4DV3F

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a, bound with streptomycin
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 20
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dv3F00
1N34F 4JI8F 4DV3F 2UXCF 4AQYF 1CQNA 1HNZF 4NXMF 4JV5F 1N33F 3OTOF 4X62F 1IBLF 4LFCF 2VQFF 1RISA 4GKJF 1FJGF 4X66F 4DR5F 1HNXF 2BVZA 2YY3A 4JI0F 4DR6F 2F4VF 4NXNF 4DUZF 4JI1F 1G7CB 4JI4F 4LF8F 4JI6F 2KJVA 2ZM6F 4LFAF 2VQEF 1HR0F 5LMNF 2BXJA 2UUBF 4B3MF 3ZZPA 5LMUF 4DR3F 4JI5F 4KHPF 4DR7F 2UUCF 3T1YF 4LF4F 4DV5F 1HNWF 1F60B 4DUYF 4DV6F 4DR2F 4LF7F 4LF9F 4X64F 3R3TA 4YY3F 1J5EF 4DV2F 4GKKF 1VMBA 2KJWA 2UUAF 4JI7F 4YHHF 1IJEB 1XNQF 4DV0F 4JI2F 1FKAF 4JI3F 2J5AA 1G1XA 2B7CB 1B64A 2B7BB 1IJFB 4DR1F 4DV4F 4LF5F 1XMQF 3T1HF 4B3SF 4DR4F 2UXDF 4DV1F 1N36F 4LF6F 2UXBF 4JYAF 1XMOF 5BR8F 4B3TF 4K0KF 2RJZA 4B3RF 1CQMA 4X65F 4LFBF 1I94F 4DV7F 1IBMF 1XNRF 1GH8A 1QJHA 1IBKF 2E5LF 1N32F 5AJ3F 1LOUA 2UU9F 5IWAF 2HHHF 4OX9F
chains in the Genus database with same CATH superfamily
4DR6J 5HMWA 3MI7X 3G2XA 3ZZOA 4DG1A 5C25A 3BQ0A 3Q83A 3SV4A 4IG0B 4NMXA 1DBDA 2AEFA 2YPYA 1YIJS 5KFWA 2YWGA 3J7ZT 2QV6A 2Z2YB 3GSIA 2UUBJ 3LP1B 2CNOB 2EPIA 1V3ZA 3IM8A 1S0MA 1BE4A 3OR1B 4KC5A 1BC6A 4F36A 4ZS6A 4Z37A 2E1AA 3UN3A 3PNIA 1HQ2A 4CZCA 4EGLA 2IBKA 2NLWA 2HNZA 2ROPA 1RT2B 4ID5A 2DD8S 4DOZA 8RUCA 1O6XA 2IAJB 4H4OB 2HGLA 4K5SA 1Q5VA 3CD5A 2LFVA 4QW8A 4DG1B 3DGPB 4WYWA 2WSEC 2XWYA 3LGNA 2GW8A 2AEMA 3DLEA 1L3TA 2HW3A 4URQU 2HVDA 2WCXA 4USVA 5DQGA 1HQUB 4D3HA 2PFFB 3TJAA 4B3RF 2LVWA 3KMSA 4PWDA 1BQMA 2X3GA 1CS4A 5EDWA 5IWAF 1P6TA 4UOFA 3MPUB 1UA0A 3SSQA 4DV6J 1R6YA 2COLA 1FVSA 3OTEA 2J7UA 5J1EB 4ID5B 1SI9A 3H25A 3CDUA 1CJVB 3QFWA 2Y3YA 4RWXA 2JLFA 1TK8A 2V4QA 2C2RA 4ELVA 4CLTA 4CLYA 4OYPA 3J81j 3KLHA 3DLEB 5KFVA 1E6YA 4FS1A 3N0VA 3ENAA 4PWDB 2XGQA 4LF7F 3PEJA 1HFEL 2JWNA 2P6TA 2HS0A 2HBZB 3FBCA 5ETPA 4W92B 1UA1A 3W60A 4OI4A 5L1IA 1AW0A 5HAOA 2GAGC 3JQJA 1MSWD 2W2OP 2OTLS 1IR2A 4X4NA 3CC2S 4RNOA 3H2UB 2CRLA 4EZ6A 5HMYA 4YR0A 3L4BC 2EKNA 3JQMA 1FHTA 1GH8A 1HWIA 2PFDA 1XWLA 5D0HA 2HRUA 1RTZA 1E6YB 1RBAA 4J9PA 2FY1A 5EUHA 1YBUA 3EZ5A 4DWIA 5CHCB 2HQFA 4C2MA 1S1TA 2OIHA 1WDDA 2RRBA 4ES3A 2ZD1B 3HHLD 4P9SA 4A8KA 1RT6B 1S1VB 3ZFVA 2CJBA 3IS9A 1I1GA 2KT3A 1FRHA 5F0UA 4KV8A 1OY9A 3CCMS 4L75A 1KQSR 1KS2A 5GAHI 1BGXT 4K4UA 1FD8A 3CJSA 2IVFB 4HI1A 4X65J 2EFNA 2BUNA 1XMBA 1LFPA 1S59A 2IRXA 2HG4A 3I4PA 3Q89A 2PC6A 1TUGB 3DMJA 3T1AA 3CJTA 2BE2A 3DLLQ 1N5VA 1J5OA 1KEKA 2FHJA 2DNOA 4GC7A 4WJBA 1T9VA 1KFDA 2XI3A 3OHAA 3R27A 3VVTA 3KJNB 5A0YA 1SKRA 3IS9B 2MQMA 4KV8B 3A8IA 3C14A 2ZVIA 1VK8A 3GCWP 2LQBA 2VFSA 3SZ2A 3M4XA 3MPYA 2RUGA 2GVZA 4RW8A 3BPDA 4NXNF 1PC4A 1VRUA 3V6JA 3V6DB 2GHPA 3BJYA 5F9NA 1X4FA 2Z57B 2DIUA 3IRXA 2YQ3A 2HZVA 3TAMB 2BABA 4OZJA 3NAIA 2QFIA 4TKTA 3CT9A 2WVEA 3ELHA 3EPIA 1U24A 2YNHA 3PACA 2KM8C 2PGCA 4DV0F 5A0YB 1S0NA 1GMUA 5KFRA 4Y6IA 1FXLA 2ZWOA 3DLJA 3PRDA 3HT0A 1H6KX 5HBMA 4A8SA 1WHWA 4RW8B 4XK8C 1VRUB 2KG1A 3FGVA 3DRPA 1UJ6A 2OPSB 1RKJA 3P96A 2F65A 3IRXB 1RHUB 2HWHA 3ILIA 3DCAA 1LW2A 4LQ9A 4KGZB 2C3PA 1DARA 4PG6A 3G71S 3T5JA 2SXLA 4C3KA 2VU5A 3BQ2A 3UNGC 1RA6A 2PA8D 3NCQA 2CQ4A 2YNHB 4IR1A 2RF2A 2AX1A 4NE9C 1RWOB 1Y10A 3CB4A 1QTNB 2A10A 1RT5B 3M30B 5HQ8A 3GPAA 2QYCA 1D09B 1VC5A 2W2QP 2ZZTA 2OJ3A 2GIFA 1HMVA 1M5OC 1LW2B 4X4SA 4X4QA 2ASLA 4AYBD 2R2TA 1S1WA 3Q8UA 2AZ3A 1T05A 1N5YA 4JI0J 3MAAB 2Z2ZA 2XY7A 4IQMA 3H2VE 2LCWA 4LRCA 3PX4A 7FDRA 3F56A 4FF4A 1KVKA 3TJ8A 2VBXA 1OO0B 4ZVTB 2H3EB 2YKOA 3MD3A 3JSYA 1G2EA 1IKWA 4KE5A 3PHEA 3ETOA 3T9ZA 7FD1A 3QWPA 2ZNZA 1Y00A 2DT9A 3JTPA 1HMVB 1NXIA 3DLBA 1OQ6A 3Q2TC 4M5LA 3GJQB 2B3TB 2ZM6J 2BYCA 2ZHOA 2CQPA 4F3MA 1S1WB 1XBWA 3HD2A 1AFIA 1BMQB 2DH7A 4Y3CA 1T05B 4LF9J 1KTQA 4YB6A 5I3PA 1OPZA 4CTAA 4B3MF 4M5DA 3DYAA 4B02A 2FUG9 4LF4F 1N0VC 1WKLA 2QRRA 3W5XA 1XNRJ 3ETMA 1N32J 2OI2A 2BV3A 2KHCA 3NNAA 1ZETA 2AQ4A 1MU2B 2DKOB 1IJEB 4NCGB 3S8SA 5DDOC 2XCPA 3MEEA 2V2QA 2YWKA 2E5IA 4B17A 1F1BB 3DFEA 4KPCA 4RZRA 2VICA 1FRLA 1RT7A 2VG5A 4USWA 4JI4J 3SCJE 3I9V9 3NLCA 2KKHA 1JLEA 4PEOA 2RILA 4OYXA 4X62J 1IQZA 4ZP9A 1XC9A 4CTAB 3BYRA 3QO9B 3CCZA 1SUQA 3DYAB 1HA1A 1HWKA 2QLFB 4U96A 3BGRB 2MKCA 4IKAA 3G4SS 4XPEA 2VPZB 1VQ7S 1E6VA 4X84A 5KFCA 1RAIB 4MT1A 1X9WA 1TKDA 4DUTA 5ETNA 5EX3A 1HBUA 4RW7A 2HQDA 3AOAA 3GG1A 4DV2J 1RT7B 4NASA 1B0TA 1HYSB 2AEJA 2I5JA 3DLHA 3R5CA 1UVJA 5M2UA 3OV7A 2ABYA 1SUQB 3PYFA 3TW0A 3G6XA 4KB7A 1JLAA 3VCDA 2J7KA 1SL2A 1HBMB 2F8HA 4QIGA 3GZ7A 4LF2A 3D6MB 2BBEA 1FEHA 1FFSB 2DRAA 2L9WA 3FDSA 2XMWA 2GHWA 2YNFA 2HVZA 1E6VB 3EZOA 4XDDA 2Z8QA 4WK3A 3JB9k 2HYIB 2UXCJ 5DRKA 1HBUB 2RS2A 3PCOB 2MJNA 4B3OB 4NI2A 3OXLA 1HNXJ 2CWXA 4P72A 1A0OB 2QLBB 4DQPA 3G8QA 2AW0A 3HT3A 3OVAA 1SCJB 2BQUA 4OV6A 2X51A 1TV6A 1FJGF 4IOCQ 3D1HA 4LBIA 2R42A 2H9ZA 1M5PC 4DR3J 2F4VF 1KWMA 2B0GA 3V2UC 1FRJA 1RI7A 3SBMA 2O5DA 1WACA 1J5EJ 1S1UA 4KIAA 1HNIB 1J2VA 1U8SA 3OTCA 1S99A 3KK3A 2O67A 2AGPA 1URNA 4X4UA 3M8SA 3N6NA 3QT8A 1LEOA 2YNIB 1Q82T 4AUKA 2R2RA 4F67A 1DQ8A 2IVMA 4W4MA 4DQQA 2VJUA 3RU0A 1FWLA 5IT0A 2RU3A 4CO3A 3IR5B 1YRXA 1N56A 4NZ7A 3RW6A 3PYDA 4MYTA 2WSFC 2KZZA 2MMYA 4CLFA 3CJRA 4N56A 2WB1D 1QAJA 1JLQA 3QWUA 4PXCA 1NO8A 2N3LA 1N34F 3LAMA 3D54A 4AQYF 4ZITA 3VHQA 3THTA 2DCUB 1A6LA 3CGIA 1VRQC 4CO4A 3GYNA 4WP3A 2B9WA 1MG7A 3DRRA 1RSCA 5D4OA 2VFTA 1KLMA 2V69A 2B6AB 4ZIVA 2P9CA 1DY3A 3TUZC 1DFDA 1TR0A 3FZ2A 2AD9A 2BXJA 5B0DA 4S0MA 2AGQA 1F60B 1HLWA 2LXIA 1Q7LB 2MY8A 1SC3B 4ZVRB 1VIOA 1TU0B 5ETOA 3L7PA 5CYQB 4OHZA 2GNKA 3W2VB 4JI3F 1Y3KA 3IA0A 1I94J 3DRRB 2RS8A 2OTJS 1ZA2B 2DR5A 1OSDA 4V19X 1N5TA 1KLMB 1RQ0A 1HHSA 1ZA1B 3R5DA 3CVKA 4HHHA 3VTIA 1NJWA 4K8RA 4IRKA 3EGZA 3T19A 2XYPB 3PY8A 3ZZUA 2VA3A 1R0AA 2R7TA 2CZ9A 2H5JB 1HNVA 4NWBA 1YJVA 1JWWA 3EVOA 3G86A 3OVBA 4J7CA 2VQEJ 5K14A 2MZSA 1WOPA 1JLCA 4QIEA 4G3IA 3AJDA 2Y1IA 2DNZA 2KXNB 3R2DJ 2I1RA 3LQVA 3OPKA 1Q78A 2KH9A 2QX0A 2Y0SD 3KJFB 1NSAA 2FJAB 5HQMA 2B4PA 2DISA 1VYAA 4Q5VA 1FI4A 2UXDJ 1HNVB 1IR0A 1VR6A 4RBUA 2VG7A 4Z7CA 3TRGA 1RAFB 4FVMA 5K14B 3BDPA 3I55S 1JLCB 2CNKB 3DN9A 4OX9J 1T9TA 2A3JA 1JLBA 3V4IA 2Q3PA 3SQOP 2CDRB 4DL3A 2ACYA 5EWEA 3HO1A 1SQFA 4DCPB 2J8SA 4J37A 4QYRA 4WXOA 1PO6A 2M88A 4CT8A 4ANEA 3C2PA 1RA7A 2Y0BB 4TYBA 1FDBA 1JIHA 3LW5C 2VG7B 1FWPA 5L1LA 1G7CB 4G1PA 4X2BA 4F0KA 4USJC 3IGNA 2W9BA 5KFPA 4LUBA 1HWLA 4DL0C 2MDAA 3HVTA 1G3OA 4G1QA 1DLOA 1N5QA 2VF3A 3TYTA 3CMAS 2K8GA 2YKAA 2ZDOA 2OMLA 3Q23A 1VJQA 4DBQA 2UUAF 5D0EA 1YRUA 2D1CA 3Q0AA 2YQ1A 2J9DE 3DOMA 2LEAA 3DXBA 2E7XA 2CQ1A 3Q86A 4WTOB 5IT9Y 1MN7A 2EWHA 1CJTA 3I96A 3QZ8A 4JI8J 4RW6A 1D0EA 5A8KA 2HNYA 1EQMA 4WZQA 5H9FJ 4DQSA 3OL8A 2W9BB 2QMUB 5J2NB 3KJQB 4RUAA 4RU2A 3HVTB 4ER8A 4G1QB 5KFKA 1DLOB 2B9YA 3M8PB 3BN4A 1NH7A 1SJRA 2LLZA 3MDFA 3T9NA 2V63A 2RRAA 1MWQA 4U7CA 1SQEA 2E7VA 2NZCA 1GXLA 1R7IA 5KT5A 1OSCA 3DOMB 4J91A 2ZH4A 1G4CA 3HSJA 3DLGB 4C8OA 3QJJA 1YZ7A 4RW6B 2ZOGA 1ELOA 2MZJA 4BWMA 3HJFA 3M2VB 4IDKA 4U7UK 1VQ5S 1SV5A 4CM0A 4N5SA 1KONA 2C2DA 3RAMA 2B7CB 1HQEA 5DZ6A 1JX4A 3I0SB 2CADA 2XYHB 1VHIA 4KBIA 2JC0A 1S77D 1LWXA 1X31C 1FXRA 4X66J 2K1RB 3IR6B 1CQNA 1TVRA 3K8VA 2KFYA 3CCRS 2B56A 4IDKB 3MTJA 2EVZA 1CPZA 1B3TA 1FNMA 2KRRA 1V5VA 1SV5B 1EB0A 3NGSA 1WJ9A 1FT8A 1HQEB 3HFKA 2QGFB 1BQXA 2VFUA 4L74A 5F8GA 2KG0A 3NXZA 3G96A 1MLAA 3MEGB 3M9NB 5IOLA 4OZ3A 1WC3A 4WKRA 3UD4P 2EW9A 1ZM9A 1IXKA 1QSSA 4EMDA 3PTWA 2KRBA 1K8AT 5J1NA 1S1XA 4RL1A 3NAHA 3FCHA 4I1TA 4PRFA 4EZ9A 4ZP7A 3RB4A 2XTJP 1TVRB 4PZVA 1VRTA 5E5NA 4DMZA 2IIHA 2A2DA 2OEKA 1IM6A 3NS7B 1FRKA 4DV1F 1BQNA 4DDFA 2H5IB 3X3UA 1JJHA 4LVNP 4OZ0A 5G0RA 3JYTA 3LUYA 1QLNA 1FJ7A 1RWWB 4RUBA 2V50A 4OI6A 4KR0B 3O8WA 2HWTA 2HFUA 3GQCA 1S1XB 4JI1J 5E2QA 4KKOA 1RWPB 4LF1A 5C42A 3HD1A 3GIMA 1ZZFA 4CLUA 2W7AA 1S4FA 2XLIA 2ALZA 4OJHA 2HMIB 3EDRB 1VRTB 4CP5A 1VQNS 3PYGA 3ISNC 2ILZA 1RAGB 3KXDA 1BQNB 3OW2R 4XIUA 5HI7A 3R7BB 5HROA 5B0AA 1XJWB 3KOAA 1AZSA 4EO8A 2NPFA 2Y9HA 4W98A 2ZNYA 1JQGA 2KB2A 4CRJA 4CH7A 4PG7A 4PABA 5IM0A 1WOSA 2AU0A 1TKXA 3R5JB 4KKOB 2QLWA 4FS2A 3LWMA 2VKRA 4PG4A 3PJ9A 1K0VA 3AB2B 5H9FK 3EYZA 2YWEA 4WWSA 2C3OA 2G1DA 4GVLA 4ILRA 1AZSB 2W7OA 3POTB 5LT5A 5DG7A 4Q43A 5LSLA 4R8UB 5IM0B 1TKXB 2JEIA 5JXSA 4CLKA 2GGPB 2EC0A 1RYSA 3FMBA 2KJVA 2FLNA 3VAIA 1NU4A 3SSSA 2MPUA 6FD1A 5KFNA 4TYAA 3QGPA 3EDQB 2LEBA 1IKYB 2D9PA 2WOMA 4B3SJ 3DDIA 4BBYA 5F8NA 2AP6A 1UMJA 2IM2A 4IH5A 2FHMA 2D74B 4KGXB 3CCES 4PUOB 4BS2A 2KXHA 1HHTP 2NPIA 3TJ9A 3RW7A 4NX9A 1V3RA 1IWGA 3DU6A 4PG5A 5IV3A 1HL6A 1A7GE 3TUPA 2FLPA 5KT4A 2IRYA 4TLRA 3CF5Q 3WQPA 4B9NA 5FDLA 5CZVA 5H9EJ 4F04B 3RR7A 2CXEA 3BH6B 1FKPB 4I6AA 1CULB 4NYOA 2P9EA 1HKAA 3AXKA 1AUSL 1QUVA 1T9YA 4QZVB 1YK9A 4K4WA 1Z1ZA 2J9EA 2HVEA 2MKHA 5KG5A 3GSDA 1FEEA 2AV5A 3SMZA 5BXIA 2FGCA 1P1LA 4OHWA 4NLUA 3MMAB 3KK1A 2VFVA 1NKEA 5FDLB 1EHWA 5F9LA 3VF0B 3K5LA 2XCAA 1RAJA 4IFYB 4JV2A 4B3RJ 1RUSA 2HAFA 2HHQA 2HHSA 3A8KA 4MIBA 4NLYA 3TANA 3TARA 5IWAJ 2K06A 1MN9A 4I2QA 2V94A 2ZZMA 4B3TF 3QT6A 5BYSA 4F26A 1RXOB 2ZC3A 3P5TL 1KDNA 4JI6J 2FJVA 2JRSA 3W8PA 4CO2A 3K7RA 3M8YA 3CWJA 3KK1B 2J7WA 5D3GA 1CSJA 1YJ7A 3AY0A 1DTTB 1S0OA 1P9QC 3AB4B 2EK1A 4CLSA 3D0HE 1U1NA 3D7SB 4LF7J 4L76A 5KG0A 4C0HA 1V3SA 2CQ0A 3OLAA 4QCLA 3D68A 4I2QB 2R2SA 3AH6A 3GP9A 2KFNA 3DXSX 1HW8A 3F73A 2BE7D 2DO0A 2NYIA 4ILLA 1P27B 5KFAA 4I7FA 1M5VC 3CW2C 3FQKA 1T0TV 1GMWA 1JKHB 2DNRA 3H98A 4RNFA 2WBMA 1S97A 1O8BA 4DU8A 3DRSB 2X1BA 3OFFA 5DO2A 1K9MT 2VBWA 4O3PA 2CZVC 3ENVA 3M2UB 4C8KA 2DR7A 5GAEI 3UCZP 3QATA 2LYVA 4NRTA 1Y7PA 3E01A 1VBZA 5G4DA 1JNRB 4KO0B 2OFHX 4I7FB 4YN3B 4LFCF 2Y1RI 1U0HB 2GZOA 1WG5A 2XSJA 3F41A 2PDAA 3AJ2A 5BJRA 2YY3A 4P2XA 4WFYA 5F0WA 4F4KA 4NLTA 4F02A 3RG6A 3J7AN 3IR7B 4CH0S 3GV7B 2RQMA 3R5BA 1VIXA 4CYUA 4OYOA 2DHHA 1C1CA 1IKXA 2B5JB 1FRIA 2LU1A 1B0VA 3BDEA 3E01B 2CJXB 2GV1A 4L73A 3CC7S 4A8FA 1TL4A 5IQQA 3DNCA 4LF5F 1VQOS 5B08A 4PYDA 3G8SA 2CQIA 1N6QA 2MSSA 5KFSA 3TWZA 4QWBA 1S6PB 3FZBA 3KKFA 3K8WA 2UU9F 2J0QD 1CC8A 5KFDA 3T6BA 4P71A 4CYUB 5H9EK 4NXNJ 1IKXB 4Y2AA 1Q95G 1HBNA 4F25A 4OL8A 1Q8BA 3PJWA 1KFSA 1BWVA 2BVZA 1ZAWA 2CNLB 2WVFA 2GAHC 4KH0B 1SJ1A 1S6OA 4DR4J 4O3OA 4WP8A 5LOQA 1N6QB 2BACA 4DV0J 3VQSA 3W2WB 2KL8A 2VKZG 1SVDA 4HL9A 2E5LJ 2ZWPA 1TAUA 1ACMB 1CBKA 1UWBA 4URSA 1IWAA 5KG1A 2B43A 1HBNB 4RJVA 3FJ2A 3LTOA 4ALZA 3R2CJ 1JJ2R 4MMOA 1WHYA 4DSKA 3ICLA 3KFWX 3C16B 3IBFB 3R1HA 4OHVA 3M8ZA 2BW2A 4LF8J 4K4SA 1R8HA 4A8WA 4TN2A 3M32B 3A13A 3AD8C 3WIUA 2HHHF 2NXEA 3GR0A 4Q8EA 4UOGA 1RT1A 1CEZA 1U1RA 3ZNUA 1TK5A 1F9FA 1UWBB 3CD7A 3AA9A 3H7HB 3C3LA 2XMMA 1YQHA 2IJNA 3SEOA 5KFFA 2BOAA 4ICLA 2U2FA 3UI3A 3PIPQ 3N4WA 3U27A 1VQ4S 2F1FA 2CJ9A 1S7IA 1U45A 4NLXA 2OLWA 2UXBJ 5KFLA 3PIOQ 3ZZTA 3GJTB 3QIPA 4YB7A 4LIWA 2W8KA 4MIWA 3M8WA 2LDIA 5AXLA 3AHPA 5CD4H 1S10A 1DQ9A 4MH8A 2PMHA 1RT1B 1F3VA 1P8GA 2DHGA 3KLIB 3QJLA 5AE2A 2YNGA 2VC1A 2NXUA 3R1LA 5KFXA 3H5YA 1NSKL 5IT4A 3SCLE 5KFUA 4K0KF 3H5XA 1NKBA 4V19J 2LQ8A 2M8DB 1YLXA 1UEUA 2CUYA 4NA3A 4HDGA 3HK2A 2HFOA 5J2PB 4CLLA 4ZVPB 3LH2S 5FD1A 3EGNA 2V8DA 1ZZNA 4C8MA 5L9XA 3GV5B 4LF4J 5F8MA 4R0EA 2YNGB 4TNOA 4D3GA 5D78A 1YI2S 1R27B 1MWYA 1CLFA 2JEGA 3C46A 1MWZA 1TL7A 3I82A 4EBEA 4FN5A 2J9CA 4K2JA 3LGHA 4ZK7M 4RX6A 5HVGA 4M5IA 2M2BA 4NCAA 4WK1A 3HXMA 5CXTA 3CC4S 1JXVA 3T6JA 4U7UD 5A8RA 4USTA 1K1QA 3J7YU 4N7TA 4ZVUB 3IWNC 3MECA 5I42A 5E41A 5HANA 3DOKA 2RRNA 4IFVA 1OYEA 4R5PB 1U1OA 1YITS 3HJVA 4OI0A 2KTQA 2MY7A 2BMBA 5IQ6A 4KT0C 1OPIA 1RTHA 1NDKA 3KLEA 3FKBA 2W24A 4CLWA 1HWJA 5K9FA 2HGMA 3I31A 1WSVA 4DF4A 2BA9A 2Q6CA 2CYYA 2OD4A 2D3ZA 3EGWB 1N0UA 4L3NA 4ED4A 1Q5YA 4P75A 4NLWA 5A8RB 4DX7A 2I8EA 4YS2A 1VQMS 5E3AA 3C19A 2J0SD 3MECB 4Q2MA 1N4LA 3DOLA 4IFVB 4JI5F 1NK9A 3OLBA 1TK0A 3R5AA 2NUHA 2HHWA 3IM9A 3R9LA 4TQRA 1S72S 3AT1B 1MMDA 3CCTA 1QAYA 4QU7A 2ZH8A 3LP0A 4OZ2A 2AKWB 4C7QA 4FXDA 2NYHA 4FYVB 4NLPA 3VAGA 2F9JA 5F3ZA 2V8VA 5A8WB 2IJRA 4OX7A 2QL5B 1XMQF 1C1BA 2W9CA 3D6TB 1JLFA 2V68A 4OFZA 5KT7A 3MM7B 5DETA 1T03A 1WSRA 1LXJA 2KXFA 3ILOA 3B78A 5KOWA 3DOLB 3TVKA 2MQQA 3PX0A 1FJGJ 2ADBA 4O3QA 1L3SA 1ITPA 3TEHB 2F4VJ 2DCLA 4K50A 1FXDA 2Z4PA 3JQKA 2HRYA 2VQFF 1T3OA 2WONA 1PJ6A 3UR0A 3LP0B 3D3CJ 4QR2A 3ISZA 1LW0B 2WVBA 1VQ9S 5BYRA 4WYLA 3RYLA 2HFZA 2W9CB 4Q2LA 2MQPA 3TZZA 3QJPA 1RAOA 4DPWA 5ETSA 1T03B 2B51A 1NRKA 2MSTA 4FVCA 5GAGI 2R8GA 3W9HA 1RT3A 4RW4B 2R4FA 1UVLA 3IC1A 1YX2A 1WHVA 4ECSA 1H3DA 2FVPA 5D4PA 1OJ4A 3HHLC 4DX5A 2CPHA 2Y8WA 3ADAC 2CAJA 3T5LA 4I6YA 4HLBA 3EPGA 1N34J 4AQYJ 2OUGA 2DGVA 4ECUA 4XPCA 5CABA 1Q1KA 2DRBA 3P4UB 2E9TA 2UUCJ 1EETA 2AYEA 1PCAA 3AFGA 2YKMA 2DGWA 3AODA 2XSFA 5DG9A 2R3VA 1D9AA 1RT3B 2HBYB 1RDRA 2CQHA 5DLFA 1VOMA 3KUGA 2E29A 2OO4A 3HHLA 2QG9B 4USKA 1PBAA 4USUA 1MW7A 2PD1A 1HBOA 4AL6A 1B7FA 3MMBA 3DLKA 4RLEA 3VV2B 1RTDA 4DX6A 2QMXA 3CO9A 4YFUA 1YSJA 4DV6F 4JI3J 2RT3A 5KG3A 2EFVA 1EETB 4EBDA 2XMVA 4ITSA 3QSIA 2GIQA 1FRMA 5DDPC 4CO1A 5JUMA 4B9TA 3QT7A 2HK2A 1HPZA 3CTRA 3BO2A 1RWUA 2OPQB 2EFGA 1R43A 1HBOB 3MEDA 1C0UB 2BJDA 2F9DA 3CCLS 2LQJA 4Q0BB 2ZH2A 4LJMA 3KLVA 2PIIA 2BKOA 1W2IA 1NK4A 1REVB 1F2GA 4J9RA 1ZM2A 4PCQA 3V5RA 4F4YA 2W7PA 4U8YA 3M6UA 5J2QA 1S6QA 3TAPA 5A2QU 2POKA 3FSYA 4QWEA 3TZXA 5K8MA 3PJXA 3GJSB 4CO5A 3BEGB 1REGX 2DR6A 4CNZA 3HM9A 4C11A 2XEXA 4B08A 2HWIA 2MTLA 1GTEA 2XMUA 4M1KA 2A6MA 4ZVFA 4ZVEA 3MR3A 4YDXA 1I5OB 4I6WA 4FF3A 3MM6A 3VAFA 2ZKUA 3UD3P 1QD1A 3MEKA 4C0OC 3UDLA 3LANA 3AD7C 2Z2LA 4E8UA 4ED1A 5DQHA 1T9WA 2E44A 2XS7A 1UKUA 2BE9B 4OQJA 3N6LA 3PZPA 1HARA 4F50A 3PEHA 4YB1P 3RAXA 4YDDB 4CO0A 2LXUA 4DS4A 4IO9Q 3K5NA 2E9RX 5EGYA 2MGZA 1RTIB 5D0GA 5IXUA 2H1YA 2QC3A 2FVQA 3AA8A 2UV8A 4JV5F 1KNZA 2RAQA 1Q0NA 4ETZA 2N3OA 1VBXA 3KK2A 1X5OA 2V34A 3HSZA 1YZ6A 3THVA 2IHR1 2D3OR 3A8EA 3KLGA 2UUAJ 4DQRA 3HSDA 5CCMA 4P6QA 5DQIA 3J80U 2NCKL 4PXBA 3QFHA 5ETMA 2R8KA 4ERDA 4Q7AA 2I38A 3FRYA 4QWCA 5T14A 1XNQF 1DAXA 2DNGA 3A12A 2B7BB 1S49A 3KHGA 1DZ5A 2EK6A 4P73A 4H4KC 1WTBA 4TY8A 2ZDPA 3OR2B 1S9EB 4FBTA 3KK2B 4PXDA 1NJIT 3IAS9 5MLCV 3ZTSA 2KT5A 1XEZA 1RHQB 1XERA 4K4VA 2YKNA 2CPDA 1D8ZA 1UZHA 1U6BA 3MR6A 3IG1A 3BKUA 1FKOA 1IN0A 1RBOB 4O4GB 3DKDA 1Q53A 3QRQA 4DSEA 4DN9A 3GFXA 2VPXB 4H4KA 2RDIA 1S9GB 3FQLA 1GTHA 1OIAA 4GC6A 2RSQA 3ZTPA 4PWUA 2W2PP 2RH3A 4C8LA 1B99A 4BC7A 3B4MA 2BX6A 4DV7J 4F8RA 2J0XA 2KO1A 4DUYF 3H4BA 2G2OA 1Z2ZA 2Z58B 2DGTA 5L9NA 3IWXA 4ZVSB 4P7TA 2B4UA 3I0RA 1HWUA 3OT9A 4WU3A 3OTOJ 5AXNA 2UUTA 2G9OA 2IBOA 4H4MA 3I56S 2J76E 1VLOA 2LU2A 2HPUA 1NM2A 2PI5A 3PRVA 3W62A 2AF6A 3MD1A 2MLZA 4NPOA 1EAYC 2ZOMA 2F63A 1T3NA 3VGSA 2JLEA 2C2ZB 3MOZA 3NOGA 1AUDA 2OEJA 3QSYB 5KFTA 2W8LA 2HGNA 3HZEA 4CI0B 2XWXA 3K57A 6FDRA 2WRMA 4DPXA 4HT7A 4JI0F 1D9FA 2EG2A 2Z30B 3W9IA 1RWVB 4H4MB 5KFQA 3LPYA 2YX7A 3DHWC 2EG1A 2EXUA 4NEYA 2K3KA 5LMNF 1K1SA 1H73A 4DN0A 2D69A 3M8QA 5C25B 2R7SA 4XO0A 1YKWA 1VQLS 1RU2A 3UPFA 4DV1J 2GO8A 3DGVA 5CCLA 1LV5A 2KFZA 3RZAA 4YEAA 3SXLA 5DG8A 1O5JA 4X4PA 4FNHA 3LP2A 1ZAVA 4AT1B 1WEZA 2HNZB 3OD2A 2UUWA 2YKPA 1N8RT 1XNRF 1N32F 3EXYA 1N54B 2GQQA 3QPIA 1OYDA 5T7LA 3GYGA 2YQ0A 3KUHA 4LIRA 4OYIA 1BQMB 1CS4B 1DRZA 4KHMA 5I4MA 1SB6A 1NK0A 2AJFE 4JI4F 4TQSA 2QL9B 3AXMA 3LP2B 2LQ9A 5C24A 4UQGA 3MFHA 3EXCX 3LA0A 4PPDA 1FNXH 2XO7A 1W25A 4WF9Q 2MXYA 2B4VA 4DLGA 1GT8A 1RAHB 4A8QA 4NLQA 4ECWA 4MKBA 3RBEA 3UD5A 3KLHB 2J0WA 3HULA 1N48A 3BYPA 2FJWA 3SFGA 2R2UA 2BM1A 1T94A 2FVSA 2OSRA 2Z56B 2DR9A 2RU9A 2VBYA 1NBEB 5C24B 1BXNA 2C3YA 2V9WA 3QIDA 4U95A 2WW4A 2JJ4D 2X1GA 1SXLA 4DL5A 4ZP8A 4LSZB 5I3UA 2LA6A 3SYZA 2G4BA 1FWKA 4ANCA 3KTQA 1V6HA 1L3VA 2BOPA 1LXNA 2MKIA 2RHSB 4DSLA 3I9ZA 2G2ZA 3CCUS 2W1BA 1GX5A 2K3IA 1NHUA 1DJ0A 1S1TB 3KMQA 4OHXA 4WIQA 4TXSA 1PC5A 2CA9A 3LF0A 4IH7A 3TA0A 2AX0A 4QYZJ 3M7VA 4ZP6A 4FP9A 4DL7A 2PEHA 3QGIA 3KNGA 1Z2LA 1RJJA 2DTJA 2W4CA 2NUUG 2MZQA 1R8CA 2K7KA 3M2RA 2YH0A 4HHUA 3UWTA 1KTVA 4LF6F 3CUNA 1S6UA 2CJYB 4CLZA 4ZLPA 1HI1A 5KAKA 3QT5A 1MROA 5DDRC 2PSZA 2YVSA 2H5EA 3CIMA 1HNZF 5A76A 2EI5A 3W3SA 3FFIA 3ITHA 5FIIA 2VPWB 5ETVA 2PA3A 4X4VA 3TP2A 3C6TA 2VJVA 3DMJB 4GO7X 2BE2B 1B70B 1EKRA 3J80Y 1J5OB 2EC2A 4M5NA 5M2PA 4OLPA 4PQAA 3NBPA 2W25A 3M2RB 4HT5A 2QTWA 2QJ3A 2RIJA 2MHEA 1RHMB 3C14B 1RLDA 6AT1B 4K4ZA 1MROB 2C42A 2GVZB 1NKCA 3JAMU 1GMVA 3CD0A 3NL0A 2FJBB 2HS3A 1SIWB 1RAAB 3FFIB 5LXYA 3RBZA 5JMNA 3PV8A 2HAIA 3I5AA 2V2ZA 3FBBA 4LBHA 1FVQA 3GLJA 2B9EA 2IA6A 1TMJA 2LEPA 2ZC4A 4NLOA 3M8RA 3AOCA 2ZE2A 4BC9A 3EWGA 1U48A 1Q86T 2ROEA 4DV3F 1CC7A 5HBMB 1YJNS 3R7SB 1U26A 2KDOA 4ANDA 3MZIA 2XS2A 2BJEA 2IA0A 3EICA 3DRPB 3BBBA 3JSMA 2W2NP 1LWCA 2WHOA 2E1PA 1CJKA 3LALA 3UVJA 4RWWA 2CFXA 1VISA 3AAWB 2GJ2A 4USMA 1QE1A 5AT1B 2KM8B 3QBCA 2ADCA 2RF2B 1X0FA 3R3TA 2OEMA 3Q8RB 3W5ZA 3OTDA 3K89A 4YHHF 5ETKA 2QSWA 3NG8A 4U9RA 1HIYA 1WF1A 4FNIA 2QA1A 1RZMA 1YRTA 2V5HG 2M7SA 4HACA 1CJKB 4N76A 2BQ3A 3UDCA 4C8YA 2FHOB 2X1FA 2IFXA 2W01A 4M5GA 2KVQE 4KFBA 3B4DA 3KHRA 2HQCA 1YVFA 4RNNA 1N5YB 2DPJA 1SPBP 2J6TA 1EQ0A 1IBLF 1SKSA 2IC3A 3UO0A 1JNZB 4WFXA 1I6JA 1IKWB 3FEYB 2V4JA 1IQTA 1OS5A 4ZPDA 2R7UA 4XDCA 2LDYA 5HQLA 2Q1LA 5KFOA 5LMUF 3U1LA 4HACB 4JOUA 1UP1A 2NXNA 3A3OB 1Y5NB 4AE5A 4QU6A 1W2BR 2O01C 1X4AA 1ZAXA 4A48A 4LF5J 3MCNA 1IKVA 4EYHB 2FC9A 1SL1A 4QYZK 4Q45A 2I6WA 4ZLJA 1U6ZA 3C15A 1Y5LB 5KFIA 4IYQA 3IRWP 3J7Z5 2C28A 4M5DB 3IFEA 3TR5A 2UU9J 4O3SA 4IRDA 2KN4A 3BR9A 3GFHA 1KVIA 3TEGA 2VONA 2Z0GA 3HVWA 4OI3A 3H4DA 2V4JB 3RRKA 1QVGR 1RYRA 3MEEB 1U2RA 1QAIA 3T1YJ 4ECVA 2PO4A 1H7XA 3PW4A 2KYZA 2HQIA 1B7YB 1K47A 2APOA 3K5OA 2VG5B 4TU7A 3DI6A 1U47A 1JLEB 4CWBA 1PG5B 3A3NB 2VBZA 2KZMA 4MJKA 4DUZF 4J9VA 4CT9A 1ZH5A 1WUUA 3PKMA 1FDNA 3TZWA 3BGUA 3NGUA 2LXFA 5K8NA 3ILLA 4NA2A 4LBPA 4LSNA 1DHMA 4F2RA 4M5HA 5KT6A 1UWAA 4AXIA 1TKTA 1H72C 3K0JA 4NLGA 5AXKA 3QNWB 1YGYA 4RW7B 8AT1B 2UVUA 3KJVA 2W4DA 2EEYA 1FERA 4ZJQA 2I5JB 1KKHA 4ZCIA 2HHHJ 3PYEA 1SKUB 1TTHB 2E1CA 4AL7A 1AA1B 1JLAB 3OJSA 1D8YA 4Y2CA 1IBKF 5AJ3F 2FDNA 4YR3A 2XLJA 4QJVA 1AROP 1XIQA 4LSNB 3TAQA 2ZKTA 1X4HA 1VBKA 3GTYX 2YNFB 4TY9A 1NDCA 1NPRA 2B8QA 3W9JA 1TQLA 2CG8A 2XO6A 2FTRA 4O23A 1WC0A 2VZ9A 2NR0A 4NI2B 1YJRA 1A9NB 5DM6Q 4I2PA 4JUZA 4LFAF 4C6AA 2ZH3A 5HATA 4ZPVR 2FZGB 4GVBA 1TV6B 1FTRA 5D77A 1S57A 4P52A 1LWEA 3UDEA 2J6SA 2B8PA 2HHTA 1WOOA 4K0KJ 1S1UB 3M6WA 1HI0P 5LSOA 4A8YA 4YP3A 3KK3B 1SH0A 3NGDA 2VDIA 1P9YA 1CJUA 3W64A 3FSIA 2Y1JA 4KHRA 3OBIA 4UTGA 4OJGA 3M05A 1EKSA 2BRLA 9RUBA 3DM2A 4YY3J 1R8PA 3G6YA 1XR7A 2R7OA 2CPXA 1UEVA 4A8XA 4LR9A 2ASDA 2IJFA 4FYXB 4WIIA 1U2CA 2JNJA 4XAKA 1U0SA 4BCAA 4ZVHA 2VUGA 4Z2XA 1JLQB 3I4HX 4Y2MA 2H4WB 3C6UA 1URRA 2HRTA 4QOTA 5FLXU 4ZVOB 2XLKA 3MR7A 4AD6A 1IR1A 1X4BA 1FDDA 1VLYA 2WB4A 3OJUA 2M3DA 2GMJA 1EJ7L 1KVJA 1GNKA 2OKQA 3H0PA 2BZ2A 1QSYA 3W8GA 3OXGA 3GIJA 3BH7B 4DHVA 1PAUB 2DEIA 2NQPA 2MZ1A 3I87A 1N52B 4M94A 2E5JA 2KVIA 3PW0A 3C6UB 1WKKA 2CDQA 4DU7A 1M5SA 1FDAA 2DNHA 2QEXS 3QMQA 3KUEA 3OUYA 1N33F 4ECQA 2CVIA 2V8GA 3J7A1 2FIUA 2AYMA 2CPEA 1U2FA 4GKJF 4FYWB 5L46A 3EE3A 1ROFA 2HIQA 4JI5J 3RAQA 1VDHA 1JJ4A 2ROGA 5SZTA 2OHDA 2AJ4A 2F7VA 4C9DA 3V4MA 4F7VA 4L3KA 4IRCA 1R0AB 2FD2A 4K2XA 3CPWR 2BR0A 2FHKA 2G0CA 1JK9B 1T95A 4QWDA 3QLHA 2ILYA 3CMES 5BYQA 4O44A 1WF0A 4O0IA 1GAOA 3ULHA 4DV5F 1LQ9A 3D28A 4F4XA 3K59A 4MK9A 3RRGA 4MK8A 3AJ1A 1XMQJ 4DPOA 3OUYB 1EX8A 3MAQA 4ECYA 2J8AA 1PYTA 1G1XA 2L9NA 1AT1B 4OLOA 5CYJA 4HR2A 2H65B 3VAHA 1UW9A 1X8DA 4ZVGA 4FXWA 2FQQB 3NNHA 4B9MA 4IG0A 4KAIA 2ZOFA 3OSNA 3IBCB 5ETRA 3N01A 1N88A 4Y34A 1KQFB 2ZH1A 3LP1A 1QJHA 3QLHB 5KFYA 4O44B 1UJ4A 4QIVA 4Y0FA 3HKZD 1FFWB 3OR1A 2H4YB 4ELTA 2DIVA 3HDSA 1NSQA 1RT2A 1JLBB 1VFJA 3V4IB 2FB0A 2V67A 2IAJA 4H4OA 5KFJA 3TVZA 4NMLA 2GQ2A 3KDNA 3OFEA 4ZPBA 1WELA 3KHHA 3S6EA 3DGPA 2QYGA 1EP4A 1FRXA 2DB1A 2BKPA 1NUEA 1HQUA 1RAEB 4DSIA 5KTQA 3Q8SB 3MM8A 2CWKA 2BJ3A 1RE1B 1NK5A 4JI2F 3IBWA 2RNEA 3J81U 2XBPA 1IM4A 4ZMMA 2D3O1 2K2PA 5J1EA 3PM9A 3EX7B 3DDKA 1CJVA 4WU2A 4A46A 5BR8F 1FFGB 2XHWA 1PKUA 1X4DA 1F2HA 3PRBA 3CCSS 2BRKA 1RHJB 2DY9A 4LSLA 5EX0A 2A6OA 2GJIA 2DH8A 3UCUP 1EP4B 3BR8A 2D7SA 4ZPAA 2F40A 3SIPB 2C3MA 3MPDA 1DTQA 3BN7A 3RR8A 2NSBA 5ETQA 2Q43A 4PG8A 1T9XA 1CJTB 4ECRA 3NRBA 3MM8B 5A8KB 2HNYB 1ZYQA 4MIAA 3NNCA 5CAAA 2BJ7A 1UVMA 3M1VA 2IM1A 4JI6F 2R7WA 2DNMA 4MKVA 4KHPF 2D41A 1PIEA 4J5OA 2CZ4A 3VZHA 5C5JA 2LA4A 4LSLB 3RB3A 1U6FA 4IUFA 1APSA 1I3OB 2F8EX 3BKTA 2XMAA 4F2SA 1NZ8A 3PFOA 1DTQB 4UUWA 2MYFA 2ATCB 1FO1A 4A47A 3CDAA 3CSKA 4ED7A 5IC4B 4Y2KA 1NZAA 3R6LB 2HBRB 4ZCLA 3M1VB 2ZUGA 1C0TA 1C2PA 2VODA 4TLQA 1T11A 5L8RC 2VC0A 2V6AA 2QT7A 2RDDA 2ZD1A 4CQ1A 1U02A 1RP5A 1H74A 3W65A 1RT6A 2BM0A 2HBQB 2CPZA 4O3RA 1S1VA 4CH1A 4PYAA 3ENQA 3A1YG 2YPZA 2RQ4A 4ZA1A 4DS5A 5RUBA 3V6HA 2AMCB 3NOCA 5U47A 1JJCB 2QN6B 4WBFA 3G6ES 4NLSA 3CDBA 2JVRA 1ZOTA 5AE3A 1AYEA 3KG1A 4BWJA 3RUBL 3SCIE 2CQCA 2VIHA 4CDIA 4DR2F 1C0TB 4BHQA 3ZZYA 4CLPA 4ED2A 3VQTA 5F41A 3IN5A 2DGOA 4NYZA 4UOHA 1JB0C 2HIYA 2O66A 4DR1F 4QQBA 2M9KA 2PMWA 5FJ4A 4K4TA 1XMOF 1V9OA 2ZBCA 3JTOA 4ECXA 4JV5J 1RCOB 5K8PA 3V6DA 4OHYA 1LOUA 1FX2A 2ZH5A 1VQKS 2VB6A 1EZZB 3UCGA 3TAMA 4ILMA 2ASYA 2L08A 4MK7A 5G0RB 3JYTB 3JSBA 5FLXY 3PR5B 4RU9A 3CJ5A 4X4TA 3UN5A 1SC6A 1UETA 4NLVA 4E0DA 3S1TA 3E2EA 3U1MA 1X7VA 2XMJA 1Y11A 2AGOA 1VQ8S 1XNQJ 5C42B 1QDUB 2FVCA 2H54B 2OPSA 2DHSA 4I64A 2CPFA 3SV3A 3TA2A 1XN9A 3WZ0A 2UVVA 1IJFB 2JDJA 3DC2A 5HROB 4DR4F 2ZJPQ 3GYXB 4G6VB 2MJUA 4LFBF 2LMIA 2MQLA 1WG4A 2DVIA 5HLFA 2E5LF 2WW8A 1RT5A 3M30A 4A4JA 5B0EA 3K2YA 5F8IA 2GIRA 3SSRA 1BD6A 1ZS6A 1F3FA 3WBZA 3GWCA 5LSRA 4NXMF 2I2YA 4OZ5A 5LL6d 2KYXA 1ZBTA 3E3XA 2ZHBA 4DUYJ 4LF8F 3IO1A 3G82A 1GXTA 3EVMA 4X4OA 3TOQA 5KG6A 1H7WA 4DR7F 3MAAA 3OQ2A 2IYGA 3JS9A 2U1AA 4YB5A 4RBTA 5EHHA 5HLFB 1MMNA 3KG0A 2QFJA 3G8TA 2DGQA 3MR5A 3W7BA 4F4ZA 3O1LA 3UFCX 2CJKA 3MPVA 4I69A 1W26A 3D66A 3M6VA 3Q8QB 1G6BA 2UXBF 2IYIA 4N41A 3QQCD 1AFJA 4ZPTR 3RBDA 2JSXA 1S79A 5A6PA 5GAHU 2F4FA 2WOMB 3MR2A 4ZPCA 3ZNJ1 3G82B 1VBYA 2FZCB 3GG0A 4ZIWA 4DL4A 1KBRA 1YJ9S 2DEJA 4AL5A 4NLRA 2OMOA 5B0BA 1RTJA 4EBCA 3OHBA 3CJKA 3NCPA 4U6PA 4FDFA 4O3NA 1VQSA 2DGSA 2YTCA 5LMNJ 1FD2A 3CNQP 4O0NA 2AZ1A 3CCWA 1U1MA 1MU2A 2R8IA 3C8YA 2O1PA 4NCGA 3RRHA 4ZJLA 1VI7A 3D1QA 3RGIA 1JXEA 5IFMA 3MXHP 1WDTA 2DNLA 2OFGX 3J81Y 1U4BA 5D6GA 2BEFA 4HH1A 3KHLA 4ZCKA 3HFZB 1RTJB 3QO9A 3CJKB 2KT2A 2ZH9A 4RPFA 3NS6A 4HI2A 3PFEA 3BGRA 4ZLLA 2FY8A 3P45B 4F3OA 3P3DA 1UJ5A 4RBVA 3H40A 3CJQA 2O3DA 4YQWA 1VS3A 2MLXA 3HKWA 3WX8A 3K5MA 2E9ZA 2HQ3A 2HFSA 3GV8B 2M8HA 1HYSA 4ZHRA 2N4DA 1CG2A 5B09A 4ZN1A 2YX4A 2OGUA 3BO4A 1TFWA 4J9QA 4DL2A 1UCNA 2RKIA 2CVEA 2I0XA 5IT9U 2RQCA 4P2SA 1D3WA 3ZC4A 3NGTA 3D5MA 3SFUA 3MUVP 1HBMA 3M9MB 2AJQA 2ZUAA 3W63A 4UW2A 2IPOB 1VQPS 4DLEA 3DHXA 5D3GB 4DCJB 1UVNA 1K44A 1NEEA 1XQIA 2HZAA 3RJMB 1U1QA 1IUJA 2FJEB 4NA1A 4QBUA 3O3LA 3L95X 4WFAQ 5GVQA 4B3OA 1KSPA 1KQGB 4ZHRB 3VVUA 1N5SA 4MTPA 2R8JA 3NS5A 2GMHA 1QY7A 3GIIA 2PEBA 4WFZA 2RKIB 4KTQA 5GMDA 2NXCA 2W2MP 3HVAA 1FCAA 1CQMA 1C4CA 4RR5A 1T9UA 3Q8YA 2AYGA 2A1BA 5CA5A 1FE4A 1RWNB 5M2RA 4WE1A 1HNIA 1VC0A 4QW9A 2C2KB 2C22A 1LK5A 2JFDA 2YNIA 4IR9A 1PYSB 2N7YA 2UV8G 3BBFA 1YJUA 3CD6S 3W66A 4KSEB 2CQGA 2HSEB 2QZ8A 1J27A 3TUJC 3ZZPA 2WVDA 4XTTA 3THPA 3U7JA 3WX4A 2XSJB 4J9KA 4X64F 2KI2A 3MF5A 1UTAA 4I56A 4LF6J 4WE1B 5E3RA 2Y8YA 2DNNA 5D4NA 2DY1A 2RDJA 4MYUA 1C1CB 2B4OA 1HNZJ 4TU9A 5KT3A 1RT4A 4YOEA 1Y5IB 2CIMA 3HFVA 2B6AA 2A18A 3O44A 3HPOA 4RNHA 3CJ8A 4EEYA 4NZ0A 2W9AA 3D0GE 2X1AA 2HQGA 3FSXA 1CVJA 2E5HA 1B0PA 1GK8A 4QPXA 2CG4A 1RWKB 4IOBA 4DFKA 2HK3A 3ZZRA 1U1PA 5CYQA 2C1EB 5HK4A 1MMLA 2OP5A 3W2VA 3UNYA 1WC1A 2WSCC 3J7YI 2UUCF 2CPJA 1RT4B 3PKYA 4R0JA 2CPYA 1NPPA 2VOOA 2EKYA 3TUIC 3QYYA 2PI4A 3GJRB 5IS2A 3GILA 2ZBRA 4A8MP 4PQUA 3Q2SC 2EBEA 1Q4RA 4ED6A 2MLYA 3GE9A 4ETXA 1M1GA 2DO4A 1O0PA 2QA4S 2BQRA 4DV3J 4JV0A 3Q22A 1OY8A 2R9LA 2WZ1A 3EJMA 4M63A 4UQTA 2HVHA 1X4GA 4I68A 2R7RA 4LR7A 1UFWA 3H2LA 5L1JA 3VAKA 2XGPA 1WKJA 1X60A 3VZIA 5AE1A 2FHJD 4WZMA 2L41A 2VV5A 3GR1A 2EFOA 2A2CA 2G2YA 1ZPVA 4PQUB 1QTMA 3BSCA 2GO9A 1SJ4P 4OYBA 4ED8A 3MOJB 2ZHAA 4FPRA 1P1TA 3VGUA 4YHHJ 1NH8A 2D3UA 2DXEA 2ZBIA 1HNWF 5GMEA 3E51A 4N47A 3H42A 4ICLB 2DNQA 4UUXA 4KY3A 3UE2A 1B4SA 5CH7B 4DSFA 3G6VA 5ETTA 3TNVA 3KYLA 2CKWA 2JVOA 2MKKA 3PG9A 3QIPB 3T1HF 4Y28C 1PJ5A 5KT2A 4HH0A 2K7JA 4RUCA 2BDPA 2RJZA 1WI8A 2CQ3A 2XNQA 2RE1A 3AOBA 1LFWA 4IH6A 1XR6A 3OL9A 1IBMF 1IBLJ 4B3MJ 3MAHA 2MEWA 2QA4G 4WPAA 2DH9A 1Z4UA 3A3PB 2Q79A 3MUMP 4OYWA 1H2UX 2VOPA 1D9DA 2D9OA 2C2EA 5LMUJ 3JXOA 1VQYA 2ZEJA 3BQ1A 5KFEA 3HHKA 2HKEA 3EZUA 1JMTA 5B0CA 4F0HA 3N5FA 1Y0HA 3T5KA 4UZCA 1NLKL 4OI2A 4C8ZA 4ZLNA 4FXVA 4EI2A 3I32A 2ZITA 4JB8B 4KQZA 3LPEA 5C2GA 3B8HA 4JI7F 5F8JA 4J90A 1H2VZ 1KP6A 3BO3A 1HI8A 7AT1B 4ZN3A 5J2NA 1KHWA 3PR4A 4DV4F 5CYMA 5EWGA 4JV1A 3M8PA 4WXWA 4ZPWR 1TL7B 5LXRA 4FKYA 4JYAF 2ZJRQ 3T5HA 2YBVA 4KH1B 1IBCB 1SJ3P 4OZLA 4PKDB 3P5BP 4OX8A 3UW1A 3DLGA 2OELA 5I42B 2JZ5A 3MMJA 4YR2A 4DUZJ 1VC6A 3DOKB 3GMGA 2QLXA 4DR5F 5EN1A 2GC8A 1X9SA 3M2VA 2CJAA 1U09A 2HFNA 1NAQA 2NXJA 1RTHB 4RO0A 3KLEB 4OIXA 2P8IA 1C4AA 5CYMB 1HR0F 4QR0A 3D6HB 3I0SA 3ZTRA 3TQ1A 2PT0A 1UFKA 2QIFA 5MAOA 5J1PA 3DDNA 1YJTA 4GKKF 1JLGA 3OXFA 3L7UA 3MCOA 1UZDA 3SQGA 4FYYB 2K1RA 3I5CA 3MCSA 1IBKJ 2V9KA 5AJ3J 4KJIA 2UVRA 1N36F 2JX2A 4CIOA 1NB2A 1VK3A 5C2CA 4DV7F 3CJ4A 4J9LA 1NNDA 5K8OA 2DGXA 2YWWA 3CDEA 3MEGA 1U7LA 1H0HB 1R0CB 2P2CB 3R8YA 1OWXA 3D0IE 3OTOF 3H90A 3B82A 2LECA 1SJFA 3TVYA 1C1BB 4N8NA 3OVSA 1JLFB 3ZXWA 1JLGB 5LJ3Y 4Y2IA 4LFAJ 4DR6F 3BS9A 2V4RA 1M90T 1BY9A 3SQGB 4LRDA 3BF4A 3PXGa 2F5GA 1PAEX 1WORA 2DRDA 2DPIA 4CCHA 3GB0A 2AJ0A 2GS8A 2UUBF 2HVIA 4UY85 2G1HA 5K20B 2WONB 5CZXA 3TA1A 1PBUA 3US5A 2JEJA 1R31A 2N4CA 2XY5A 5JJBA 3S01A 4QPTA 4OYZA 1EIYB 3MPWA 4OV1A 2OD6A 3BSNA 1ICEB 4DPUA 5KFMA 1WEXA 3MWBA 1WC6A 2ACMA 2HMIA 3CIZA 3B54A 4F3QA 4ZCMA 3TX0A 4R25A 2B9XA 3OL7A 4NRUA 1F5BA 3R6GB 1R6VA 1YG0A 2XZWA 3E8OA 1MNEA 3RB0A 3QZ7A 1FTCA 2BJ1A 4O4RA 2RVJA 4ZVQB 3VGVA 2E5GA 3D4JA 1RHKB 2YKMB 2AIRB 2RUSA 3LGMA 3Q8VA 3NWRA 3UR3C 4M5JA 4U8VA 3TZYA 5GMKa 2ZBPA 1PILA 1XR5A 4OYMA 4YMEA 3IP0A 4ATNA 3P8BB 4KPYA 3HHLB 4RUHA 2LKZA 1WNEA 1NB7A 3CJ2A 1NSPA 1OY6A 1ZM4A 4MAKA 3MMBB 3DLKB 3M9OB 1OMSA 1KR4A 1RCXB 2FYXA 1X4EA 4OYAA 1RTDB 1NCLA 2IDLA 4LRAA 1TKZA 3HZGA 2R7QA 3POTA 4R8UA 4ENOA 3LWLA 1N33J 4WP9A 2IMWP 4KYZA 1SL0A 1NDPA 2GGPA 4OJ1A 4GKJJ 5L39A 2E1MC 5E3PA 3MHYA 2ZH7A 2DGUA 3ILJA 2VFRA 1HPZB 2GX8A 4NL5A 1UVKA 2JHEA 4V1Ak 3MEDB 4H54A 5DS7A 1UL3A 2IDEA 1IKYA 4USIA 4DV5J 2MQNA 1TKZB 2GVDA 5F3TA 4PAAA 3EM1A 4P7VA 3C66A 4DCOB 2C3UA 2AJ2A 2VA2A 4M95A 2JFKA 4EUVA 1PGZA 4PUOA 2GHVC 2GFFA 4C48A 2IY5B 5J2QB 1S6QB 8ATCB 1RU1A 4UZBA 2M70A 4EO6A 1PYOB 3HVRA 1SQGA 1X9MA 3L9ZA 3R5GA 3EMTA 5HVFA 4C11B 1KQKA 2RQKA 2VHGA 1FKPA 3BGLA 3H59A 3H5UA 1CULA 4LVOP 4J9MA 2GVDB 4X65F 1LWFA 2MHNA 3K17A 4N77A 2MB0B 4MKYA 4WKYA 1D1UA 3BB5A 4IO1A 3MM6B 3FCVA 3PHTA 1QAXA 1AB8A 4B9VA 1I51B 2HNDA 2NSCA 1M0SA 2GQCA 3BBCA 3FEZA 3AD9C 4HVZA 5F8LA 3MMAA 2Z2MA 4P2MA 2ZH6A 2XMTA 1TL3A 1WTFA 2ATLA 1LNQA 3KNAA 3D6FB 1VJWA 2P6SA 3JSRA 2MGZB 2AWZA 3N79A 4IFYA 5KG4A 3HCXA 2G0IA 3X1LB 1HD1A 3BSOA 2ERRA 4RNMA 1NDLA 3FK4A 4JI2J 1LWFB 5HL7Q 4TU8A 4K4XA 4J9SA 4ES2A 3AQPA 5DM7Q 5EWFA 2IMOA 5BR8J 3CJ0A 2HNDB 3EVWA 3B6BA 3KLGB 2OPPA 4LT6A 4DXLA 2DXFA 3GONA 4LRBA 1VQ6S 2M52A 1H98A 1TL3B 5KFZA 2E7WA 1Y9OA 1DTTA 2VL1A 2DJWA 4IOAQ 4U67Q 3OTBA 4UOCA 2BJ9A 4WTYA 3GU0A 2L48A 1U49A 1QUPA 1X4CA 2OPRA 2HLUA 2Y1LB 1S5ZA 1S76D 5F8HA 4TY8B 1KOOA 2XI2A 3K5PA 1RISA 4K5RA 5JVHQ 4B9UA 4C0BA 2OH2A 1ZTWA 3UN2A 4KHPJ 2YWFA 2OPPB 1JKHA 5ETLA 3TO8A 2YKNB 1UVIA 2EFPA 1YHQS 1BHNA 3PW2A 4NCBA 3IG1B 3NWGA 4K7QA 3DRSA 3NMRA 1FKOB 2XMKA 1OQ3A 2BJ8A 4NZ6A 2UP1A 2HURA 3PW7A 2H51B 1ZM3A 3M2UA 2A0FB 5E0OA 2OPRB 4HEA9 3OSPA 3WC2A 1FJCA 5LJ5Y 1KHVA 4YUDA 3MGJA 2JL9A 5KFBA 3IGVA 4DZDA 4KGKA 3HHNB 3O5TB 4KO0A 2JOQA 4DJBA 5DGAA 2VASA 2HHPA 1U0HA 2HZCA 1WC5A 3HHEA 2XY6A 4E98A 3I0RB 2C2NA 1TUWA 2F8MA 3T3FA 3HLUA 1RGVA 4ID8A 3BGFA 1QSLA 3CCVS 5D15A 1W7WA 4RKUC 2JC1A 4I0WA 2NZ4A 1RBLA 3CE8A 3CO0P 1FX4A 1YWXA 4UY8T 5DLGA 5K5MA 1NHVA 2C2MB 1EARA 2B5JA 1SIZA 1Q7YT 2QL7B 5D0RA 1UEKA 3D1OA 4DEZA 4DR2J 5E3QA 2J6UA 2FGOA 2ZM6F 2XB2D 3CXCR 3KG4A 4KRWA 4DPTA 4HDHA 4MFBA 4DX8H 4LF9F 1L3KA 2ZBQA 5T41A 3BKFA 4DR1J 3GIKA 2CJQA 1VMBA 2RB7A 1TZ0A 1S6PA 3NCRA 1U1KA 2FC8A 1HHQA 1XMOJ 5CD4A 3WC0A 1Y3JA 3TQEA 4E2FB 1WHXA 2P5VA 3M8QB 2BW7A 2YH1A 1RWXB 4W90B 2V2KA 1K73T 2DHXA 1FNOA 2CQDA 3ZTOA 2F3JA 1BUXA 1WI6A 9ATCB 4MFBB 5HJYA 1L3UA 3MM5A 2XC9A 4X62F 2JLGA 1RWMB 1YDLA 1GFWB 4F4WA 3W2WA 3DU5A 4AFFA 4CM2A 3UQSA 5DDQC 2LQ5A 3O2IA 2VG6A 2HEKA 2DNKA 4DFJA 4URGA 1Q81T 2FLOA 5T7LB 4BLGA 1SJQA 3T1YF 3MM9A 1SBRA 4OX6A 3LAKA 1ZPWX 3C16A 5DJBA 5C7PA 3LO3A 4DV2F 4IG3A 4NYPA 1KN6A 3M32A 4K59A 3R97A 3RBXA 1S7HA 3MM5B 2DYAA 4HHJA 4LFBJ 2V0NA 1H38A 4AXJA 5HO4A 5A2QY 2R7XA 2VG6B 5H1SV 1VHFA 4CNYA 3UDVA 3FC9A 1RLCL 2BANA 2QE5A 1TP7A 5HP1A 4NXMJ 3N5BA 3TI0A 1R8BA 3FNNA 5SUHA 4FF1A 4NLDA 3MM9B 2UXCF 3W61A 2M0GB 2MZRA 4M8LA 2JEFA 5ITHA 2X3DA 2V8PA 4IG3B 5GAEU 3OFGA 1L5UA 3O6QA 3EGVA 1HNXF 2P9GA 4B9SA 2AJ1A 1BWEA 4DR7J 4GO5X 4ZKAA 3DRYA 3SDEA 4DPYA 1AXQA 2FZKB 3HP6A 3PO4A 3KLIA 3S7RA 4DR3F 4L6V3 3F44A 4Z7YA 4OJ3A 2BANB 5B0GA 5I3UB 5HP1B 3IWLA 4FF2A 1J5EF 2PN6A 2WK4A 3WDOA 1WWHA 3CMQA 4DFMA 4M5MA 4GRSA 1WD6A 1B64A 5KG7A 2V2VA 3GFZA 3AQOA 3HSGA 5J2PA 4HTIA 3PO5A 2LP4A 2MQ8A 3SDEB 4FBUA 1WC4A 1U1LA 1TL5A 3ISND 4TVAB 1KD1T 2GJFA 1R8AA 1DQAA 1UFLA 4DSJA 4OMFG 3QRPA 1RHRB 1S0VA 2L9DA 1RADB 1RK8A 1QM9A 3P49B 2QA2A 1IVZA 1F0XA 4Q44A 1HW9A 3FVYA 4OI1A 3D3BJ 5JVGQ 2FJXA 1NPKA 5GADI 2XZDB 4ED3A 1GX6A 1FK9A 3NY0A 1DURA 4HTJA 3T41A 5IC6B 3ITHB 5D8HB 4B3TJ 4J9OA 3C6TB 3PDNA 1RB0A 4NEZA 4YY3F 4R5PA 1T02A 1LKZA 3NBPB 2IM0A 1U8WA 2HS4A 2VPYB 4G1IA 3H8YA 3H5SA 3FUYA 4QIFA 2G0JA 4PXEA 5B0FA 2DHAA 2HFVA 1NK6A 2V8HA 2XZTB 4F4AA 1VGYA 1I94F 1FK9B 1FESA 1Q8LA 4UT4A 5L1KA 4N8OA 3IXQA 1S9FA 3ZTQA 4DL6A 3Q8PB 4DI6A 1F9EB 1M5HA 2XYGB 2ZFHA 3IMQJ 2WVCA 4JBCA 2FVRA 1VCTA 2DNYA 3W5YA 1RABB 2PE8A 3BV8A 5LM7E 1GEHA 1NJXA 2ZE2B 3ZZ0A 2FJDB 3CULA 4ECZA 2XS5A 2VQEF 1X5SA 5HN0A 3HHDA 4QWAA 1SKWA 5A8WA 2OAUA 3NEKA 4B9LA 4Y00A 2CPIA 2X7IA 3JSMB 1LWCB 3MFIA 4RW9A 2AYBA 2G13A 2KJWA 3MM7A 1ULRA 1R0BG 5AXMA 4X4RA 3UVJB 5CQGA 1YTYA 1JXLA 3RTVA 1SC4B 4LFCJ 1QE1B 3WHIA 1WEYA 1X0PA 3VGTA 3VR1A 1UPMB 4P2FA 1QVFR 4ES1A 2UXDF 3MCMA 2XULA 1NK7A 5KFGA 2DBBA 2JH3A 3D9BA 1LW0A 3HF5A 3BM7A 4J9UE 4KGVB 2DK2A 4OX9F 1Q79A 1Q16B 2GMLA 3ET6A 4RW9B 3ENWA 3BREA 3KLFA 5KOXA 4USHA 3QAUA 3V6KA 4KFBB 2XG8A 5HMXA 1O51A 3MURP 3FBEA 2N7CA 5GADU 4RW4A 2IM3A 3PX6A 3TX8A 3HX9A 1T7PA 4C97A 4X64J 4ZOSA 2J9DA 1RKIA 2KU7A 1Y4ZB 3L3CA 4UF4A 4LR8A 2PMZD 1M1KT 2RD5C 3G9CA 1TL1A 2IC3B 5E3CA 4ECTA 4DQIA 4EFAC 3SI8A 5HSPA 3KDOA 2AHOB 2R7VA 1YJWS 1NJZA 5J2MA 4HKQA 1F5AA 5DZ7A 1RACB 3ET6B 4LRFA 4WFBQ 2GCFA 4LREA 3FMWA 1GMWD 4FKXA 3DRXA 4WFNQ 3KLFB 4ZJOA 2WAQD 1H2TZ 1U25A 3N9UC 3N28A 3MUTP 4C4WA 3R7NB 3V81A 1IKVB 1NJYA 3A4TA 2NS1B 3C15B 5HJXA 4A8OA 5IV4A 4JI8F 1TL1B 3D2WA 2H48B 2WTFA 1M1HA 5E33A 4PWWA 4DFPA 1K0TA 3MMCA 1S4EA 1UAWA 5J2MB 2YKQA 4G65A 3EUNA 2FLLA 2QLJB 2E1RA 2ALYB 1SH3A 1NHKL 2DR8A 5DGBA 2E66A 3L09A 3QRRA 4QIWD 3W1YC 2QO3A 3KWMA 3G87A 2NREA 3FCWA 4ZDNA 2HHUA 2Q66A 3V81B 1LK7A 3F0NA 3DI6B 1X5TA 3LOUA 4EU0A 1KC8T 2MKYA 2OPQA 3SCKE 3NKYA 4Y65A 1C0UA 1HD0A 4MKAA 5ADZA 2RMLA 4Q0BA 2MQOA 1WG1A 3MMCB 1V5IB 3I5BA 2ASJA 2YWHA 1REVA 2XQCA 4GMKA 2W4PA 1KOHA 1TELA 4ELUA 3OL6A 5THWA 4C3MA 1KLNA 1TKTB 1FA0A 2UZAA 2QMWA 4K4YA 4M5KA 3PW5A 3CJ3A 2HHVA 1FE0A 3VAJA 2MKSA 4F0MA 3CCJS 3KJVB 5IZHA 1S12A 3H20A 2CQBA 2YXLA 2L3MA 1ZTTA 5HVHA 1PJ7A 5L38A 1XK8A 3NP5A 5D4LA 4X66F 2EFQA 2VD3A 3N6MA 4EK2A 2BKNA 1HNWJ 4J9NA 4OZ1A 4ED0A 1GQEA 2MZTA 1NMEB 3QGGA 3WIVA 3CDWA 2FPHX 3HMJG 2RHQB 2UVWA 3GFYA 2XM3A 1TAQA 2GA7A 2MKJA 3RB6A 4KGMA 1TUVA 3HI9A 1TMMA 3T1HJ 4QR1A 3ZO7A 3NGRA 4I2PB 2R8HA 4C3LA 3BZQA 3Q24A 2KHDA 4BDPA 1RTIA 2XHCA 1IBMJ 3M6XA 4GVBB 2N82B 4WCEQ 4C8NA 3U1NA 1KRPA 5GAGU 1F6TA 3ZZZA 2EBGA 1LWEB 1PSDA 1SH2A 4OZNA 2HLTA 3CCQS 1F5CA 4DZ6A 3IAM9 3JAMY 4P74A 4PPZA 4NOHA 3MTKA 4LMZA 1CJUB 3VWSA 2VH7A 2Q6BA 2QSFA 4IQXA 3ONQA 3JTNA 4EYIB 4JI1F 3GIRA 3OFHA 2M4MA 3DM2B 3D67A 3QGHA 4JI7J 1YBAA 1T8EA 1WF2A 3OR2A 2VDHA 1S9EA 2IRUA 3I6PA 4DV4J 3L7OA 3BPSP 2YX1A 4JYAJ 1FKAF 2J5AA 4FPIA 1SC1B 4L72B 1Q8KA 2C2OB 2DNPA 5E7OB 3BGOP 2CNNB 1UPPA 4PR6A 2XNRA 4I4BA 4O4GA 5HMZA 1UW4A 1F9HA 1TFYA 3VALA 2CQ2A 3A8JA 1M5KC 4Q8FA 3QAEA 3VAMA 4ED5A 2HHXA 1Q8IA 1S9GA 4DR5J 5I3QA 1BLUA 5B7WA 3U02A 4FYDA 1NK8A 1X5PA 3CEDA 4I67A 1HR0J 2ZZNA 3FEXB 3BSAA 3FRZA 1R89A 2IVYA 1GXUA 1YBTA 5KG2A 3P6YC 4C98A 2ZJQQ 4GKKJ 1FF2A 1R3NA 3GCXP 1FJEB 4EWTA 3FBFA 2DXDA 3PVXA 2M5YA 2DITA 1XTZA 2WBRA 4FZVA 1N36J 2VQFJ 5A6WA 3NGKA 3K58A 4DF8A 3NMAA 4B3SF 2OSQA 4P10A 5KFHA 4LQ3A 4HYKA 4JP8A 2AT1B 2I9SA 1S48A 2ZVSA
chains in the Genus database with same CATH topology
5HMWA 3K7RA 3MI7X 3UW1A 3DLGA 3CWJA 5I42B 1N5YB 2JZ5A 3KK1B 2DPJA 3MMJA 2J7WA 4YR2A 1VC6A 5D3GA 2J6TA 3ZZOA 1CSJA 3DOKB 4DG1A 1IBLF 3GMGA 5C25A 3BQ0A 3SV4A 4IG0B 1DBDA 1SKSA 2QLXA 3AY0A 4DR5F 2IC3A 1YIJS 5KFWA 2YWGA 5EN1A 3J7ZT 2QV6A 1DTTB 2GC8A 1P9QC 1S0OA 1X9SA 3M2VA 2CJAA 1U09A 2HFNA 1NAQA 3LP1B 1JNZB 2EK1A 3AB4B 1RTHB 3KLEB 4OIXA 4WFXA 2EPIA 3D0HE 1I6JA 1IKWB 1V3ZA 1U1NA 3FEYB 2V4JA 1C4AA 1IQTA 1OS5A 5CYMB 4ZPDA 5KG0A 4C0HA 2R7UA 1S0MA 4XDCA 2LDYA 1HR0F 1V3SA 2Q1LA 2CQ0A 5KFOA 3OLAA 4QCLA 5LMUF 3OR1B 4KC5A 4I2QB 1BC6A 3U1LA 2R2SA 3AH6A 4ZS6A 4Z37A 2KFNA 2E1AA 4JOUA 1UP1A 4QR0A 3PNIA 3DXSX 1HW8A 3I0SA 3F73A 1Y5NB 4CZCA 4AE5A 2DO0A 4EGLA 2NLWA 2NYIA 2IBKA 4QU6A 4ILLA 2HNZA 2ROPA 3TQ1A 1P27B 1RT2B 2PT0A 1W2BR 5KFAA 2QIFA 4I7FA 2O01C 5MAOA 4ID5A 1X4AA 1ZAXA 4A48A 3DDNA 5J1PA 1M5VC 1YJTA 3FQKA 2DD8S 4DOZA 4GKKF 1JLGA 3OXFA 1JKHB 1IKVA 2DNRA 4EYHB 2IAJB 2FC9A 3H98A 4H4OB 2HGLA 4RNFA 4K5SA 1SL1A 4Q45A 1U6ZA 2WBMA 3CD5A 3SQGA 1Y5LB 1S97A 1O8BA 5KFIA 4IYQA 4QW8A 3IRWP 4DG1B 2K1RA 4WYWA 3J7Z5 2C28A 4M5DB 3DRSB 2WSEC 2X1BA 2XWYA 3LGNA 3OFFA 2GW8A 5DO2A 3IFEA 3I5CA 3MCSA 3TR5A 2V9KA 1K9MT 3DLEA 4KJIA 4O3SA 2VBWA 1L3TA 2HW3A 4URQU 4IRDA 2KN4A 3BR9A 3GFHA 2CZVC 2WCXA 4O3PA 1N36F 2UVRA 2VONA 1KVIA 5DQGA 1HQUB 2Z0GA 2JX2A 4D3HA 2PFFB 4CIOA 3ENVA 3M2UB 1VK3A 3HVWA 4C8KA 4OI3A 2DR7A 4B3RF 3H4DA 2V4JB 5GAEI 3UCZP 3RRKA 4DV7F 2LVWA 3CJ4A 3KMSA 4J9LA 1QVGR 4PWDA 1BQMA 2X3GA 1NNDA 5EDWA 1RYRA 2LYVA 1SJFA 3MEEB 5IWAF 1P6TA 1U2RA 1Y7PA 4NRTA 5K8OA 2DGXA 1QAIA 4ECVA 1UA0A 2PO4A 3CDEA 3MEGA 1U7LA 3SSQA 1H7XA 3E01A 1H0HB 1VBZA 1OWXA 1R6YA 3PW4A 5G4DA 2KYZA 1JNRB 4KO0B 2COLA 1FVSA 2HQIA 2OFHX 3D0IE 3OTOF 3OTEA 2J7UA 2APOA 3B82A 3K5OA 4ID5B 1C1BB 4I7FB 1SI9A 4N8NA 2VG5B 3CDUA 3TVYA 3OVSA 3H25A 1JLFB 4LFCF 2Y1RI 1JLGB 4TU7A 1WG5A 4RWXA 5LJ3Y 2XSJA 2JLFA 3DI6A 3F41A 1TK8A 4Y2IA 2PDAA 1U47A 1JLEB 3AJ2A 5BJRA 2YY3A 4DR6F 4WFYA 3BS9A 2V4QA 5F0WA 2V4RA 1M90T 1BY9A 3SQGB 2VBZA 2C2RA 2KZMA 4ELVA 4F4KA 4MJKA 4NLTA 4F02A 4DUZF 3BF4A 3PXGa 4CT9A 1ZH5A 3PKMA 3IR7B 4CH0S 1FDNA 3KLHA 3GV7B 2RQMA 3DLEB 2DPIA 4CCHA 3GB0A 2AJ0A 3BGUA 2UUBF 2HVIA 4UY85 5KFVA 2LXFA 5K8NA 3R5BA 1VIXA 1E6YA 4NA2A 2WONB 4LSNA 1DHMA 4FS1A 4F2RA 3N0VA 4PWDB 5CZXA 2XGQA 5KT6A 4LF7F 3PEJA 1C1CA 1IKXA 1HFEL 2JWNA 2B5JB 2P6TA 3TA1A 3US5A 4AXIA 1TKTA 1FRIA 2LU1A 2HS0A 1B0VA 3K0JA 2JEJA 4NLGA 3BDEA 5AXKA 4W92B 1UA1A 3E01B 4OI4A 1YGYA 4RW7B 1R31A 2GV1A 2N4CA 2UVUA 2XY5A 5JJBA 5L1IA 3CC7S 4A8FA 3KJVA 2W4DA 1AW0A 3S01A 4QPTA 1FERA 1TL4A 3MPWA 5IQQA 4OV1A 2I5JB 3DNCA 4LF5F 1MSWD 1VQOS 2OD6A 5B08A 4ZCIA 2OTLS 3G8SA 2CQIA 3BSNA 4X4NA 1N6QA 3CC2S 2MSSA 4RNOA 3H2UB 2CRLA 5KFSA 5KFMA 5HMYA 4YR0A 4EZ6A 1WEXA 3MWBA 2E1CA 4AL7A 4QWBA 1JLAB 2HMIA 1FHTA 3CIZA 1S6PB 3OJSA 1GH8A 1D8YA 1HWIA 3FZBA 3KKFA 1XWLA 4Y2CA 1IBKF 5AJ3F 4F3QA 3K8WA 2UU9F 2HRUA 2FDNA 4ZCMA 1CC8A 5KFDA 2J0QD 4YR3A 3T6BA 2XLJA 1E6YB 4R25A 4QJVA 1AROP 2B9XA 4LSNB 3TAQA 2ZKTA 3OL7A 1X4HA 4J9PA 1IKXB 2YNFB 4TY9A 4Y2AA 4NRUA 2FY1A 1F5BA 1HBNA 1TQLA 4F25A 4OL8A 5EUHA 1YG0A 1Q8BA 2FTRA 3EZ5A 2XZWA 3E8OA 4DWIA 4O23A 1MNEA 3PJWA 1KFSA 3RB0A 3QZ7A 1FTCA 2BVZA 5CHCB 4C2MA 1ZAWA 1S1TA 4O4RA 2RVJA 2VZ9A 2OIHA 2E5GA 2RRBA 2NR0A 4ES3A 1YJRA 1A9NB 1SJ1A 5DM6Q 2YKMB 4I2PA 1S6OA 2ZD1B 4JUZA 4O3OA 3LGMA 4LFAF 3UR3C 3HHLD 2ZH3A 1N6QB 2BACA 4A8KA 1RT6B 5GMKa 1PILA 4ZPVR 1S1VB 1TV6B 3VQSA 1FTRA 3W2WB 1XR5A 3ZFVA 4YMEA 2VKZG 2CJBA 4ATNA 3IS9A 1I1GA 4HL9A 5D77A 2KT3A 1TAUA 1FRHA 5F0UA 4KPYA 1UWBA 4KV8A 3HHLB 4RUHA 2LKZA 3CCMS 1WNEA 4URSA 1NB7A 1LWEA 3CJ2A 1KQSR 2J6SA 1ZM4A 4MAKA 1KS2A 5KG1A 5GAHI 1BGXT 3MMBB 3DLKB 3M9OB 1FD8A 4K4UA 2HHTA 1KR4A 2IVFB 1X4EA 2B43A 1HBNB 1S1UB 1RTDB 3M6WA 4HI1A 2EFNA 2BUNA 1TKZA 3FJ2A 4ALZA 3HZGA 2R7QA 4MMOA 1JJ2R 1XMBA 1LFPA 1HI0P 5LSOA 4A8YA 4YP3A 2IRXA 2HG4A 3KK3B 1SH0A 3NGDA 3I4PA 1WHYA 3POTA 4DSKA 3ICLA 3KFWX 2PC6A 3R1HA 4OHVA 3DMJA 3T1AA 4R8UA 2BW2A 2BE2A 3LWLA 1R8HA 4A8WA 3DLLQ 3FSIA 2Y1JA 1N5VA 4TN2A 4K4SA 3M32B 1J5OA 2IMWP 4KHRA 2FHJA 1KEKA 1SL0A 2DNOA 3OBIA 4GC7A 2GGPA 4WJBA 4OJ1A 1KFDA 4OJGA 2HHHF 5L39A 3GR0A 3M05A 4Q8EA 2XI3A 2BRLA 1RT1A 2E1MC 5E3PA 3MHYA 3R27A 3OHAA 2ZH7A 1CEZA 5A0YA 1U1RA 1SKRA 3DM2A 2DGUA 1F9FA 1R8PA 2VFRA 3IS9B 3G6YA 1TK5A 1HPZB 2MQMA 2GX8A 1XR7A 2R7OA 2CPXA 1UWBB 4KV8B 4NL5A 1UEVA 3CD7A 1UVKA 2JHEA 1VK8A 3AA9A 4A8XA 2ASDA 3C3LA 2XMMA 2IJFA 1YQHA 2IJNA 3SEOA 2LQBA 4WIIA 2VFSA 5KFFA 3SZ2A 4ICLA 3M4XA 3MPYA 2RUGA 4XAKA 3MEDB 2U2FA 4H54A 3UI3A 3PIPQ 4RW8A 3N4WA 3U27A 5DS7A 4NXNF 1PC4A 1VQ4S 1UL3A 4BCAA 1VRUA 3V6JA 2F1FA 4ZVHA 3V6DB 1IKYA 4USIA 2VUGA 2MQNA 2GHPA 4Z2XA 1JLQB 3BJYA 1TKZB 5F9NA 3I4HX 4Y2MA 1X4FA 3C6UA 1URRA 2DIUA 2CJ9A 3IRXA 2YQ3A 5F3TA 1U45A 4P7VA 4NLXA 2OLWA 3TAMB 5KFLA 3PIOQ 3C66A 2C3UA 2BABA 2VA2A 4QOTA 4M95A 3ZZTA 4OZJA 2XLKA 3QIPA 4YB7A 2JFKA 4EUVA 1PGZA 4PUOA 2GHVC 2GFFA 3NAIA 4TKTA 1X4BA 4LIWA 2W8KA 1FDDA 4MIWA 1VLYA 2WB4A 3CT9A 3OJUA 2M3DA 2LDIA 5AXLA 3AHPA 5J2QB 2GMJA 3EPIA 1S6QB 5CD4H 1U24A 2YNHA 1S10A 1KVJA 1GNKA 2OKQA 3PACA 1DQ9A 4MH8A 2PMHA 2KM8C 1RT1B 2PGCA 4DV0F 2BZ2A 1QSYA 5A0YB 2M70A 1S0NA 4EO6A 1P8GA 2DHGA 5KFRA 3OXGA 4Y6IA 3GIJA 3HVRA 3KLIB 1X9MA 4DHVA 3QJLA 1FXLA 3DLJA 5AE2A 3PRDA 2YNGA 2VC1A 2NXUA 1H6KX 5HBMA 4A8SA 2NQPA 3R1LA 5KFXA 1WHWA 2MZ1A 3I87A 1N52B 4M94A 4C11B 4RW8B 1KQKA 3H5YA 2RQKA 2E5JA 4XK8C 1VRUB 5IT4A 2KG1A 3SCLE 3FGVA 1FKPA 3BGLA 3DRPA 5KFUA 4K0KF 3H59A 3H5UA 1UJ6A 2KVIA 2OPSB 4LVOP 4J9MA 3PW0A 1NKBA 3H5XA 4X65F 3C6UB 1LWFA 1RKJA 2MHNA 3P96A 2CDQA 4V19J 2M8DB 3IRXB 2HWHA 4N77A 1M5SA 1UEUA 3DCAA 2MB0B 1FDAA 4MKYA 4WKYA 1LW2A 4LQ9A 2DNHA 2QEXS 2C3PA 3BB5A 4IO1A 1D1UA 3MM6B 3QMQA 1DARA 4PG6A 4NA3A 4HDGA 3G71S 3T5JA 3HK2A 2HFOA 2SXLA 3OUYA 1QAXA 4C3KA 5J2PB 1N33F 4ECQA 3BQ2A 4B9VA 2CVIA 3UNGC 2HNDA 2V8GA 1RA6A 2PA8D 3NCQA 2NSCA 1M0SA 3LH2S 5FD1A 2FIUA 3J7A1 3EGNA 2CQ4A 2AYMA 2GQCA 2YNHB 2CPEA 3FEZA 1U2FA 4HVZA 5F8LA 4IR1A 2V8DA 4GKJF 2RF2A 3MMAA 1ZZNA 2AX1A 4C8MA 1ROFA 2Z2MA 2ZH6A 2HIQA 5L9XA 2XMTA 1TL3A 3RAQA 1WTFA 2ATLA 3KNAA 3GV5B 3CB4A 1JJ4A 2ROGA 2A10A 5SZTA 1RT5B 2AJ4A 3M30B 2F7VA 5F8MA 4C9DA 4R0EA 3V4MA 2YNGB 4TNOA 1VJWA 4D3GA 4IRCA 5HQ8A 5D78A 1R0AB 2FD2A 2P6SA 3JSRA 2AWZA 4K2XA 2MGZB 3CPWR 1YI2S 2BR0A 1R27B 3N79A 2FHKA 2G0CA 1JK9B 1T95A 1MWYA 4IFYA 5KG4A 4QWDA 3X1LB 1CLFA 2QYCA 3QLHA 2ILYA 1HD1A 3CMES 5BYQA 2JEGA 4O44A 3BSOA 1WF0A 4RNMA 2ERRA 1VC5A 4O0IA 3C46A 1MWZA 1GAOA 3ULHA 4DV5F 1LWFB 5HL7Q 3I82A 1LQ9A 3D28A 4TU8A 4K4XA 4EBEA 4F4XA 2OJ3A 4FN5A 2J9CA 3K59A 4J9SA 1HMVA 4MK9A 1M5OC 3RRGA 4MK8A 1LW2B 4ES2A 4X4SA 3AJ1A 3AQPA 4ZK7M 4RX6A 5DM7Q 4DPOA 4X4QA 2M2BA 3OUYB 4NCAA 4WK1A 3HXMA 5CXTA 5EWFA 3MAQA 2ASLA 4ECYA 2J8AA 3CC4S 4AYBD 2IMOA 3T6JA 2R2TA 5DGAA 1G1XA 5A8RA 3CJ0A 2L9NA 2HNDB 1K1QA 1S1WA 3J7YU 3KLGB 2OPPA 4OLOA 5CYJA 4LT6A 1T05A 3IWNC 3MECA 5I42A 1N5YA 3VAHA 1VQ6S 2M52A 1H98A 1TL3B 1X8DA 5E41A 2XY7A 4IQMA 4ZVGA 5KFZA 3DOKA 2E7WA 2RRNA 4FXWA 3H2VE 4IFVA 4R5PB 2LCWA 1U1OA 1YITS 3NNHA 4B9MA 4IG0A 3PX4A 7FDRA 4KAIA 3F56A 4OI0A 2ZOFA 3OSNA 2MY7A 4FF4A 2KTQA 1Y9OA 2VBXA 1DTTA 1OO0B 2VL1A 1N88A 2DJWA 3N01A 4Y34A 1KQFB 3OTBA 3LP1A 4U67Q 2ZH1A 5IQ6A 4KT0C 1OPIA 2YKOA 4UOCA 1QJHA 1RTHA 4WTYA 3MD3A 3JSYA 1G2EA 3KLEA 2L48A 2W24A 1IKWA 1HWJA 1U49A 3QLHB 1QUPA 1X4CA 2OPRA 5KFYA 2HLUA 4O44B 4KE5A 5K9FA 1UJ4A 3PHEA 3ETOA 2HGMA 3T9ZA 7FD1A 1S76D 4QIVA 4Y0FA 3I31A 2ZNZA 3HKZD 1Y00A 3QWPA 2DT9A 3JTPA 3OR1A 5F8HA 4TY8B 1HMVB 1KOOA 4DF4A 3DLBA 1OQ6A 4ELTA 2DIVA 2XI2A 3Q2TC 2BA9A 3K5PA 2Q6CA 2CYYA 1RISA 2OD4A 4K5RA 2B3TB 5JVHQ 2D3ZA 4B9UA 4C0BA 2OH2A 3EGWB 3HDSA 1N0UA 2BYCA 1RT2A 1JLBB 1VFJA 4L3NA 3V4IB 2ZHOA 2CQPA 1ZTWA 4F3MA 2YWFA 4NLWA 5A8RB 2FB0A 1S1WB 1XBWA 2I8EA 2OPPB 1VQMS 1JKHA 3TO8A 2YKNB 2IAJA 4H4OA 5KFJA 1UVIA 2DH7A 1AFIA 2EFPA 4Y3CA 5E3AA 4NMLA 3TVZA 1YHQS 3MECB 1T05B 2J0SD 2GQ2A 4Q2MA 1N4LA 3OFEA 1KTQA 4YB6A 5I3PA 4ZPBA 1WELA 3PW2A 4NCBA 3KHHA 3S6EA 3DOLA 1OPZA 4CTAA 3IG1B 3DGPA 3NWGA 4IFVB 4B3MF 4M5DA 3DRSA 1NK9A 4JI5F 3NMRA 1FKOB 3OLBA 2XMKA 3DYAA 1TK0A 4B02A