VYT A;  5L37 A;  4PG3 A;  3RNU A;  4HCS A;  2R7Z G;  2JQO A;  4BY7 H;  1NAP A;  2RCF A;  1BXT A;  5C44 G;  1JOK A;  2IPK D;  5C6A A;  4X3K A;  1I4Q A;  2CKZ B;  4BWG B;  4DGZ A;  1N34 L;  1LTS D;  1VF5 C;  4DAP A;  2BA1 A;  1FGU A;  1IBK L;  4JV5 Q;  2KJX A;  4O1N A;  2G9D A;  1BO0 A;  4A3K G;  1PFN A;  2QDL A;  5IP7 H;  3PQI A;  4LUO A;  4DR6 L;  4OGQ C;  1HR0 L;  1XJV A;  4DFA A;  1EYG A;  2K28 A;  2ZTE A;  4UPA A;  1CSP A;  1Q81 C;  4P74 A;  2ZJQ A;  4BY7 G;  4HIK A;  2FJ2 A;  2ZM6 Q;  3NQI A;  5LMN L;  3Q6S A;  4DR7 Q;  3NBI A;  3Q22 A;  2NB0 A;  2A68 C;  1TWC H;  3E3X A;  4JOI C;  3D4W A;  5IP7 G;  3G6E A;  1SNP A;  5HGQ A;  3SXH A;  1YNN C;  1HNX Q;  4EQ5 A;  4HR7 B;  1BBX C;  2WV6 D;  1BDO A;  3LGJ A;  4H0L C;  5IP9 H;  3OHX C;  2FHT A;  1UE5 A;  3SK8 A;  5LMU L;  1TWG B;  2UU9 L;  1Y8O B;  4KHZ A;  2E2J H;  2WB1 B;  4IUT A;  3HOU H;  4BS9 A;  2VUM B;  4I7Z C;  3SEB A;  2M00 A;  5IYC H;  4K0K L;  3WDN A;  1YJW A;  5CGK A;  1L1O B;  4XYQ A;  2WIN B;  4RH6 A;  1SYD A;  1F2M A;  2EY2 A;  2I5M X;  1I6V C;  1YHA A;  5IYD G;  1ASY A;  4BBS G;  4LF9 Q;  1AZP A;  1PYS B;  3H09 A;  2BH8 A;  1XNQ L;  2JYO A;  2TSS A;  5M3F H;  2DNC A;  4A3E H;  3HOY G;  1VCI A;  3K57 A;  2OQ0 A;  1FL0 A;  1J9O A;  3P20 A;  2XWB B;  4RCO A;  1IBM Q;  2ES2 A;  2ICI A;  5EBD A;  5LL6 X;  4G7H C;  1K73 C;  5IGB A;  5M5X B;  5A35 A;  1ZYR D;  3QB3 A;  4GLV B;  1KHI A;  2GVB A;  5G3L D;  2L4N A;  5KIX A;  3BVM A;  1LTR D;  1YBY A;  2KHJ A;  4JPB W;  4XT1 B;  1SNM A;  5EKL A;  2QGQ A;  4LF5 Q;  4DAY A;  1FNU A;  1VQH A;  3SE0 A;  1FVI A;  1N34 Q;  4GOP B;  1VQI A;  2WP8 J;  2PMZ B;  4A3D B;  4ZUI A;  1XXG A;  2B39 A;  4MTK A;  4WJ4 A;  3PUX A;  4JI7 Q;  4EQN A;  5CR3 A;  2CFM A;  4IO9 A;  3H0G G;  3VA7 A;  2F0H A;  1PYW D;  5D3I B;  4QQB X;  3EJI A;  2EVB A;  4KK7 A;  4HJ9 A;  1CHP D;  1ML0 D;  2OEO A;  1NNX A;  5ELD A;  1YNN D;  3CC7 A;  4YHH Q;  3AMU A;  4A3K B;  3GTL H;  4QUC A;  2SDF A;  1U4P A;  3L2P A;  3OTO L;  2OTL A;  2QA4 A;  4K5W A;  4RA8 A;  4R8I A;  3S17 H;  2B8G A;  4NXM L;  3VR4 A;  4IUQ A;  2AHO B;  3I4N G;  2NVY B;  4AH6 A;  1HZB A;  2RQX A;  3GTJ H;  4N9P A;  4A3J H;  2IL8 A;  4EGV A;  1RIP A;  3GTP H;  2PNH A;  1QG7 A;  4K8I A;  4UY8 C;  5DNF A;  5EPK A;  4N9T A;  3DLL A;  3G48 A;  1G8Z D;  3H6M A;  3KF6 A;  4MTN A;  4DR7 L;  1XMO L;  4LWC A;  4CDC C;  1K8M A;  2A74 C;  3PUZ A;  1EIF A;  3BU2 A;  3PO3 G;  2HDL A;  2MQH A;  2E5L L;  2NZH A;  5DEH A;  3S15 H;  4MN3 A;  1Z47 A;  4A3I B;  1L0X B;  3BYT B;  5JVH 3;  5A2Q L;  3OWE B;  2F0I A;  2GN5 A;  3SK5 A;  1OTC A;  3FEW X;  4OXP A;  2JA9 A;  3NE5 B;  5ISR A;  4C3I H;  4B3M Q;  1GHJ A;  2RVL A;  3FDT A;  3QOL A;  2J0T D;  1N9W A;  4B9W A;  3UDF A;  1HJP A;  1SSO A;  1YJ9 A;  4G4K A;  2F0O A;  1IYJ B;  4A93 B;  3R8B A;  3MAQ A;  4IUU A;  1BR9 A;  2EXZ A;  1KD1 C;  1Y1V B;  4KKU A;  2AWO A;  2K1B A;  1WCM G;  4PMW A;  1IL2 A;  4I65 A;  1UE1 A;  1X56 A;  5GQO A;  4AYB G;  4A3B B;  3TN2 A;  3DEP A;  1WTO A;  2Z6B A;  3A8J E;  4ZKB B;  1A8V A;  3J80 E;  5FLM H;  1KDA A;  1EY8 A;  4HTH A;  3CCU A;  3MXP A;  4KKT A;  2GA4 B;  1NE3 A;  1PXU A;  2DNE A;  2NZO A;  3M85 A;  1SEB D;  2QDB A;  4EQO A;  3I4L A;  2F0W A;  2MP1 A;  1W2B A;  5I4D A;  2CCZ A;  1STY A;  5GAH C;  4U68 A;  2E2H B;  4OWX B;  2JA8 H;  1SLJ A;  2KBN A;  1KC8 C;  5DM6 3;  1S5E D;  5C0X J;  1CA6 A;  2HCI A;  4OON A;  1QJO A;  5E1F A;  5JEA H;  1PA6 A;  4DV3 L;  1SDF A;  1A2U A;  4CBV A;  3AQQ A;  2X6G A;  3FP9 A;  3PSI A;  4H44 C;  1HNW L;  5K5P A;  1T5X D;  2L12 A;  1CQV A;  2PZW A;  1JB7 A;  4K2L A;  1F9P A;  4DAM A;  2D9U A;  3GTM B;  4DA2 A;  4X3T A;  3CCS A;  2PCF B;  1PH1 A;  3EN2 A;  3UDI A;  2BE5 D;  4LF8 L;  1KLG D;  3S16 H;  4B3T L;  5FLX L;  1YNJ C;  2A6H D;  2XNA C;  4QUF A;  3VR5 A;  2YTV A;  4K5V A;  2F0K A;  2LS0 1;  5CV9 A;  3CF5 A;  2A8V A;  4DXF A;  4DR1 Q;  4FF4 A;  2K14 A;  1CZG A;  1D8L A;  2N49 A;  2OCE A;  2ZTD A;  1GVP A;  1NSN S;  3MXG A;  2E5L Q;  2MNA A;  3R3O A;  3S2D H;  4A3G B;  1VQG A;  1DYQ A;  4YWK A;  1JJC B;  3G6J B;  1DON A;  1MGS A;  4IOA A;  1H95 A;  1I5F A;  3K8A A;  3P7J A;  1GM5 A;  5HGT A;  3HEJ A;  1MJE A;  4IUV A;  3A55 A;  3PUY A;  5CV7 A;  1RDP D;  3U58 A;  5T1I A;  1XNR L;  3AU7 A;  1X54 A;  1GUO A;  3M4O H;  4CKE A;  2KVM A;  4OEL B;  1X3Q A;  1X55 A;  3MC0 B;  1WFQ A;  1VQK A;  3HG9 A;  1KQS A;  1I4H A;  1NMG A;  3TDQ A;  4ZUJ A;  3W2D A;  2F0P A;  2Z4H A;  4K0K Q;  3S1R B;  4DK1 A;  2JP1 A;  2O4X A;  1HNX L;  1GUN A;  1OXU A;  1QUQ B;  1LV9 A;  3RUZ A;  3CME A;  3TZD A;  3SK4 A;  2EXD A;  1PTO B;  3HRZ C;  3RD4 A;  1U0L A;  2AUK A;  2KCT A;  3C2P A;  2FFK B;  3CCL A;  3HKZ B;  1WD0 A;  2O2L D;  2R7Z H;  2UXD L;  3S1M H;  1I4P A;  1YNJ D;  2XVS A;  1CUK A;  4DF7 A;  1SYF A;  3B6Y A;  4A3M B;  1E1T A;  4FXG C;  4LF8 Q;  4A3B G;  4LJZ C;  4RHS A;  4C3J B;  1C8C A;  3F2B A;  5JAV A;  5KEE A;  1E22 A;  5IIF A;  1EIG A;  1VQE A;  2K5W A;  1PH6 A;  3A7A B;  4BY7 B;  3BZK A;  5KNC A;  4G7Z C;  3A7L A;  4GOP C;  2K5N A;  1ROD A;  1Q7Y C;  4JYA Q;  4POF A;  3K5M A;  2CH4 W;  1JC7 A;  1SJE D;  2C5C A;  5E4W C;  3OSO A;  1HUN A;  3ERS X;  3T1Y Q;  3CPW A;  3A8K E;  5JPM C;  1K3B C;  1SE2 A;  2EY6 A;  3RN5 A;  2CH4 A;  2MUY A;  1I6H H;  1L2F A;  4JK1 C;  4LF7 L;  3WOF A;  1I50 H;  2Q8T A;  1XMO Q;  5C44 B;  3GTG B;  2JA5 H;  2HCC A;  2PYK A;  4PMC A;  4E6I A;  1MD2 D;  3DEO A;  3SHL A;  1EOT A;  1TY0 A;  1K8O A;  2HD3 A;  3U50 C;  4A3J G;  4L5T A;  2AQ1 B;  1PZK D;  5KGU A;  4RGO S;  1Q46 A;  1O7L A;  1I94 L;  5NUC A;  2JSO A;  1RF2 D;  4DR4 L;  3AEV A;  5D14 A;  3K59 A;  3TS0 A;  2AKW B;  1QVC A;  1WI5 A;  3QR8 A;  1IBL Q;  2HT1 A;  1QNU A;  5I6Y A;  1JQY D;  5M5W H;  3J81 c;  4Y7N B;  1A3T A;  5JJK A;  4QIW E;  4IPC A;  2E2I B;  1TWH H;  4YIJ A;  1S5C D;  2B2Y C;  4X3U A;  1OXV A;  2EYF A;  3BVG A;  4JI1 Q;  4CKB A;  1R9T B;  1ASZ A;  1KNE A;  1KRS A;  1EOV A;  1NR2 A;  4BXX G;  1E2Z A;  4B3R L;  3RZD H;  1HZC A;  4NP5 A;  5CBA E;  3NK9 A;  2A6E D;  5CV5 A;  1F2Z A;  1PFB A;  4DR1 L;  2CHB D;  2F0E A;  1HXY D;  2ICE C;  4ODG A;  1EY9 A;  3CCQ A;  4BA2 I;  4LF5 L;  1YNX A;  4L5Q A;  4CGY B;  3MWY W;  1F9R A;  2A69 D;  3CCE A;  1PH4 A;  1DD2 A;  5ELN A;  3H0G H;  2ZT9 C;  1HCZ A;  1B53 A;  1V43 A;  1H9K A;  1ENA A;  2B2U C;  4P2C B;  5M5Y B;  4WFN 3;  1Q86 C;  5FOB B;  4GKJ L;  2K01 A;  1XYI A;  2L5T A;  3IRB A;  2JA7 B;  2F03 A;  3BDO A;  4OWW B;  2SNS A;  3MEH A;  3X3N A;  2B2Y A;  1VQ9 A;  4C1N K;  1AZQ A;  4K6L A;  3RLF A;  2NN6 G;  3FPP A;  3MXU A;  4K5X A;  3T4A C;  3S2H H;  1DCZ A;  3K7A B;  4GNX B;  1STG A;  2KOL A;  5IYC G;  3PIP 3;  4A76 A;  2QCP X;  2VY3 A;  3OYY A;  3GTQ B;  3NXW A;  4Y52 H;  1STN A;  4M8A A;  1EWI A;  1RD9 D;  2K7V A;  3OWF A;  1AEX A;  1WTQ A;  4IFD G;  2EYO A;  2MO1 A;  3MVV A;  4U67 3;  3BDL A;  4A3K H;  2K4K A;  4A3E G;  4OWT B;  3HOY H;  3CQZ B;  1VQ4 A;  1JJ2 A;  1CKN A;  3UE0 A;  4Q5V A;  3LNN A;  1DOK A;  3N6R A;  1SYB A;  4DR2 Q;  5C4H A;  4C1N I;  1N32 Q;  1Q8I A;  2CQA A;  1X9N A;  5EGT A;  4L8J A;  3BJU A;  3GTO H;  2N88 A;  4TQU S;  4R4T A;  1X3P A;  3CP0 A;  2R93 H;  3TSS A;  2F0D A;  4FF3 A;  2H5X A;  2VS1 A;  3NBH B;  2K04 A;  1I4R A;  1CKN B;  2M2L A;  1EY7 A;  3HOZ G;  5FO7 B;  3NQT A;  5AJ3 Q;  4BY1 H;  2ZXR A;  4A3C G;  1VQA A;  2D5D A;  3J7Y W;  3FKI H;  2EJM A;  3ER0 A;  4O42 A;  4DNI A;  3M7N A;  2KEE A;  3S14 B;  4ZYS A;  2QW7 A;  3GTK H;  1FGB D;  1Q90 A;  2DGY A;  3OMG A;  1CKM A;  2SOB A;  3RZO B;  5JPN C;  1KDC A;  5EBC A;  4A4I A;  3TP7 A;  2HQL A;  3PMF A;  2EYJ A;  1PZI D;  2EQS A;  1MKH A;  4DN4 M;  4BBR G;  1IZ6 A;  1KAW A;  3HOV B;  4LFC Q;  1IBM L;  1A15 A;  1PH9 A;  3DXJ C;  4KY6 A;  4Z9C B;  1DOL A;  1LT5 D;  1B7Y B;  1ZKO A;  4C3I G;  1EQR A;  4DV1 Q;  3GO5 A;  1Y1V H;  1VQO A;  2PW7 A;  1N32 L;  1M90 C;  1E0B A;  1D1I A;  1TWC B;  2RHQ B;  1I3Q B;  5K36 H;  4DK3 C;  1D2B A;  3MFG A;  2A73 B;  2PQA B;  2RDF A;  1D5Z C;  1PTO D;  4RWS C;  1HTP A;  4FYD A;  5IYB H;  1MJC A;  1VQC A;  4KJO A;  4NKL A;  3J81 L;  2B2V A;  1KLU D;  1KDB A;  1QCB D;  1U4R A;  3ND8 A;  4LW1 A;  2VUM H;  1LYL A;  3KDF B;  4C56 C;  2UUB Q;  2B2W C;  4DR6 Q;  1AFP A;  4HJ7 A;  3W1G A;  2K75 A;  5C3E B;  4DV2 L;  1NCV A;  1SN8 A;  3VR2 A;  2L55 A;  4KI0 A;  1PRT D;  3U4Z A;  3UDX A;  4APV A;  5M3F B;  3S1Q H;  3A56 A;  2OTJ A;  2OWO A;  4DNR B;  4DKA C;  5JVG 3;  2UUA L;  4L6T B;  3ICE A;  4EVO A;  1X3G A;  4JI6 Q;  4XYO A;  4WJ3 M;  2L15 A;  3D0F A;  3TS2 A;  1STB A;  2MO0 A;  1K8G A;  4JBM A;  4JCV E;  4AQY L;  3PUV A;  1V1P B;  1LTL A;  5J39 A;  1PHJ A;  1OXT A;  4DK0 A;  5I2Y A;  1E3P A;  2KUM A;  1Y1V G;  3ZYY X;  1GO3 E;  1LO5 D;  3ULJ A;  3QO2 A;  1D1K A;  2ZJP A;  1RKN A;  3K80 C;  1DGS A;  2F0S A;  2RDH A;  1B44 D;  1UUP A;  2JJQ A;  4HJ5 A;  2EJF C;  3CC4 A;  2M9V A;  4N8F A;  3I4N H;  3N52 A;  3VA5 A;  4QCL A;  5CV8 A;  1GD7 A;  1FNW A;  3ITP A;  5EKI A;  2LXK A;  2XIW A;  3MFY A;  2E8G A;  1I4G A;  1PLF A;  2D62 A;  1ZXT A;  3CCR A;  1HUM A;  1EWH A;  1NMF A;  2RHS B;  1U9R A;  5FJ8 G;  3QIA A;  4DU9 A;  2VQF L;  1XTC D;  4RMF A;  4R4O A;  3J81 j;  3MTS A;  3OOC A;  5M3M G;  2KEN A;  2IHE A;  1LAC A;  4LFB Q;  2R93 G;  4BXX H;  3MXN A;  5FLX E;  1S5F D;  3CU7 A;  3I56 A;  2EJG C;  3HOV G;  4DXG A;  1HRJ A;  4JI0 Q;  2VB2 X;  3CAM A;  2R7D A;  4CKC A;  1IL8 A;  4LK1 C;  2KEC A;  3E6Z X;  4PQX A;  3A5U A;  1D5X C;  1HR0 Q;  2I07 B;  1RL2 A;  3T53 B;  2UXC L;  3MXN B;  4L63 B;  4IJH A;  4F7X A;  2EOT A;  1PFS A;  3PO2 B;  4EX5 A;  4KHP L;  3I4M B;  4DV4 Q;  4RGM A;  2EY1 A;  4PZ6 A;  3UI2 A;  4A3F G;  4JYA L;  1DZ1 A;  2ZJR A;  2E75 C;  2PQE A;  4O2D A;  5GAG C;  4BBS H;  5IYD H;  3DWP A;  3Q8D A;  4DAV A;  4C3J H;  1RTN A;  4L5R C;  2HUG A;  2EYM A;  1AN8 A;  4B3T Q;  3AFQ A;  4A3D G;  1R4P B;  1JWS D;  1JOR A;  1SJH D;  4TSS A;  4JI5 L;  1VMC A;  2MFI A;  3U9S A;  4GLA C;  5KYI A;  2NVT H;  3KLS A;  3IFT A;  4HSP A;  2IHF A;  2QEX A;  2X69 A;  5J3B A;  2K32 A;  5KND A;  2YU9 H; 
#chains in the Genus database with same CATH homology
 1YVC A;  3PUY A;  1G51 A;  1WOC A;  3PIP A;  3U58 A;  3HOV H;  4DV2 Q;  3S1N H;  4UP9 A;  1A62 A;  5IWA Q;  1XNR L;  2JA6 H;  1X54 A;  4YCV A;  3M4O H;  1AH9 A;  4R1J A;  1X3F A;  1X55 A;  2JEB I;  3EBE A;  4JBJ A;  3NEM A;  4NXN L;  1WFQ A;  1YJN A;  1VQK A;  1SFO H;  3AFP A;  5BR8 Q;  1KQS A;  2HHH Q;  4JI8 Q;  4AIM A;  1NMG A;  2C35 B;  4QJF A;  3H3V H;  4K0K Q;  1K9M C;  4DR3 Q;  1HR0 W;  2VQF Q;  3E9H A;  1BBW A;  1HNX L;  1OXU A;  1QVG A;  1YHQ A;  2IY5 B;  1QUQ B;  4JI8 L;  2LSS A;  3CME A;  2EXD A;  3ULP A;  2JEA I;  2UU9 Q;  5EAY A;  1IXR A;  1V9P A;  3J7Z C;  4DV1 L;  1JT8 A;  2VZA A;  1Q1E A;  2Q2T A;  1BVS A;  1U0L A;  2ZM6 L;  2KCT A;  3PO2 G;  1I94 Q;  3I4M G;  2VQE Q;  1VQL A;  3CCL A;  1SRU A;  2JK8 A;  1J5E Q;  3E0E A;  2NN6 I;  1K3R A;  2R7Z H;  1J6Q A;  2UXD L;  5JJL A;  1G6P A;  3S1M H;  5DLQ E;  3CCM A;  2XGT A;  4P75 A;  4POG A;  5M5X H;  4GKJ Q;  1Q12 A;  1CUK A;  5M3M H;  1VQ5 A;  3B6Y A;  3KFU A;  1A0I A;  1E1T A;  4LF8 Q;  4GNX C;  4A3B G;  4DK6 C;  3PO2 H;  4LF6 L;  3I4M H;  3DM3 A;  4UP7 A;  4JBW A;  4LF7 Q;  2YTY A;  3F2B A;  4HJA A;  3F1Z A;  1FJG Q;  3TQY A;  2ATW A;  1E22 A;  1HZA A;  2K5H A;  2KCM A;  3UE1 A;  4H02 A;  3WWV A;  1VQE A;  4A3D H;  3J80 i;  3HOX G;  4JI4 Q;  2K5V A;  1VS0 A;  1PH6 A;  5C3E G;  4DV6 Q;  3BZK A;  5H1S E;  1FJG L;  3W5O A;  4BA1 I;  4OX9 Q;  3PUW A;  4GOP C;  2K5N A;  1VQP A;  3NEN A;  3VDY A;  4AQY Q;  4YWL A;  1Q7Y C;  4POF A;  2IX1 A;  4B3M L;  4JYA Q;  2JA6 G;  2PI2 A;  5C44 H;  3GTG H;  3K0X A;  1UE6 A;  1BBU A;  4DR5 Q;  1KXL A;  4LFA L;  3H15 A;  2R92 H;  3PIO A;  3ERS X;  3T1Y Q;  4JI1 L;  1YEZ A;  3CPW A;  2UXB L;  2JA7 H;  3PF5 A;  2UXC Q;  3A74 A;  3RN5 A;  4LFB L;  4A3G G;  3KYH C;  1I6H H;  5AJ3 L;  1L2F A;  4DV0 L;  4LF7 L;  3RN2 A;  1S40 A;  4LF6 Q;  1I50 H;  4DUZ L;  1S72 A;  1XMO Q;  4GN5 A;  3GDE A;  4LF9 L;  1NY4 A;  5C4J H;  2JA5 H;  1QZG A;  2YYZ A;  4R4C A;  2HIV A;  5LMU Q;  3RR5 A;  4GOP A;  1QVF A;  1XNQ Q;  3HOW H;  4DPG A;  1NBW A;  3TEH B;  1UEB A;  5M3F G;  3U50 C;  4A3J G;  4J15 A;  3S1R H;  4L5T A;  5HY6 A;  4DR4 Q;  3K7A H;  3JAM i;  4MNO A;  4HID A;  1Q46 A;  4IPD A;  1KRT A;  1HZ9 A;  1VQD A;  3K81 C;  5C0X I;  2ID0 A;  2B29 A;  1I94 L;  1E1O A;  1R9T H;  4XTC S;  5BR8 L;  4DR4 L;  4NXM Q;  1D7Q A;  1WJJ A;  3AEV A;  4P73 A;  4JOI A;  4NXN Q;  3TS0 A;  2AKW B;  1QVC A;  1WI5 A;  2N8N A;  1IBL Q;  2BH2 A;  2HT1 A;  4A3L H;  4DV7 L;  5M5W H;  3J81 c;  1EUJ A;  4QGU A;  2CWP A;  5LMN Q;  1UWV A;  4QIW E;  4OO1 G;  5JJK A;  4IPC A;  1JMC A;  2D0P A;  4DR3 L;  5FJ8 H;  4DV0 Q;  3OW2 A;  4DUZ Q;  4KLK A;  1YIT A;  1YIJ A;  2DUD A;  1TWH H;  1A63 A;  3M4P A;  3E9I A;  1OXV A;  1NTG A;  2A19 A;  3KF8 B;  1N36 L;  2N78 A;  4JI1 Q;  3G71 A;  1VQ7 A;  1ASZ A;  1T9H A;  5IP9 G;  1XPO A;  4JI5 Q;  4DUY Q;  1KRS A;  1K8A C;  2UXB Q;  3T1Y L;  1EOV A;  4BXX G;  4PG3 A;  4B3R L;  3RNU A;  3RZD H;  1HZC A;  2R7Z G;  3RLO A;  4Y7N H;  2JQO A;  2IT1 A;  4BY7 H;  1EFW A;  4DR1 L;  1AE3 A;  3U4V A;  5C44 G;  5GAE C;  1Y1W G;  1JE5 A;  1YI2 A;  3CCQ A;  4BA2 I;  4LF5 L;  1YNX A;  4L5Q A;  2CKZ B;  3I2Z A;  1C7Y A;  1N34 L;  1VQB A;  4B3R Q;  3BZC A;  3G4S A;  3CCE A;  1PH4 A;  2BA1 A;  4X66 L;  1FGU A;  5ELN A;  1HNZ L;  1N33 Q;  1IBK L;  1TWA H;  3H0G H;  1Q8K A;  4JV5 Q;  4XIG S;  1V43 A;  1CSQ A;  4OX9 L;  2AMC B;  4IPH A;  3W1B A;  5IT9 c;  4A3K G;  4X65 L;  5IP7 H;  1Q86 C;  4LUO A;  4GKJ L;  5LMN W;  4A3B H;  3IRB A;  1C9O A;  4GKK Q;  4LF4 L;  4DR6 L;  1HR0 L;  1XJV A;  4OWW B;  4P71 A;  1EYG A;  5ELO A;  2ZTE A;  4QY7 A;  4UPA A;  1VQ9 A;  1CSP A;  3MEF A;  1Q81 C;  4P74 A;  1TWG H;  4DR2 L;  2ZJQ A;  4BY7 G;  3RLF A;  4HIK A;  3J81 i;  2ZM6 Q;  3STB C;  3L0O A;  2NN6 G;  4DV3 Q;  5LMN L;  4GLX A;  1VQM A;  3S2H H;  5IYB G;  4DR7 Q;  4GNX B;  4IJL A;  5IYC G;  1N36 Q;  1TWC H;  4A76 A;  4JOI C;  5M5Y H;  1NJI C;  3L7Z C;  2VY3 A;  3OYY A;  5IP7 G;  3G6E A;  4Y52 H;  5HGQ A;  2Z6K C;  1EWI A;  3HKS A;  3T1H L;  1HNX Q;  4EQ5 A;  4X62 L;  3KDF A;  2IX0 A;  1WYD A;  3LGJ A;  2B63 G;  5C4X G;  5IP9 H;  4IFD G;  2MO1 A;  1I3Q H;  1UE5 A;  4A3K H;  5LMU L;  2NVY H;  1SE8 A;  2K4K A;  2UU9 L;  4IFD J;  3KJO A;  4A3E G;  4OWT B;  3HOY H;  1VQ4 A;  4KHZ A;  4GN4 B;  4JI3 L;  5GAD C;  1XMQ Q;  4X62 Q;  2E2J H;  1JJ2 A;  1S3O A;  1CKN A;  3UE0 A;  3HOU H;  1KL9 A;  2YTX A;  1U5K A;  4LUV A;  5IYC H;  4DR2 Q;  4K0K L;  4NB3 A;  1YJW A;  1L1O B;  1Y1W H;  5JJI A;  3JC6 6;  3A5Z B;  1N32 Q;  2JE6 I;  2Z0S A;  2I5M X;  3M9B A;  1X9N A;  3GTM H;  1YHA A;  5IYD G;  4YHH L;  4AYB E;  1ASY A;  4DV5 L;  1M1K C;  3BJU A;  4BBS G;  4LF9 Q;  4TQU S;  3GTO H;  1PYS B;  4R4T A;  4IOC A;  2BH8 A;  4DR5 L;  1B70 B;  2F52 A;  3CP0 A;  5M3F H;  1XNQ L;  3S14 H;  1OXS C;  2R93 H;  4A3E H;  3HOY G;  1VCI A;  2OQ0 A;  1Z9F A;  1FL0 A;  2B3G A;  2H5X A;  2VS1 A;  3F8T A;  3NBH B;  4LFA Q;  4LFC L;  4GKK L;  5C3E H;  2ASB A;  3HOU G;  1CKN B;  3I7F A;  1IBM Q;  2WFW A;  2ES2 A;  3HOZ G;  1K73 C;  4P72 A;  5AJ3 Q;  4BY1 H;  1B8A A;  1P16 A;  1MIU A;  3HKZ G;  4A3C G;  1VQA A;  3FKI H;  3HKZ E;  3CW2 C;  1K83 H;  3ER0 A;  2I5L X;  1E7Z A;  1KHI A;  4GLV B;  2GVB A;  4A3M H;  2NVQ H;  4DNI A;  3M7N A;  1X6O A;  1YBY A;  2KHJ A;  3CPF A;  2UUC L;  1PVO A;  2QGQ A;  2PMZ E;  1L0W A;  4LF5 Q;  2DGY A;  3GTK H;  1VQH A;  2Q2H A;  1CKM A;  1FVI A;  1X3E A;  3K7U C;  1N34 Q;  4GOP B;  1VQI A;  2WP8 J;  4A4I A;  1LUZ A;  4DV6 L;  5IE8 A;  1C0A A;  2PI2 E;  2HQL A;  4HJ8 A;  2EQS A;  2GVA A;  4WJ4 A;  3PUX A;  1PH8 A;  1MKH A;  3FKI G;  5E7N A;  5GRO A;  4HIM A;  4JI7 Q;  2B63 H;  4BBR G;  2VNU D;  1IZ6 A;  1KAW A;  2KHI A;  3HFZ B;  4LFC Q;  2CFM A;  4IO9 A;  1IBM L;  2YV5 A;  3H0G G;  3EIV A;  1PH9 A;  3I55 A;  4KHP Q;  3F2C A;  4QL5 A;  4R4Q A;  1Y14 B;  1B7Y B;  4JBK A;  4QQB X;  2RF4 A;  1EQR A;  4HJ9 A;  4JI6 L;  4DV1 Q;  3GO5 A;  4LNQ A;  4JI0 L;  1Y1V H;  1VQF A;  1P8L A;  2JA7 G;  1VQO A;  4FDB A;  1CKO A;  1N32 L;  1M90 C;  2UXD Q;  4DV5 Q;  3CXC A;  3CC7 A;  4YHH Q;  2RHQ B;  3GD7 A;  5IY0 A;  3GTL H;  4DK3 C;  3UDG A;  2I5H A;  3L2P A;  3A0J A;  3OTO L;  2UUA Q;  1VQN A;  2OTL A;  2QA4 A;  2VUM H;  3S17 H;  2PQA B;  4GN3 B;  4NXM L;  4DV7 Q;  3TRZ A;  2VL6 A;  5IYB H;  1X65 A;  2AHO B;  1MJC A;  3I4N G;  1SMX A;  1VQC A;  2K52 A;  4YWM A;  4AH6 A;  1XNR Q;  1HZB A;  2PQA A;  3CQZ H;  3GTJ H;  2Q2I A;  4A3J H;  1RIP A;  3GTP H;  4LW1 A;  2PNH A;  4A3F H;  3JAM c;  1EIY B;  1LYL A;  3KDF B;  5JEA J;  4UY8 C;  1K0R A;  2XTI A;  2UUB Q;  1VQ6 A;  4DR6 Q;  5FLX c;  4O0A A;  4JI2 L;  4A3C H;  1PH3 A;  3DLL A;  4B3S Q;  3F2D A;  4HJ7 A;  3G48 A;  2F4V Q;  2AWN A;  3KF6 A;  3W1G A;  4MTN A;  4DR7 L;  2F3I A;  1XMO L;  3CC2 A;  4LWC A;  2K75 A;  3CCV A;  1PH5 A;  3HOZ H;  4DV2 L;  2FXQ A;  2WB1 E;  3M3Y H;  4HIO A;  1SN8 A;  4KI0 A;  3U4Z A;  3UDX A;  4APV A;  3PUZ A;  1EIF A;  3BU2 A;  3S1Q H;  3PO3 G;  1W3S A;  2A1A A;  2MQH A;  3I4O A;  2NZH A;  2E5L L;  2OTJ A;  2OWO A;  2UUA L;  4DKA C;  3S15 H;  4LF4 Q;  4MZ9 A;  1Z47 A;  3J80 c;  3ICE A;  1QUQ A;  3CD6 A;  1X3G A;  4JI6 Q;  2GN5 A;  4WJ3 M;  1OTC A;  3D0F A;  1GKH A;  2L15 A;  2Y0S E;  2MO0 A;  2R7F A;  1K8G A;  4OXP A;  4JCV E;  4AQY L;  4JBM A;  2JA9 A;  3PUV A;  1N33 L;  1E24 A;  3H3V I;  3CMA A;  4DAY B;  1LTL A;  4C3I H;  1PHJ A;  4B3M Q;  3SGI A;  1OXT A;  3PGZ A;  1N9W A;  4A3I G;  1E3P A;  4DV4 L;  1Y1V G;  2WAQ G;  4BY1 G;  3UDF A;  1GO3 E;  3ULJ A;  1HJP A;  2ZJP A;  3RZO H;  2I0Q A;  1YJ9 A;  4JI4 L;  3K80 C;  1G29 1;  1IYJ B;  2OQK A;  4X64 Q;  2HIX A;  1L1O C;  1DGS A;  5FLM G;  3KJP A;  2BA0 A;  4LUZ A;  1Q82 C;  2JJQ A;  4HJ5 A;  1PV4 A;  3CC4 A;  4A3G H;  2ZTC A;  3I4N H;  1KD1 C;  4DUY L;  3D31 A;  3KOJ A;  1IBL L;  5K36 G;  2AWO A;  1WCM G;  1GD7 A;  4R4I A;  4PMW A;  1IL2 A;  3KF6 B;  1UE1 A;  2LXK A;  3HOW G;  2E2H H;  1PYB A;  1X56 A;  5GQO A;  1SR3 A;  4YCW A;  4AYB G;  2E8G A;  4B3S L;  2JA8 G;  2NVX H;  1QZH A;  4TVA B;  2D62 A;  3HOX H;  4L5S A;  3CCR A;  1A8V A;  3FHW A;  5FLM H;  1HNW Q;  1J5E L;  1TXY A;  3CCU A;  1NMF A;  1XMQ L;  3J7A 5;  1NE3 A;  2RHS B;  2EIF A;  5FJ8 G;  2ALY B;  2NZO A;  3M85 A;  4JI3 Q;  4PZ7 A;  4A93 H;  2VQF L;  4C2M H;  3J81 j;  4RMF A;  4R4O A;  1W2B A;  5M3M G;  2KEN A;  2CCZ A;  2R92 G;  3PV0 A;  5GAH C;  3T1H Q;  3GTQ H;  2IHE A;  2E2I H;  3OTO Q;  4OWX B;  2JA8 H;  3RLN A;  1SLJ A;  2LXJ A;  2KBN A;  3M4Q A;  4JG2 A;  4UP8 A;  1KC8 C;  4LFB Q;  2R93 G;  1V1Q A;  1EQQ A;  4BXX H;  2HHH L;  5C0X J;  1WCM H;  3PO3 H;  4OON A;  1XTD A;  3I56 A;  3HOV G;  4X6A H;  1PA6 A;  4YCU A;  4DV3 L;  1SRO A;  4PZ8 A;  2Z6K A;  4NPS A;  3AQQ A;  2WAQ E;  4GNX A;  4JI0 Q;  2RCN A;  3FP9 A;  5IWA L;  4A3I H;  2Q2U A;  3CAM A;  3PSI A;  1HNW L;  4IFD I;  3AYH B;  2R7D A;  2V1C C;  1LM0 A;  2VW9 A;  2CQO A;  5C4X H;  4A3M G;  4X64 L;  1UE7 A;  1OXX K;  4JC0 A;  1JB7 A;  4DAM A;  2N3S A;  3A5U A;  4C3H H;  4X65 Q;  3NEL A;  3ZJY C;  1HR0 Q;  4A3L G;  4JI7 L;  1HH2 P;  1RL2 A;  1AE2 A;  4IPG A;  2UXC L;  3MXN B;  4IJH A;  5JEA G;  1PH7 A;  3CCS A;  1PFS A;  1YZ6 A;  4EX5 A;  4KHP L;  1PH1 A;  4DV4 Q;  3KLW A;  4PZ6 A;  4A75 A;  3EN2 A;  4A3F G;  1L1O A;  2VUM G;  4JYA L;  3UDI A;  5C0X G;  1IBK Q;  1XPU A;  1O7I A;  3STB D;  4JV5 L;  4X66 Q;  2ZJR A;  4LF8 L;  4O2D A;  4BBS H;  5GAG C;  3S16 H;  4YY3 L;  4B3T L;  3PF4 A;  5IYD H;  1JJG A;  4ALP A;  3Q8D A;  2R6G A;  3S24 A;  4C3J H;  3TRE A;  2YTV A;  3PCO B;  3ULL A;  1KIX A;  4L5R C;  2D0O A;  2A8V A;  3CF5 A;  2Y0S G;  4DR1 Q;  4OO1 I;  2K50 A;  4YY3 Q;  2K14 A;  4B3T Q;  1YHB A;  2UUC Q;  1D8L A;  1PH2 A;  2N49 A;  3AFQ A;  1N8R C;  3TS2 A;  4A3D G;  1VQ8 A;  2OCE A;  2ZTD A;  1GVP A;  1HNZ Q;  4ME3 A;  1BKB A;  1TWF H;  2MNA A;  3CCJ A;  1XPR A;  2E5L Q;  3S2D H;  4A93 G;  1VQG A;  2JA5 G;  4JI5 L;  4YWK A;  1JJC B;  1VQJ A;  2MFI A;  4IOA A;  1H95 A;  2CWA A;  4GLA C;  2NVT H;  1I5F A;  3K8A A;  4GS3 A;  4JI2 Q;  1GM5 A;  2UUB L;  2WB1 G;  2IHF A;  2F4V L;  2QEX A;  5J3B A;  1MJE A;  4RG1 A;  1Q1B A;  4BBR H;  2VQE L;  2YU9 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...