4DV3I

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a, bound with streptomycin
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 23
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dv3I00
3QT6A 4Z7YA 2VQEI 1Z0CA 4NXNI 4DPUA 1Z0GA 3T1HI 3B78A 2HK3A 2V2ZA 4DPWA 4JI5E 4LFCE 2DEJA 1VISA 4LF4I 1HNZI 2UUCE 2HFSA 4Z7CA 4PRVA 3J80C 5IWAE 1N34I 1Z0WA 1B63A 4B3SI 2HKJA 2R3VA 1KTVA 2R42A 4HACA 4JI3E 1PVGA 1XHKA 4WUCA 4MYTA 3Q1QA 4JI5I 1H72C 4K0KE 1I94I 4FWHA 2VQFE 2UUCI 1A6FA 4DPXA 5IWAI 4LFBE 4DV3E 2ZM6I 3QT7A 2A2DA 1IBKE 1RR9A 1U2RA 4K0KI 1Z0EA 2VQFI 4MYUA 2E5LI 4JI2E 3GONA 4DV5E 1N0VC 5BR8E 1FJGI 1FKAE 3OTOE 1IBKI 3JAMC 4JI0E 3PYFA 3ZZTA 4ED4A 4RPFA 1Z0BA 2UUAE 5FLXC 4DXLA 4EMDA 1XNRE 4DV5I 1N36E 4DU7A 1HNXI 4PRXA 1MG7A 3T1YE 3PYEA 4JI8I 3OTOI 3CWVA 4JV5E 3WU6A 1PKPA 4UTGA 4LF6E 4X65E 4UT4A 4JI4E 1FWKA 4DUZE 2NPFA 1DARA 1MU5A 1ELOA 3LPSA 4DV1E 1J5EE 1QZRA 4LFAE 1PIEA 3T1YI 4JV5I 4FN5A 4LF6I 3F0NA 4X65I 4X62E 4JI4I 4B3ME 3ZM7A 5LMUE 3M6AA 1S16A 4HYMA 4AQYE 2BM0A 4XTJA 5LMNE 4DV1I 1HR0E 1J5EI 4LFAI 3ZKBA 2GS8A 1OJ4A 4PU9A 1NHHA 3J81Q 2BV3A 4USMA 1XNQE 4DV2E 2UXDE 4B3RE 4X62I 4LFCI 1NHJA 3LTOA 4B3MI 1NZ0A 5LMUI 4AQYI 2UXCE 1HR0I 3J7AG 1ZXNA 3ZZUA 3LNUA 4DV2I 4DV6E 2WW4A 4JI3I 2HKEA 2UXDI 4DR4E 4B3RI 1S4EA 4LF8E 4GKJE 3H4LA 4X64E 1Z5CA 2UXCI 2Q2EB 1IBME 1XMOE 2UUBE 1EI1A 1XMQE 2J7KA 2DEIA 4X66E 2UU9E 4LFBI 4DR2E 4DV3I 1Z0VA 2HHHE 4DV6I 3QT8A 1KVKA 2EFGA 4DR4I 4GKKE 1ZM2A 4LF7E 4OX9E 1Z0TA 5GMEA 1ZM9A 4X64I 1XMOI 4JI2I 2HK2A 2ZBKB 2UUBI 2CZ9A 2AJ4A 3K1JA 1H74A 4X66I 2UU9I 2XEXA 4DR2I 5BR8I 2E1RA 3ZKDA 4HACB 2HHHI 4DPTA 4R1FA 4P7AA 4JI0I 1EA6A 4GKKI 2UXBE 1FNMA 1H73A 4ZVIA 1IBLE 2HFUA 4OX9I 2UUAI 1HNWE 1N33E 4B3TE 1ZXMA 1XNRI 2VQEE 1FWLA 3J81C 4URLA 1N36I 1ZM3A 4DR3E 5A2QQ 2A2CA 2UXBI 4JYAE 1HNZE 1IBLI 4DV7E 1WUUA 4DUZI 1H7UA 4DPYA 3WU5A 1HNWI 4FWGA 1K47A 1RREA 2X36A 3B82A 4DV0E 4DV4E 4B3TI 5LL6R 4B3SE 4HY1A 3WU3A 4FW9A 2VF3A 4JI7E 4DR3I 4FWDA 5GMDA 5L3JA 4JYAI 3B8HA 4LF5E 1I94E 4DV7I 4DR1E 1BKNA 4DUYE 5LMNI 4WUBA 4DV4I 5IT9C 4DV0I 2F4VE 2BM1A 4YY3E 4LF9E 2ZM6E 1NHIA 1N32E 4DR6E 4P52A 1XNQI 4JI7I 4JI6E 3K17A 4DU8A 4LF5I 4USKA 1ZM4A 4DR1I 1N0UA 1B62A 2E5LE 4DUYI 1Z5AA 3J80Q 2ZITA 4JI1E 2F4VI 4YY3I 2V34A 5IT9Q 4LF9I 1FJGE 2V2QA 1N32I 4DR7E 4DR6I 3J7AM 4DR5E 4JI6I 4LF8I 1FI4A 4M1KA 2V8PA 4GKJI 4YHHE 1Z5BA 4I3HA 1IBMI 3V5RA 4JI1I 2LJPA 1XMQI 1HNXE 1KIJA 2X7IA 4JI8E 1UEKA 4DR7I 4KHPE 5A2QC 4DR5I 2V2VA 4JG4A 4NXME 3WU4A 1MX0A 4LF7I 1Z59A 4WUDA 4YHHI 3PYGA 3HULA 3PYDA 4NXNE 3T1HE 4KHPI 3JAMQ 4HXZA 4KQVA 1D6TA 4NXMI 4LF4E 1H7SA 3ZZ0A 5FLXQ 1KKHA 3QT5A 3V2UC 1N33I 3D4JA 1N34E 2OI2A
chains in the Genus database with same CATH superfamily
3Q6NA 3QT6A 4Z7YA 2VQEI 1Z0CA 4MQYA 4NXNI 4DPUA 1Z0GA 3T1HI 3B78A 2HK3A 2O1WA 2WP8B 5C0XC 3Q6MA 2V2ZA 4DPWA 5JEAF 4JI5E 4LFCE 5K36F 4IFDD 2DEJA 1VISA 4LF4I 4FW7A 1HK7A 1HNZI 2UUCE 3M85G 2HFSA 4Z7CA 4PRVA 4IFDE 3J80C 5IWAE 1N34I 1Z0WA 1B63A 3P06A 4B3SI 2HKJA 2R3VA 1KTVA 2R42A 1UDOA 2PO2B 5C0XA 4HACA 4JI3E 1PVGA 1XHKA 4WUCA 4MYTA 3Q1QA 4JI5I 4LCGA 1H72C 2PO0A 4K0KE 2NN6F 2C37B 1I94I 4FWHA 2VQFE 2UUCI 1A6FA 3P76A 4DPXA 2GO3A 5IWAI 4IZKA 4FW5A 2PNMA 4LOMA 4LFBE 4DV3E 2Z5EA 2ZM6I 3QT7A 2A2DA 2J65A 1IBKE 1RR9A 1U2RA 5JEAC 2VESA 5K36C 4K0KI 1Z0EA 2C38B 2PNZA 2BR2B 2VQFI 3M7NG 4MYUA 2E5LI 4JI2E 3GONA 4LCHA 2JEAB 4DV5E 1N0VC 2IOPA 5BR8E 1FJGI 2BA1G 5DNLA 3OTOE 1FKAE 2BA0G 1Y4SA 5JEAA 1IBKI 3JAMC 3L7ZA 3PS1A 3PYFA 4JI0E 3ZZTA 5K36A 4ED4A 5EKWA 4BA2A 4RPFA 1Z0BA 4FW4A 4MDTA 2UUAE 2NN6C 5FLXC 4DXLA 1YH8A 4EMDA 1USVA 1XNRE 3HJCA 4IZJB 4DV5I 2JE6B 1N36E 4DU7A 1HNXI 4PRXA 4U3DA 1MG7A 3T1YE 3H1CA 3PYEA 4JI8I 3OTOI 3CWVA 4JV5E 3WU6A 1PKPA 4UTGA 4LF6E 4NBQA 3CDIA 4IS9A 4X65E 4UT4A 2PO1B 4JI4E 2NN6A 1FWKA 4DUZE 2NPFA 1DARA 1MU5A 1ELOA 3LPSA 4FW3A 2JEBB 4J3DA 4DV1E 1J5EE 1QZRA 4LFAE 4N3OA 2GO4A 1Y6ZA 1PIEA 2AE8A 3T1YI 2Z5BA 4JV5I 2CVEA 4FN5A 4LF6I 3F0NA 4X65I 1UDSA 4MU3A 4X62E 4BA1B 4JI4I 1XXEA 4B3ME 3ZM7A 5LMUE 3M6AA 1S16A 4HYMA 4AQYE 2BM0A 4XTJA 4OO1D 5LMNE 4DV1I 1HR0E 1J5EI 4LFAI 3ZKBA 3PS3A 2GS8A 1OJ4A 4PU9A 4OO1E 1NHHA 3J81Q 2BV3A 3U1YA 4USMA 3GLLA 2C39B 4DV2E 1XNQE 5EL9A 2UXDE 4B3RE 4X62I 4LFCI 4OZEA 1NHJA 3LTOA 3PRYA 4B3MI 5ELWA 1NZ0A 5LMUI 4AQYI 2UXCE 1HR0I 3J7AG 1ZXNA 4IFDB 3ZZUA 4GQUA 3LNUA 3K85A 4OO1B 4DV2I 4DV6E 2WW4A 1R6MA 1RHYA 4JI3I 2HKEA 2UXDI 4DR4E 1E3HA 4B3RI 1S4EA 4LF8E 5DRRA 1UDQA 5C0XD 4GKJE 3H4LA 4X64E 1Z5CA 2F1DA 2UXCI 2Q2EB 1IBME 1XMOE 1EI1A 2UUBE 5C0XE 1XMQE 2J7KA 2DEIA 2O1VA 4AM3A 3P3EA 4X66E 2UU9E 5DROA 4LFBI 4DR2E 4DV3I 1Z0VA 2Z5CA 2HHHE 4DV6I 2WP8A 3QT8A 1KVKA 2EFGA 4DR4I 3U1KA 4GKKE 2CGEA 1ZM2A 4LF7E 4OX9E 3GCMA 1Z0TA 5GMEA 1ZM9A 4X64I 5DRQA 1XMOI 4JI2I 2HK2A 2ZBKB 2UUBI 2CZ9A 2AJ4A 3K1JA 1H74A 3B4TA 3DD6A 4X66I 2UU9I 2XEXA 5C0XB 4IFDC 4DR2I 5BR8I 2E1RA 3ZKDA 4HACB 4LCFA 2PO2A 2HHHI 4DPTA 4R1FA 4P7AA 4JI0I 3M7ND 2IOQA 1EA6A 2PO0B 4GKKI 2UXBE 1FNMA 1H73A 4ZVIA 1IBLE 1E3PA 2HFUA 4OX9I 2UUAI 5JEAD 1HNWE 1N33E 5K36D 4IZKB 4B3TE 1ZXMA 4AIDA 1XNRI 2VQEE 1FWLA 3J81C 1UDNA 5JEAE 2BA0D 4URLA 5K36E 1N36I 3HKMA 5DNXA 2PNLA 3PS2A 5DRPA 1ZM3A 4DR3E 5A2QQ 4AIMA 1R6LA 2A2CA 2UXBI 4JYAE 1HNZE 1IBLI 4DV7E 2PNZB 2O3ZA 1WUUA 4DUZI 1H7UA 4DPYA 2O1UA 3WU5A 2C38A 2BR2A 1HNWI 4FWGA 1K47A 1RREA 2X36A 3B82A 4MU4A 4DV0E 4DV4E 5LL6R 2IESA 4B3TI 4B3SE 2NN6D 2JEAA 2CG9A 4HY1A 4QNJA 3WU3A 3P3CA 1USUA 2Z5CB 4FW9A 5JEAB 2NN6E 3L7ZB 2VF3A 5K36B 4JI7E 4BA2B 4DR3I 4FWDA 5GMDA 5L3JA 1OYRA 4JYAI 3B8HA 4LF5E 1I94E 4DV7I 4DR1E 1Y4UA 1BKNA 4DUYE 2GQ0A 5LMNI 4WUBA 4DV4I 5IT9C 4DV0I 2F4VE 2WNRA 2BM1A 4YY3E 4IZJA 4LF9E 2JE6A 4MU0A 2ZM6E 1NHIA 4FW6A 1N32E 4IFDF 4DR6E 4P52A 1XNQI 4JI7I 4JI6E 4OO1F 2JT2A 2NN6B 1YHCA 3GMEA 3K17A 4DU8A 3M85D 2PO1A 1OYSA 4LF5I 4LPFA 4OKGA 4USKA 1ZM4A 4DR1I 1N0UA 1B62A 2E5LE 4DUYI 2JEBA 1Z5AA 3J80Q 5FWKA 2ZITA 4JI1E 2F4VI 4YY3I 2V34A 5IT9Q 4LF9I 1FJGE 1Y60A 4U3BA 2V2QA 2Z5BB 1N32I 1P42A 1OYPA 4DR7E 4DR6I 3KRNA 3J7AM 4IZJD 4DR5E 4JI6I 4BA1A 4LF8I 1FI4A 4M1KA 2V8PA 4GKJI 3NZKA 4YHHE 1Z5BA 4I3HA 1IBMI 3V5RA 4ISAA 4JI1I 2LJPA 1XMQI 1HNXE 1KIJA 2X7IA 4JI8E 1UEKA 4DR7I 5C0XF 4KHPE 5A2QC 2C39A 4DR5I 2V2VA 4JG4A 4OO1C 4NXME 3WU4A 1VI7A 4MU1A 1MX0A 3CDJA 4LF7I 3UHMA 1Z59A 4WUDA 2C37A 4QNKA 4YHHI 2WNRB 3PYGA 3HULA 3P3GA 2BA1D 3PYDA 4NXNE 4IFDA 3T1HE 2O1TA 1Y5YA 2IERA 4OO1A 4KHPI 3JAMQ 4HXZA 4KQVA 1D6TA 4NXMI 4LF4E 1H7SA 3ZZ0A 5FLXQ 1KKHA 3QT5A 3V2UC 1N33I 3D4JA 1N34E 2OI2A
chains in the Genus database with same CATH topology
3Q6NA 3QT6A 4Z7YA 2VQEI 1Z0CA 4NXNI 4DPUA 1Z0GA 3T1HI 3B78A 2HK3A 2O1WA 3Q6MA 2V2ZA 4DPWA 4JI5E 4LFCE 2DEJA 1VISA 4LF4I 1HK7A 1HNZI 2UUCE 2HFSA 4Z7CA 4PRVA 3J80C 5IWAE 1N34I 1Z0WA 1B63A 3P06A 4B3SI 2HKJA 2R3VA 1KTVA 2R42A 4HACA 4JI3E 1PVGA 1XHKA 4WUCA 4MYTA 3Q1QA 4JI5I 1H72C 4K0KE 1I94I 4FWHA 2VQFE 2UUCI 1A6FA 4DPXA 5IWAI 4IZKA 2PNMA 4LFBE 4DV3E 2Z5EA 2ZM6I 3QT7A 2A2DA 1IBKE 1RR9A 1U2RA 4K0KI 1Z0EA 2VQFI 4MYUA 2E5LI 4JI2E 3GONA 4DV5E 1N0VC 2IOPA 5BR8E 1FJGI 1FKAE 3OTOE 1Y4SA 1IBKI 3JAMC 4JI0E 3PYFA 3ZZTA 4ED4A 4RPFA 1Z0BA 2UUAE 5FLXC 4DXLA 4EMDA 1USVA 1XNRE 3HJCA 4IZJB 4DV5I 1N36E 4DU7A 1HNXI 4PRXA 1MG7A 3T1YE 3PYEA 4JI8I 3OTOI 3CWVA 4JV5E 3WU6A 1PKPA 4UTGA 4LF6E 4X65E 4UT4A 4JI4E 1FWKA 4DUZE 2NPFA 1DARA 1MU5A 1ELOA 3LPSA 4DV1E 1J5EE 1QZRA 4LFAE 4N3OA 1Y6ZA 1PIEA 3T1YI 2Z5BA 4JV5I 4FN5A 4LF6I 3F0NA 4X65I 4X62E 4JI4I 4B3ME 3ZM7A 5LMUE 3M6AA 1S16A 4HYMA 4AQYE 2BM0A 4XTJA 5LMNE 4DV1I 1HR0E 1J5EI 4LFAI 3ZKBA 2GS8A 1OJ4A 4PU9A 1NHHA 3J81Q 2BV3A 4USMA 1XNQE 4DV2E 2UXDE 4B3RE 4X62I 4LFCI 1NHJA 3LTOA 3PRYA 4B3MI 1NZ0A 5LMUI 4AQYI 2UXCE 1HR0I 3J7AG 1ZXNA 3ZZUA 3LNUA 3K85A 4DV2I 4DV6E 2WW4A 4JI3I 2HKEA 2UXDI 4DR4E 4B3RI 1S4EA 4LF8E 4GKJE 3H4LA 4X64E 1Z5CA 2UXCI 2Q2EB 1IBME 1XMOE 1EI1A 2UUBE 1XMQE 2J7KA 2DEIA 2O1VA 4X66E 2UU9E 4LFBI 4DR2E 4DV3I 1Z0VA 2Z5CA 2HHHE 4DV6I 3QT8A 1KVKA 2EFGA 4DR4I 4GKKE 2CGEA 1ZM2A 4LF7E 4OX9E 1Z0TA 5GMEA 1ZM9A 4X64I 1XMOI 4JI2I 2HK2A 2ZBKB 2UUBI 2CZ9A 2AJ4A 3K1JA 1H74A 4X66I 2UU9I 2XEXA 4DR2I 5BR8I 2E1RA 3ZKDA 4HACB 2HHHI 4DPTA 4R1FA 4P7AA 4JI0I 2IOQA 1EA6A 4GKKI 2UXBE 1FNMA 1H73A 4ZVIA 1IBLE 2HFUA 4OX9I 2UUAI 1HNWE 1N33E 4IZKB 4B3TE 1ZXMA 1XNRI 2VQEE 1FWLA 3J81C 4URLA 1N36I 2PNLA 1ZM3A 4DR3E 5A2QQ 2A2CA 2UXBI 4JYAE 1HNZE 1IBLI 4DV7E 1WUUA 4DUZI 1H7UA 4DPYA 2O1UA 3WU5A 1HNWI 4FWGA 1K47A 1RREA 2X36A 3B82A 4DV0E 4DV4E 4B3TI 5LL6R 4B3SE 2CG9A 4HY1A 3WU3A 1USUA 2Z5CB 4FW9A 2VF3A 4JI7E 4DR3I 4FWDA 5GMDA 5L3JA 4JYAI 3B8HA 4LF5E 1I94E 4DV7I 4DR1E 1Y4UA 1BKNA 4DUYE 2GQ0A 5LMNI 4WUBA 4DV4I 5IT9C 4DV0I 2F4VE 2BM1A 4YY3E 4IZJA 4LF9E 2ZM6E 1NHIA 1N32E 4DR6E 4P52A 1XNQI 4JI7I 4JI6E 3K17A 4DU8A 4LF5I 4USKA 1ZM4A 4DR1I 1N0UA 1B62A 2E5LE 4DUYI 1Z5AA 3J80Q 5FWKA 2ZITA 4JI1E 2F4VI 4YY3I 2V34A 5IT9Q 4LF9I 1FJGE 2V2QA 2Z5BB 1N32I 4DR7E 4DR6I 3J7AM 4IZJD 4DR5E 4JI6I 4LF8I 1FI4A 4M1KA 2V8PA 4GKJI 4YHHE 1Z5BA 4I3HA 1IBMI 3V5RA 4JI1I 2LJPA 1XMQI 1HNXE 1KIJA 2X7IA 4JI8E 1UEKA 4DR7I 4KHPE 5A2QC 4DR5I 2V2VA 4JG4A 4NXME 3WU4A 1MX0A 4LF7I 1Z59A 4WUDA 4YHHI 3PYGA 3HULA 3PYDA 4NXNE 3T1HE 2O1TA 4KHPI 3JAMQ 4HXZA 4KQVA 1D6TA 4NXMI 4LF4E 1H7SA 3ZZ0A 5FLXQ 1KKHA 3QT5A 3V2UC 1N33I 3D4JA 1N34E 2OI2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QT6 A;  4Z7Y A;  2VQE I;  1Z0C A;  4NXN I;  4DPU A;  1Z0G A;  3T1H I;  3B78 A;  2HK3 A;  2V2Z A;  4DPW A;  4JI5 E;  4LFC E;  2DEJ A;  1VIS A;  4LF4 I;  1HNZ I;  2UUC E;  2HFS A;  4Z7C A;  4PRV A;  3J80 C;  5IWA E;  1N34 I;  1Z0W A;  1B63 A;  4B3S I;  2HKJ A;  2R3V A;  1KTV A;  2R42 A;  4HAC A;  4JI3 E;  1PVG A;  1XHK A;  4WUC A;  4MYT A;  3Q1Q A;  4JI5 I;  1H72 C;  4K0K E;  1I94 I;  4FWH A;  2VQF E;  2UUC I;  1A6F A;  4DPX A;  5IWA I;  4LFB E;  4DV3 E;  2ZM6 I;  3QT7 A;  2A2D A;  1IBK E;  1RR9 A;  1U2R A;  4K0K I;  1Z0E A;  2VQF I;  4MYU A;  2E5L I;  4JI2 E;  3GON A;  4DV5 E;  1N0V C;  5BR8 E;  1FJG I;  1FKA E;  3OTO E;  1IBK I;  3JAM C;  4JI0 E;  3PYF A;  3ZZT A;  4ED4 A;  4RPF A;  1Z0B A;  2UUA E;  5FLX C;  4DXL A;  4EMD A;  1XNR E;  4DV5 I;  1N36 E;  4DU7 A;  1HNX I;  4PRX A;  1MG7 A;  3T1Y E;  3PYE A;  4JI8 I;  3OTO I;  3CWV A;  4JV5 E;  3WU6 A;  1PKP A;  4UTG A;  4LF6 E;  4X65 E;  4UT4 A;  4JI4 E;  1FWK A;  4DUZ E;  2NPF A;  1DAR A;  1MU5 A;  1ELO A;  3LPS A;  4DV1 E;  1J5E E;  1QZR A;  4LFA E;  1PIE A;  3T1Y I;  4JV5 I;  4FN5 A;  4LF6 I;  3F0N A;  4X65 I;  4X62 E;  4JI4 I;  4B3M E;  3ZM7 A;  5LMU E;  3M6A A;  1S16 A;  4HYM A;  4AQY E;  2BM0 A;  4XTJ A;  5LMN E;  4DV1 I;  1HR0 E;  1J5E I;  4LFA I;  3ZKB A;  2GS8 A;  1OJ4 A;  4PU9 A;  1NHH A;  3J81 Q;  2BV3 A;  4USM A;  1XNQ E;  4DV2 E;  2UXD E;  4B3R E;  4X62 I;  4LFC I;  1NHJ A;  3LTO A;  4B3M I;  1NZ0 A;  5LMU I;  4AQY I;  2UXC E;  1HR0 I;  3J7A G;  1ZXN A;  3ZZU A;  3LNU A;  4DV2 I;  4DV6 E;  2WW4 A;  4JI3 I;  2HKE A;  2UXD I;  4DR4 E;  4B3R I;  1S4E A;  4LF8 E;  4GKJ E;  3H4L A;  4X64 E;  1Z5C A;  2UXC I;  2Q2E B;  1IBM E;  1XMO E;  2UUB E;  1EI1 A;  1XMQ E;  2J7K A;  2DEI A;  4X66 E;  2UU9 E;  4LFB I;  4DR2 E;  4DV3 I;  1Z0V A;  2HHH E;  4DV6 I;  3QT8 A;  1KVK A;  2EFG A;  4DR4 I;  4GKK E;  1ZM2 A;  4LF7 E;  4OX9 E;  1Z0T A;  5GME A;  1ZM9 A;  4X64 I;  1XMO I;  4JI2 I;  2HK2 A;  2ZBK B;  2UUB I;  2CZ9 A;  2AJ4 A;  3K1J A;  1H74 A;  4X66 I;  2UU9 I;  2XEX A;  4DR2 I;  5BR8 I;  2E1R A;  3ZKD A;  4HAC B;  2HHH I;  4DPT A;  4R1F A;  4P7A A;  4JI0 I;  1EA6 A;  4GKK I;  2UXB E;  1FNM A;  1H73 A;  4ZVI A;  1IBL E;  2HFU A;  4OX9 I;  2UUA I;  1HNW E;  1N33 E;  4B3T E;  1ZXM A;  1XNR I;  2VQE E;  1FWL A;  3J81 C;  4URL A;  1N36 I;  1ZM3 A;  4DR3 E;  5A2Q Q;  2A2C A;  2UXB I;  4JYA E;  1HNZ E;  1IBL I;  4DV7 E;  1WUU A;  4DUZ I;  1H7U A;  4DPY A;  3WU5 A;  1HNW I;  4FWG A;  1K47 A;  1RRE A;  2X36 A;  3B82 A;  4DV0 E;  4DV4 E;  4B3T I;  5LL6 R;  4B3S E;  4HY1 A;  3WU3 A;  4FW9 A;  2VF3 A;  4JI7 E;  4DR3 I;  4FWD A;  5GMD A;  5L3J A;  4JYA I;  3B8H A;  4LF5 E;  1I94 E;  4DV7 I;  4DR1 E;  1BKN A;  4DUY E;  5LMN I;  4WUB A;  4DV4 I;  5IT9 C;  4DV0 I;  2F4V E;  2BM1 A;  4YY3 E;  4LF9 E;  2ZM6 E;  1NHI A;  1N32 E;  4DR6 E;  4P52 A;  1XNQ I;  4JI7 I;  4JI6 E;  3K17 A;  4DU8 A;  4LF5 I;  4USK A;  1ZM4 A;  4DR1 I;  1N0U A;  1B62 A;  2E5L E;  4DUY I;  1Z5A A;  3J80 Q;  2ZIT A;  4JI1 E;  2F4V I;  4YY3 I;  2V34 A;  5IT9 Q;  4LF9 I;  1FJG E;  2V2Q A;  1N32 I;  4DR7 E;  4DR6 I;  3J7A M;  4DR5 E;  4JI6 I;  4LF8 I;  1FI4 A;  4M1K A;  2V8P A;  4GKJ I;  4YHH E;  1Z5B A;  4I3H A;  1IBM I;  3V5R A;  4JI1 I;  2LJP A;  1XMQ I;  1HNX E;  1KIJ A;  2X7I A;  4JI8 E;  1UEK A;  4DR7 I;  4KHP E;  5A2Q C;  4DR5 I;  2V2V A;  4JG4 A;  4NXM E;  3WU4 A;  1MX0 A;  4LF7 I;  1Z59 A;  4WUD A;  4YHH I;  3PYG A;  3HUL A;  3PYD A;  4NXN E;  3T1H E;  4KHP I;  3JAM Q;  4HXZ A;  4KQV A;  1D6T A;  4NXM I;  4LF4 E;  1H7S A;  3ZZ0 A;  5FLX Q;  1KKH A;  3QT5 A;  3V2U C;  1N33 I;  3D4J A;  1N34 E;  2OI2 A; 
#chains in the Genus database with same CATH topology
 3Q6N A;  3QT6 A;  4Z7Y A;  2VQE I;  1Z0C A;  4MQY A;  4NXN I;  4DPU A;  1Z0G A;  3T1H I;  3B78 A;  2HK3 A;  2O1W A;  2WP8 B;  5C0X C;  3Q6M A;  2V2Z A;  4DPW A;  5JEA F;  4JI5 E;  4LFC E;  5K36 F;  4IFD D;  2DEJ A;  1VIS A;  4LF4 I;  4FW7 A;  1HK7 A;  1HNZ I;  2UUC E;  3M85 G;  2HFS A;  4Z7C A;  4PRV A;  4IFD E;  3J80 C;  5IWA E;  1N34 I;  1Z0W A;  1B63 A;  3P06 A;  4B3S I;  2HKJ A;  2R3V A;  1KTV A;  2R42 A;  1UDO A;  2PO2 B;  5C0X A;  4HAC A;  4JI3 E;  1PVG A;  1XHK A;  4WUC A;  4MYT A;  3Q1Q A;  4JI5 I;  4LCG A;  1H72 C;  2PO0 A;  4K0K E;  2NN6 F;  2C37 B;  1I94 I;  4FWH A;  2VQF E;  2UUC I;  1A6F A;  3P76 A;  4DPX A;  2GO3 A;  5IWA I;  4IZK A;  4FW5 A;  2PNM A;  4LOM A;  4LFB E;  4DV3 E;  2Z5E A;  2ZM6 I;  3QT7 A;  2A2D A;  2J65 A;  1IBK E;  1RR9 A;  1U2R A;  5JEA C;  2VES A;  5K36 C;  4K0K I;  1Z0E A;  2C38 B;  2PNZ A;  2BR2 B;  2VQF I;  3M7N G;  4MYU A;  2E5L I;  4JI2 E;  3GON A;  4LCH A;  2JEA B;  4DV5 E;  1N0V C;  2IOP A;  5BR8 E;  1FJG I;  2BA1 G;  5DNL A;  3OTO E;  1FKA E;  2BA0 G;  1Y4S A;  5JEA A;  1IBK I;  3JAM C;  3L7Z A;  3PS1 A;  3PYF A;  4JI0 E;  3ZZT A;  5K36 A;  4ED4 A;  5EKW A;  4BA2 A;  4RPF A;  1Z0B A;  4FW4 A;  4MDT A;  2UUA E;  2NN6 C;  5FLX C;  4DXL A;  1YH8 A;  4EMD A;  1USV A;  1XNR E;  3HJC A;  4IZJ B;  4DV5 I;  2JE6 B;  1N36 E;  4DU7 A;  1HNX I;  4PRX A;  4U3D A;  1MG7 A;  3T1Y E;  3H1C A;  3PYE A;  4JI8 I;  3OTO I;  3CWV A;  4JV5 E;  3WU6 A;  1PKP A;  4UTG A;  4LF6 E;  4NBQ A;  3CDI A;  4IS9 A;  4X65 E;  4UT4 A;  2PO1 B;  4JI4 E;  2NN6 A;  1FWK A;  4DUZ E;  2NPF A;  1DAR A;  1MU5 A;  1ELO A;  3LPS A;  4FW3 A;  2JEB B;  4J3D A;  4DV1 E;  1J5E E;  1QZR A;  4LFA E;  4N3O A;  2GO4 A;  1Y6Z A;  1PIE A;  2AE8 A;  3T1Y I;  2Z5B A;  4JV5 I;  2CVE A;  4FN5 A;  4LF6 I;  3F0N A;  4X65 I;  1UDS A;  4MU3 A;  4X62 E;  4BA1 B;  4JI4 I;  1XXE A;  4B3M E;  3ZM7 A;  5LMU E;  3M6A A;  1S16 A;  4HYM A;  4AQY E;  2BM0 A;  4XTJ A;  4OO1 D;  5LMN E;  4DV1 I;  1HR0 E;  1J5E I;  4LFA I;  3ZKB A;  3PS3 A;  2GS8 A;  1OJ4 A;  4PU9 A;  4OO1 E;  1NHH A;  3J81 Q;  2BV3 A;  3U1Y A;  4USM A;  3GLL A;  2C39 B;  4DV2 E;  1XNQ E;  5EL9 A;  2UXD E;  4B3R E;  4X62 I;  4LFC I;  4OZE A;  1NHJ A;  3LTO A;  3PRY A;  4B3M I;  5ELW A;  1NZ0 A;  5LMU I;  4AQY I;  2UXC E;  1HR0 I;  3J7A G;  1ZXN A;  4IFD B;  3ZZU A;  4GQU A;  3LNU A;  3K85 A;  4OO1 B;  4DV2 I;  4DV6 E;  2WW4 A;  1R6M A;  1RHY A;  4JI3 I;  2HKE A;  2UXD I;  4DR4 E;  1E3H A;  4B3R I;  1S4E A;  4LF8 E;  5DRR A;  1UDQ A;  5C0X D;  4GKJ E;  3H4L A;  4X64 E;  1Z5C A;  2F1D A;  2UXC I;  2Q2E B;  1IBM E;  1XMO E;  1EI1 A;  2UUB E;  5C0X E;  1XMQ E;  2J7K A;  2DEI A;  2O1V A;  4AM3 A;  3P3E A;  4X66 E;  2UU9 E;  5DRO A;  4LFB I;  4DR2 E;  4DV3 I;  1Z0V A;  2Z5C A;  2HHH E;  4DV6 I;  2WP8 A;  3QT8 A;  1KVK A;  2EFG A;  4DR4 I;  3U1K A;  4GKK E;  2CGE A;  1ZM2 A;  4LF7 E;  4OX9 E;  3GCM A;  1Z0T A;  5GME A;  1ZM9 A;  4X64 I;  5DRQ A;  1XMO I;  4JI2 I;  2HK2 A;  2ZBK B;  2UUB I;  2CZ9 A;  2AJ4 A;  3K1J A;  1H74 A;  3B4T A;  3DD6 A;  4X66 I;  2UU9 I;  2XEX A;  5C0X B;  4IFD C;  4DR2 I;  5BR8 I;  2E1R A;  3ZKD A;  4HAC B;  4LCF A;  2PO2 A;  2HHH I;  4DPT A;  4R1F A;  4P7A A;  4JI0 I;  3M7N D;  2IOQ A;  1EA6 A;  2PO0 B;  4GKK I;  2UXB E;  1FNM A;  1H73 A;  4ZVI A;  1IBL E;  1E3P A;  2HFU A;  4OX9 I;  2UUA I;  5JEA D;  1HNW E;  1N33 E;  5K36 D;  4IZK B;  4B3T E;  1ZXM A;  4AID A;  1XNR I;  2VQE E;  1FWL A;  3J81 C;  1UDN A;  5JEA E;  2BA0 D;  4URL A;  5K36 E;  1N36 I;  3HKM A;  5DNX A;  2PNL A;  3PS2 A;  5DRP A;  1ZM3 A;  4DR3 E;  5A2Q Q;  4AIM A;  1R6L A;  2A2C A;  2UXB I;  4JYA E;  1HNZ E;  1IBL I;  4DV7 E;  2PNZ B;  2O3Z A;  1WUU A;  4DUZ I;  1H7U A;  4DPY A;  2O1U A;  3WU5 A;  2C38 A;  2BR2 A;  1HNW I;  4FWG A;  1K47 A;  1RRE A;  2X36 A;  3B82 A;  4MU4 A;  4DV0 E;  4DV4 E;  5LL6 R;  2IES A;  4B3T I;  4B3S E;  2NN6 D;  2JEA A;  2CG9 A;  4HY1 A;  4QNJ A;  3WU3 A;  3P3C A;  1USU A;  2Z5C B;  4FW9 A;  5JEA B;  2NN6 E;  3L7Z B;  2VF3 A;  5K36 B;  4JI7 E;  4BA2 B;  4DR3 I;  4FWD A;  5GMD A;  5L3J A;  1OYR A;  4JYA I;  3B8H A;  4LF5 E;  1I94 E;  4DV7 I;  4DR1 E;  1Y4U A;  1BKN A;  4DUY E;  2GQ0 A;  5LMN I;  4WUB A;  4DV4 I;  5IT9 C;  4DV0 I;  2F4V E;  2WNR A;  2BM1 A;  4YY3 E;  4IZJ A;  4LF9 E;  2JE6 A;  4MU0 A;  2ZM6 E;  1NHI A;  4FW6 A;  1N32 E;  4IFD F;  4DR6 E;  4P52 A;  1XNQ I;  4JI7 I;  4JI6 E;  4OO1 F;  2JT2 A;  2NN6 B;  1YHC A;  3GME A;  3K17 A;  4DU8 A;  3M85 D;  2PO1 A;  1OYS A;  4LF5 I;  4LPF A;  4OKG A;  4USK A;  1ZM4 A;  4DR1 I;  1N0U A;  1B62 A;  2E5L E;  4DUY I;  2JEB A;  1Z5A A;  3J80 Q;  5FWK A;  2ZIT A;  4JI1 E;  2F4V I;  4YY3 I;  2V34 A;  5IT9 Q;  4LF9 I;  1FJG E;  1Y60 A;  4U3B A;  2V2Q A;  2Z5B B;  1N32 I;  1P42 A;  1OYP A;  4DR7 E;  4DR6 I;  3KRN A;  3J7A M;  4IZJ D;  4DR5 E;  4JI6 I;  4BA1 A;  4LF8 I;  1FI4 A;  4M1K A;  2V8P A;  4GKJ I;  3NZK A;  4YHH E;  1Z5B A;  4I3H A;  1IBM I;  3V5R A;  4ISA A;  4JI1 I;  2LJP A;  1XMQ I;  1HNX E;  1KIJ A;  2X7I A;  4JI8 E;  1UEK A;  4DR7 I;  5C0X F;  4KHP E;  5A2Q C;  2C39 A;  4DR5 I;  2V2V A;  4JG4 A;  4OO1 C;  4NXM E;  3WU4 A;  1VI7 A;  4MU1 A;  1MX0 A;  3CDJ A;  4LF7 I;  3UHM A;  1Z59 A;  4WUD A;  2C37 A;  4QNK A;  4YHH I;  2WNR B;  3PYG A;  3HUL A;  3P3G A;  2BA1 D;  3PYD A;  4NXN E;  4IFD A;  3T1H E;  2O1T A;  1Y5Y A;  2IER A;  4OO1 A;  4KHP I;  3JAM Q;  4HXZ A;  4KQV A;  1D6T A;  4NXM I;  4LF4 E;  1H7S A;  3ZZ0 A;  5FLX Q;  1KKH A;  3QT5 A;  3V2U C;  1N33 I;  3D4J A;  1N34 E;  2OI2 A; 
#chains in the Genus database with same CATH homology
 3Q6N A;  3QT6 A;  4Z7Y A;  2VQE I;  1Z0C A;  4NXN I;  4DPU A;  1Z0G A;  3T1H I;  3B78 A;  2HK3 A;  2O1W A;  3Q6M A;  2V2Z A;  4DPW A;  4JI5 E;  4LFC E;  2DEJ A;  1VIS A;  4LF4 I;  1HK7 A;  1HNZ I;  2UUC E;  2HFS A;  4Z7C A;  4PRV A;  3J80 C;  5IWA E;  1N34 I;  1Z0W A;  1B63 A;  3P06 A;  4B3S I;  2HKJ A;  2R3V A;  1KTV A;  2R42 A;  4HAC A;  4JI3 E;  1PVG A;  1XHK A;  4WUC A;  4MYT A;  3Q1Q A;  4JI5 I;  1H72 C;  4K0K E;  1I94 I;  4FWH A;  2VQF E;  2UUC I;  1A6F A;  4DPX A;  5IWA I;  4IZK A;  2PNM A;  4LFB E;  4DV3 E;  2Z5E A;  2ZM6 I;  3QT7 A;  2A2D A;  1IBK E;  1RR9 A;  1U2R A;  4K0K I;  1Z0E A;  2VQF I;  4MYU A;  2E5L I;  4JI2 E;  3GON A;  4DV5 E;  1N0V C;  2IOP A;  5BR8 E;  1FJG I;  1FKA E;  3OTO E;  1Y4S A;  1IBK I;  3JAM C;  4JI0 E;  3PYF A;  3ZZT A;  4ED4 A;  4RPF A;  1Z0B A;  2UUA E;  5FLX C;  4DXL A;  4EMD A;  1USV A;  1XNR E;  3HJC A;  4IZJ B;  4DV5 I;  1N36 E;  4DU7 A;  1HNX I;  4PRX A;  1MG7 A;  3T1Y E;  3PYE A;  4JI8 I;  3OTO I;  3CWV A;  4JV5 E;  3WU6 A;  1PKP A;  4UTG A;  4LF6 E;  4X65 E;  4UT4 A;  4JI4 E;  1FWK A;  4DUZ E;  2NPF A;  1DAR A;  1MU5 A;  1ELO A;  3LPS A;  4DV1 E;  1J5E E;  1QZR A;  4LFA E;  4N3O A;  1Y6Z A;  1PIE A;  3T1Y I;  2Z5B A;  4JV5 I;  4FN5 A;  4LF6 I;  3F0N A;  4X65 I;  4X62 E;  4JI4 I;  4B3M E;  3ZM7 A;  5LMU E;  3M6A A;  1S16 A;  4HYM A;  4AQY E;  2BM0 A;  4XTJ A;  5LMN E;  4DV1 I;  1HR0 E;  1J5E I;  4LFA I;  3ZKB A;  2GS8 A;  1OJ4 A;  4PU9 A;  1NHH A;  3J81 Q;  2BV3 A;  4USM A;  1XNQ E;  4DV2 E;  2UXD E;  4B3R E;  4X62 I;  4LFC I;  1NHJ A;  3LTO A;  3PRY A;  4B3M I;  1NZ0 A;  5LMU I;  4AQY I;  2UXC E;  1HR0 I;  3J7A G;  1ZXN A;  3ZZU A;  3LNU A;  3K85 A;  4DV2 I;  4DV6 E;  2WW4 A;  4JI3 I;  2HKE A;  2UXD I;  4DR4 E;  4B3R I;  1S4E A;  4LF8 E;  4GKJ E;  3H4L A;  4X64 E;  1Z5C A;  2UXC I;  2Q2E B;  1IBM E;  1XMO E;  1EI1 A;  2UUB E;  1XMQ E;  2J7K A;  2DEI A;  2O1V A;  4X66 E;  2UU9 E;  4LFB I;  4DR2 E;  4DV3 I;  1Z0V A;  2Z5C A;  2HHH E;  4DV6 I;  3QT8 A;  1KVK A;  2EFG A;  4DR4 I;  4GKK E;  2CGE A;  1ZM2 A;  4LF7 E;  4OX9 E;  1Z0T A;  5GME A;  1ZM9 A;  4X64 I;  1XMO I;  4JI2 I;  2HK2 A;  2ZBK B;  2UUB I;  2CZ9 A;  2AJ4 A;  3K1J A;  1H74 A;  4X66 I;  2UU9 I;  2XEX A;  4DR2 I;  5BR8 I;  2E1R A;  3ZKD A;  4HAC B;  2HHH I;  4DPT A;  4R1F A;  4P7A A;  4JI0 I;  2IOQ A;  1EA6 A;  4GKK I;  2UXB E;  1FNM A;  1H73 A;  4ZVI A;  1IBL E;  2HFU A;  4OX9 I;  2UUA I;  1HNW E;  1N33 E;  4IZK B;  4B3T E;  1ZXM A;  1XNR I;  2VQE E;  1FWL A;  3J81 C;  4URL A;  1N36 I;  2PNL A;  1ZM3 A;  4DR3 E;  5A2Q Q;  2A2C A;  2UXB I;  4JYA E;  1HNZ E;  1IBL I;  4DV7 E;  1WUU A;  4DUZ I;  1H7U A;  4DPY A;  2O1U A;  3WU5 A;  1HNW I;  4FWG A;  1K47 A;  1RRE A;  2X36 A;  3B82 A;  4DV0 E;  4DV4 E;  4B3T I;  5LL6 R;  4B3S E;  2CG9 A;  4HY1 A;  3WU3 A;  1USU A;  2Z5C B;  4FW9 A;  2VF3 A;  4JI7 E;  4DR3 I;  4FWD A;  5GMD A;  5L3J A;  4JYA I;  3B8H A;  4LF5 E;  1I94 E;  4DV7 I;  4DR1 E;  1Y4U A;  1BKN A;  4DUY E;  2GQ0 A;  5LMN I;  4WUB A;  4DV4 I;  5IT9 C;  4DV0 I;  2F4V E;  2BM1 A;  4YY3 E;  4IZJ A;  4LF9 E;  2ZM6 E;  1NHI A;  1N32 E;  4DR6 E;  4P52 A;  1XNQ I;  4JI7 I;  4JI6 E;  3K17 A;  4DU8 A;  4LF5 I;  4USK A;  1ZM4 A;  4DR1 I;  1N0U A;  1B62 A;  2E5L E;  4DUY I;  1Z5A A;  3J80 Q;  5FWK A;  2ZIT A;  4JI1 E;  2F4V I;  4YY3 I;  2V34 A;  5IT9 Q;  4LF9 I;  1FJG E;  2V2Q A;  2Z5B B;  1N32 I;  4DR7 E;  4DR6 I;  3J7A M;  4IZJ D;  4DR5 E;  4JI6 I;  4LF8 I;  1FI4 A;  4M1K A;  2V8P A;  4GKJ I;  4YHH E;  1Z5B A;  4I3H A;  1IBM I;  3V5R A;  4JI1 I;  2LJP A;  1XMQ I;  1HNX E;  1KIJ A;  2X7I A;  4JI8 E;  1UEK A;  4DR7 I;  4KHP E;  5A2Q C;  4DR5 I;  2V2V A;  4JG4 A;  4NXM E;  3WU4 A;  1MX0 A;  4LF7 I;  1Z59 A;  4WUD A;  4YHH I;  3PYG A;  3HUL A;  3PYD A;  4NXN E;  3T1H E;  2O1T A;  4KHP I;  3JAM Q;  4HXZ A;  4KQV A;  1D6T A;  4NXM I;  4LF4 E;  1H7S A;  3ZZ0 A;  5FLX Q;  1KKH A;  3QT5 A;  3V2U C;  1N33 I;  3D4J A;  1N34 E;  2OI2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...