4DV3I

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a, bound with streptomycin
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 23
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dv3I00
3J81C 2DEIA 4JI5I 4WUDA 3F0NA 2HKJA 2WW4A 4NXNE 1N32E 2UUCI 4DR3E 2ZM6I 3QT6A 1OJ4A 1VISA 2UUAE 4JI8I 3K17A 4WUCA 4R1FA 2E1RA 1H7UA 4LFAE 4DUZI 3J80C 3T1HI 2UXDI 3PYEA 2A2DA 3LPSA 1HNXI 1PVGA 2UUCE 1NHJA 2ZM6E 2UXBE 4DV7I 2X36A 4JI8E 4JG4A 4FWDA 1XNRE 3J7AG 4KHPI 1ZM9A 1B62A 3JAMC 4PRXA 2R3VA 5FLXQ 4HXZA 1D6TA 4I3HA 4JYAI 1N33I 4Z7YA 3Q1QA 1FWLA 1RR9A 2BV3A 4DV7E 1FNMA 1ZXNA 3WU3A 2EFGA 1N34E 4KHPE 4EMDA 5LMNE 1H72C 4LFBI 4DV0I 1IBLI 4WUBA 1I94I 4LF8I 5FLXC 1N0UA 1PKPA 3LTOA 3V5RA 5GMEA 4XTJA 2E5LE 1IBLE 4DV0E 1XHKA 3WU5A 1KIJA 3QT8A 1ELOA 2HHHI 4LF4I 1FJGE 4JI1E 4NXME 4OX9I 2BM1A 1Z0EA 1N36E 1NHHA 5BR8E 4JV5E 1Z5BA 4DV1E 3ZM7A 4USMA 1S4EA 1HR0I 4DPUA 4LF4E 4DR5E 1Z0TA 4B3TE 4URLA 1MX0A 5GMDA 4JI2I 3B82A 2V8PA 3ZZTA 3GONA 1FI4A 4LFCE 5IWAI 4LF6I 4Z7CA 4DV6E 1HNZE 4USKA 1NHIA 4UT4A 4X64I 4JI5E 1FWKA 1ZXMA 5A2QQ 3K1JA 4GKKI 4JI2E 1Z0GA 3T1YI 4DPXA 2CZ9A 4DUZE 2UUBI 3T1HE 2UXDE 4X65I 2VQFI 4DV5I 1EI1A 1HNXE 4DR1I 4YY3I 4LF5I 2UXCI 4DV2I 4GKKE 4GKJI 1XMOI 4DPWA 1J5EI 5A2QC 3T1YE 1XMQI 1ZM3A 1XNQI 1RREA 2UUBE 4DPYA 1H7SA 3J7AM 4X65E 2VQFE 2F4VI 2HK2A 4DV5E 4JYAE 1N33E 5LMUI 3CWVA 4YY3E 4ED4A 4LF5E 4LF9I 2UXCE 2OI2A 3WU6A 4JI6I 2VF3A 4DV2E 4JI3I 4JI4I 1KKHA 1MG7A 4B3RI 1J5EE 1Z5CA 4DR4I 4HACA 4DUYI 4LFBE 2GS8A 4DXLA 4X62I 2F4VE 4X66I 1IBKI 2V2VA 1DARA 3B78A 5LMUE 4B3SI 4P52A 4HYMA 1I94E 3QT7A 4LF8E 5IT9Q 1UEKA 4LF9E 4FW9A 3OTOI 4JI4E 1MU5A 3WU4A 4B3RE 4DR4E 1N0VC 2HKEA 2VQEI 4K0KI 1A6FA 1PIEA 4M1KA 4HY1A 4NXNI 1IBKE 4YHHI 4DR6I 2HHHE 2UUAI 3J80Q 4OX9E 3OTOE 4DPTA 2XEXA 3D4JA 4LFAI 5IT9C 2HFUA 3PYFA 2VQEE 4K0KE 3H4LA 1Z0CA 1HR0E 4YHHE 4DR6E 2UXBI 5LL6R 2ZBKB 3JAMQ 1XNRI 1WUUA 2NPFA 4FN5A 3QT5A 2UU9I 1B63A 2J7KA 2HK3A 5IWAE 4LF6E 2R42A 1KTVA 1KVKA 2LJPA 4DV3I 1BKNA 4DU7A 2HFSA 4X64E 3V2UC 3ZZUA 3B8HA 5L3JA 4DV4I 3PYGA 4LF7I 4KQVA 3PYDA 1IBMI 4DU8A 2UU9E 1N34I 1S16A 5LMNI 4DR2I 3ZKDA 2Q2EB 2V2QA 4FWHA 4DR7I 2ZITA 1U2RA 4UTGA 4DV3E 4P7AA 1H73A 1EA6A 4DR1E 4DV4E 4LF7E 4HACB 2V2ZA 4B3MI 1IBME 2V34A 3LNUA 1HNWI 4GKJE 1XMOE 2AJ4A 2E5LI 4DR2E 4FWGA 1XMQE 1XNQE 4DR7E 3M6AA 1Z59A 4MYUA 1QZRA 4JI7I 4JI0I 4ZVIA 1K47A 1ZM4A 1FJGI 4RPFA 4JI1I 4NXMI 2BM0A 2DEJA 1Z5AA 1ZM2A 4PU9A 1N36I 4B3ME 4JI6E 1HNWE 3J81Q 4JI3E 5BR8I 1Z0BA 4JV5I 4DV1I 4AQYI 3ZKBA 3ZZ0A 3HULA 2A2CA 4DUYE 4X62E 1FKAE 4JI7E 4X66E 2X7IA 4JI0E 1N32I 4PRVA 4DR3I 1Z0WA 4B3SE 4DR5I 4B3TI 4MYTA 4LFCI 1H74A 4DV6I 1HNZI 1Z0VA 1NZ0A 4AQYE
chains in the Genus database with same CATH superfamily
3J81C 2DEIA 2PNZA 4JI5I 5JEAF 4WUDA 5C0XE 3F0NA 2HKJA 2WW4A 4NXNE 2BA0G 1N32E 2UUCI 4BA2A 4DR3E 1E3PA 4FW3A 2ZM6I 3QT6A 1OJ4A 1VISA 1Y4UA 4LOMA 4JI8I 2UUAE 4MU4A 3K17A 2C38A 4WUCA 4R1FA 2E1RA 1H7UA 4LFAE 3PS1A 2CGEA 4DUZI 3J80C 3T1HI 2UXDI 3PYEA 4LCFA 2A2DA 3LPSA 1HNXI 1UDSA 1PVGA 2UUCE 1NHJA 4MU1A 2ZM6E 2UXBE 4DV7I 2X36A 4JI8E 4JG4A 4FWDA 1XNRE 1YH8A 4LPFA 3J7AG 4KHPI 1ZM9A 1B62A 3JAMC 4PRXA 2R3VA 1RHYA 5FLXQ 2Z5BA 1UDNA 3B4TA 4HXZA 1D6TA 4I3HA 4JYAI 1N33I 4Z7YA 3Q1QA 2C37A 1FWLA 1RR9A 4BA1B 2BV3A 4DV7E 4OO1B 1FNMA 1ZXNA 3WU3A 2GO4A 2EFGA 3HJCA 1N34E 2BA0D 4KHPE 4EMDA 2NN6A 5LMNE 1H72C 5JEAC 4LFBI 3K85A 4DV0I 1IBLI 5K36A 2IERA 4WUBA 1UDOA 2NN6C 5K36C 2JEAA 1I94I 4LF8I 5FLXC 5JEAE 2JEBB 5EKWA 1N0UA 4IFDA 4NBQA 2NN6E 5K36E 1PKPA 3LTOA 3V5RA 5DROA 5GMEA 2AE8A 4AIDA 4XTJA 2E5LE 2PO2B 4DV0E 1IBLE 5JEAD 5C0XB 1XHKA 1USUA 3WU5A 4OZEA 1KIJA 3QT8A 1ELOA 2HHHI 4LCGA 4LF4I 1FJGE 4JI1E 4NXME 4OX9I 2BM1A 1Z0EA 2PNZB 1UDQA 2C39A 1N36E 1NHHA 5BR8E 4BA2B 4ISAA 4FW4A 4JV5E 1Z5BA 4DV1E 3ZM7A 4USMA 1S4EA 2C38B 2GQ0A 2IOPA 1HR0I 4DPUA 4LF4E 2PO1A 4DR5E 1Z0TA 4B3TE 2PO0A 3PRYA 4URLA 2O3ZA 3H1CA 1MX0A 5GMDA 4JI2I 3B82A 2BA1G 2V8PA 3ZZTA 3GONA 1FI4A 4LFCE 5IWAI 4LF6I 4Z7CA 4DV6E 1HNZE 2BR2A 4IS9A 4USKA 5EL9A 1NHIA 4UT4A 4X64I 1OYRA 4JI5E 3U1YA 1FWKA 2O1UA 1ZXMA 4OO1F 2GO3A 1P42A 4GQUA 5A2QQ 3K1JA 2Z5BB 4GKKI 2IESA 4JI2E 4MDTA 1USVA 1Z0GA 3M85D 2C37B 4DPXA 3T1YI 2CZ9A 2O1VA 4DUZE 2UUBI 3T1HE 2UXDE 4X65I 2VQFI 4DV5I 1EI1A 1Y5YA 1HNXE 4DR1I 4YY3I 4IZJD 4LF5I 2NN6B 4QNJA 2VESA 2UXCI 5K36B 4DV2I 4GKKE 4GKJI 1XMOI 4AIMA 4DPWA 1R6LA 2JEAB 5JEAA 1J5EI 5A2QC 3T1YE 1XMQI 1ZM3A 1XNQI 1RREA 2O1WA 1YHCA 2UUBE 4IFDB 4DPYA 1H7SA 3J7AM 4X65E 2VQFE 2F4VI 3PS2A 2HK2A 2BA1D 4DV5E 3M7NG 4JYAE 1N33E 5LMUI 3CWVA 4YY3E 4ED4A 4LF5E 4LF9I 2UXCE 2OI2A 3WU6A 2CVEA 4JI6I 5DNLA 2VF3A 4DV2E 4JI3I 4U3DA 4JI4I 1KKHA 1MG7A 4B3RI 1J5EE 1Z5CA 4U3BA 4DR4I 5FWKA 4HACA 4DUYI 4LFBE 2GS8A 4DXLA 4X62I 2F4VE 4X66I 2C39B 1IBKI 2V2VA 1DARA 3B78A 2JT2A 5LMUE 4B3SI 4P52A 3Q6MA 4HYMA 3QT7A 1I94E 4LF8E 2IOQA 3PS3A 5IT9Q 1UEKA 4LF9E 2Z5EA 3NZKA 4FW9A 3L7ZA 3OTOI 4IZKA 4AM3A 4JI4E 1MU5A 3P06A 5ELWA 3WU4A 4B3RE 4FW5A 1R6MA 4DR4E 1N0VC 2PO1B 5DRRA 2WP8A 2HKEA 2VQEI 2PO0B 4K0KI 1A6FA 1PIEA 4M1KA 4HY1A 4QNKA 4NXNI 1IBKE 3CDIA 4YHHI 4OO1D 4DR6I 2HHHE 2UUAI 2Z5CA 2BR2B 3CDJA 3J80Q 4OX9E 3OTOE 2WNRA 4DPTA 2XEXA 3D4JA 4LFAI 4OKGA 5IT9C 2HFUA 3PYFA 4IZJA 2VQEE 1Y4SA 3Q6NA 4K0KE 3H4LA 2NN6F 1Z0CA 1HR0E 4YHHE 4DR6E 4MQYA 2UXBI 5K36F 3GCMA 2ZBKB 5LL6R 3JAMQ 1XNRI 1WUUA 2NPFA 4FN5A 3QT5A 2UU9I 3UHMA 1B63A 2J7KA 2HK3A 5C0XD 4IFDF 5IWAE 4LF6E 2R42A 1KTVA 1KVKA 2LJPA 1OYPA 4DV3I 1BKNA 4DU7A 2HFSA 4X64E 2JE6B 3V2UC 5JEAB 3ZZUA 3B8HA 5L3JA 4DV4I 3PYGA 4LF7I 4KQVA 3PYDA 3U1KA 4MU3A 1IBMI 4DU8A 2UU9E 1N34I 1S16A 3GMEA 2JE6A 5LMNI 4DR2I 1HK7A 2PNLA 3ZKDA 2Q2EB 2V2QA 4FWHA 4DR7I 2ZITA 5C0XF 1VI7A 1U2RA 4N3OA 4UTGA 2F1DA 5DRPA 4DV3E 4P7AA 1H73A 5DNXA 1EA6A 4DR1E 4DV4E 4LF7E 4HACB 2V2ZA 4B3MI 1IBME 2V34A 3LNUA 1HNWI 4GKJE 4FW6A 1XMOE 2AJ4A 2E5LI 2J65A 4DR2E 4BA1A 4FWGA 1XMQE 1XNQE 3P3EA 4DR7E 3M6AA 1Z59A 4OO1A 4FW7A 4MYUA 1Y60A 1QZRA 3L7ZB 3P3GA 4IZKB 4JI7I 3DD6A 4JI0I 4OO1C 4ZVIA 1K47A 1ZM4A 3KRNA 1FJGI 4RPFA 4JI1I 4NXMI 2BM0A 2PNMA 2DEJA 1Z5AA 1ZM2A 2WP8B 4PU9A 1N36I 4B3ME 1XXEA 4MU0A 4JI6E 4IFDC 1HNWE 3J81Q 4JI3E 4OO1E 5BR8I 3GLLA 1Z0BA 4JV5I 4LCHA 2JEBA 3P3CA 4DV1I 4AQYI 3ZKBA 3ZZ0A 2Z5CB 3HULA 2A2CA 1E3HA 4DUYE 4IFDE 2NN6D 4J3DA 4X62E 1FKAE 4JI7E 4X66E 5K36D 2WNRB 2X7IA 4JI0E 2CG9A 4PRVA 1N32I 3M85G 2PO2A 1OYSA 4DR3I 1Z0WA 4B3SE 4DR5I 4B3TI 1Y6ZA 5C0XA 3P76A 4IZJB 2O1TA 4MYTA 5C0XC 3M7ND 4IFDD 4LFCI 1H74A 4DV6I 1HNZI 1Z0VA 1NZ0A 5DRQA 4AQYE 3HKMA
chains in the Genus database with same CATH topology
3J81C 2DEIA 4JI5I 4WUDA 3F0NA 2HKJA 2WW4A 4NXNE 1N32E 2UUCI 4DR3E 2ZM6I 3QT6A 1OJ4A 1VISA 1Y4UA 4JI8I 2UUAE 3K17A 4WUCA 4R1FA 2E1RA 1H7UA 4LFAE 2CGEA 4DUZI 3J80C 3T1HI 2UXDI 3PYEA 2A2DA 3LPSA 1HNXI 1PVGA 2UUCE 1NHJA 2ZM6E 2UXBE 4DV7I 2X36A 4JI8E 4JG4A 4FWDA 1XNRE 3J7AG 4KHPI 1ZM9A 1B62A 3JAMC 4PRXA 2R3VA 5FLXQ 2Z5BA 4HXZA 1D6TA 4I3HA 4JYAI 1N33I 4Z7YA 3Q1QA 1FWLA 1RR9A 2BV3A 4DV7E 1FNMA 1ZXNA 3WU3A 2EFGA 3HJCA 1N34E 4KHPE 4EMDA 5LMNE 1H72C 4LFBI 3K85A 4DV0I 1IBLI 4WUBA 1I94I 4LF8I 5FLXC 1N0UA 1PKPA 3LTOA 3V5RA 5GMEA 4XTJA 2E5LE 4DV0E 1IBLE 1XHKA 1USUA 3WU5A 1KIJA 3QT8A 1ELOA 2HHHI 4LF4I 1FJGE 4JI1E 4NXME 4OX9I 2BM1A 1Z0EA 1N36E 1NHHA 5BR8E 4JV5E 1Z5BA 4DV1E 3ZM7A 4USMA 1S4EA 2GQ0A 2IOPA 1HR0I 4DPUA 4LF4E 4DR5E 1Z0TA 4B3TE 3PRYA 4URLA 1MX0A 5GMDA 4JI2I 3B82A 2V8PA 3ZZTA 3GONA 1FI4A 4LFCE 5IWAI 4LF6I 4Z7CA 4DV6E 1HNZE 4USKA 1NHIA 4UT4A 4X64I 4JI5E 1FWKA 2O1UA 1ZXMA 5A2QQ 3K1JA 2Z5BB 4GKKI 4JI2E 1USVA 1Z0GA 3T1YI 4DPXA 2CZ9A 2O1VA 4DUZE 2UUBI 3T1HE 2UXDE 4X65I 2VQFI 4DV5I 1EI1A 1HNXE 4DR1I 4YY3I 4IZJD 4LF5I 2UXCI 4DV2I 4GKKE 4GKJI 1XMOI 4DPWA 1J5EI 5A2QC 3T1YE 1XMQI 1ZM3A 1XNQI 1RREA 2O1WA 2UUBE 4DPYA 1H7SA 3J7AM 4X65E 2VQFE 2F4VI 2HK2A 4DV5E 4JYAE 1N33E 5LMUI 3CWVA 4YY3E 4ED4A 4LF5E 4LF9I 2UXCE 2OI2A 3WU6A 4JI6I 2VF3A 4DV2E 4JI3I 4JI4I 1KKHA 1MG7A 4B3RI 1J5EE 1Z5CA 4DR4I 5FWKA 4HACA 4DUYI 4LFBE 2GS8A 4DXLA 4X62I 2F4VE 4X66I 1IBKI 2V2VA 1DARA 3B78A 5LMUE 4B3SI 4P52A 3Q6MA 4HYMA 3QT7A 1I94E 4LF8E 2IOQA 5IT9Q 1UEKA 4LF9E 2Z5EA 4FW9A 3OTOI 4IZKA 4JI4E 1MU5A 3P06A 3WU4A 4B3RE 4DR4E 1N0VC 2HKEA 2VQEI 4K0KI 1A6FA 1PIEA 4M1KA 4HY1A 4NXNI 1IBKE 4YHHI 4DR6I 2HHHE 2UUAI 2Z5CA 3J80Q 4OX9E 3OTOE 4DPTA 2XEXA 3D4JA 4LFAI 5IT9C 2HFUA 3PYFA 4IZJA 2VQEE 1Y4SA 3Q6NA 4K0KE 3H4LA 1Z0CA 1HR0E 4YHHE 4DR6E 2UXBI 5LL6R 2ZBKB 3JAMQ 1XNRI 1WUUA 2NPFA 4FN5A 3QT5A 2UU9I 1B63A 2J7KA 2HK3A 5IWAE 4LF6E 2R42A 1KTVA 1KVKA 2LJPA 4DV3I 1BKNA 4DU7A 2HFSA 4X64E 3V2UC 3ZZUA 3B8HA 5L3JA 4DV4I 3PYGA 4LF7I 4KQVA 3PYDA 1IBMI 4DU8A 2UU9E 1N34I 1S16A 5LMNI 4DR2I 1HK7A 2PNLA 3ZKDA 2Q2EB 2V2QA 4FWHA 4DR7I 2ZITA 1U2RA 4N3OA 4UTGA 4DV3E 4P7AA 1H73A 1EA6A 4DR1E 4DV4E 4LF7E 4HACB 2V2ZA 4B3MI 1IBME 2V34A 3LNUA 1HNWI 4GKJE 1XMOE 2AJ4A 2E5LI 4DR2E 4FWGA 1XMQE 1XNQE 4DR7E 3M6AA 1Z59A 4MYUA 1QZRA 4IZKB 4JI7I 4JI0I 4ZVIA 1K47A 1ZM4A 1FJGI 4RPFA 4JI1I 4NXMI 2BM0A 2PNMA 2DEJA 1Z5AA 1ZM2A 4PU9A 1N36I 4B3ME 4JI6E 1HNWE 3J81Q 4JI3E 5BR8I 1Z0BA 4JV5I 4DV1I 4AQYI 3ZKBA 3ZZ0A 2Z5CB 3HULA 2A2CA 4DUYE 4X62E 1FKAE 4JI7E 4X66E 2X7IA 4JI0E 2CG9A 4PRVA 1N32I 4DR3I 1Z0WA 4B3SE 4DR5I 4B3TI 1Y6ZA 4IZJB 2O1TA 4MYTA 4LFCI 1H74A 4DV6I 1HNZI 1Z0VA 1NZ0A 4AQYE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J81 C;  2DEI A;  4JI5 I;  4WUD A;  3F0N A;  2HKJ A;  2WW4 A;  4NXN E;  1N32 E;  2UUC I;  4DR3 E;  2ZM6 I;  3QT6 A;  1OJ4 A;  1VIS A;  2UUA E;  4JI8 I;  3K17 A;  4WUC A;  4R1F A;  2E1R A;  1H7U A;  4LFA E;  4DUZ I;  3J80 C;  3T1H I;  2UXD I;  3PYE A;  2A2D A;  3LPS A;  1HNX I;  1PVG A;  2UUC E;  1NHJ A;  2ZM6 E;  2UXB E;  4DV7 I;  2X36 A;  4JI8 E;  4JG4 A;  4FWD A;  1XNR E;  3J7A G;  4KHP I;  1ZM9 A;  1B62 A;  3JAM C;  4PRX A;  2R3V A;  5FLX Q;  4HXZ A;  1D6T A;  4I3H A;  4JYA I;  1N33 I;  4Z7Y A;  3Q1Q A;  1FWL A;  1RR9 A;  2BV3 A;  4DV7 E;  1FNM A;  1ZXN A;  3WU3 A;  2EFG A;  1N34 E;  4KHP E;  4EMD A;  5LMN E;  1H72 C;  4LFB I;  4DV0 I;  1IBL I;  4WUB A;  1I94 I;  4LF8 I;  5FLX C;  1N0U A;  1PKP A;  3LTO A;  3V5R A;  5GME A;  4XTJ A;  2E5L E;  1IBL E;  4DV0 E;  1XHK A;  3WU5 A;  1KIJ A;  3QT8 A;  1ELO A;  2HHH I;  4LF4 I;  1FJG E;  4JI1 E;  4NXM E;  4OX9 I;  2BM1 A;  1Z0E A;  1N36 E;  1NHH A;  5BR8 E;  4JV5 E;  1Z5B A;  4DV1 E;  3ZM7 A;  4USM A;  1S4E A;  1HR0 I;  4DPU A;  4LF4 E;  4DR5 E;  1Z0T A;  4B3T E;  4URL A;  1MX0 A;  5GMD A;  4JI2 I;  3B82 A;  2V8P A;  3ZZT A;  3GON A;  1FI4 A;  4LFC E;  5IWA I;  4LF6 I;  4Z7C A;  4DV6 E;  1HNZ E;  4USK A;  1NHI A;  4UT4 A;  4X64 I;  4JI5 E;  1FWK A;  1ZXM A;  5A2Q Q;  3K1J A;  4GKK I;  4JI2 E;  1Z0G A;  3T1Y I;  4DPX A;  2CZ9 A;  4DUZ E;  2UUB I;  3T1H E;  2UXD E;  4X65 I;  2VQF I;  4DV5 I;  1EI1 A;  1HNX E;  4DR1 I;  4YY3 I;  4LF5 I;  2UXC I;  4DV2 I;  4GKK E;  4GKJ I;  1XMO I;  4DPW A;  1J5E I;  5A2Q C;  3T1Y E;  1XMQ I;  1ZM3 A;  1XNQ I;  1RRE A;  2UUB E;  4DPY A;  1H7S A;  3J7A M;  4X65 E;  2VQF E;  2F4V I;  2HK2 A;  4DV5 E;  4JYA E;  1N33 E;  5LMU I;  3CWV A;  4YY3 E;  4ED4 A;  4LF5 E;  4LF9 I;  2UXC E;  2OI2 A;  3WU6 A;  4JI6 I;  2VF3 A;  4DV2 E;  4JI3 I;  4JI4 I;  1KKH A;  1MG7 A;  4B3R I;  1J5E E;  1Z5C A;  4DR4 I;  4HAC A;  4DUY I;  4LFB E;  2GS8 A;  4DXL A;  4X62 I;  2F4V E;  4X66 I;  1IBK I;  2V2V A;  1DAR A;  3B78 A;  5LMU E;  4B3S I;  4P52 A;  4HYM A;  1I94 E;  3QT7 A;  4LF8 E;  5IT9 Q;  1UEK A;  4LF9 E;  4FW9 A;  3OTO I;  4JI4 E;  1MU5 A;  3WU4 A;  4B3R E;  4DR4 E;  1N0V C;  2HKE A;  2VQE I;  4K0K I;  1A6F A;  1PIE A;  4M1K A;  4HY1 A;  4NXN I;  1IBK E;  4YHH I;  4DR6 I;  2HHH E;  2UUA I;  3J80 Q;  4OX9 E;  3OTO E;  4DPT A;  2XEX A;  3D4J A;  4LFA I;  5IT9 C;  2HFU A;  3PYF A;  2VQE E;  4K0K E;  3H4L A;  1Z0C A;  1HR0 E;  4YHH E;  4DR6 E;  2UXB I;  5LL6 R;  2ZBK B;  3JAM Q;  1XNR I;  1WUU A;  2NPF A;  4FN5 A;  3QT5 A;  2UU9 I;  1B63 A;  2J7K A;  2HK3 A;  5IWA E;  4LF6 E;  2R42 A;  1KTV A;  1KVK A;  2LJP A;  4DV3 I;  1BKN A;  4DU7 A;  2HFS A;  4X64 E;  3V2U C;  3ZZU A;  3B8H A;  5L3J A;  4DV4 I;  3PYG A;  4LF7 I;  4KQV A;  3PYD A;  1IBM I;  4DU8 A;  2UU9 E;  1N34 I;  1S16 A;  5LMN I;  4DR2 I;  3ZKD A;  2Q2E B;  2V2Q A;  4FWH A;  4DR7 I;  2ZIT A;  1U2R A;  4UTG A;  4DV3 E;  4P7A A;  1H73 A;  1EA6 A;  4DR1 E;  4DV4 E;  4LF7 E;  4HAC B;  2V2Z A;  4B3M I;  1IBM E;  2V34 A;  3LNU A;  1HNW I;  4GKJ E;  1XMO E;  2AJ4 A;  2E5L I;  4DR2 E;  4FWG A;  1XMQ E;  1XNQ E;  4DR7 E;  3M6A A;  1Z59 A;  4MYU A;  1QZR A;  4JI7 I;  4JI0 I;  4ZVI A;  1K47 A;  1ZM4 A;  1FJG I;  4RPF A;  4JI1 I;  4NXM I;  2BM0 A;  2DEJ A;  1Z5A A;  1ZM2 A;  4PU9 A;  1N36 I;  4B3M E;  4JI6 E;  1HNW E;  3J81 Q;  4JI3 E;  5BR8 I;  1Z0B A;  4JV5 I;  4DV1 I;  4AQY I;  3ZKB A;  3ZZ0 A;  3HUL A;  2A2C A;  4DUY E;  4X62 E;  1FKA E;  4JI7 E;  4X66 E;  2X7I A;  4JI0 E;  1N32 I;  4PRV A;  4DR3 I;  1Z0W A;  4B3S E;  4DR5 I;  4B3T I;  4MYT A;  4LFC I;  1H74 A;  4DV6 I;  1HNZ I;  1Z0V A;  1NZ0 A;  4AQY E; 
#chains in the Genus database with same CATH topology
 3J81 C;  2DEI A;  2PNZ A;  4JI5 I;  5JEA F;  4WUD A;  5C0X E;  3F0N A;  2HKJ A;  2WW4 A;  4NXN E;  2BA0 G;  1N32 E;  2UUC I;  4BA2 A;  4DR3 E;  1E3P A;  4FW3 A;  2ZM6 I;  3QT6 A;  1OJ4 A;  1VIS A;  1Y4U A;  4LOM A;  4JI8 I;  2UUA E;  4MU4 A;  3K17 A;  2C38 A;  4WUC A;  4R1F A;  2E1R A;  1H7U A;  4LFA E;  3PS1 A;  2CGE A;  4DUZ I;  3J80 C;  3T1H I;  2UXD I;  3PYE A;  4LCF A;  2A2D A;  3LPS A;  1HNX I;  1UDS A;  1PVG A;  2UUC E;  1NHJ A;  4MU1 A;  2ZM6 E;  2UXB E;  4DV7 I;  2X36 A;  4JI8 E;  4JG4 A;  4FWD A;  1XNR E;  1YH8 A;  4LPF A;  3J7A G;  4KHP I;  1ZM9 A;  1B62 A;  3JAM C;  4PRX A;  2R3V A;  1RHY A;  5FLX Q;  2Z5B A;  1UDN A;  3B4T A;  4HXZ A;  1D6T A;  4I3H A;  4JYA I;  1N33 I;  4Z7Y A;  3Q1Q A;  2C37 A;  1FWL A;  1RR9 A;  4BA1 B;  2BV3 A;  4DV7 E;  4OO1 B;  1FNM A;  1ZXN A;  3WU3 A;  2GO4 A;  2EFG A;  3HJC A;  1N34 E;  2BA0 D;  4KHP E;  4EMD A;  2NN6 A;  5LMN E;  1H72 C;  5JEA C;  4LFB I;  3K85 A;  4DV0 I;  1IBL I;  5K36 A;  2IER A;  4WUB A;  1UDO A;  2NN6 C;  5K36 C;  2JEA A;  1I94 I;  4LF8 I;  5FLX C;  5JEA E;  2JEB B;  5EKW A;  1N0U A;  4IFD A;  4NBQ A;  2NN6 E;  5K36 E;  1PKP A;  3LTO A;  3V5R A;  5DRO A;  5GME A;  2AE8 A;  4AID A;  4XTJ A;  2E5L E;  2PO2 B;  4DV0 E;  1IBL E;  5JEA D;  5C0X B;  1XHK A;  1USU A;  3WU5 A;  4OZE A;  1KIJ A;  3QT8 A;  1ELO A;  2HHH I;  4LCG A;  4LF4 I;  1FJG E;  4JI1 E;  4NXM E;  4OX9 I;  2BM1 A;  1Z0E A;  2PNZ B;  1UDQ A;  2C39 A;  1N36 E;  1NHH A;  5BR8 E;  4BA2 B;  4ISA A;  4FW4 A;  4JV5 E;  1Z5B A;  4DV1 E;  3ZM7 A;  4USM A;  1S4E A;  2C38 B;  2GQ0 A;  2IOP A;  1HR0 I;  4DPU A;  4LF4 E;  2PO1 A;  4DR5 E;  1Z0T A;  4B3T E;  2PO0 A;  3PRY A;  4URL A;  2O3Z A;  3H1C A;  1MX0 A;  5GMD A;  4JI2 I;  3B82 A;  2BA1 G;  2V8P A;  3ZZT A;  3GON A;  1FI4 A;  4LFC E;  5IWA I;  4LF6 I;  4Z7C A;  4DV6 E;  1HNZ E;  2BR2 A;  4IS9 A;  4USK A;  5EL9 A;  1NHI A;  4UT4 A;  4X64 I;  1OYR A;  4JI5 E;  3U1Y A;  1FWK A;  2O1U A;  1ZXM A;  4OO1 F;  2GO3 A;  1P42 A;  4GQU A;  5A2Q Q;  3K1J A;  2Z5B B;  4GKK I;  2IES A;  4JI2 E;  4MDT A;  1USV A;  1Z0G A;  3M85 D;  2C37 B;  4DPX A;  3T1Y I;  2CZ9 A;  2O1V A;  4DUZ E;  2UUB I;  3T1H E;  2UXD E;  4X65 I;  2VQF I;  4DV5 I;  1EI1 A;  1Y5Y A;  1HNX E;  4DR1 I;  4YY3 I;  4IZJ D;  4LF5 I;  2NN6 B;  4QNJ A;  2VES A;  2UXC I;  5K36 B;  4DV2 I;  4GKK E;  4GKJ I;  1XMO I;  4AIM A;  4DPW A;  1R6L A;  2JEA B;  5JEA A;  1J5E I;  5A2Q C;  3T1Y E;  1XMQ I;  1ZM3 A;  1XNQ I;  1RRE A;  2O1W A;  1YHC A;  2UUB E;  4IFD B;  4DPY A;  1H7S A;  3J7A M;  4X65 E;  2VQF E;  2F4V I;  3PS2 A;  2HK2 A;  2BA1 D;  4DV5 E;  3M7N G;  4JYA E;  1N33 E;  5LMU I;  3CWV A;  4YY3 E;  4ED4 A;  4LF5 E;  4LF9 I;  2UXC E;  2OI2 A;  3WU6 A;  2CVE A;  4JI6 I;  5DNL A;  2VF3 A;  4DV2 E;  4JI3 I;  4U3D A;  4JI4 I;  1KKH A;  1MG7 A;  4B3R I;  1J5E E;  1Z5C A;  4U3B A;  4DR4 I;  5FWK A;  4HAC A;  4DUY I;  4LFB E;  2GS8 A;  4DXL A;  4X62 I;  2F4V E;  4X66 I;  2C39 B;  1IBK I;  2V2V A;  1DAR A;  3B78 A;  2JT2 A;  5LMU E;  4B3S I;  4P52 A;  3Q6M A;  4HYM A;  3QT7 A;  1I94 E;  4LF8 E;  2IOQ A;  3PS3 A;  5IT9 Q;  1UEK A;  4LF9 E;  2Z5E A;  3NZK A;  4FW9 A;  3L7Z A;  3OTO I;  4IZK A;  4AM3 A;  4JI4 E;  1MU5 A;  3P06 A;  5ELW A;  3WU4 A;  4B3R E;  4FW5 A;  1R6M A;  4DR4 E;  1N0V C;  2PO1 B;  5DRR A;  2WP8 A;  2HKE A;  2VQE I;  2PO0 B;  4K0K I;  1A6F A;  1PIE A;  4M1K A;  4HY1 A;  4QNK A;  4NXN I;  1IBK E;  3CDI A;  4YHH I;  4OO1 D;  4DR6 I;  2HHH E;  2UUA I;  2Z5C A;  2BR2 B;  3CDJ A;  3J80 Q;  4OX9 E;  3OTO E;  2WNR A;  4DPT A;  2XEX A;  3D4J A;  4LFA I;  4OKG A;  5IT9 C;  2HFU A;  3PYF A;  4IZJ A;  2VQE E;  1Y4S A;  3Q6N A;  4K0K E;  3H4L A;  2NN6 F;  1Z0C A;  1HR0 E;  4YHH E;  4DR6 E;  4MQY A;  2UXB I;  5K36 F;  3GCM A;  2ZBK B;  5LL6 R;  3JAM Q;  1XNR I;  1WUU A;  2NPF A;  4FN5 A;  3QT5 A;  2UU9 I;  3UHM A;  1B63 A;  2J7K A;  2HK3 A;  5C0X D;  4IFD F;  5IWA E;  4LF6 E;  2R42 A;  1KTV A;  1KVK A;  2LJP A;  1OYP A;  4DV3 I;  1BKN A;  4DU7 A;  2HFS A;  4X64 E;  2JE6 B;  3V2U C;  5JEA B;  3ZZU A;  3B8H A;  5L3J A;  4DV4 I;  3PYG A;  4LF7 I;  4KQV A;  3PYD A;  3U1K A;  4MU3 A;  1IBM I;  4DU8 A;  2UU9 E;  1N34 I;  1S16 A;  3GME A;  2JE6 A;  5LMN I;  4DR2 I;  1HK7 A;  2PNL A;  3ZKD A;  2Q2E B;  2V2Q A;  4FWH A;  4DR7 I;  2ZIT A;  5C0X F;  1VI7 A;  1U2R A;  4N3O A;  4UTG A;  2F1D A;  5DRP A;  4DV3 E;  4P7A A;  1H73 A;  5DNX A;  1EA6 A;  4DR1 E;  4DV4 E;  4LF7 E;  4HAC B;  2V2Z A;  4B3M I;  1IBM E;  2V34 A;  3LNU A;  1HNW I;  4GKJ E;  4FW6 A;  1XMO E;  2AJ4 A;  2E5L I;  2J65 A;  4DR2 E;  4BA1 A;  4FWG A;  1XMQ E;  1XNQ E;  3P3E A;  4DR7 E;  3M6A A;  1Z59 A;  4OO1 A;  4FW7 A;  4MYU A;  1Y60 A;  1QZR A;  3L7Z B;  3P3G A;  4IZK B;  4JI7 I;  3DD6 A;  4JI0 I;  4OO1 C;  4ZVI A;  1K47 A;  1ZM4 A;  3KRN A;  1FJG I;  4RPF A;  4JI1 I;  4NXM I;  2BM0 A;  2PNM A;  2DEJ A;  1Z5A A;  1ZM2 A;  2WP8 B;  4PU9 A;  1N36 I;  4B3M E;  1XXE A;  4MU0 A;  4JI6 E;  4IFD C;  1HNW E;  3J81 Q;  4JI3 E;  4OO1 E;  5BR8 I;  3GLL A;  1Z0B A;  4JV5 I;  4LCH A;  2JEB A;  3P3C A;  4DV1 I;  4AQY I;  3ZKB A;  3ZZ0 A;  2Z5C B;  3HUL A;  2A2C A;  1E3H A;  4DUY E;  4IFD E;  2NN6 D;  4J3D A;  4X62 E;  1FKA E;  4JI7 E;  4X66 E;  5K36 D;  2WNR B;  2X7I A;  4JI0 E;  2CG9 A;  4PRV A;  1N32 I;  3M85 G;  2PO2 A;  1OYS A;  4DR3 I;  1Z0W A;  4B3S E;  4DR5 I;  4B3T I;  1Y6Z A;  5C0X A;  3P76 A;  4IZJ B;  2O1T A;  4MYT A;  5C0X C;  3M7N D;  4IFD D;  4LFC I;  1H74 A;  4DV6 I;  1HNZ I;  1Z0V A;  1NZ0 A;  5DRQ A;  4AQY E;  3HKM A; 
#chains in the Genus database with same CATH homology
 3J81 C;  2DEI A;  4JI5 I;  4WUD A;  3F0N A;  2HKJ A;  2WW4 A;  4NXN E;  1N32 E;  2UUC I;  4DR3 E;  2ZM6 I;  3QT6 A;  1OJ4 A;  1VIS A;  1Y4U A;  4JI8 I;  2UUA E;  3K17 A;  4WUC A;  4R1F A;  2E1R A;  1H7U A;  4LFA E;  2CGE A;  4DUZ I;  3J80 C;  3T1H I;  2UXD I;  3PYE A;  2A2D A;  3LPS A;  1HNX I;  1PVG A;  2UUC E;  1NHJ A;  2ZM6 E;  2UXB E;  4DV7 I;  2X36 A;  4JI8 E;  4JG4 A;  4FWD A;  1XNR E;  3J7A G;  4KHP I;  1ZM9 A;  1B62 A;  3JAM C;  4PRX A;  2R3V A;  5FLX Q;  2Z5B A;  4HXZ A;  1D6T A;  4I3H A;  4JYA I;  1N33 I;  4Z7Y A;  3Q1Q A;  1FWL A;  1RR9 A;  2BV3 A;  4DV7 E;  1FNM A;  1ZXN A;  3WU3 A;  2EFG A;  3HJC A;  1N34 E;  4KHP E;  4EMD A;  5LMN E;  1H72 C;  4LFB I;  3K85 A;  4DV0 I;  1IBL I;  4WUB A;  1I94 I;  4LF8 I;  5FLX C;  1N0U A;  1PKP A;  3LTO A;  3V5R A;  5GME A;  4XTJ A;  2E5L E;  4DV0 E;  1IBL E;  1XHK A;  1USU A;  3WU5 A;  1KIJ A;  3QT8 A;  1ELO A;  2HHH I;  4LF4 I;  1FJG E;  4JI1 E;  4NXM E;  4OX9 I;  2BM1 A;  1Z0E A;  1N36 E;  1NHH A;  5BR8 E;  4JV5 E;  1Z5B A;  4DV1 E;  3ZM7 A;  4USM A;  1S4E A;  2GQ0 A;  2IOP A;  1HR0 I;  4DPU A;  4LF4 E;  4DR5 E;  1Z0T A;  4B3T E;  3PRY A;  4URL A;  1MX0 A;  5GMD A;  4JI2 I;  3B82 A;  2V8P A;  3ZZT A;  3GON A;  1FI4 A;  4LFC E;  5IWA I;  4LF6 I;  4Z7C A;  4DV6 E;  1HNZ E;  4USK A;  1NHI A;  4UT4 A;  4X64 I;  4JI5 E;  1FWK A;  2O1U A;  1ZXM A;  5A2Q Q;  3K1J A;  2Z5B B;  4GKK I;  4JI2 E;  1USV A;  1Z0G A;  3T1Y I;  4DPX A;  2CZ9 A;  2O1V A;  4DUZ E;  2UUB I;  3T1H E;  2UXD E;  4X65 I;  2VQF I;  4DV5 I;  1EI1 A;  1HNX E;  4DR1 I;  4YY3 I;  4IZJ D;  4LF5 I;  2UXC I;  4DV2 I;  4GKK E;  4GKJ I;  1XMO I;  4DPW A;  1J5E I;  5A2Q C;  3T1Y E;  1XMQ I;  1ZM3 A;  1XNQ I;  1RRE A;  2O1W A;  2UUB E;  4DPY A;  1H7S A;  3J7A M;  4X65 E;  2VQF E;  2F4V I;  2HK2 A;  4DV5 E;  4JYA E;  1N33 E;  5LMU I;  3CWV A;  4YY3 E;  4ED4 A;  4LF5 E;  4LF9 I;  2UXC E;  2OI2 A;  3WU6 A;  4JI6 I;  2VF3 A;  4DV2 E;  4JI3 I;  4JI4 I;  1KKH A;  1MG7 A;  4B3R I;  1J5E E;  1Z5C A;  4DR4 I;  5FWK A;  4HAC A;  4DUY I;  4LFB E;  2GS8 A;  4DXL A;  4X62 I;  2F4V E;  4X66 I;  1IBK I;  2V2V A;  1DAR A;  3B78 A;  5LMU E;  4B3S I;  4P52 A;  3Q6M A;  4HYM A;  3QT7 A;  1I94 E;  4LF8 E;  2IOQ A;  5IT9 Q;  1UEK A;  4LF9 E;  2Z5E A;  4FW9 A;  3OTO I;  4IZK A;  4JI4 E;  1MU5 A;  3P06 A;  3WU4 A;  4B3R E;  4DR4 E;  1N0V C;  2HKE A;  2VQE I;  4K0K I;  1A6F A;  1PIE A;  4M1K A;  4HY1 A;  4NXN I;  1IBK E;  4YHH I;  4DR6 I;  2HHH E;  2UUA I;  2Z5C A;  3J80 Q;  4OX9 E;  3OTO E;  4DPT A;  2XEX A;  3D4J A;  4LFA I;  5IT9 C;  2HFU A;  3PYF A;  4IZJ A;  2VQE E;  1Y4S A;  3Q6N A;  4K0K E;  3H4L A;  1Z0C A;  1HR0 E;  4YHH E;  4DR6 E;  2UXB I;  5LL6 R;  2ZBK B;  3JAM Q;  1XNR I;  1WUU A;  2NPF A;  4FN5 A;  3QT5 A;  2UU9 I;  1B63 A;  2J7K A;  2HK3 A;  5IWA E;  4LF6 E;  2R42 A;  1KTV A;  1KVK A;  2LJP A;  4DV3 I;  1BKN A;  4DU7 A;  2HFS A;  4X64 E;  3V2U C;  3ZZU A;  3B8H A;  5L3J A;  4DV4 I;  3PYG A;  4LF7 I;  4KQV A;  3PYD A;  1IBM I;  4DU8 A;  2UU9 E;  1N34 I;  1S16 A;  5LMN I;  4DR2 I;  1HK7 A;  2PNL A;  3ZKD A;  2Q2E B;  2V2Q A;  4FWH A;  4DR7 I;  2ZIT A;  1U2R A;  4N3O A;  4UTG A;  4DV3 E;  4P7A A;  1H73 A;  1EA6 A;  4DR1 E;  4DV4 E;  4LF7 E;  4HAC B;  2V2Z A;  4B3M I;  1IBM E;  2V34 A;  3LNU A;  1HNW I;  4GKJ E;  1XMO E;  2AJ4 A;  2E5L I;  4DR2 E;  4FWG A;  1XMQ E;  1XNQ E;  4DR7 E;  3M6A A;  1Z59 A;  4MYU A;  1QZR A;  4IZK B;  4JI7 I;  4JI0 I;  4ZVI A;  1K47 A;  1ZM4 A;  1FJG I;  4RPF A;  4JI1 I;  4NXM I;  2BM0 A;  2PNM A;  2DEJ A;  1Z5A A;  1ZM2 A;  4PU9 A;  1N36 I;  4B3M E;  4JI6 E;  1HNW E;  3J81 Q;  4JI3 E;  5BR8 I;  1Z0B A;  4JV5 I;  4DV1 I;  4AQY I;  3ZKB A;  3ZZ0 A;  2Z5C B;  3HUL A;  2A2C A;  4DUY E;  4X62 E;  1FKA E;  4JI7 E;  4X66 E;  2X7I A;  4JI0 E;  2CG9 A;  4PRV A;  1N32 I;  4DR3 I;  1Z0W A;  4B3S E;  4DR5 I;  4B3T I;  1Y6Z A;  4IZJ B;  2O1T A;  4MYT A;  4LFC I;  1H74 A;  4DV6 I;  1HNZ I;  1Z0V A;  1NZ0 A;  4AQY E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...