4DV3J

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a, bound with streptomycin
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
98
structure length
98
Chain Sequence
b'KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 13
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4dv3J00
4JV5J 5LMUJ 4YHHJ 1HR0J 3R2CJ 3J81U 4JI2J 4DV5J 5LM7E 2ZM6J 4LFBJ 1HNXJ 4NXNJ 2UUAJ 1N36J 4DUYJ 3T1YJ 4GKKJ 2UXDJ 4LF5J 1I94J 4JI6J 3OTOJ 4JI0J 3W1YC 4NXMJ 4LF9J 4LFAJ 5FLXU 4DR1J 1HNWJ 4DV0J 4X64J 1FJGJ 1HNZJ 4DV2J 4B3RJ 4X66J 2UXCJ 4V1Ak 2VQFJ 4JI8J 4LFCJ 2MEWA 2KVQE 2HHHJ 2UUBJ 2KL8A 1XMOJ 4DR6J 2MTLA 5A2QU 4RJVA 2UU9J 4LF8J 4DV1J 1XMQJ 3D3BJ 4DV3J 3JAMU 3D3CJ 5BR8J 1XNQJ 4DUZJ 2E5LJ 4DV4J 1XNRJ 2MQ8A 4B3MJ 1N33J 4PWWA 4DV7J 5IWAJ 3IMQJ 1IBLJ 1IBMJ 5LMNJ 3T1HJ 4LF6J 4HHUA 4DR7J 4KY3A 4KHPJ 2UXBJ 4JYAJ 3J7AN 4NEZA 2F4VJ 5AJ3J 4DR3J 4JI3J 4JI1J 4LF7J 5IT9U 4NEYA 1N32J 4DR2J 4AQYJ 4DV6J 1J5EJ 3R2DJ 4B3SJ 4KYZA 2UUCJ 4YY3J 4DR4J 4K0KJ 1IBKJ 4JI7J 4DR5J 2VQEJ 4OX9J 4X65J 4B3TJ 4X62J 4JI5J 4LF4J 3J80U 4GKJJ 1N34J 4JI4J
chains in the Genus database with same CATH superfamily
3T9ZA 2UVRA 4YHHJ 3ZZPA 1CULA 1FJGF 3G71S 3HVTB 3NS7B 1IBCB 1RWMB 3KLEA 4RR5A 4Z7YA 2VB6A 2CQCA 3CCJS 2C2RA 4FPIA 3RJMB 4U7UK 1TAUA 2HLTA 4FF3A 3U02A 3H59A 5B0AA 2ZJRQ 4QIFA 2ZH3A 4X4TA 1RJJA 2IPOB 4NOHA 1VRUB 4KIAA 3HVTA 2FLNA 2IYGA 1YJVA 2CAJA 2QGFB 5D8HB 4ECYA 4Y2AA 1Q4RA 4IDKB 3QBCA 1U7LA 3ISZA 4WFYA 4LSZB 2V0NA 2B8PA 3VALA 1R0AB 2Y1LB 2QFIA 2KT2A 4ECRA 1HBOA 4L6V3 4F2SA 2GMLA 3VAJA 5J2NB 2J0XA 3W9JA 4LF4F 2XMKA 2GS8A 2MMYA 4IFVA 3QFWA 2ERRA 2FJWA 4USTA 4IDKA 3RB6A 2AV5A 2IBOA 2J76E 2DGSA 3BREA 2DEIA 2V2QA 2CPXA 3C14A 4U95A 4G1QA 3IG1A 4JI2J 2HZVA 5J2NA 1HNZF 4USUA 1RKJA 4B3RF 1R8HA 4JI8F 1YTYA 3R1HA 4RKUC 2YWHA 3R6LB 2CQ1A 2OD4A 1CJUB 1PAEX 2AQ4A 2MY7A 1N33F 5D77A 5B0FA 4YN3B 2WB1D 4ZLPA 4TVAB 3VAIA 2HQCA 4F0HA 2RJZA 3P8BB 4PPDA 3W63A 2R7WA 2HNYB 2IJNA 4USKA 2GVDB 3VGSA 1ZBTA 2AYBA 1L3UA 3IGVA 3HT3A 4YR0A 1C1CB 1CJUA 2HAIA 1RLDA 4X2BA 4P73A 4C4WA 2ZBPA 4X4OA 4ZP6A 4OZ1A 3VAFA 1RWUA 1RBAA 2HNYA 4IQXA 1FXLA 3MCOA 3ZFVA 2N7CA 2GVDA 2UV8G 2GHWA 2HYIB 1KFDA 2CQGA 5HJXA 4ZVEA 1NUEA 4HVZA 2AZ3A 2WTFA 1C1CA 1SBRA 2U2FA 2D3UA 5KFTA 4HI2A 1VGYA 1VFJA 2L3MA 1PC4A 1M1HA 3W5XA 3NNCA 2XY5A 3SV4A 1HQEB 1R6YA 1X5PA 1W7WA 5ETQA 3GIIA 1REVB 4DCJB 1XNQF 3R5CA 2K3KA 2RQCA 2VIHA 3F0NA 2QN6B 4WE1A 4A8WA 2BE7D 1OQ6A 8ATCB 1Y5NB 4HDHA 3UQSA 1XNRJ 2LXIA 1WC3A 4Q2LA 1W2BR 1HQEA 3GIRA 1FFGB 3MUVP 2FPHX 4F26A 2KZMA 1REVA 2ZKUA 1WHWA 4WIQA 5H9EK 5KFYA 3EZUA 1NHUA 2P6TA 3HD2A 3RGIA 1KVIA 5J2QB 4R0EA 4DF4A 2QX0A 5LXRA 4X62J 3IM8A 5F3ZA 3CUNA 1HQUB 3PRDA 1OS5A 4O3PA 2I5JB 5L1JA 2RDDA 2VHGA 2XLJA 3I0RB 1J27A 1TR0A 1FNMA 5KFEA 3V2UC 2ACMA 1X5TA 5JVHQ 2VUGA 3HFZB 2JFKA 4ENOA 5J2QA 3AOAA 4ED7A 3DXBA 2ASLA 3FRYA 2PMWA 4NA2A 2ZVIA 2FVCA 1NSAA 3NY0A 1WG1A 3X1LB 1WSRA 2I5JA 3HDSA 2EFOA 4OI4A 3LPEA 4ZN1A 4BWMA 1CJVA 4F0MA 3CD6S 1Q0NA 4M5IA 1IBLJ 4J9KA 2IA6A 1IR0A 4HLBA 2RU3A 2HVEA 4A47A 1YWXA 2VA2A 1RWWB 2VG5B 1UW9A 4NCAA 4CIOA 5F8NA 4MTPA 2VPYB 1Q1KA 3GLJA 1T9XA 3KHRA 1TQLA 4B08A 4WF9Q 3LTOA 3R9LA 2JSXA 3EPIA 3O6QA 4LF9F 3VAMA 3H25A 4RWXA 1TL4A 2DNYA 2R42A 4DV5J 3EMTA 1IQTA 2HK3A 5KFRA 2BQUA 1PYSB 3MECB 4URGA 2FGOA 2FHJD 2VG5A 2R8JA 3B4DA 3WC2A 2EFGA 4USIA 3B6BA 4LFAJ 2CFXA 1M1GA 3CEDA 3TAPA 4MKAA 1NNDA 5C42B 1U1LA 1BY9A 3I5BA 4JV1A 5CYJA 3NG8A 2EG2A 3QT8A 1D8ZA 2J9DE 3FEYB 3LA0A 1NMEB 1SJ3P 2AX0A 4IO9Q 1GH8A 2FLLA 1TL7B 3MECA 3ZZZA 2MKKA 4FKXA 5GAEU 3A8EA 4J9NA 4KAIA 4AL7A 2M52A 1RT2B 4CWBA 2HGMA 2ZC4A 3ISND 1O51A 1KQKA 1TUVA 5C42A 4NLUA 3GFYA 1I5OB 4X4UA 1Q95G 1WEXA 4PXEA 1F1BB 1F2HA 5MLCV 3BF4A 1TL7A 1WWHA 3E51A 1ZZFA 4YY3J 1U8SA 4P2XA 3H4DA 3PO5A 1MWYA 2B4UA 3BEGB 1RT2A 1FEHA 3GYGA 3BQ0A 3B78A 5K8PA 3SQGB 1RAEB 3BO4A 4OYZA 4Y2KA 3FEXB 4ZP7A 4OMFG 3PW7A 3SI8A 4DUYJ 3AFGA 4LF5J 4JI6J 3EGVA 5F8MA 2MPUA 4DS5A 2LECA 5AT1B 2AJ4A 5KFHA 5DG8A 5LSRA 5AXKA 3SQGA 2C2OB 1IKWA 1V5IB 4XPEA 3DKDA 3DRSB 4A8YA 2P5VA 3MFHA 4WXOA 3M30B 2HRUA 5E7OB 1U24A 3DFEA 2E9RX 3ITHB 3H5SA 4DV6F 2RDJA 3L3CA 1UL3A 5DLFA 3BR8A 3HSDA 4LR7A 3SCIE 2AMCB 3I5CA 4FYDA 3ETOA 3POTB 3MR7A 1H73A 1R6VA 3RZAA 4JI1F 3DLJA 1T11A 3HHLB 4CI0B 1YRXA 2BMBA 3VVTA 1KFSA 1HWKA 5A6WA 1UA0A 3CJQA 2XZWA 2HQ3A 3I5AA 1NK4A 1SJ1A 4CLPA 2VDIA 3FBEA 4PPZA 2NXJA 1TKXA 3ENVA 3POTA 3A3OB 2UXCF 1GMVA 4QWBA 2W9CA 2PI5A 3K5PA 1YZ7A 3JSYA 4OYWA 5H9FK 1XMOF 1YJUA 1R0CB 1T0TV 1GAOA 3MM8B 3QT6A 2R7SA 3MCMA 5CYMB 4AFFA 4LQ9A 2D9PA 1S1VB 4UF4A 1TUGB 3FCHA 2OP5A 3G8QA 4OYXA 3R5AA 4CO5A 4J9SA 1JLGB 3OTBA 2WSEC 1BQXA 2ASDA 3IRWP 2CRLA 3MM8A 1X8DA 1EIYB 1LV5A 2R7OA 4OYBA 4DR3J 3QO9B 5CYMA 2FD2A 2CNLB 3WIVA 4XIUA 4U96A 1S1VA 3V6JA 1R89A 4ANCA 3I4HX 1WF0A 4N77A 2HBZB 2HURA 3M2RB 1JLGA 3CCRS 1NK0A 2RMLA 2ZH7A 2Z4PA 5B09A 3BSOA 3OL8A 1LW2B 5K14B 4M5KA 2ZUGA 1MMNA 3QO9A 1HNVB 3HLUA 3AB2B 5E3CA 1HKAA 2LQ9A 2MKCA 4JI0J 2OPSA 1VBYA 5G4DA 4LBPA 4NRTA 2OKQA 5BYRA 4BHQA 2L9WA 3R8YA 3M2RA 3O5TB 3JS9A 4PKDB 5AXMA 1A6LA 1LW2A 3TUZC 4DXLA 3TQ1A 3BH7B 2V8DA 2KM8B 4LF6F 2MSTA 2FC8A 3BYRA 4BDPA 1HNVA 2PO4A 2GAGC 4EWTA 4JUZA 2ZBCA 2RAQA 4UUXA 3QJJA 2QA2A 2VICA 2WSCC 2CPZA 3KK2A 2BDPA 3KMSA 5JUMA 3Q8UA 2MLYA 2OSQA 3DGPB 4RX6A 2CJQA 4JV5F 4KYZA 3M2VB 3TVKA 5HROB 1FHTA 3OJUA 3QAUA 3G86A 4NL5A 2RUSA 4DPWA 4NLVA 4WCEQ 4O4RA 1T9VA 4X64F 4A48A 2E29A 1X4EA 3DGPA 3TJ8A 1ZTWA 3M2VA 1QAXA 2F9DA 5HROA 2FY1A 2DH9A 3BKTA 2IM2A 3PG9A 2WVEA 1VQ4S 5KG6A 2KHDA 3TAMA 1KQSR 4ZCKA 1NKCA 3IXQA 4K4VA 3US5A 1NAQA 2B4VA 3PTWA 3MAAB 3TZXA 1W25A 3I9V9 4ID5B 1VQLS 4F3OA 3LP1B 1NSKL 1S10A 2FY8A 3Q8YA 1YJ9S 4ECUA 2H4YB 3IN5A 1RT1B 3MMBB 1DURA 4C8NA 1V9OA 2ZJPQ 5C2GA 5KTQA 5DETA 3MAAA 2Z2ZA 1RSCA 3BB5A 4ID5A 3LP1A 1GT8A 1S7IA 3FGVA 2AJ2A 2JDJA 4IQMA 4WJBA 2EFPA 5I4MA 2V8PA 1WUUA 1YDLA 2PE8A 1C0UB 1KSPA 5ADZA 2B51A 1RT1A 1D9FA 3MMBA 1TL3A 4HKQA 2QZ8A 4EUVA 3K5MA 3E01B 3M6UA 3DLGA 2DT9A 1XWLA 5U47A 1NPRA 3WQPA 4QPXA 2QSFA 1RABB 4WZQA 3W9IA 4A8OA 3I4PA 2WRMA 2GHPA 1VRQC 5BJRA 2LDYA 4RUCA 1HWJA 5GMKa 2RQ4A 1C0UA 4YOEA 1YJNS 2XNRA 3HP6A 3UD3P 4B9UA 1PC5A 3MM7B 4DL0C 2HHHJ 4OV6A 2HNDA 1XMBA 2N4CA 4CLUA 3TEGA 2HNZB 5KFOA 4AT1B 1H3DA 5HQLA 5M2PA 4K4UA 4EU0A 2ZH4A 1R7IA 1IBMJ 1VI7A 1AW0A 3GR1A 4TQRA 1Y00A 2WVCA 1VR6A 2F65A 3DLKA 3KFWX 3MM7A 2FZGB 3CCLS 1UPPA 3VQTA 3SFUA 3DOMB 5B0DA 3ZZYA 3NMRA 4USMA 2BUNA 3RUBL 3V5RA 4MIWA 4AL6A 2IFXA 4AXIA 2WCXA 1HR0J 5E2QA 2ZM6J 2EK6A 2CUYA 3SDEB 3L09A 1I6JA 1VK8A 4P2FA 4NXNF 5ETKA 3CDUA 3Q8QB 3G4SS 3ZZRA 1X7VA 4U67Q 2C3YA 2DHXA 5AE1A 4HH1A 5F8GA 2OD6A 3R27A 1RTDB 1S9FA 1PJ6A 5ETOA 2RHQB 3OBIA 3TP2A 4NLXA 2UVVA 4B9SA 1TK5A 5C24A 3PX0A 3DCAA 3L7UA 1VIOA 3VAGA 1R31A 4AXJA 4NLYA 3UR0A 5KFXA 3OR2B 1RTDA 4ZVFA 1XR6A 4A8XA 4ER8A 3BYPA 1SJ4P 2MDAA 3CCES 3UDEA 1QSSA 1HBUB 2G0CA 3N9UC 4O3RA 4OYPA 4C2MA 1LXJA 1TTHB 2E1MC 3VWSA 2CNKB 2XZTB 3T1YJ 1U45A 3OR2A 3MZIA 5AXNA 4M5LA 3M1VA 3QLHB 5HVGA 3VCDA 4DR6F 2HW3A 2HWHA 4DV2J 1DRZA 3FNNA 1HBUA 3CJ2A 2A2DA 2RT3A 2A1BA 4C8LA 3BSAA 4DR7F 3T1HF 2FZCB 4CO2A 4LF8J 3TANA 1VS3A 1VJQA 2XMTA 2UXBF 2E7XA 3NP5A 1PG5B 1KHVA 3FK4A 3EPGA 3DOLB 2AX1A 4Z37A 2FHOB 3QLHA 3HJVA 3PJXA 1QAJA 3FFIB 4FZVA 2RF2B 2CPFA 2NXNA 1UETA 2DGQA 3N5FA 1HHQA 3TI0A 3TVZA 1YHQS 5KFPA 4YHHF 4R25A 1X5SA 1D9AA 5AE3A 2VQEJ 3DOLA 3PKYA 4PZVA 1HWUA 3FFIA 2F40A 2RS8A 1H38A 5HMXA 5KFAA 3CPWR 1TP7A 1GTHA 5GADI 2LU2A 4DQRA 5IC4B 1S6PB 3QJLA 3NBPB 2DXDA 3OD2A 5KT3A 2WW8A 1NK6A 5ETRA 4NYZA 2B9WA 4I69A 2CG8A 4P75A 4PWUA 1P27B 3D6MB 2JZ5A 2DNHA 2F3JA 2POKA 4F3MA 2V8VA 4DV3J 2AJ0A 4KO0B 2CQHA 3LAKA 4DUZJ 3NBPA 1CVJA 2WBMA 1LFWA 2M88A 4B9NA 5G0RB 3M6WA 2QO3A 2H65B 1C4AA 3LWLA 4CO3A 1RA7A 1T95A 2RH3A 3TYTA 2Q1LA 7FDRA 4KH1B 4RW6A 4YR3A 5KG5A 2R8IA 3W2VA 1VQNS 4KO0A 5HANA 1MU2B 4Q7AA 2DK2A 4JI2F 4JI7J 4P52A 1SH0A 2IYIA 1OYDA 3M8RA 3KUEA 3MAHA 3P6YC 4DG1B 2NQPA 3CXCR 2AD9A 5KOWA 2HRTA 1S79A 1MU2A 2O67A 3K0JA 2AZ1A 4G6VB 1FRKA 3Q8PB 4ED2A 4NLDA 1FO1A 2IAJB 5IZHA 2J0SD 1Q8KA 4DG1A 3PEJA 4K2XA 3KG4A 3CMES 3PJWA 1WSVA 4OYMA 1X4CA 3CCTA 1PKUA 1OPIA 3C46A 2ZUAA 5GVQA 1S0MA 2IDLA 3G6VA 1BQNB 1UVJA 2ZE2B 3CF5Q 2XTJP 2IAJA 4ZKAA 5HP1B 3UD4P 1K9MT 4NE9C 3HVAA 1RWXB 4W4MA 2HFOA 1AB8A 3E8OA 3AY0A 3K8WA 1UVNA 2WOMB 1EHWA 3I0SB 1BQNA 2IMOA 2ZE2A 2PMZD 1Y7PA 2C2NA 2ZOFA 4GRSA 5LM7E 1SPBP 2O66A 1K8AT 2KFNA 1L3SA 5D15A 2LDIA 3KK1A 2QG9B 1D09B 4ZVQB 2K1RB 3HVWA 4J9LA 3BQ2A 1XNRF 3I0SA 4I6YA 3BDEA 2MHNA 2KJVA 4JBCA 1I3OB 1A7GE 5DDPC 1HW9A 2Z57B 1GMWA 2VDHA 3PYEA 4OI0A 1BQMA 1U1QA 1SC1B 2K1RA 2HFVA 1W26A 4MYUA 3OHBA 1FXDA 1N56A 2HWIA 3J7ZT 1QUPA 3EGWB 1UVKA 4X62F 2CKWA 5LL6d 2AW0A 1XQIA 3T6BA 1UVIA 4M95A 4DR5J 4PXCA 4NLGA 3KUGA 5KG3A 1VDHA 2O3DA 1NKBA 2L9NA 3P45B 2VFUA 5KFVA 3MR3A 4NWBA 2HFNA 4JV0A 2QA1A 4DQPA 1EKSA 4WBFA 2M5YA 2QYGA 1IKXB 5HL7Q 3RR7A 2VG6B 4DU8A 1KLNA 1ZZNA 3FRZA 1X9WA 3I31A 2BM1A 3GILA 3LP2B 4CH7A 3R5GA 5LOQA 1WDTA 1SJFA 4RO0A 2U1AA 1IBLF 1U47A 2BJDA 2XWYA 2R2RA 3ISNC 2IA0A 1RAAB 4FF4A 4ZJQA 2YY3A 1IKXA 1Y0HA 2VG6A 2HHXA 2GO8A 1AA1B 2IRYA 2OH2A 2UVWA 1U6ZA 3IR7B 1S1XB 3LP2A 2CJ9A 3NWRA 3NL0A 3TQEA 2YWEA 2DIVA 2I1RA 4QW9A 1CS4B 3FZBA 1RT3B 5HBMA 3UNYA 1PYTA 4DV5F 1YBTA 5CCMA 1X4GA 3H42A 2WBRA 4LFAF 2OPPB 3NCPA 1YK9A 2D3OR 3EXCX 2QMXA 5CYQB 5DM6Q 4B9LA 1LEOA 4MKYA 1BE4A 1SC4B 2ZC3A 1CS4A 3E2EA 3B54A 1RT3A 2HKEA 3KTQA 5EWGA 1KBRA 4F4KA 4UTGA 1KVJA 1N5SA 4LFCJ 4XDDA 1NPKA 1SXLA 3CJRA 3MM6B 3HULA 2OPPA 4M5DB 3RBXA 5ETVA 4QYRA 5CYQA 3D3BJ 2M70A 3DHXA 1O5JA 1JMTA 3HZGA 1HARA 1FRLA 4LSNB 1WC0A 5FJ4A 1UP1A 2D9OA 4YY3F 2HMIB 4JV2A 1B7YB 4RZRA 3GV5B 3MM6A 2JVOA 5IT9Y 2V67A 1RZMA 1RAHB 2ILYA 1AYEA 3AH6A 3VAKA 1OIAA 3QNWB 4DUYF 5F41A 4LF5F 4JI6F 2VOOA 4DMZA 1P9YA 1SUQB 1UJ6A 3CO9A 2KVIA 2E7WA 2HMIA 3NWGA 1N36J 1S59A 4I7FB 3JSBA 5GMEA 4DU7A 2WSFC 2W4PA 4C8KA 4W98A 1M5HA 4KPCA 3H0PA 2XGPA 3D2WA 4Y2IA 1UMJA 4DQQA 3KLVA 3PW2A 1KLMA 3SSSA 1NHVA 4HEA9 1H7WA 3NAIA 2PDAA 2MTLA 1TKTB 1RT4B 1JIHA 1EP4B 1PBUA 3D6FB 3TO8A 2JL9A 5KFMA 3LGNA 2BA9A 3RAMA 2EBEA 2PC6A 4PUOB 2B7BB 1TL1B 2G0JA 4DR2J 3ZZ0A 3CW2C 1RT4A 4FYXB 2BRLA 2YWGA 3WC0A 2N3LA 1EP4A 1QTNB 2IMWP 5KFBA 2E5GA 3QQCD 2BOPA 3MEGB 2DD8S 2PIIA 4MT1A 3FSXA 4OYIA 1U0HB 4TN2A 3DYAB 3GV7B 1H0HB 4PUOA 2NUHA 3FCWA 4RNNA 3H90A 4ED5A 2KI2A 1TL1A 1RTJB 2MQPA 2XS2A 3JSMB 3J81Y 2Z30B 2VL1A 5D0GA 1EAYC 4ZPDA 2YKOA 3MEGA 1WC1A 1KR4A 1U0HA 2DH8A 3UN5A 1D9DA 4FF1A 1H2TZ 4CCHA 3OLAA 1GK8A 2XSJB 1RTJA 4K4YA 3JSMA 2OFHX 4DR3F 2YWKA 4DV7J 3SSRA 3DMJB 2CDQA 1OY6A 1Z2LA 2DGWA 1D0EA 4JI3J 2H54B 2HVIA 4LF7J 2W24A 1E6VB 2F7VA 4FP9A 2W4CA 4B3SJ 2XSJA 3GCWP 4F4AA 2H5IB 1S5ZA 4EO8A 4J5OA 1R8AA 3UVJA 1BGXT 4GMKA 4QOTA 4USJC 3QPIA 4TY9A 1WKKA 1Q7YT 2K7KA 3LGHA 4WYWA 4WFAQ 2VBZA 4JI0F 5DQIA 4NZ0A 5KFWA 3DMJA 1IVZA 5EN1A 2OEMA 3AT1B 1E6VA 3KYLA 2W8LA 2BKPA 2MZJA 1V6HA 3C6UA 4EBDA 2AJQA 2LEBA 3NGRA 4S0MA 3D9BA 2D69A 2F8EX 4I2QB 5KT7A 2VONA 4JP8A 4DL4A 1LFPA 4WZMA 2QL5B 4KGVB 2HRYA 4RW8A 4X4PA 1S9GB 5CABA 1VYAA 2ZBQA 4DV4J 5KAKA 3VQSA 2XO6A 1YGYA 3H5XA 3CJSA 5LMNJ 2MGZA 4I2QA 2V6AA 1SCJB 1RT6A 1WKJA 4Y6IA 5JVGQ 1FF2A 2P9GA 2HFZA 4A8SA 2DHSA 5E3RA 2V4RA 1WC4A 1S9GA 4ELUA 1HL6A 1IKYB 2YKAA 3TX0A 1SKUB 1VC6A 4URQU 1Q8BA 2E44A 2FJXA 3OTEA 2Z2MA 3ELHA 4M8LA 1U4BA 4FVCA 1PSDA 3J80Y 4ZCIA 5KFZA 2HHWA 2A18A 3OR1B 5KT6A 3TZYA 1MWZA 5KFSA 1U1RA 2O5DA 3M6XA 2GX8A 5ETPA 1UEUA 3MF5A 4LRFA 4P10A 1HFEL 2R7UA 1TVRB 4OYAA 3PHEA 2JOQA 2N4DA 4USHA 3MI7X 3OR1A 2EFVA 3KOAA 2GQQA 3A1YG 1SC3B 3WBZA 3HSZA 1ZAXA 4EFAC 2ZH9A 4EK2A 4CO1A 4ZA1A 1JLEB 3UCZP 1FK9B 5HLFB 2YKQA 1TVRA 2VC0A 3PDNA 2GHVC 4JI1J 3P49B 4DPUA 4NEYA 1GFWB 3GYNA 1N32J 1RTIB 3KG1A 2B43A 5DRKA 1ZAWA 4KGMA 4WFNQ 4F2RA 4X4RA 4LMZA 3BBCA 2YKNB 3W8PA 3PEHA 1GQEA 1N4LA 5C5JA 4JI5J 3D1QA 2OGUA 2HHVA 5L8RC 5IV3A 3OXGA 4DHVA 2F1FA 4AE5A 1JLEA 1QDUB 2MQLA 4M94A 1FK9A 3J7YI 3PXGa 2V4QA 1HW8A 1RTIA 4D3HA 3GZ7A 4ED6A 4OX6A 2HHHF 1KD1T 1RAGB 4DX5A 1F5AA 2W8KA 4X66J 4J7CA 1AFJA 4F7VA 4OX7A 2I0XA 3OL9A 1VCTA 3CC7S 3KHLA 2G2OA 4M5JA 1FESA 3OVAA 3MM5B 2CQBA 5HI7A 1G1XA 2KZZA 2V2VA 5LJ3Y 4BS2A 2VBWA 4K5RA 4HH0A 1CQNA 3MWBA 5J2MB 5IT9U 2E9ZA 1IKVB 5B0EA 1S6OA 1RT5A 2PN6A 3OVBA 3MM5A 1VHFA 3W5YA 1HR0F 1JJ4A 4O3QA 2ZM6F 4LREA 3I55S 4YEAA 1KOHA 4TU7A 1BMQB 1QE1B 2ROEA 3OVSA 4MJKA 2A6MA 4LSLB 1O0PA 2W25A 3R2CJ 5J2MA 4PYAA 2YQ1A 1IKVA 2BE9B 5MAOA 4P71A 2DXFA 2H51B 4P6QA 3NRBA 3GFZA 2VODA 3TA2A 2XLKA 2EG1A 3RBEA 4Y2CA 2OSRA 4WXWA 1QE1A 3QZ8A 5FD1A 4LSLA 3H2UB 3IGNA 3EVWA 3K7RA 2G4BA 4A8QA 1RISA 2NZ4A 2FLOA 2OAUA 2HZCA 2DNQA 9ATCB 3VHQA 1FE0A 2V2ZA 4CH0S 5CD4A 2C22A 3IRXB 5D4OA 2ATCB 2QJ3A 1JLAB 2QL7B 4I1TA 4YR2A 2HHPA 1ZYQA 4OHVA 3DRYA 2E7VA 3EICA 1M90T 5L9XA 2MKJA 1B64A 1LKZA 3W2WA 2M4MA 1K0TA 1X0PA 2MQNA 3BS9A 3IRXA 1F5CA 3T1YF 5A8WB 1VBZA 2UUTA 1JLAA 2A10A 3A12A 3J81U 1B0TA 4P9SA 1UJ4A 2G2ZA 4DV2F 3HCXA 3ILJA 4QIVA 2HQIA 3FMWA 3B4MA 5A8KB 5EHHA 1L3VA 2ZD1B 2B4OA 2KN4A 3K5NA 2VKRA 3AA9A 3M9OB 3FUYA 2CADA 4LF8F 2IRXA 4C98A 5A8WA 2VQFJ 4QWEA 2WZ1A 2DH7A 4J9VA 3TOQA 4RW7B 1RU2A 2GCFA 5IQ6A 5KT4A 1MN7A 1CSJA 1KDNA 3IO1A 2YKPA 5I3QA 1N5YB 5A8KA 3AXKA 2X51A 2ZD1A 3IMQJ 3MD1A 1UEVA 2JEGA 4M5GA 2KG1A 1C2PA 5EWEA 3FCVA 2B6AB 2VQEF 2AP6A 4Q44A 3IFEA 4RUBA 1W2IA 1XK8A 1N5YA 2V50A 3H5YA 4C7QA 2HHSA 4ELVA 3PV8A 1FI4A 3FZ2A 3GB0A 4JI4J 2WHOA 3NLCA 4IG0B 3PO4A 1A9NB 1N5TA 2B6AA 2NXUA 2AYMA 4CQ1A 1RHRB 2ZH8A 1X9SA 3A8JA 2M2BA 1JLFB 3PJ9A 3QWUA 5C2CA 4OJ3A 4DV3F 1QJHA 2XMVA 4ANEA 2QA4G 2C2MB 1FDDA 4DUZF 4V19J 4CO4A 2FQQB 5DDQC 2MKIA 4ICLB 4RLEA 5DZ7A 1R8BA 1RLCL 1WF2A 3M4XA 1OMSA 1TV6B 3ETMA 2HQGA 1JLFA 4C97A 3VZIA 1RHKB 3SXLA 2FYXA 2KXFA 1ZAVA 4JI7F 4L3KA 2FTRA 1IM6A 1VK3A 2CJXB 2DR7A 1K1SA 2RILA 2MZRA 5T14A 1K1QA 1HA1A 2EFQA 4UOFA 3G9CA 4Q43A 1FEEA 4ICLA 3M6VA 1PBAA 4TU9A 1RGVA 4NLOA 4DL5A 1OSDA 1TV6A 4HI1A 4HDGA 4CYUB 1RE1B 5E41A 2C2KB 3J80U 1N34J 2DR9A 2CJYB 3BN7A 3AJDA 3MEEB 4QWCA 1RT7B 4NXNJ 1RWOB 2IM1A 4RU2A 4QW8A 2ZBRA 2CQ0A 2NSCA 3GMGA 3M2UB 2YQ0A 1G3OA 1UVLA 4H4OB 3PYGA 4KE5A 1F2GA 2AEMA 4FPRA 3BV8A 4CYUA 3D0HE 4FXWA 2DNMA 2KXNB 4KT0C 3DOKA 3K58A 3DLEB 1VBKA 4J90A 3TNVA 1Y9OA 1DTQB 2AWZA 2W4DA 3G87A 1NJXA 3M2UA 1RAFB 3MHYA 2R7TA 5LT5A 5L9NA 4H4OA 4TY8B 2KDOA 1KQFB 1DAXA 2LYVA 2OUGA 1VLYA 3MPWA 3JB9k 4FS1A 1NB2A 1LWEB 1S1TB 3N6LA 2RD5C 1U2CA 3R7NB 4IH5A 4DPOA 1JLCB 2ILZA 4ZLLA 3SCKE 4MIAA 1U49A 1SQEA 2Y1RI 4DR4J 4K59A 2OELA 1NO8A 5HK4A 3K59A 3EZ5A 4TY8A 3ONQA 1S97A 1N52B 1Q16B 4ERDA 2KFYA 1LWEA 1NDKA 1D3WA 3VZHA 1S1TA 2MKYA 1IQZA 4DL6A 1JLCA 1ZM9A 4G3IA 2XCAA 2VH7A 4A8FA 2AJFE 4OV1A 2ACYA 3TZZA 2R2UA 3EXYA 2B7CB 3D0IE 2QLFB 5IT4A 3MFIA 5IFMA 2MXYA 2RU9A 4K50A 2OEKA 2G1DA 4DPXA 2J6TA 4DSKA 1RWVB 1VQ9S 4F0KA 2I8EA 2YWFA 3I9ZA 4LRAA 5IV4A 2FHMA 1WHXA 4PWWA 2BZ2A 4IKAA 2R9LA 1IJEB 2UZAA 2FLPA 3OFEA 1VQ5S 2J0QD 3PRBA 1YBUA 4I64A 4ZJLA 2DITA 2DGTA 4DR5F 1DJ0A 7FD1A 2W2QP 3M32A 1XIQA 5CZVA 4ZS6A 3I87A 4QZVB 3NNHA 1IR2A 1FFSB 5K20B 2A0FB 3GIMA 4ECXA 4PQAA 2CQ4A 1YZ6A 1SL1A 3UCUP 5E0OA 1BC6A 1RBLA 4NYPA 1UEKA 1WHVA 1URNA 2LCWA 1UFWA 2VZ9A 1LWCB 4J91A 3TUJC 2AEFA 3KK3B 5E3AA 2B9XA 4RWWA 4DSIA 2R7XA 3BN4A 3PM9A 5FLXY 3G82B 3GPAA 4XK8C 2XC9A 3L4BC 4PQUB 1F5BA 3RBDA 3JQJA 4NZ7A 5DGBA 3N01A 2W7PA 1S49A 1VRUA 3EGZA 2HS0A 3DRRB 3KK3A 5KFGA 2XM3A 2EWHA 4YQWA 4WP3A 1IJFB 4K4TA 3G82A 2OEJA 2LQ5A 4HR2A 2IIHA 1R0AA 4HTJA 4PQUA 3M7VA 3R2DJ 4K0KJ 4LT6A 2QA4S 3EGNA 3GSIA 3DRRA 4LUBA 3KG0A 3GYXB 4TQSA 5KT2A 2LXFA 2O1PA 1Z4UA 1H72C 2Y0BB 3MDFA 2GW8A 1Q78A 3GSDA 2YH1A 1PILA 1CJKB 2VFRA 2LKZA 4LFCF 1TL5A 4ATNA 1PYOB 1RQ0A 2R2SA 4ZVGA 1NH8A 1NJIT 3T41A 4OHZA 2CNNB 2VG7B 3VGUA 4UZBA 3BKUA 1M5KC 3D0GE 3CCVS 2IHR1 4WPAA 4ECQA 4LJMA 1ZOTA 2HIQA 3QGGA 5HQMA 2DXEA 3FBCA 3CIZA 5EWFA 3IR5B 4DSEA 2Y0SD 1T9WA 2X1GA 3CJ8A 4EZ6A 2VG7A 3HHNB 2KTQA 2ADBA 2HFUA 2YX7A 4N76A 5DG7A 3FMBA 1LQ9A 1MW7A 2DIUA 3H5UA 1QSLA 3QIDA 4CRJA 1U8WA 4K2JA 2J6UA 3K2YA 2G0IA 2L08A 1N36F 2WK4A 2LP4A 5DJBA 2EK1A 1FKPB 3AOCA 5LMUJ 4DSLA 1X5OA 3T3FA 2W2PP 1Y10A 4A8KA 2CPDA 2AGPA 5F8HA 2APOA 4F4YA 1TMJA 4OX8A 5KG4A 4ZN3A 4CLTA 4YUDA 1FKPA 3MM9B 4HT7A 4OHXA 1ZS6A 4OI6A 1RA6A 2RIJA 4IYQA 4N8OA 2GIFA 4DR2F 1DQAA 2X1AA 4KHPJ 2ZH5A 1SIWB 3NGKA 2DR6A 4ZVOB 1Y3JA 5F8IA 1Y3KA 1WDDA 3MM9A 2QV6A 4LRCA 4M5HA 1SQFA 2MQQA 2AYEA 1KS2A 1DLOB 4Y34A 1WJ9A 3RRHA 3KLGB 2P6SA 1P8GA 3EYZA 2BYCA 3K57A 1HQUA 3LALA 5IM0B 4LF1A 2FC9A 2Q3PA 2RKIB 3I0RA 1UFKA 4W90B 1VHIA 1ACMB 5B0GA 1DLOA 2BW2A 2GA7A 4HL9A 3TUIC 3KJVB 1GXTA 2KRRA 3HMJG 3KLGA 1FFWB 3LF0A 5DM7Q 4DV7F 4U9RA 3IA0A 1YJRA 2CG4A 2RKIA 1RXOB 1X4AA 4JI3F 4YB6A 4ZVTB 4LF7F 3QT7A 1EQMA 2HVDA 4I56A 5IXUA 4DJBA 1UAWA 4B3SF 1YSJA 2MY8A 1WTBA 2QMWA 1Q79A 2DCLA 2ZOMA 3BBFA 3QIPB 1OYEA 4P2MA 4IFYB 4ZCLA 3ENAA 1FTCA 2NZCA 4K8RA 3UN3A 2XMAA 4U6PA 5L1LA 3PHTA 1FWLA 3PR4A 3QJPA 1T94A 2ZDOA 2WVFA 1RHQB 4ZLNA 3MOZA 4MIBA 2IVMA 2BEFA 1VQYA 2QLWA 2W01A 4ETXA 3QIPA 1OJ4A 5GAEI 4QR1A 4AUKA 4IFYA 4B3OB 3HXMA 3V6DB 2AKWB 3ZZOA 1H7XA 5T7LB 2ALYB 3CCZA 2DY9A 3OTCA 3RRGA 4DV4F 1VC5A 2XULA 2UUBJ 1RU1A 4XAKA 1Y4ZB 3THTA 5I42B 5LMNF 2VOPA 2NPFA 2FHKA 3NCQA 3Q83A 2PEBA 3CJ3A 1VQ8S 1ZH5A 3GJRB 2VC1A 2EEYA 3HKZD 5GAHU 4C0BA 3QATA 1HD0A 2LQ8A 3V6DA 4I6AA 2BW7A 4M5NA 5T7LA 3CC2S 1O8BA 1XC9A 4NEZA 2NR0A 2XY7A 4DS4A 1NH7A 5I42A 3I82A 3CC4S 1S77D 1F0XA 2HHUA 3CE8A 1GMWD 1FDAA 2Z2LA 2CZ4A 2F5GA 1V3SA 2HBRB 3MPUB 4ITSA 1U6BA 1VIXA 4Q8FA 1U1PA 2ZNYA 3KXDA 2UUAJ 2R8HA 1F3FA 1NEEA 1WF1A 5FLXU 5ETNA 3Q24A 2PEHA 1CG2A 2BX6A 4KPYA 2KVQE 1NXIA 3Q86A 3DRSA 3S8SA 1GX5A 3TA1A 4IG3B 3M30A 1N32F 3D66A 1QY7A 1U02A 2UVUA 3ITHA 4R5PB 3DI6B 1EZZB 3HKWA 4N56A 4FKYA 2YX4A 4JI5F 4B9MA 3A3PB 4ED0A 5FIIA 1F9FA 4DSJA 3LH2S 5KFFA 4UUWA 4IG3A 2GJIA 1IR1A 3V6KA 3AB4B 4N7TA 3HHLA 3CCUS 4NMLA 3CGIA 2B3TB 5KG1A 4R5PA 2P9EA 2BANB 1HBMB 3DI6A 2W9AA 4NYOA 3OLBA 2KT3A 4AL5A 3HSGA 3KNGA 4X66F 2IRUA 4H4KC 3Q8SB 3ZTOA 3H2LA 4C0OC 2HS3A 4NLRA 4OIXA 2DJWA 3GP9A 3N0VA 4RW9B 5DQHA 1P1LA 3H40A 2DGVA 2BANA 3O3LA 1HBMA 1NHKL 3T19A 1EETB 1RUSA 3BGRB 1NDLA 3N6MA 4O44B 3PW5A 1HI8A 1VOMA 4DL3A 5EX0A 3GONA 2GQ2A 3BH6B 3G6ES 2DNRA 3D28A 1SH2A 3KMQA 2NCKL 1M5SA 4MAKA 1RK8A 2DNLA 1EETA 3QSYB 3BGRA 4O44A 1Q5YA 2BKOA 3T6JA 3MTKA 3L7PA 3MMAB 3P96A 3FC9A 2ZH1A 4GKJJ 3PACA 1DARA 1AFIA 3V4IB 2DPIA 3AD8C 4ZOSA 4ECSA 3PW4A 3OXLA 1GMUA 4XDCA 3NGSA 1JJHA 5K14A 3DU5A 2V9KA 5F0WA 1SKSA 2V68A 1FRXA 4MFBB 4NX9A 1FKOB 4CT9A 2GVZB 4DFKA 3V4IA 4E8UA 8RUCA 5DDRC 2M0GB 3VR1A 2E1CA 4PYDA 3GWCA 4YMEA 4YDXA 3BGFA 1K0VA 2F4FA 2JX2A 2E1RA 1N88A 1U1KA 1NPPA 5SZTA 4MFBA 1FKOA 2YPYA 3P4UB 2GVZA 3IC1A 4PR6A 3R1LA 4ZDNA 4GVLA 3W65A 3IR6B 5F0UA 3R6GB 2LA4A 1JLQB 4K7QA 1N48A 4QJVA 3G96A 3DN9A 1UFLA 2P9CA 2XS5A 2H9ZA 3HD1A 2W2MP 4HYKA 1YX2A 1S72S 4Q8EA 2PFFB 2ADCA 3KLIB 1TMMA 2V34A 5I3UB 3IWNC 1T9TA 3NGDA 2VQFF 1Y5IB 4FBUA 1GX6A 4LFBF 4DR1J 2B0GA 5RUBA 5CH7B 4ZVHA 1S0NA 1IXKA 3EE3A 4CNYA 4X4QA 4RUHA 5A0YB 3BQ1A 2KL8A 2DO4A 3BDPA 3KLIA 1XBWA 3Q89A 5I3UA 2IC3B 4U8VA 4WKRA 3Q0AA 3PYFA 4PRFA 4PG6A 5C7PA 2F63A 3JAMY 4KJIA 2HVZA 4LBHA 3DHWC 1NZ8A 2DY1A 2RRAA 3C15B 2R3VA 3CDBA 4OZ0A 2F8MA 2XWXA 2MLXA 4JI4F 4FVMA 2IC3A 3RW6A 2MZTA 2M8DB 2VBYA 3M8WA 5M2RA 1HBNB 2W2OP 2EC0A 1Q82T 1S57A 2MYFA 3CJTA 1FNOA 1CBKA 4FS2A 1H98A 4FDFA 3E01A 3C15A 4KGXB 4URSA 4RBVA 5K9FA 4R0JA 1VLOA 1CJTB 2FVQA 1HBNA 2XB2D 5CCLA 4Q5VA 2R8KA 3PKMA 3CULA 4LR9A 4TXSA 5F9LA 2VPZB 3HJFA 5D0HA 3NKYA 1MROB 2N7YA 2J9DA 2HNZA 3IS9B 3N6NA 3LQVA 1VQMS 1CJTA 1ZPVA 4EBCA 2JLEA 5IWAF 2CPJA 6FDRA 3RB3A 2CWKA 4O23A 4NRUA 2XBPA 1WOOA 2COLA 2VPXB 2J6SA 1N34F 2C42A 4DL2A 2CQIA 2BBEA 2H48B 4FNHA 3A8KA 1KRPA 4ZK7M 3GFHA 5KG2A 2HPUA 2DGUA 5D3GB 3DOMA 3ZNJ1 3QYYA 2DR5A 3VAHA 4ETZA 4YFUA 4U7UD 2VBXA 3CMAS 2HHQA 2WB4A 2BJ7A 2GAHC 3X3UA 4FYYB 3LO3A 2E1PA 2DGOA 3SDEA 4LRDA 2A2CA 2NYIA 3W3SA 5D3GA 2DO0A 3T1AA 3LW5C 4CLZA 5E5NA 3EDQB 3NOGA 1G4CA 2AEJA 1IN0A 5ETTA 5IT0A 2BKNA 1S4EA 2EKYA 4PEOA 1T02A 2CJBA 2V2KA 3KJFB 4IRCA 1HBOB 4ES1A 1RACB 3D7SB 4KV8B 2HBYB 2JLFA 2VFTA 4NZ6A 4DR4F 5DDOC 5ITHA 3QT5A 2ABYA 4IFVB 2W7AA 1RHJB 1CLFA 2VJUA 4LVNP 1NJZA 3C14B 4ZPCA 3MOJB 4EYIB 4G1QB 3IG1B 4KV8A 1EX8A 1KHWA 2C2DA 4XPCA 3E3XA 1MNEA 4R8UB 2XGQA 5ETMA 2GMJA 1RWPB 1AUDA 4PXBA 3SEOA 2DHGA 2C3OA 2RVJA 4OHYA 3R7BB 3OTOJ 4WP9A 1HMVB 4I67A 1RKIA 4I0WA 2PT0A 4PAAA 1VJWA 2DHHA 1HQ2A 3EX7B 1QVFR 1U48A 4R8UA 3CCSS 1YJ7A 2WVBA 2QEXS 2PGCA 1SB6A 1UZHA 4ECTA 1SV5B 5J1EB 1UW4A 4U8YA 3SZ2A 5KG7A 4ZVRB 2OLWA 3TRGA 4B3MJ 1HMVA 1RYRA 1ZPWX 4KBIA 4RUAA 5HMWA 2SXLA 4DF8A 2HVHA 4LBIA 3WZ0A 3S01A 1M0SA 4DPTA 2J7WA 3MMCB 2RRBA 4F3QA 2J0WA 4CP5A 1C0TB 3AHPA 2YPZA 1JQGA 2C2ZB 1LWXA 2RF2A 1SV5A 2YTCA 4OI2A 5J1EA 4N41A 3RAXA 5CHCB 1OPZA 2NSBA 2Q66A 2EXUA 5D4NA 1XTZA 1OWXA 4Y0FA 1VMBA 2QRRA 3QZ7A 2L48A 4K4XA 3MMCA 1C0TA 3KDNA 3W5ZA 1I94J 5L46A 3BZQA 5DQGA 3IBCB 1NBEB 1EARA 3OFHA 1S6PA 4X84A 1OSCA 2CDRB 1FE4A 4TYAA 1QSYA 2C2EA 4WE1B 3UFCX 3SQOP 1U25A 3Q8RB 3FVYA 2MQMA 1NLKL 2BE2B 3PZPA 1WNEA 1A0OB 4ZJOA 5BYSA 3TX8A 4CM2A 4TNOA 1S6QB 4DCPB 4EMDA 2LXUA 4YP3A 5F3TA 2CJKA 2YNGB 4WTOB 3NEKA 5G0RA 4K0KF 4RBTA 1VRTB 4J9MA 2BE2A 4YB7A 4LR8A 2UP1A 4DZ6A 3CDEA 3MUTP 5F8LA 4MK9A 1NK8A 1JXVA 4OX9J 1S6QA 4YB5A 2B4PA 4CLWA 1N8RT 1D8YA 3B82A 2YNGA 2FVRA 1Q8IA 1NJYA 4LQ3A 3A3NB 1VRTA 4F04B 2Y8YA 3WDOA 1EB0A 4KB7A 2VF3A 2CQ3A 1FDBA 1YQHA 2DHAA 4DX7A 1SKWA 4OYOA 1SKRA 1S9EB 3HO1A 1Q53A 2J9CA 2XHCA 2BVZA 1CJVB 2UV8A 4C0HA 4RJVA 2MLZA 2RSQA 2DEJA 3JAMU 1DHMA 5IS2A 3VV2B 2KB2A 5A2QY 3CIMA 3SIPB 3F56A 5A8RB 1NK7A 3GQCA 2P8IA 2RQMA 1S9EA 4ZP9A 2LQJA 1T9UA 4O0NA 3P3DA 2MKSA 2FB0A 2FZKB 4ES3A 5HP1A 1R0BG 2CIMA 3RB4A 5LMUF 1UWAA 3BBBA 2VU5A 1S4FA 5A8RA 1NU4A 4DLEA 1BWVA 1F60B 2BJ8A 3DXSX 4B9VA 2AYGA 2WOMA 2DNGA 2DCUB 4EEYA 1JJ2R 1RHMB 2EPIA 4IR1A 2RS2A 3H98A 5CAAA 2R7QA 4O0IA 1HWIA 4CLKA 2XS7A 5KFKA 3U7JA 5D0RA 2CZ9A 4I68A 2KYXA 3S7RA 4GKKF 5B0BA 4Q2MA 2ZDPA 1QAYA 4O4GB 2M7SA 2CZVC 1DTTB 4KFBB 3PVXA 1B0VA 1FRMA 4EYHB 1OY8A 1ZTTA 4YS2A 4CZCA 4RW4B 3M9MB 4KHPF 5D78A 4U7CA 2DB1A 3GFXA 2OHDA 2CWXA 3HK2A 4O4GA 1HHSA 4QQBA 1T7PA 1DTTA 4JYAJ 4KFBA 2K8GA 2GGPB 3I6PA 4F36A 1G2EA 1X4BA 1YIJS 5BXIA 3FBFA 8AT1B 2UUWA 3DC2A 3GJTB 2OMOA 3C8YA 4RW4A 2GZOA 2Y1IA 1LK5A 1P9QC 4A4JA 4X65J 4B3TJ 2J8AA 1RHUB 3MEDB 4NLPA 3SFGA 2LQBA 3DLLQ 2GGPA 1WG5A 3M9NB 2YNIB 4ILRA 2PA8D 3CMQA 3IAM9 1KKHA 5CZXA 1QAIA 4H4KA 1T9YA 1KC8T 1WHYA 3QWPA 1IKWB 1ZM4A 2CXEA 3MEDA 1FD8A 2Q43A 1P1TA 1JX4A 1SI9A 2YNIA 1HI0P 4IH7A 1IUJA 2HLUA 4P7TA 3R97A 2VKZG 1YJWS 4PG5A 3J7AN 1RWNB 1WEYA 3ZC4A 3HX9A 1CC8A 4A8MP 3FDSA 1S1XA 1F9EB 4P72A 4OZNA 1NK5A 2N82B 1H2VZ 3IBFB 5D4PA 3FKBA 1R8PA 2KXHA 5KOXA 1HPZB 4F50A 1TKXB 3H2VE 5EUHA 3OW2R 2W9CB 1UVMA 2RB7A 2XLIA 4ZLJA 2UUBF 1HNWJ 2HSEB 1NKEA 1HPZA 1Z2ZA 1I51B 1RAIB 2FGCA 2XYGB 2HZAA 3NMAA 2OPQB 4DEZA 1PJ5A 2K3IA 4C3MA 2N3OA 4J9PA 4B9TA 1M5OC 4ECZA 3ADAC 1JKHB 3KHGA 4M5DA 3AJ2A 3F73A 2GNKA 2OPRB 2MQ8A 3W64A 3OHAA 5HQ8A 4KY3A 2ZVSA 5HO4A 2YNHB 2OPQA 3TW0A 4LSNA 3V4MA 4NLSA 3CB4A 1JKHA 2RDIA 3S6EA 2V69A 4OL8A 2OPRA 4J9UE 4O3OA 3ZTQA 2UUAF 2ZNZA 2DNOA 2YNHA 2AHOB 4MYTA 5DS7A 2OPSB 1SUQA 3HHEA 3RW7A 4DX6A 4C11B 2IJRA 4OQJA 4XTTA 1Q7LB 3PX4A 4I7FA 3IP0A 4WFZA 3TVYA 3FJ2A 1UJ5A 1QUVA 3CCMS 3UR3C 2OFGX 3WX4A 1FTRA 4GO5X 4ID8A 4G65A 1JJCB 3LWMA 2ZH2A 5BR8J 4WFXA 4NA1A 3TJAA 4ZIVA 4PG4A 1RAJA 2R7VA 1TKTA 4C11A 1H2UX 2XCPA 2NREA 3KK2B 2R4FA 2E5LF 1KWMA 4Q0BB 2XMWA 4HHHA 4X4NA 2FJDB 3QRPA 2ATLA 3OXFA 1B7FA 3GJSB 4QR0A 4TLQA 1Q86T 4NCBA 1FJ7A 1UTAA 4OI1A 3ENWA 4I2PB 4D3GA 1C1BB 3AODA 4Q0BA 2J7UA 4NI2B 3ZTRA 3MR5A 4BBYA 1FWKA 3RAQA 2MJUA 2M9KA 3DYAA 3EJMA 3P5BP 2CNOB 4OJ1A 2GJFA 5LSLA 2JWNA 4TLRA 3TAMB 1IM4A 4I2PA 1C1BA 3PW0A 1FA0A 3L9ZA 4X4VA 5KT5A 2AU0A 4F4XA 2Q6CA 4NI2A 4UY8T 1TKDA 4USWA 5BYQA 2K2PA 1YJTA 3OTDA 1R43A 2ZH6A 5A2QU 2UU9J 4DL7A 4PXDA 2HEKA 4DV1J 4GO7X 1FWPA 3FQKA 2BV3A 3GIKA 2XMJA 1UZDA 3B8HA 3SYZA 3UDLA 1F6TA 1FVSA 3UW1A 3GTYX 4OZ2A 1S99A 3GJQB 4GKJF 3THPA 1KVKA 5J2PB 4IRDA 1FJEB 3GV8B 1FDNA 1IBKJ 1TL3B 2MHEA 2VFVA 3EWGA 3DLGB 3QGIA 2ZEJA 1SC6A 4RL1A 4UOGA 2F8HA 1WORA 2DRBA 4ZP8A 4ED4A 5J2PA 3CDWA 2MKHA 1GNKA 4DV0J 2Y1JA 2OO4A 4OJHA 3M8PB 4OJGA 3ENQA 2HNDB 1NB7A 2R7RA 3U27A 3MCNA 2MEWA 4WYLA 2J7KA 5D6GA 2HQDA 5AE2A 3LAMA 1NDPA 2LMIA 4P2SA 2JEFA 4RU9A 2RE1A 1RB0A 3MMJA 1H6KX 1FRIA 3DLKB 4BCAA 5EDWA 3M8PA 1S0OA 2JC0A 3NXZA 4H4MB 1JWWA 4FNIA 3LUYA 2GIQA 2GJ2A 5DZ6A 2DVIA 3W61A 3AOBA 3BPSP 3KJQB 4KQZA 2V5HG 1IKYA 3A4TA 2KHCA 4FXDA 3CO0P 1OY9A 2G1HA 3C66A 5LXYA 3U1LA 1EQ0A 1R27B 4DR1F 2J5AA 2ASYA 2ZOGA 1SL2A 4H4MA 4NASA 4ZHRB 2MB0B 3QFHA 1KQGB 2ZHOA 1O6XA 4NXMJ 4OZLA 3CCQS 4GC7A 1ZA2B 2NYHA 3UCGA 4CT8A 4IH6A 4RNHA 4Y65A 5CXTA 4BWJA 3R5DA 2PI4A 2EBGA 3MD3A 3AJ1A 1VQOS 2JVRA 4ZHRA 4ZMMA 4C8YA 2BQ3A 1AZSB 4FYWB 1RBOB 1RCOB 5C24B 3PYDA 1L5UA 2DISA 1DQ8A 1BD6A 1NDCA 3UDVA 3IM9A 3OFFA 4ANDA 1PO6A 4KGZB 3QGPA 3M8ZA 5HLFA 2GMHA 2H4WB 2MQOA 2YWWA 1AZSA 3HSJA 3EM1A 3W8GA 3I96A 1L3TA 2VPWB 2YKNA 4EI2A 1EJ7L 4ED1A 3F41A 2QTWA 1KONA 3OFGA 1YBAA 2I6WA 1KNZA 1VQPS 1N6QB 4NPOA 3BJYA 3CJ4A 5L39A 2YKMB 2D1CA 2JJ4D 3M1VB 2E5JA 2JC1A 2FJAB 3W1YC 4QWAA 1J2VA 4ZPAA 4EBEA 2E5IA 4WFBQ 2D3ZA 3EUNA 2A6OA 4DZDA 1YG0A 3GCXP 5KFLA 1KEKA 3DDIA 2GO9A 2ROGA 1CC7A 4K5SA 1N6QA 2HBQB 4UOCA 3MEKA 2YKMA 1XMQJ 4HACB 4Y2MA 3W66A 4JOUA 1G6BA 1EKRA 2CQPA 1TKZB 2VJVA 4ES2A 2XI2A 5E3PA 2FVSA 1MLAA 4IOCQ 5ETSA 1ROFA 3L7OA 2BJ9A 3EVMA 4ECWA 1R3NA 2FUG9 3N5BA 2CPHA 4P74A 2FJEB 5HJYA 2F4VJ 4UOHA 5AJ3J 3RB0A 3LANA 4FXVA 1J5EJ 4DDFA 3LPYA 3KNAA 2AJ1A 2H5EA 2LA6A 4HACA 3HI9A 1LNQA 3KUHA 1B70B 1XEZA 3Q22A 3MUMP 1TKZA 2V63A 2KU7A 1DQ9A 2HWTA 2XYHB 2BJ1A 1NK9A 2H5JB 1V5VA 2EFNA 2DPJA 4L73A 4IO1A 3CD5A 3JTNA 3FSIA 2UXDJ 1M5VC 4M63A 2C3PA 1TAQA 1FXRA 2Z56B 4DLGA 2OTLS 3VTIA 1NZAA 1BHNA 3TR5A 2YXLA 2E66A 2Z58B 2QIFA 4RBUA 3ULHA 3D54A 1FCAA 2D3O1 5GADU 1H74A 2EVZA 4OZJA 5IQQA 1MN9A 3OSPA 5D0EA 1RTHB 2QE5A 1VQKS 3D68A 3UWTA 2G9OA 1X4FA 2WVDA 4RW6B 3W2VB 5A6PA 4QU6A 2NXEA 2WW4A 5EGYA 3VGTA 4A46A 3ZO7A 4DQSA 4O3NA 1RTHA 1FNXH 3HHDA 2HGLA 2DNPA 1MG7A 3AD9C 2C3MA 4OFZA 3OTOF 2IVFB 4DI6A 4L72B 1QLNA 5KG0A 4LFBJ 1HNXJ 3D1OA 1X9MA 2IM0A 4QBUA 2W2NP 3NOCA 5L38A 1KN6A 2NLWA 1D1UA 2F9JA 4M5MA 2GIRA 4LVOP 3HHLD 2HIYA 1SJRA 2DYAA 4B3MF 4IRKA 3G2XA 4OI3A 1NCLA 3OL6A 3IWLA 2E9TA 4RW7A 2NUUG 1N0UA 3FQLA 3ZXWA 1JK9B 3SCLE 5GAGI 3TA0A 2HFSA 4Z2XA 3W9HA 4QWDA 2XO7A 5GAGU 4OLOA 4H54A 2FHJA 2I38A 2QSWA 3HM9A 1U1OA 3PX6A 2CA9A 3PIOQ 2JH3A 3TUPA 3BSCA 2JFDA 3KWMA 5JXSA 9RUBA 3AD7C 4OLPA 1I94F 5K8OA 2BJEA 2D41A 2KH9A 2VD3A 1KTVA 1YVFA 1MMDA 2GQCA 1M5PC 3AA8A 1FERA 1V3ZA 4IG0A 3J81j 3R5BA 1T05B 5C25B 4NCGB 3KK1B 2IVYA 1BWEA 3QMQA 3TEHB 4IOAQ 4CTAB 2NXCA 1TFYA 3T5JA 3NGTA 1AXQA 1ZM2A 3ZZTA 3QSIA 3VF0B 5KFCA 5L1IA 2CJAA 4Z7CA 2JHEA 2VA3A 3OSNA 1BQMB 3D67A 1T05A 5C25A 4NCGA 5HVFA 1SL0A 2Q79A 1T03B 1YRTA 3BSNA 1Y5LB 4Y28C 4CTAA 3TARA 5IWAJ 2JLGA 1RAOA 5B0CA 4C8MA 5B7WA 2ZBIA 2XZDB 5KFDA 2XMMA 4DFJA 3PFOA 1HYSB 3D5MA 4OX9F 4AQYJ 1HNIB 1IWGA 1FRHA 1HWLA 1IWAA 2UUCJ 3CCWA 1T03A 1U2RA 1WOSA 1OQ3A 3UN2A 3KHHA 3U1MA 4IOBA 4V19X 3P5TL 4EGLA 3M8YA 1HI1A 3QRRA 2Y9HA 1HYSA 5D4LA 3KLFB 4B17A 2VV5A 5THWA 5H1SV 1DFDA 1HNIA 3D6HB 3MEEA 5A76A 1Q5VA 1RT7A 5KFUA 4KSEB 1ULRA 4FN5A 4WWSA 3C2PA 2DRDA 4L74A 3W60A 1FJGJ 2P2CB 3ZNUA 4J9QA 1RTZA 1GXLA 5HSPA 3OL7A 2V8HA 4KR0B 3BGLA 4LIWA 1TZ0A 2BRKA 1OO0B 2H1YA 4F67A 1NJWA 4QPTA 3M8SA 1AT1B 4MMOA 3KLFA 3HVRA 4TU8A 3D3CJ 2YX1A 1WOPA 1GEHA 3DLEA 3SSQA 2ZHAA 2I2YA 1DTQA 2CQDA 4MKBA 4C8ZA 2C3UA 1K44A 4ZITA 1K73T 5GMDA 3UDCA 4CNZA 1G7CB 3CDAA 5FDLB 5HBMB 4MKVA 2DGXA 3AXMA 4KC5A 3NNAA 3PY8A 3NS5A 3AAWB 1B3TA 4LF4J 3JSRA 2XEXA 3MAQA 5K8MA 1XR5A 2HG4A 3ILOA 4MH8A 3SV3A 5FDLA 3K17A 1X4DA 3RU0A 2B9EA 3CSKA 2C1EB 4QYZJ 2XG8A 4UZCA 4QIGA 1T3NA 3DRXA 1HNZJ 3RR8A 1UA1A 4B3RJ 4UQTA 4JI8J 2X3DA 3T5HA 4J9OA 1MMLA 3DM2B 2ZZTA 2PA3A 1YITS 2PSZA 1GXUA 4JYAF 1WI8A 2JRSA 1N33J 2BABA 2EC2A 4ED3A 3WHIA 3H8YA 2XI3A 3SCJE 4X65F 1HHTP 2DNKA 1DY3A 4B3TF 3DM2A 3GU0A 4F8RA 2G2YA 2ZJQQ 2W7OA 3WX8A 3G6XA 4N5SA 3DRPB 3GG0A 2CPIA 4ZVSB 3O1LA 3ET6B 4L3NA 1VQSA 1WEZA 3MGJA 2QT7A 2ZFHA 2CPYA 2XMUA 2Z0GA 2JNJA 3HF5A 2B5JB 1PAUB 4KRWA 3K89A 3ILLA 1B4SA 1R8CA 3JQMA 1ITPA 1KLMB 1SH3A 3DRPA 4RNFA 1QTMA 1LWCA 3H7HB 4CLLA 1YI2S 4G1PA 4LF2A 2XHWA 3ET6A 5DO2A 1YRUA 1FT8A 4KGKA 4MK8A 3LGMA 4UT4A 1ZM3A 2HQFA 1SQGA 2B5JA 1JNZB 5B08A 4DN0A 1XNQJ 1T3OA 4C3KA 3SMZA 2CQ2A 1Y11A 1JNRB 4HHUA 1JXLA 2AF6A 1M1KT 4ZVUB 3U1NA 1X4HA 3UO0A 2E5HA 4N47A 6FD1A 5JMNA 1VQ6S 2MZQA 3G8SA 2Z2YB 3IBWA 2PD1A 1QD1A 4I6WA 2CPEA 2YVSA 1HNWF 2M8HA 4N8NA 2I9SA 2BACA 3CJ0A 3BM7A 1CJKA 4K4WA 2R8GA 1MWQA 4DPYA 2RRNA 1PIEA 5T41A 5KFJA 3D4JA 3EDRB 4OZ5A 5F9NA 1HIYA 3MPVA 4PG8A 4WKYA 3CJ5A 3CD0A 2Y8WA 1ZETA 3R5JB 3A8IA 5I3PA 4DFMA 3N28A 4C48A 2Z8QA 4E0DA 2V8GA 2RQKA 2KFZA 2BQRA 4WP8A 3DLHA 3PRVA 3Q2SC 4WK3A 4HHJA 3OPKA 1JLBB 4C9DA 3OUYB 1AROP 2LLZA 2WAQD 3UVJB 4PWDB 4PABA 3FEZA 1REGX 1XR7A 2J8SA 3NCRA 1UCNA 3RYLA 2KKHA 4KTQA 3HFKA 5K5MA 1BLUA 1RYSA 3NGUA 3C6UB 4OZ3A 4GKKJ 1JLBA 3OUYA 4PWDA 1RI7A 1JXEA 1U2FA 4F4WA 4LF9J 1BXNA 2ZZNA 4FBTA 1WKLA 2BJ3A 2BM0A 1CPZA 5HMYA 2A3JA 1VISA 3PCOB 2LVWA 4UY85 5BR8F 1SIZA 4RW8B 4L76A 2ZKTA 4ZIWA 5M2UA 1LW0B 2FJBB 5ETLA 4BLGA 3DLBA 4KHRA 3JXOA 2DKOB 2MGZB 2QLJB 4QR2A 1S76D 2PFDA 2OMLA 3Q23A 3G8TA 2KJWA 4ZPTR 1RT6B 3BGOP 4CM0A 4ZPBA 3AQPA 3MURP 3BKFA 3ZTPA 1VQ7S 3V81B 4CDIA 1WTFA 1LW0A 1UWBB 3K5OA 4MK7A 3R3TA 4XO0A 1TELA 2ROPA 4F4ZA 3OT9A 4ED8A 1N5VA 3CNQP 3JYTB 1K47A 4K4ZA 4DUTA 1RCXB 3V81A 3V6HA 2FIUA 2CVIA 4HT5A 3NAHA 3EVOA 2AGOA 2ASJA 1UWBA 2FDNA 1WG4A 2XNQA 5IM0A 2L9DA 2RHSB 2UU9F 4DV1F 2ZITA 5KFIA 4W92B 5AXLA 3RRKA 3JYTA 2JEIA 3KJVA 3DU6A 3CJKB 1QVGR 5KFQA 4RNMA 3PNIA 3C6TB 2MZSA 2C28A 4UW2A 1XN9A 1FJCA 3OJSA 2KT5A 2K7JA 5HVHA 3BGUA 2FJVA 2QC3A 2XSFA 4ILLA 4O3SA 5LJ5Y 1N5QA 3J7A1 2L41A 1DBDA 1IBKF 4ZPWR 4PG7A 3CJKA 4NMXA 3SBMA 4DV6J 3GIJA 2X1FA 3C6TA 1FD2A 1GTEA 3UD5A 1MSWD 3GR0A 4BC7A 3F44A 2QLXA 1SVDA 2DR8A 4DV0F 2RUGA 1YLXA 5JJBA 4NLQA 1F9HA 3PIPQ 1PGZA 5GAHI 2ZHBA 3TWZA 2OI2A 3HZEA 4B3OA 3C19A 2UXCJ 3J7YU 4DFPA 3VVUA 4CLYA 2QYCA 2AGQA 1XMOJ 4ECVA 4G1IA 1WELA 4EO6A 4USVA 3G6YA 1TFWA 2MSSA 3RBZA 2V4JB 2D74B 4I4BA 4DCOB 4WIIA 2YNFB 1RT5B 2RNEA 1IBMF 5HMZA 2Y3YA 3CD7A 1L3KA 4DWIA 1U1NA 3M8QB 4ILMA 3JQKA 1NSQA 3ICLA 3QGHA 3HPOA 3CWJA 2V4JA 1C4CA 3FSYA 4NXMF 1VBXA 3BPDA 2YNFA 2BOAA 3MR6A 3W62A 3D1HA 3RTVA 1U09A 3O8WA 4IR9A 4L75A 5KFNA 3M8QA 1I1GA 4RNOA 2XQCA 2XY6A 3PR5B 2ZZMA 1B99A 1LOUA 4Y3CA 7AT1B 2EKNA 1S1UB 2KO1A 3TAQA 1WACA 4KKOB 3HHKA 1WC6A 3UPFA 3L95X 2QFJA 3C16B 3S1TA 2BXJA 1WC5A 4CO0A 1WD6A 3PFEA 4UQGA 4QCLA 4AD6A 1S1WB 2E5LJ 3I56S 4F25A 2E1AA 4DOZA 2ZWOA 1S1UA 2LEAA 4LF6J 3TJ9A 1U1MA 3TZWA 1U26A 3DGVA 1N54B 4KKOA 1S7HA 4DN9A 4J9RA 3C16A 4RPFA 3VGVA 3W2WB 4Y00A 4AYBD 5CD4H 2MZ1A 1KTQA 5E3QA 3QRQA 2YH0A 4DQIA 2HHTA 2VASA 1S1WA 4QIEA 3LP0B 5HAOA 1YKWA 4QYZK 5HN0A 4CLFA 4JV5J 4F02A 5DGAA 3DDNA 3N4WA 5H9EJ 2W1BA 4YDDB 2HGNA 2JEJA 1UKUA 2D7SA 5IC6B 3T5KA 2AT1B 3O2IA 1X31C 5E33A 4X64J 1RP5A 1S6UA 3HFVA 3LP0A 2QL9B 4CLSA 1XMQF 2DRAA 2IM3A 2DBBA 2X3GA 4V1Ak 1QM9A 3FBBA 1LWFB 3O44A 2EW9A 4RW9A 4HTIA 2ZWPA 1S12A 2F4VF 1UPMB 2DNZA 5AJ3F 4CH1A 1P6TA 1WI6A 1KOOA 1JB0C 1J5EF 1E6YB 4DX8H 2HS4A 2OJ3A 4TYBA 1LWFA 2IDEA 5LSOA 3IWXA 1LXNA 1BUXA 2R2TA 3CVKA 1F3VA 4ZCMA 5K8NA 3WIUA 2OIHA 3MXHP 5DG9A 4WU3A 1U0SA 4GVBB 1Z1ZA 1T8EA 4WK1A 3H20A 4NA3A 2UXDF 1E6YA 3HT0A 1SJQA 3MCSA 1ELOA 4M1KA 2V94A 2CVEA 3EZOA 3MMAA 4DBQA 2GC8A 2DNNA 3M05A 2GV1A 4KHMA 2KYZA 2FVPA 3GE9A 3Q8VA 2H3EB 3NS6A 4GVBA 3HHLC 1TK0A 3RG6A 3I32A 2B56A 1S48A 4E98A 3BO2A 3KDOA 3ZZUA 4ELTA 4FF2A 3CTRA 4WU2A 4FYVB 1TK8A 2YBVA 2IY5B 3Q2TC 3T9NA 3T5LA 4J37A 3R7SB 5J1NA 3JTOA 1FVQA 5SUHA 1XJWB 1V3RA 1FX4A 3IAS9 4QIWD 1KP6A 2BR0A 2LU1A 3AQOA 3N79A 2X7IA 2QLBB 5CA5A 3KKFA 1AUSL 2YQ3A 2NS1B 2WONB 1NRKA 1RADB 1FRJA 4C8OA 3H4BA 4IUFA 2AIRB 1JLQA 4P7VA 1HNXF 3BR9A 1HLWA 3DDKA 1TUWA 4JB8B 5J1PA 2W9BB 4DSFA 2WONA 1FKAF 1FX2A 4NLWA 3A13A 3K8VA 3MPYA 1B0PA 3DOKB 2B9YA 2OTJS 3D6TB 3K5LA 2HK2A 2G13A 2M3DA 4BC9A 2W9BA 5A0YA 1ZA1B 4YB1P 3UE2A 4ALZA 2HAFA 1VC0A 1RDRA 2XYPB 5EX3A 2MJNA 2K06A 3QAEA 2X1BA 2IJFA 2V9WA 4Q45A 4X4SA 1PJ7A 4C6AA 1PCAA 3OQ2A 3MTJA 4NLTA 4TKTA 3GG1A 2KM8C 1X60A 3ZTSA 1ICEB 2GFFA 3C3LA 1U6FA 3J7Z5 5CQGA 3W7BA 1HD1A 1CEZA 3LOUA 3OV7A 4WTYA 1CQMA 3UI3A 2EI5A 1XERA 2QMUB 3MPDA 3THVA 3KLHB 4EZ9A 3DNCA 2LFVA 5IOLA 1N0VC 5DLGA 2Q6BA 5L1KA 2DTJA 1DZ5A 5F8JA 3UNGC 4C3LA 1URRA 4ZPVR 1LK7A 3KJNB 2IBKA 3CT9A 4ZVPB 2ALZA 4DR6J 2J9EA 1RWKB 5H9FJ 1S0VA 3KLHA 4GC6A 1TU0B 3ILIA 5HATA 1J5OB 4PCQA 1MROA 4B02A 4AQYF 3MR2A 6AT1B 3T1HJ 4DR7J 2VFSA 2UXBJ 4K4SA 3JTPA 3IS9A 2UUCF 3M32B 2O01C 1CULB 1X0FA 4OHWA 1Q8LA 4KH0B 4LRBA 3KLEB 2KG0A 4E2FB 2PMHA 2NPIA 1NM2A 3BO3A 1NSPA 1APSA 2LEPA 4LIRA 2CYYA 1Q81T 1J5OA 4QU7A 2B8QA 2KRBA
chains in the Genus database with same CATH topology
4JV5J 5LMUJ 4YHHJ 1HR0J 3R2CJ 3J81U 4JI2J 4DV5J 5LM7E 2ZM6J 4LFBJ 1HNXJ 4NXNJ 2UUAJ 1N36J 4DUYJ 3T1YJ 4GKKJ 2UXDJ 4LF5J 1I94J 4JI6J 3OTOJ 4JI0J 3W1YC 4NXMJ 4LF9J 4LFAJ 5FLXU 4DR1J 1HNWJ 4DV0J 4X64J 1FJGJ 1HNZJ 4DV2J 4B3RJ 4X66J 2UXCJ 4V1Ak 2VQFJ 4JI8J 4LFCJ 2MEWA 2KVQE 2HHHJ 2UUBJ 2KL8A 1XMOJ 4DR6J 2MTLA 5A2QU 4RJVA 2UU9J 4LF8J 4DV1J 1XMQJ 3D3BJ 4DV3J 3JAMU 3D3CJ 5BR8J 1XNQJ 4DUZJ 2E5LJ 4DV4J 1XNRJ 2MQ8A 4B3MJ 1N33J 4PWWA 4DV7J 5IWAJ 3IMQJ 1IBLJ 1IBMJ 5LMNJ 3T1HJ 4LF6J 4HHUA 4DR7J 4KY3A 4KHPJ 2UXBJ 4JYAJ 3J7AN 4NEZA 2F4VJ 5AJ3J 4DR3J 4JI3J 4JI1J 4LF7J 5IT9U 4NEYA 1N32J 4DR2J 4AQYJ 4DV6J 1J5EJ 3R2DJ 4B3SJ 4KYZA 2UUCJ 4YY3J 4DR4J 4K0KJ 1IBKJ 4JI7J 4DR5J 2VQEJ 4OX9J 4X65J 4B3TJ 4X62J 4JI5J 4LF4J 3J80U 4GKJJ 1N34J 4JI4J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JV5 J;  5LMU J;  4YHH J;  1HR0 J;  3R2C J;  3J81 U;  4JI2 J;  4DV5 J;  5LM7 E;  2ZM6 J;  4LFB J;  1HNX J;  4NXN J;  2UUA J;  1N36 J;  4DUY J;  3T1Y J;  4GKK J;  2UXD J;  4LF5 J;  1I94 J;  4JI6 J;  3OTO J;  4JI0 J;  3W1Y C;  4NXM J;  4LF9 J;  4LFA J;  5FLX U;  4DR1 J;  1HNW J;  4DV0 J;  4X64 J;  1FJG J;  1HNZ J;  4DV2 J;  4B3R J;  4X66 J;  2UXC J;  4V1A k;  2VQF J;  4JI8 J;  4LFC J;  2MEW A;  2KVQ E;  2HHH J;  2UUB J;  2KL8 A;  1XMO J;  4DR6 J;  2MTL A;  5A2Q U;  4RJV A;  2UU9 J;  4LF8 J;  4DV1 J;  1XMQ J;  3D3B J;  4DV3 J;  3JAM U;  3D3C J;  5BR8 J;  1XNQ J;  4DUZ J;  2E5L J;  4DV4 J;  1XNR J;  2MQ8 A;  4B3M J;  1N33 J;  4PWW A;  4DV7 J;  5IWA J;  3IMQ J;  1IBL J;  1IBM J;  5LMN J;  3T1H J;  4LF6 J;  4HHU A;  4DR7 J;  4KY3 A;  4KHP J;  2UXB J;  4JYA J;  3J7A N;  4NEZ A;  2F4V J;  5AJ3 J;  4DR3 J;  4JI3 J;  4JI1 J;  4LF7 J;  5IT9 U;  4NEY A;  1N32 J;  4DR2 J;  4AQY J;  4DV6 J;  1J5E J;  3R2D J;  4B3S J;  4KYZ A;  2UUC J;  4YY3 J;  4DR4 J;  4K0K J;  1IBK J;  4JI7 J;  4DR5 J;  2VQE J;  4OX9 J;  4X65 J;  4B3T J;  4X62 J;  4JI5 J;  4LF4 J;  3J80 U;  4GKJ J;  1N34 J;  4JI4 J; 
#chains in the Genus database with same CATH topology
 3T9Z A;  2UVR A;  4YHH J;  3ZZP A;  1CUL A;  1FJG F;  3G71 S;  3HVT B;  3NS7 B;  1IBC B;  1RWM B;  3KLE A;  4RR5 A;  4Z7Y A;  2VB6 A;  2CQC A;  3CCJ S;  2C2R A;  4FPI A;  3RJM B;  4U7U K;  1TAU A;  2HLT A;  4FF3 A;  3U02 A;  3H59 A;  5B0A A;  2ZJR Q;  4QIF A;  2ZH3 A;  4X4T A;  1RJJ A;  2IPO B;  4NOH A;  1VRU B;  4KIA A;  3HVT A;  2FLN A;  2IYG A;  1YJV A;  2CAJ A;  2QGF B;  5D8H B;  4ECY A;  4Y2A A;  1Q4R A;  4IDK B;  3QBC A;  1U7L A;  3ISZ A;  4WFY A;  4LSZ B;  2V0N A;  2B8P A;  3VAL A;  1R0A B;  2Y1L B;  2QFI A;  2KT2 A;  4ECR A;  1HBO A;  4L6V 3;  4F2S A;  2GML A;  3VAJ A;  5J2N B;  2J0X A;  3W9J A;  4LF4 F;  2XMK A;  2GS8 A;  2MMY A;  4IFV A;  3QFW A;  2ERR A;  2FJW A;  4UST A;  4IDK A;  3RB6 A;  2AV5 A;  2IBO A;  2J76 E;  2DGS A;  3BRE A;  2DEI A;  2V2Q A;  2CPX A;  3C14 A;  4U95 A;  4G1Q A;  3IG1 A;  4JI2 J;  2HZV A;  5J2N A;  1HNZ F;  4USU A;  1RKJ A;  4B3R F;  1R8H A;  4JI8 F;  1YTY A;  3R1H A;  4RKU C;  2YWH A;  3R6L B;  2CQ1 A;  2OD4 A;  1CJU B;  1PAE X;  2AQ4 A;  2MY7 A;  1N33 F;  5D77 A;  5B0F A;  4YN3 B;  2WB1 D;  4ZLP A;  4TVA B;  3VAI A;  2HQC A;  4F0H A;  2RJZ A;  3P8B B;  4PPD A;  3W63 A;  2R7W A;  2HNY B;  2IJN A;  4USK A;  2GVD B;  3VGS A;  1ZBT A;  2AYB A;  1L3U A;  3IGV A;  3HT3 A;  4YR0 A;  1C1C B;  1CJU A;  2HAI A;  1RLD A;  4X2B A;  4P73 A;  4C4W A;  2ZBP A;  4X4O A;  4ZP6 A;  4OZ1 A;  3VAF A;  1RWU A;  1RBA A;  2HNY A;  4IQX A;  1FXL A;  3MCO A;  3ZFV A;  2N7C A;  2GVD A;  2UV8 G;  2GHW A;  2HYI B;  1KFD A;  2CQG A;  5HJX A;  4ZVE A;  1NUE A;  4HVZ A;  2AZ3 A;  2WTF A;  1C1C A;  1SBR A;  2U2F A;  2D3U A;  5KFT A;  4HI2 A;  1VGY A;  1VFJ A;  2L3M A;  1PC4 A;  1M1H A;  3W5X A;  3NNC A;  2XY5 A;  3SV4 A;  1HQE B;  1R6Y A;  1X5P A;  1W7W A;  5ETQ A;  3GII A;  1REV B;  4DCJ B;  1XNQ F;  3R5C A;  2K3K A;  2RQC A;  2VIH A;  3F0N A;  2QN6 B;  4WE1 A;  4A8W A;  2BE7 D;  1OQ6 A;  8ATC B;  1Y5N B;  4HDH A;  3UQS A;  1XNR J;  2LXI A;  1WC3 A;  4Q2L A;  1W2B R;  1HQE A;  3GIR A;  1FFG B;  3MUV P;  2FPH X;  4F26 A;  2KZM A;  1REV A;  2ZKU A;  1WHW A;  4WIQ A;  5H9E K;  5KFY A;  3EZU A;  1NHU A;  2P6T A;  3HD2 A;  3RGI A;  1KVI A;  5J2Q B;  4R0E A;  4DF4 A;  2QX0 A;  5LXR A;  4X62 J;  3IM8 A;  5F3Z A;  3CUN A;  1HQU B;  3PRD A;  1OS5 A;  4O3P A;  2I5J B;  5L1J A;  2RDD A;  2VHG A;  2XLJ A;  3I0R B;  1J27 A;  1TR0 A;  1FNM A;  5KFE A;  3V2U C;  2ACM A;  1X5T A;  5JVH Q;  2VUG A;  3HFZ B;  2JFK A;  4ENO A;  5J2Q A;  3AOA A;  4ED7 A;  3DXB A;  2ASL A;  3FRY A;  2PMW A;  4NA2 A;  2ZVI A;  2FVC A;  1NSA A;  3NY0 A;  1WG1 A;  3X1L B;  1WSR A;  2I5J A;  3HDS A;  2EFO A;  4OI4 A;  3LPE A;  4ZN1 A;  4BWM A;  1CJV A;  4F0M A;  3CD6 S;  1Q0N A;  4M5I A;  1IBL J;  4J9K A;  2IA6 A;  1IR0 A;  4HLB A;  2RU3 A;  2HVE A;  4A47 A;  1YWX A;  2VA2 A;  1RWW B;  2VG5 B;  1UW9 A;  4NCA A;  4CIO A;  5F8N A;  4MTP A;  2VPY B;  1Q1K A;  3GLJ A;  1T9X A;  3KHR A;  1TQL A;  4B08 A;  4WF9 Q;  3LTO A;  3R9L A;  2JSX A;  3EPI A;  3O6Q A;  4LF9 F;  3VAM A;  3H25 A;  4RWX A;  1TL4 A;  2DNY A;  2R42 A;  4DV5 J;  3EMT A;  1IQT A;  2HK3 A;  5KFR A;  2BQU A;  1PYS B;  3MEC B;  4URG A;  2FGO A;  2FHJ D;  2VG5 A;  2R8J A;  3B4D A;  3WC2 A;  2EFG A;  4USI A;  3B6B A;  4LFA J;  2CFX A;  1M1G A;  3CED A;  3TAP A;  4MKA A;  1NND A;  5C42 B;  1U1L A;  1BY9 A;  3I5B A;  4JV1 A;  5CYJ A;  3NG8 A;  2EG2 A;  3QT8 A;  1D8Z A;  2J9D E;  3FEY B;  3LA0 A;  1NME B;  1SJ3 P;  2AX0 A;  4IO9 Q;  1GH8 A;  2FLL A;  1TL7 B;  3MEC A;  3ZZZ A;  2MKK A;  4FKX A;  5GAE U;  3A8E A;  4J9N A;  4KAI A;  4AL7 A;  2M52 A;  1RT2 B;  4CWB A;  2HGM A;  2ZC4 A;  3ISN D;  1O51 A;  1KQK A;  1TUV A;  5C42 A;  4NLU A;  3GFY A;  1I5O B;  4X4U A;  1Q95 G;  1WEX A;  4PXE A;  1F1B B;  1F2H A;  5MLC V;  3BF4 A;  1TL7 A;  1WWH A;  3E51 A;  1ZZF A;  4YY3 J;  1U8S A;  4P2X A;  3H4D A;  3PO5 A;  1MWY A;  2B4U A;  3BEG B;  1RT2 A;  1FEH A;  3GYG A;  3BQ0 A;  3B78 A;  5K8P A;  3SQG B;  1RAE B;  3BO4 A;  4OYZ A;  4Y2K A;  3FEX B;  4ZP7 A;  4OMF G;  3PW7 A;  3SI8 A;  4DUY J;  3AFG A;  4LF5 J;  4JI6 J;  3EGV A;  5F8M A;  2MPU A;  4DS5 A;  2LEC A;  5AT1 B;  2AJ4 A;  5KFH A;  5DG8 A;  5LSR A;  5AXK A;  3SQG A;  2C2O B;  1IKW A;  1V5I B;  4XPE A;  3DKD A;  3DRS B;  4A8Y A;  2P5V A;  3MFH A;  4WXO A;  3M30 B;  2HRU A;  5E7O B;  1U24 A;  3DFE A;  2E9R X;  3ITH B;  3H5S A;  4DV6 F;  2RDJ A;  3L3C A;  1UL3 A;  5DLF A;  3BR8 A;  3HSD A;  4LR7 A;  3SCI E;  2AMC B;  3I5C A;  4FYD A;  3ETO A;  3POT B;  3MR7 A;  1H73 A;  1R6V A;  3RZA A;  4JI1 F;  3DLJ A;  1T11 A;  3HHL B;  4CI0 B;  1YRX A;  2BMB A;  3VVT A;  1KFS A;  1HWK A;  5A6W A;  1UA0 A;  3CJQ A;  2XZW A;  2HQ3 A;  3I5A A;  1NK4 A;  1SJ1 A;  4CLP A;  2VDI A;  3FBE A;  4PPZ A;  2NXJ A;  1TKX A;  3ENV A;  3POT A;  3A3O B;  2UXC F;  1GMV A;  4QWB A;  2W9C A;  2PI5 A;  3K5P A;  1YZ7 A;  3JSY A;  4OYW A;  5H9F K;  1XMO F;  1YJU A;  1R0C B;  1T0T V;  1GAO A;  3MM8 B;  3QT6 A;  2R7S A;  3MCM A;  5CYM B;  4AFF A;  4LQ9 A;  2D9P A;  1S1V B;  4UF4 A;  1TUG B;  3FCH A;  2OP5 A;  3G8Q A;  4OYX A;  3R5A A;  4CO5 A;  4J9S A;  1JLG B;  3OTB A;  2WSE C;  1BQX A;  2ASD A;  3IRW P;  2CRL A;  3MM8 A;  1X8D A;  1EIY B;  1LV5 A;  2R7O A;  4OYB A;  4DR3 J;  3QO9 B;  5CYM A;  2FD2 A;  2CNL B;  3WIV A;  4XIU A;  4U96 A;  1S1V A;  3V6J A;  1R89 A;  4ANC A;  3I4H X;  1WF0 A;  4N77 A;  2HBZ B;  2HUR A;  3M2R B;  1JLG A;  3CCR S;  1NK0 A;  2RML A;  2ZH7 A;  2Z4P A;  5B09 A;  3BSO A;  3OL8 A;  1LW2 B;  5K14 B;  4M5K A;  2ZUG A;  1MMN A;  3QO9 A;  1HNV B;  3HLU A;  3AB2 B;  5E3C A;  1HKA A;  2LQ9 A;  2MKC A;  4JI0 J;  2OPS A;  1VBY A;  5G4D A;  4LBP A;  4NRT A;  2OKQ A;  5BYR A;  4BHQ A;  2L9W A;  3R8Y A;  3M2R A;  3O5T B;  3JS9 A;  4PKD B;  5AXM A;  1A6L A;  1LW2 A;  3TUZ C;  4DXL A;  3TQ1 A;  3BH7 B;  2V8D A;  2KM8 B;  4LF6 F;  2MST A;  2FC8 A;  3BYR A;  4BDP A;  1HNV A;  2PO4 A;  2GAG C;  4EWT A;  4JUZ A;  2ZBC A;  2RAQ A;  4UUX A;  3QJJ A;  2QA2 A;  2VIC A;  2WSC C;  2CPZ A;  3KK2 A;  2BDP A;  3KMS A;  5JUM A;  3Q8U A;  2MLY A;  2OSQ A;  3DGP B;  4RX6 A;  2CJQ A;  4JV5 F;  4KYZ A;  3M2V B;  3TVK A;  5HRO B;  1FHT A;  3OJU A;  3QAU A;  3G86 A;  4NL5 A;  2RUS A;  4DPW A;  4NLV A;  4WCE Q;  4O4R A;  1T9V A;  4X64 F;  4A48 A;  2E29 A;  1X4E A;  3DGP A;  3TJ8 A;  1ZTW A;  3M2V A;  1QAX A;  2F9D A;  5HRO A;  2FY1 A;  2DH9 A;  3BKT A;  2IM2 A;  3PG9 A;  2WVE A;  1VQ4 S;  5KG6 A;  2KHD A;  3TAM A;  1KQS R;  4ZCK A;  1NKC A;  3IXQ A;  4K4V A;  3US5 A;  1NAQ A;  2B4V A;  3PTW A;  3MAA B;  3TZX A;  1W25 A;  3I9V 9;  4ID5 B;  1VQL S;  4F3O A;  3LP1 B;  1NSK L;  1S10 A;  2FY8 A;  3Q8Y A;  1YJ9 S;  4ECU A;  2H4Y B;  3IN5 A;  1RT1 B;  3MMB B;  1DUR A;  4C8N A;  1V9O A;  2ZJP Q;  5C2G A;  5KTQ A;  5DET A;  3MAA A;  2Z2Z A;  1RSC A;  3BB5 A;  4ID5 A;  3LP1 A;  1GT8 A;  1S7I A;  3FGV A;  2AJ2 A;  2JDJ A;  4IQM A;  4WJB A;  2EFP A;  5I4M A;  2V8P A;  1WUU A;  1YDL A;  2PE8 A;  1C0U B;  1KSP A;  5ADZ A;  2B51 A;  1RT1 A;  1D9F A;  3MMB A;  1TL3 A;  4HKQ A;  2QZ8 A;  4EUV A;  3K5M A;  3E01 B;  3M6U A;  3DLG A;  2DT9 A;  1XWL A;  5U47 A;  1NPR A;  3WQP A;  4QPX A;  2QSF A;  1RAB B;  4WZQ A;  3W9I A;  4A8O A;  3I4P A;  2WRM A;  2GHP A;  1VRQ C;  5BJR A;  2LDY A;  4RUC A;  1HWJ A;  5GMK a;  2RQ4 A;  1C0U A;  4YOE A;  1YJN S;  2XNR A;  3HP6 A;  3UD3 P;  4B9U A;  1PC5 A;  3MM7 B;  4DL0 C;  2HHH J;  4OV6 A;  2HND A;  1XMB A;  2N4C A;  4CLU A;  3TEG A;  2HNZ B;  5KFO A;  4AT1 B;  1H3D A;  5HQL A;  5M2P A;  4K4U A;  4EU0 A;  2ZH4 A;  1R7I A;  1IBM J;  1VI7 A;  1AW0 A;  3GR1 A;  4TQR A;  1Y00 A;  2WVC A;  1VR6 A;  2F65 A;  3DLK A;  3KFW X;  3MM7 A;  2FZG B;  3CCL S;  1UPP A;  3VQT A;  3SFU A;  3DOM B;  5B0D A;  3ZZY A;  3NMR A;  4USM A;  2BUN A;  3RUB L;  3V5R A;  4MIW A;  4AL6 A;  2IFX A;  4AXI A;  2WCX A;  1HR0 J;  5E2Q A;  2ZM6 J;  2EK6 A;  2CUY A;  3SDE B;  3L09 A;  1I6J A;  1VK8 A;  4P2F A;  4NXN F;  5ETK A;  3CDU A;  3Q8Q B;  3G4S S;  3ZZR A;  1X7V A;  4U67 Q;  2C3Y A;  2DHX A;  5AE1 A;  4HH1 A;  5F8G A;  2OD6 A;  3R27 A;  1RTD B;  1S9F A;  1PJ6 A;  5ETO A;  2RHQ B;  3OBI A;  3TP2 A;  4NLX A;  2UVV A;  4B9S A;  1TK5 A;  5C24 A;  3PX0 A;  3DCA A;  3L7U A;  1VIO A;  3VAG A;  1R31 A;  4AXJ A;  4NLY A;  3UR0 A;  5KFX A;  3OR2 B;  1RTD A;  4ZVF A;  1XR6 A;  4A8X A;  4ER8 A;  3BYP A;  1SJ4 P;  2MDA A;  3CCE S;  3UDE A;  1QSS A;  1HBU B;  2G0C A;  3N9U C;  4O3R A;  4OYP A;  4C2M A;  1LXJ A;  1TTH B;  2E1M C;  3VWS A;  2CNK B;  2XZT B;  3T1Y J;  1U45 A;  3OR2 A;  3MZI A;  5AXN A;  4M5L A;  3M1V A;  3QLH B;  5HVG A;  3VCD A;  4DR6 F;  2HW3 A;  2HWH A;  4DV2 J;  1DRZ A;  3FNN A;  1HBU A;  3CJ2 A;  2A2D A;  2RT3 A;  2A1B A;  4C8L A;  3BSA A;  4DR7 F;  3T1H F;  2FZC B;  4CO2 A;  4LF8 J;  3TAN A;  1VS3 A;  1VJQ A;  2XMT A;  2UXB F;  2E7X A;  3NP5 A;  1PG5 B;  1KHV A;  3FK4 A;  3EPG A;  3DOL B;  2AX1 A;  4Z37 A;  2FHO B;  3QLH A;  3HJV A;  3PJX A;  1QAJ A;  3FFI B;  4FZV A;  2RF2 B;  2CPF A;  2NXN A;  1UET A;  2DGQ A;  3N5F A;  1HHQ A;  3TI0 A;  3TVZ A;  1YHQ S;  5KFP A;  4YHH F;  4R25 A;  1X5S A;  1D9A A;  5AE3 A;  2VQE J;  3DOL A;  3PKY A;  4PZV A;  1HWU A;  3FFI A;  2F40 A;  2RS8 A;  1H38 A;  5HMX A;  5KFA A;  3CPW R;  1TP7 A;  1GTH A;  5GAD I;  2LU2 A;  4DQR A;  5IC4 B;  1S6P B;  3QJL A;  3NBP B;  2DXD A;  3OD2 A;  5KT3 A;  2WW8 A;  1NK6 A;  5ETR A;  4NYZ A;  2B9W A;  4I69 A;  2CG8 A;  4P75 A;  4PWU A;  1P27 B;  3D6M B;  2JZ5 A;  2DNH A;  2F3J A;  2POK A;  4F3M A;  2V8V A;  4DV3 J;  2AJ0 A;  4KO0 B;  2CQH A;  3LAK A;  4DUZ J;  3NBP A;  1CVJ A;  2WBM A;  1LFW A;  2M88 A;  4B9N A;  5G0R B;  3M6W A;  2QO3 A;  2H65 B;  1C4A A;  3LWL A;  4CO3 A;  1RA7 A;  1T95 A;  2RH3 A;  3TYT A;  2Q1L A;  7FDR A;  4KH1 B;  4RW6 A;  4YR3 A;  5KG5 A;  2R8I A;  3W2V A;  1VQN S;  4KO0 A;  5HAN A;  1MU2 B;  4Q7A A;  2DK2 A;  4JI2 F;  4JI7 J;  4P52 A;  1SH0 A;  2IYI A;  1OYD A;  3M8R A;  3KUE A;  3MAH A;  3P6Y C;  4DG1 B;  2NQP A;  3CXC R;  2AD9 A;  5KOW A;  2HRT A;  1S79 A;  1MU2 A;  2O67 A;  3K0J A;  2AZ1 A;  4G6V B;  1FRK A;  3Q8P B;  4ED2 A;  4NLD A;  1FO1 A;  2IAJ B;  5IZH A;  2J0S D;  1Q8K A;  4DG1 A;  3PEJ A;  4K2X A;  3KG4 A;  3CME S;  3PJW A;  1WSV A;  4OYM A;  1X4C A;  3CCT A;  1PKU A;  1OPI A;  3C46 A;  2ZUA A;  5GVQ A;  1S0M A;  2IDL A;  3G6V A;  1BQN B;  1UVJ A;  2ZE2 B;  3CF5 Q;  2XTJ P;  2IAJ A;  4ZKA A;  5HP1 B;  3UD4 P;  1K9M T;  4NE9 C;  3HVA A;  1RWX B;  4W4M A;  2HFO A;  1AB8 A;  3E8O A;  3AY0 A;  3K8W A;  1UVN A;  2WOM B;  1EHW A;  3I0S B;  1BQN A;  2IMO A;  2ZE2 A;  2PMZ D;  1Y7P A;  2C2N A;  2ZOF A;  4GRS A;  5LM7 E;  1SPB P;  2O66 A;  1K8A T;  2KFN A;  1L3S A;  5D15 A;  2LDI A;  3KK1 A;  2QG9 B;  1D09 B;  4ZVQ B;  2K1R B;  3HVW A;  4J9L A;  3BQ2 A;  1XNR F;  3I0S A;  4I6Y A;  3BDE A;  2MHN A;  2KJV A;  4JBC A;  1I3O B;  1A7G E;  5DDP C;  1HW9 A;  2Z57 B;  1GMW A;  2VDH A;  3PYE A;  4OI0 A;  1BQM A;  1U1Q A;  1SC1 B;  2K1R A;  2HFV A;  1W26 A;  4MYU A;  3OHB A;  1FXD A;  1N56 A;  2HWI A;  3J7Z T;  1QUP A;  3EGW B;  1UVK A;  4X62 F;  2CKW A;  5LL6 d;  2AW0 A;  1XQI A;  3T6B A;  1UVI A;  4M95 A;  4DR5 J;  4PXC A;  4NLG A;  3KUG A;  5KG3 A;  1VDH A;  2O3D A;  1NKB A;  2L9N A;  3P45 B;  2VFU A;  5KFV A;  3MR3 A;  4NWB A;  2HFN A;  4JV0 A;  2QA1 A;  4DQP A;  1EKS A;  4WBF A;  2M5Y A;  2QYG A;  1IKX B;  5HL7 Q;  3RR7 A;  2VG6 B;  4DU8 A;  1KLN A;  1ZZN A;  3FRZ A;  1X9W A;  3I31 A;  2BM1 A;  3GIL A;  3LP2 B;  4CH7 A;  3R5G A;  5LOQ A;  1WDT A;  1SJF A;  4RO0 A;  2U1A A;  1IBL F;  1U47 A;  2BJD A;  2XWY A;  2R2R A;  3ISN C;  2IA0 A;  1RAA B;  4FF4 A;  4ZJQ A;  2YY3 A;  1IKX A;  1Y0H A;  2VG6 A;  2HHX A;  2GO8 A;  1AA1 B;  2IRY A;  2OH2 A;  2UVW A;  1U6Z A;  3IR7 B;  1S1X B;  3LP2 A;  2CJ9 A;  3NWR A;  3NL0 A;  3TQE A;  2YWE A;  2DIV A;  2I1R A;  4QW9 A;  1CS4 B;  3FZB A;  1RT3 B;  5HBM A;  3UNY A;  1PYT A;  4DV5 F;  1YBT A;  5CCM A;  1X4G A;  3H42 A;  2WBR A;  4LFA F;  2OPP B;  3NCP A;  1YK9 A;  2D3O R;  3EXC X;  2QMX A;  5CYQ B;  5DM6 Q;  4B9L A;  1LEO A;  4MKY A;  1BE4 A;  1SC4 B;  2ZC3 A;  1CS4 A;  3E2E A;  3B54 A;  1RT3 A;  2HKE A;  3KTQ A;  5EWG A;  1KBR A;  4F4K A;  4UTG A;  1KVJ A;  1N5S A;  4LFC J;  4XDD A;  1NPK A;  1SXL A;  3CJR A;  3MM6 B;  3HUL A;  2OPP A;  4M5D B;  3RBX A;  5ETV A;  4QYR A;  5CYQ A;  3D3B J;  2M70 A;  3DHX A;  1O5J A;  1JMT A;  3HZG A;  1HAR A;  1FRL A;  4LSN B;  1WC0 A;  5FJ4 A;  1UP1 A;  2D9O A;  4YY3 F;  2HMI B;  4JV2 A;  1B7Y B;  4RZR A;  3GV5 B;  3MM6 A;  2JVO A;  5IT9 Y;  2V67 A;  1RZM A;  1RAH B;  2ILY A;  1AYE A;  3AH6 A;  3VAK A;  1OIA A;  3QNW B;  4DUY F;  5F41 A;  4LF5 F;  4JI6 F;  2VOO A;  4DMZ A;  1P9Y A;  1SUQ B;  1UJ6 A;  3CO9 A;  2KVI A;  2E7W A;  2HMI A;  3NWG A;  1N36 J;  1S59 A;  4I7F B;  3JSB A;  5GME A;  4DU7 A;  2WSF C;  2W4P A;  4C8K A;  4W98 A;  1M5H A;  4KPC A;  3H0P A;  2XGP A;  3D2W A;  4Y2I A;  1UMJ A;  4DQQ A;  3KLV A;  3PW2 A;  1KLM A;  3SSS A;  1NHV A;  4HEA 9;  1H7W A;  3NAI A;  2PDA A;  2MTL A;  1TKT B;  1RT4 B;  1JIH A;  1EP4 B;  1PBU A;  3D6F B;  3TO8 A;  2JL9 A;  5KFM A;  3LGN A;  2BA9 A;  3RAM A;  2EBE A;  2PC6 A;  4PUO B;  2B7B B;  1TL1 B;  2G0J A;  4DR2 J;  3ZZ0 A;  3CW2 C;  1RT4 A;  4FYX B;  2BRL A;  2YWG A;  3WC0 A;  2N3L A;  1EP4 A;  1QTN B;  2IMW P;  5KFB A;  2E5G A;  3QQC D;  2BOP A;  3MEG B;  2DD8 S;  2PII A;  4MT1 A;  3FSX A;  4OYI A;  1U0H B;  4TN2 A;  3DYA B;  3GV7 B;  1H0H B;  4PUO A;  2NUH A;  3FCW A;  4RNN A;  3H90 A;  4ED5 A;  2KI2 A;  1TL1 A;  1RTJ B;  2MQP A;  2XS2 A;  3JSM B;  3J81 Y;  2Z30 B;  2VL1 A;  5D0G A;  1EAY C;  4ZPD A;  2YKO A;  3MEG A;  1WC1 A;  1KR4 A;  1U0H A;  2DH8 A;  3UN5 A;  1D9D A;  4FF1 A;  1H2T Z;  4CCH A;  3OLA A;  1GK8 A;  2XSJ B;  1RTJ A;  4K4Y A;  3JSM A;  2OFH X;  4DR3 F;  2YWK A;  4DV7 J;  3SSR A;  3DMJ B;  2CDQ A;  1OY6 A;  1Z2L A;  2DGW A;  1D0E A;  4JI3 J;  2H54 B;  2HVI A;  4LF7 J;  2W24 A;  1E6V B;  2F7V A;  4FP9 A;  2W4C A;  4B3S J;  2XSJ A;  3GCW P;  4F4A A;  2H5I B;  1S5Z A;  4EO8 A;  4J5O A;  1R8A A;  3UVJ A;  1BGX T;  4GMK A;  4QOT A;  4USJ C;  3QPI A;  4TY9 A;  1WKK A;  1Q7Y T;  2K7K A;  3LGH A;  4WYW A;  4WFA Q;  2VBZ A;  4JI0 F;  5DQI A;  4NZ0 A;  5KFW A;  3DMJ A;  1IVZ A;  5EN1 A;  2OEM A;  3AT1 B;  1E6V A;  3KYL A;  2W8L A;  2BKP A;  2MZJ A;  1V6H A;  3C6U A;  4EBD A;  2AJQ A;  2LEB A;  3NGR A;  4S0M A;  3D9B A;  2D69 A;  2F8E X;  4I2Q B;  5KT7 A;  2VON A;  4JP8 A;  4DL4 A;  1LFP A;  4WZM A;  2QL5 B;  4KGV B;  2HRY A;  4RW8 A;  4X4P A;  1S9G B;  5CAB A;  1VYA A;  2ZBQ A;  4DV4 J;  5KAK A;  3VQS A;  2XO6 A;  1YGY A;  3H5X A;  3CJS A;  5LMN J;  2MGZ A;  4I2Q A;  2V6A A;  1SCJ B;  1RT6 A;  1WKJ A;  4Y6I A;  5JVG Q;  1FF2 A;  2P9G A;  2HFZ A;  4A8S A;  2DHS A;  5E3R A;  2V4R A;  1WC4 A;  1S9G A;  4ELU A;  1HL6 A;  1IKY B;  2YKA A;  3TX0 A;  1SKU B;  1VC6 A;  4URQ U;  1Q8B A;  2E44 A;  2FJX A;  3OTE A;  2Z2M A;  3ELH A;  4M8L A;  1U4B A;  4FVC A;  1PSD A;  3J80 Y;  4ZCI A;  5KFZ A;  2HHW A;  2A18 A;  3OR1 B;  5KT6 A;  3TZY A;  1MWZ A;  5KFS A;  1U1R A;  2O5D A;  3M6X A;  2GX8 A;  5ETP A;  1UEU A;  3MF5 A;  4LRF A;  4P10 A;  1HFE L;  2R7U A;  1TVR B;  4OYA A;  3PHE A;  2JOQ A;  2N4D A;  4USH A;  3MI7 X;  3OR1 A;  2EFV A;  3KOA A;  2GQQ A;  3A1Y G;  1SC3 B;  3WBZ A;  3HSZ A;  1ZAX A;  4EFA C;  2ZH9 A;  4EK2 A;  4CO1 A;  4ZA1 A;  1JLE B;  3UCZ P;  1FK9 B;  5HLF B;  2YKQ A;  1TVR A;  2VC0 A;  3PDN A;  2GHV C;  4JI1 J;  3P49 B;  4DPU A;  4NEY A;  1GFW B;  3GYN A;  1N32 J;  1RTI B;  3KG1 A;  2B43 A;  5DRK A;  1ZAW A;  4KGM A;  4WFN Q;  4F2R A;  4X4R A;  4LMZ A;  3BBC A;  2YKN B;  3W8P A;  3PEH A;  1GQE A;  1N4L A;  5C5J A;  4JI5 J;  3D1Q A;  2OGU A;  2HHV A;  5L8R C;  5IV3 A;  3OXG A;  4DHV A;  2F1F A;  4AE5 A;  1JLE A;  1QDU B;  2MQL A;  4M94 A;  1FK9 A;  3J7Y I;  3PXG a;  2V4Q A;  1HW8 A;  1RTI A;  4D3H A;  3GZ7 A;  4ED6 A;  4OX6 A;  2HHH F;  1KD1 T;  1RAG B;  4DX5 A;  1F5A A;  2W8K A;  4X66 J;  4J7C A;  1AFJ A;  4F7V A;  4OX7 A;  2I0X A;  3OL9 A;  1VCT A;  3CC7 S;  3KHL A;  2G2O A;  4M5J A;  1FES A;  3OVA A;  3MM5 B;  2CQB A;  5HI7 A;  1G1X A;  2KZZ A;  2V2V A;  5LJ3 Y;  4BS2 A;  2VBW A;  4K5R A;  4HH0 A;  1CQN A;  3MWB A;  5J2M B;  5IT9 U;  2E9Z A;  1IKV B;  5B0E A;  1S6O A;  1RT5 A;  2PN6 A;  3OVB A;  3MM5 A;  1VHF A;  3W5Y A;  1HR0 F;  1JJ4 A;  4O3Q A;  2ZM6 F;  4LRE A;  3I55 S;  4YEA A;  1KOH A;  4TU7 A;  1BMQ B;  1QE1 B;  2ROE A;  3OVS A;  4MJK A;  2A6M A;  4LSL B;  1O0P A;  2W25 A;  3R2C J;  5J2M A;  4PYA A;  2YQ1 A;  1IKV A;  2BE9 B;  5MAO A;  4P71 A;  2DXF A;  2H51 B;  4P6Q A;  3NRB A;  3GFZ A;  2VOD A;  3TA2 A;  2XLK A;  2EG1 A;  3RBE A;  4Y2C A;  2OSR A;  4WXW A;  1QE1 A;  3QZ8 A;  5FD1 A;  4LSL A;  3H2U B;  3IGN A;  3EVW A;  3K7R A;  2G4B A;  4A8Q A;  1RIS A;  2NZ4 A;  2FLO A;  2OAU A;  2HZC A;  2DNQ A;  9ATC B;  3VHQ A;  1FE0 A;  2V2Z A;  4CH0 S;  5CD4 A;  2C22 A;  3IRX B;  5D4O A;  2ATC B;  2QJ3 A;  1JLA B;  2QL7 B;  4I1T A;  4YR2 A;  2HHP A;  1ZYQ A;  4OHV A;  3DRY A;  2E7V A;  3EIC A;  1M90 T;  5L9X A;  2MKJ A;  1B64 A;  1LKZ A;  3W2W A;  2M4M A;  1K0T A;  1X0P A;  2MQN A;  3BS9 A;  3IRX A;  1F5C A;  3T1Y F;  5A8W B;  1VBZ A;  2UUT A;  1JLA A;  2A10 A;  3A12 A;  3J81 U;  1B0T A;  4P9S A;  1UJ4 A;  2G2Z A;  4DV2 F;  3HCX A;  3ILJ A;  4QIV A;  2HQI A;  3FMW A;  3B4M A;  5A8K B;  5EHH A;  1L3V A;  2ZD1 B;  2B4O A;  2KN4 A;  3K5N A;  2VKR A;  3AA9 A;  3M9O B;  3FUY A;  2CAD A;  4LF8 F;  2IRX A;  4C98 A;  5A8W A;  2VQF J;  4QWE A;  2WZ1 A;  2DH7 A;  4J9V A;  3TOQ A;  4RW7 B;  1RU2 A;  2GCF A;  5IQ6 A;  5KT4 A;  1MN7 A;  1CSJ A;  1KDN A;  3IO1 A;  2YKP A;  5I3Q A;  1N5Y B;  5A8K A;  3AXK A;  2X51 A;  2ZD1 A;  3IMQ J;  3MD1 A;  1UEV A;  2JEG A;  4M5G A;  2KG1 A;  1C2P A;  5EWE A;  3FCV A;  2B6A B;  2VQE F;  2AP6 A;  4Q44 A;  3IFE A;  4RUB A;  1W2I A;  1XK8 A;  1N5Y A;  2V50 A;  3H5Y A;  4C7Q A;  2HHS A;  4ELV A;  3PV8 A;  1FI4 A;  3FZ2 A;  3GB0 A;  4JI4 J;  2WHO A;  3NLC A;  4IG0 B;  3PO4 A;  1A9N B;  1N5T A;  2B6A A;  2NXU A;  2AYM A;  4CQ1 A;  1RHR B;  2ZH8 A;  1X9S A;  3A8J A;  2M2B A;  1JLF B;  3PJ9 A;  3QWU A;  5C2C A;  4OJ3 A;  4DV3 F;  1QJH A;  2XMV A;  4ANE A;  2QA4 G;  2C2M B;  1FDD A;  4DUZ F;  4V19 J;  4CO4 A;  2FQQ B;  5DDQ C;  2MKI A;  4ICL B;  4RLE A;  5DZ7 A;  1R8B A;  1RLC L;  1WF2 A;  3M4X A;  1OMS A;  1TV6 B;  3ETM A;  2HQG A;  1JLF A;  4C97 A;  3VZI A;  1RHK B;  3SXL A;  2FYX A;  2KXF A;  1ZAV A;  4JI7 F;  4L3K A;  2FTR A;  1IM6 A;  1VK3 A;  2CJX B;  2DR7 A;  1K1S A;  2RIL A;  2MZR A;  5T14 A;  1K1Q A;  1HA1 A;  2EFQ A;  4UOF A;  3G9C A;  4Q43 A;  1FEE A;  4ICL A;  3M6V A;  1PBA A;  4TU9 A;  1RGV A;  4NLO A;  4DL5 A;  1OSD A;  1TV6 A;  4HI1 A;  4HDG A;  4CYU B;  1RE1 B;  5E41 A;  2C2K B;  3J80 U;  1N34 J;  2DR9 A;  2CJY B;  3BN7 A;  3AJD A;  3MEE B;  4QWC A;  1RT7 B;  4NXN J;  1RWO B;  2IM1 A;  4RU2 A;  4QW8 A;  2ZBR A;  2CQ0 A;  2NSC A;  3GMG A;  3M2U B;  2YQ0 A;  1G3O A;  1UVL A;  4H4O B;  3PYG A;  4KE5 A;  1F2G A;  2AEM A;  4FPR A;  3BV8 A;  4CYU A;  3D0H E;  4FXW A;  2DNM A;  2KXN B;  4KT0 C;  3DOK A;  3K58 A;  3DLE B;  1VBK A;  4J90 A;  3TNV A;  1Y9O A;  1DTQ B;  2AWZ A;  2W4D A;  3G87 A;  1NJX A;  3M2U A;  1RAF B;  3MHY A;  2R7T A;  5LT5 A;  5L9N A;  4H4O A;  4TY8 B;  2KDO A;  1KQF B;  1DAX A;  2LYV A;  2OUG A;  1VLY A;  3MPW A;  3JB9 k;  4FS1 A;  1NB2 A;  1LWE B;  1S1T B;  3N6L A;  2RD5 C;  1U2C A;  3R7N B;  4IH5 A;  4DPO A;  1JLC B;  2ILZ A;  4ZLL A;  3SCK E;  4MIA A;  1U49 A;  1SQE A;  2Y1R I;  4DR4 J;  4K59 A;  2OEL A;  1NO8 A;  5HK4 A;  3K59 A;  3EZ5 A;  4TY8 A;  3ONQ A;  1S97 A;  1N52 B;  1Q16 B;  4ERD A;  2KFY A;  1LWE A;  1NDK A;  1D3W A;  3VZH A;  1S1T A;  2MKY A;  1IQZ A;  4DL6 A;  1JLC A;  1ZM9 A;  4G3I A;  2XCA A;  2VH7 A;  4A8F A;  2AJF E;  4OV1 A;  2ACY A;  3TZZ A;  2R2U A;  3EXY A;  2B7C B;  3D0I E;  2QLF B;  5IT4 A;  3MFI A;  5IFM A;  2MXY A;  2RU9 A;  4K50 A;  2OEK A;  2G1D A;  4DPX A;  2J6T A;  4DSK A;  1RWV B;  1VQ9 S;  4F0K A;  2I8E A;  2YWF A;  3I9Z A;  4LRA A;  5IV4 A;  2FHM A;  1WHX A;  4PWW A;  2BZ2 A;  4IKA A;  2R9L A;  1IJE B;  2UZA A;  2FLP A;  3OFE A;  1VQ5 S;  2J0Q D;  3PRB A;  1YBU A;  4I64 A;  4ZJL A;  2DIT A;  2DGT A;  4DR5 F;  1DJ0 A;  7FD1 A;  2W2Q P;  3M32 A;  1XIQ A;  5CZV A;  4ZS6 A;  3I87 A;  4QZV B;  3NNH A;  1IR2 A;  1FFS B;  5K20 B;  2A0F B;  3GIM A;  4ECX A;  4PQA A;  2CQ4 A;  1YZ6 A;  1SL1 A;  3UCU P;  5E0O A;  1BC6 A;  1RBL A;  4NYP A;  1UEK A;  1WHV A;  1URN A;  2LCW A;  1UFW A;  2VZ9 A;  1LWC B;  4J91 A;  3TUJ C;  2AEF A;  3KK3 B;  5E3A A;  2B9X A;  4RWW A;  4DSI A;  2R7X A;  3BN4 A;  3PM9 A;  5FLX Y;  3G82 B;  3GPA A;  4XK8 C;  2XC9 A;  3L4B C;  4PQU B;  1F5B A;  3RBD A;  3JQJ A;  4NZ7 A;  5DGB A;  3N01 A;  2W7P A;  1S49 A;  1VRU A;  3EGZ A;  2HS0 A;  3DRR B;  3KK3 A;  5KFG A;  2XM3 A;  2EWH A;  4YQW A;  4WP3 A;  1IJF B;  4K4T A;  3G82 A;  2OEJ A;  2LQ5 A;  4HR2 A;  2IIH A;  1R0A A;  4HTJ A;  4PQU A;  3M7V A;  3R2D J;  4K0K J;  4LT6 A;  2QA4 S;  3EGN A;  3GSI A;  3DRR A;  4LUB A;  3KG0 A;  3GYX B;  4TQS A;  5KT2 A;  2LXF A;  2O1P A;  1Z4U A;  1H72 C;  2Y0B B;  3MDF A;  2GW8 A;  1Q78 A;  3GSD A;  2YH1 A;  1PIL A;  1CJK B;  2VFR A;  2LKZ A;  4LFC F;  1TL5 A;  4ATN A;  1PYO B;  1RQ0 A;  2R2S A;  4ZVG A;  1NH8 A;  1NJI T;  3T41 A;  4OHZ A;  2CNN B;  2VG7 B;  3VGU A;  4UZB A;  3BKU A;  1M5K C;  3D0G E;  3CCV S;  2IHR 1;  4WPA A;  4ECQ A;  4LJM A;  1ZOT A;  2HIQ A;  3QGG A;  5HQM A;  2DXE A;  3FBC A;  3CIZ A;  5EWF A;  3IR5 B;  4DSE A;  2Y0S D;  1T9W A;  2X1G A;  3CJ8 A;  4EZ6 A;  2VG7 A;  3HHN B;  2KTQ A;  2ADB A;  2HFU A;  2YX7 A;  4N76 A;  5DG7 A;  3FMB A;  1LQ9 A;  1MW7 A;  2DIU A;  3H5U A;  1QSL A;  3QID A;  4CRJ A;  1U8W A;  4K2J A;  2J6U A;  3K2Y A;  2G0I A;  2L08 A;  1N36 F;  2WK4 A;  2LP4 A;  5DJB A;  2EK1 A;  1FKP B;  3AOC A;  5LMU J;  4DSL A;  1X5O A;  3T3F A;  2W2P P;  1Y10 A;  4A8K A;  2CPD A;  2AGP A;  5F8H A;  2APO A;  4F4Y A;  1TMJ A;  4OX8 A;  5KG4 A;  4ZN3 A;  4CLT A;  4YUD A;  1FKP A;  3MM9 B;  4HT7 A;  4OHX A;  1ZS6 A;  4OI6 A;  1RA6 A;  2RIJ A;  4IYQ A;  4N8O A;  2GIF A;  4DR2 F;  1DQA A;  2X1A A;  4KHP J;  2ZH5 A;  1SIW B;  3NGK A;  2DR6 A;  4ZVO B;  1Y3J A;  5F8I A;  1Y3K A;  1WDD A;  3MM9 A;  2QV6 A;  4LRC A;  4M5H A;  1SQF A;  2MQQ A;  2AYE A;  1KS2 A;  1DLO B;  4Y34 A;  1WJ9 A;  3RRH A;  3KLG B;  2P6S A;  1P8G A;  3EYZ A;  2BYC A;  3K57 A;  1HQU A;  3LAL A;  5IM0 B;  4LF1 A;  2FC9 A;  2Q3P A;  2RKI B;  3I0R A;  1UFK A;  4W90 B;  1VHI A;  1ACM B;  5B0G A;  1DLO A;  2BW2 A;  2GA7 A;  4HL9 A;  3TUI C;  3KJV B;  1GXT A;  2KRR A;  3HMJ G;  3KLG A;  1FFW B;  3LF0 A;  5DM7 Q;  4DV7 F;  4U9R A;  3IA0 A;  1YJR A;  2CG4 A;  2RKI A;  1RXO B;  1X4A A;  4JI3 F;  4YB6 A;  4ZVT B;  4LF7 F;  3QT7 A;  1EQM A;  2HVD A;  4I56 A;  5IXU A;  4DJB A;  1UAW A;  4B3S F;  1YSJ A;  2MY8 A;  1WTB A;  2QMW A;  1Q79 A;  2DCL A;  2ZOM A;  3BBF A;  3QIP B;  1OYE A;  4P2M A;  4IFY B;  4ZCL A;  3ENA A;  1FTC A;  2NZC A;  4K8R A;  3UN3 A;  2XMA A;  4U6P A;  5L1L A;  3PHT A;  1FWL A;  3PR4 A;  3QJP A;  1T94 A;  2ZDO A;  2WVF A;  1RHQ B;  4ZLN A;  3MOZ A;  4MIB A;  2IVM A;  2BEF A;  1VQY A;  2QLW A;  2W01 A;  4ETX A;  3QIP A;  1OJ4 A;  5GAE I;  4QR1 A;  4AUK A;  4IFY A;  4B3O B;  3HXM A;  3V6D B;  2AKW B;  3ZZO A;  1H7X A;  5T7L B;  2ALY B;  3CCZ A;  2DY9 A;  3OTC A;  3RRG A;  4DV4 F;  1VC5 A;  2XUL A;  2UUB J;  1RU1 A;  4XAK A;  1Y4Z B;  3THT A;  5I42 B;  5LMN F;  2VOP A;  2NPF A;  2FHK A;  3NCQ A;  3Q83 A;  2PEB A;  3CJ3 A;  1VQ8 S;  1ZH5 A;  3GJR B;  2VC1 A;  2EEY A;  3HKZ D;  5GAH U;  4C0B A;  3QAT A;  1HD0 A;  2LQ8 A;  3V6D A;  4I6A A;  2BW7 A;  4M5N A;  5T7L A;  3CC2 S;  1O8B A;  1XC9 A;  4NEZ A;  2NR0 A;  2XY7 A;  4DS4 A;  1NH7 A;  5I42 A;  3I82 A;  3CC4 S;  1S77 D;  1F0X A;  2HHU A;  3CE8 A;  1GMW D;  1FDA A;  2Z2L A;  2CZ4 A;  2F5G A;  1V3S A;  2HBR B;  3MPU B;  4ITS A;  1U6B A;  1VIX A;  4Q8F A;  1U1P A;  2ZNY A;  3KXD A;  2UUA J;  2R8H A;  1F3F A;  1NEE A;  1WF1 A;  5FLX U;  5ETN A;  3Q24 A;  2PEH A;  1CG2 A;  2BX6 A;  4KPY A;  2KVQ E;  1NXI A;  3Q86 A;  3DRS A;  3S8S A;  1GX5 A;  3TA1 A;  4IG3 B;  3M30 A;  1N32 F;  3D66 A;  1QY7 A;  1U02 A;  2UVU A;  3ITH A;  4R5P B;  3DI6 B;  1EZZ B;  3HKW A;  4N56 A;  4FKY A;  2YX4 A;  4JI5 F;  4B9M A;  3A3P B;  4ED0 A;  5FII A;  1F9F A;  4DSJ A;  3LH2 S;  5KFF A;  4UUW A;  4IG3 A;  2GJI A;  1IR1 A;  3V6K A;  3AB4 B;  4N7T A;  3HHL A;  3CCU S;  4NML A;  3CGI A;  2B3T B;  5KG1 A;  4R5P A;  2P9E A;  2BAN B;  1HBM B;  3DI6 A;  2W9A A;  4NYO A;  3OLB A;  2KT3 A;  4AL5 A;  3HSG A;  3KNG A;  4X66 F;  2IRU A;  4H4K C;  3Q8S B;  3ZTO A;  3H2L A;  4C0O C;  2HS3 A;  4NLR A;  4OIX A;  2DJW A;  3GP9 A;  3N0V A;  4RW9 B;  5DQH A;  1P1L A;  3H40 A;  2DGV A;  2BAN A;  3O3L A;  1HBM A;  1NHK L;  3T19 A;  1EET B;  1RUS A;  3BGR B;  1NDL A;  3N6M A;  4O44 B;  3PW5 A;  1HI8 A;  1VOM A;  4DL3 A;  5EX0 A;  3GON A;  2GQ2 A;  3BH6 B;  3G6E S;  2DNR A;  3D28 A;  1SH2 A;  3KMQ A;  2NCK L;  1M5S A;  4MAK A;  1RK8 A;  2DNL A;  1EET A;  3QSY B;  3BGR A;  4O44 A;  1Q5Y A;  2BKO A;  3T6J A;  3MTK A;  3L7P A;  3MMA B;  3P96 A;  3FC9 A;  2ZH1 A;  4GKJ J;  3PAC A;  1DAR A;  1AFI A;  3V4I B;  2DPI A;  3AD8 C;  4ZOS A;  4ECS A;  3PW4 A;  3OXL A;  1GMU A;  4XDC A;  3NGS A;  1JJH A;  5K14 A;  3DU5 A;  2V9K A;  5F0W A;  1SKS A;  2V68 A;  1FRX A;  4MFB B;  4NX9 A;  1FKO B;  4CT9 A;  2GVZ B;  4DFK A;  3V4I A;  4E8U A;  8RUC A;  5DDR C;  2M0G B;  3VR1 A;  2E1C A;  4PYD A;  3GWC A;  4YME A;  4YDX A;  3BGF A;  1K0V A;  2F4F A;  2JX2 A;  2E1R A;  1N88 A;  1U1K A;  1NPP A;  5SZT A;  4MFB A;  1FKO A;  2YPY A;  3P4U B;  2GVZ A;  3IC1 A;  4PR6 A;  3R1L A;  4ZDN A;  4GVL A;  3W65 A;  3IR6 B;  5F0U A;  3R6G B;  2LA4 A;  1JLQ B;  4K7Q A;  1N48 A;  4QJV A;  3G96 A;  3DN9 A;  1UFL A;  2P9C A;  2XS5 A;  2H9Z A;  3HD1 A;  2W2M P;  4HYK A;  1YX2 A;  1S72 S;  4Q8E A;  2PFF B;  2ADC A;  3KLI B;  1TMM A;  2V34 A;  5I3U B;  3IWN C;  1T9T A;  3NGD A;  2VQF F;  1Y5I B;  4FBU A;  1GX6 A;  4LFB F;  4DR1 J;  2B0G A;  5RUB A;  5CH7 B;  4ZVH A;  1S0N A;  1IXK A;  3EE3 A;  4CNY A;  4X4Q A;  4RUH A;  5A0Y B;  3BQ1 A;  2KL8 A;  2DO4 A;  3BDP A;  3KLI A;  1XBW A;  3Q89 A;  5I3U A;  2IC3 B;  4U8V A;  4WKR A;  3Q0A A;  3PYF A;  4PRF A;  4PG6 A;  5C7P A;  2F63 A;  3JAM Y;  4KJI A;  2HVZ A;  4LBH A;  3DHW C;  1NZ8 A;  2DY1 A;  2RRA A;  3C15 B;  2R3V A;  3CDB A;  4OZ0 A;  2F8M A;  2XWX A;  2MLX A;  4JI4 F;  4FVM A;  2IC3 A;  3RW6 A;  2MZT A;  2M8D B;  2VBY A;  3M8W A;  5M2R A;  1HBN B;  2W2O P;  2EC0 A;  1Q82 T;  1S57 A;  2MYF A;  3CJT A;  1FNO A;  1CBK A;  4FS2 A;  1H98 A;  4FDF A;  3E01 A;  3C15 A;  4KGX B;  4URS A;  4RBV A;  5K9F A;  4R0J A;  1VLO A;  1CJT B;  2FVQ A;  1HBN A;  2XB2 D;  5CCL A;  4Q5V A;  2R8K A;  3PKM A;  3CUL A;  4LR9 A;  4TXS A;  5F9L A;  2VPZ B;  3HJF A;  5D0H A;  3NKY A;  1MRO B;  2N7Y A;  2J9D A;  2HNZ A;  3IS9 B;  3N6N A;  3LQV A;  1VQM S;  1CJT A;  1ZPV A;  4EBC A;  2JLE A;  5IWA F;  2CPJ A;  6FDR A;  3RB3 A;  2CWK A;  4O23 A;  4NRU A;  2XBP A;  1WOO A;  2COL A;  2VPX B;  2J6S A;  1N34 F;  2C42 A;  4DL2 A;  2CQI A;  2BBE A;  2H48 B;  4FNH A;  3A8K A;  1KRP A;  4ZK7 M;  3GFH A;  5KG2 A;  2HPU A;  2DGU A;  5D3G B;  3DOM A;  3ZNJ 1;  3QYY A;  2DR5 A;  3VAH A;  4ETZ A;  4YFU A;  4U7U D;  2VBX A;  3CMA S;  2HHQ A;  2WB4 A;  2BJ7 A;  2GAH C;  3X3U A;  4FYY B;  3LO3 A;  2E1P A;  2DGO A;  3SDE A;  4LRD A;  2A2C A;  2NYI A;  3W3S A;  5D3G A;  2DO0 A;  3T1A A;  3LW5 C;  4CLZ A;  5E5N A;  3EDQ B;  3NOG A;  1G4C A;  2AEJ A;  1IN0 A;  5ETT A;  5IT0 A;  2BKN A;  1S4E A;  2EKY A;  4PEO A;  1T02 A;  2CJB A;  2V2K A;  3KJF B;  4IRC A;  1HBO B;  4ES1 A;  1RAC B;  3D7S B;  4KV8 B;  2HBY B;  2JLF A;  2VFT A;  4NZ6 A;  4DR4 F;  5DDO C;  5ITH A;  3QT5 A;  2ABY A;  4IFV B;  2W7A A;  1RHJ B;  1CLF A;  2VJU A;  4LVN P;  1NJZ A;  3C14 B;  4ZPC A;  3MOJ B;  4EYI B;  4G1Q B;  3IG1 B;  4KV8 A;  1EX8 A;  1KHW A;  2C2D A;  4XPC A;  3E3X A;  1MNE A;  4R8U B;  2XGQ A;  5ETM A;  2GMJ A;  1RWP B;  1AUD A;  4PXB A;  3SEO A;  2DHG A;  2C3O A;  2RVJ A;  4OHY A;  3R7B B;  3OTO J;  4WP9 A;  1HMV B;  4I67 A;  1RKI A;  4I0W A;  2PT0 A;  4PAA A;  1VJW A;  2DHH A;  1HQ2 A;  3EX7 B;  1QVF R;  1U48 A;  4R8U A;  3CCS S;  1YJ7 A;  2WVB A;  2QEX S;  2PGC A;  1SB6 A;  1UZH A;  4ECT A;  1SV5 B;  5J1E B;  1UW4 A;  4U8Y A;  3SZ2 A;  5KG7 A;  4ZVR B;  2OLW A;  3TRG A;  4B3M J;  1HMV A;  1RYR A;  1ZPW X;  4KBI A;  4RUA A;  5HMW A;  2SXL A;  4DF8 A;  2HVH A;  4LBI A;  3WZ0 A;  3S01 A;  1M0S A;  4DPT A;  2J7W A;  3MMC B;  2RRB A;  4F3Q A;  2J0W A;  4CP5 A;  1C0T B;  3AHP A;  2YPZ A;  1JQG A;  2C2Z B;  1LWX A;  2RF2 A;  1SV5 A;  2YTC A;  4OI2 A;  5J1E A;  4N41 A;  3RAX A;  5CHC B;  1OPZ A;  2NSB A;  2Q66 A;  2EXU A;  5D4N A;  1XTZ A;  1OWX A;  4Y0F A;  1VMB A;  2QRR A;  3QZ7 A;  2L48 A;  4K4X A;  3MMC A;  1C0T A;  3KDN A;  3W5Z A;  1I94 J;  5L46 A;  3BZQ A;  5DQG A;  3IBC B;  1NBE B;  1EAR A;  3OFH A;  1S6P A;  4X84 A;  1OSC A;  2CDR B;  1FE4 A;  4TYA A;  1QSY A;  2C2E A;  4WE1 B;  3UFC X;  3SQO P;  1U25 A;  3Q8R B;  3FVY A;  2MQM A;  1NLK L;  2BE2 B;  3PZP A;  1WNE A;  1A0O B;  4ZJO A;  5BYS A;  3TX8 A;  4CM2 A;  4TNO A;  1S6Q B;  4DCP B;  4EMD A;  2LXU A;  4YP3 A;  5F3T A;  2CJK A;  2YNG B;  4WTO B;  3NEK A;  5G0R A;  4K0K F;  4RBT A;  1VRT B;  4J9M A;  2BE2 A;  4YB7 A;  4LR8 A;  2UP1 A;  4DZ6 A;  3CDE A;  3MUT P;  5F8L A;  4MK9 A;  1NK8 A;  1JXV A;  4OX9 J;  1S6Q A;  4YB5 A;  2B4P A;  4CLW A;  1N8R T;  1D8Y A;  3B82 A;  2YNG A;  2FVR A;  1Q8I A;  1NJY A;  4LQ3 A;  3A3N B;  1VRT A;  4F04 B;  2Y8Y A;  3WDO A;  1EB0 A;  4KB7 A;  2VF3 A;  2CQ3 A;  1FDB A;  1YQH A;  2DHA A;  4DX7 A;  1SKW A;  4OYO A;  1SKR A;  1S9E B;  3HO1 A;  1Q53 A;  2J9C A;  2XHC A;  2BVZ A;  1CJV B;  2UV8 A;  4C0H A;  4RJV A;  2MLZ A;  2RSQ A;  2DEJ A;  3JAM U;  1DHM A;  5IS2 A;  3VV2 B;  2KB2 A;  5A2Q Y;  3CIM A;  3SIP B;  3F56 A;  5A8R B;  1NK7 A;  3GQC A;  2P8I A;  2RQM A;  1S9E A;  4ZP9 A;  2LQJ A;  1T9U A;  4O0N A;  3P3D A;  2MKS A;  2FB0 A;  2FZK B;  4ES3 A;  5HP1 A;  1R0B G;  2CIM A;  3RB4 A;  5LMU F;  1UWA A;  3BBB A;  2VU5 A;  1S4F A;  5A8R A;  1NU4 A;  4DLE A;  1BWV A;  1F60 B;  2BJ8 A;  3DXS X;  4B9V A;  2AYG A;  2WOM A;  2DNG A;  2DCU B;  4EEY A;  1JJ2 R;  1RHM B;  2EPI A;  4IR1 A;  2RS2 A;  3H98 A;  5CAA A;  2R7Q A;  4O0I A;  1HWI A;  4CLK A;  2XS7 A;  5KFK A;  3U7J A;  5D0R A;  2CZ9 A;  4I68 A;  2KYX A;  3S7R A;  4GKK F;  5B0B A;  4Q2M A;  2ZDP A;  1QAY A;  4O4G B;  2M7S A;  2CZV C;  1DTT B;  4KFB B;  3PVX A;  1B0V A;  1FRM A;  4EYH B;  1OY8 A;  1ZTT A;  4YS2 A;  4CZC A;  4RW4 B;  3M9M B;  4KHP F;  5D78 A;  4U7C A;  2DB1 A;  3GFX A;  2OHD A;  2CWX A;  3HK2 A;  4O4G A;  1HHS A;  4QQB A;  1T7P A;  1DTT A;  4JYA J;  4KFB A;  2K8G A;  2GGP B;  3I6P A;  4F36 A;  1G2E A;  1X4B A;  1YIJ S;  5BXI A;  3FBF A;  8AT1 B;  2UUW A;  3DC2 A;  3GJT B;  2OMO A;  3C8Y A;  4RW4 A;  2GZO A;  2Y1I A;  1LK5 A;  1P9Q C;  4A4J A;  4X65 J;  4B3T J;  2J8A A;  1RHU B;  3MED B;  4NLP A;  3SFG A;  2LQB A;  3DLL Q;  2GGP A;  1WG5 A;  3M9N B;  2YNI B;  4ILR A;  2PA8 D;  3CMQ A;  3IAM 9;  1KKH A;  5CZX A;  1QAI A;  4H4K A;  1T9Y A;  1KC8 T;  1WHY A;  3QWP A;  1IKW B;  1ZM4 A;  2CXE A;  3MED A;  1FD8 A;  2Q43 A;  1P1T A;  1JX4 A;  1SI9 A;  2YNI A;  1HI0 P;  4IH7 A;  1IUJ A;  2HLU A;  4P7T A;  3R97 A;  2VKZ G;  1YJW S;  4PG5 A;  3J7A N;  1RWN B;  1WEY A;  3ZC4 A;  3HX9 A;  1CC8 A;  4A8M P;  3FDS A;  1S1X A;  1F9E B;  4P72 A;  4OZN A;  1NK5 A;  2N82 B;  1H2V Z;  3IBF B;  5D4P A;  3FKB A;  1R8P A;  2KXH A;  5KOX A;  1HPZ B;  4F50 A;  1TKX B;  3H2V E;  5EUH A;  3OW2 R;  2W9C B;  1UVM A;  2RB7 A;  2XLI A;  4ZLJ A;  2UUB F;  1HNW J;  2HSE B;  1NKE A;  1HPZ A;  1Z2Z A;  1I51 B;  1RAI B;  2FGC A;  2XYG B;  2HZA A;  3NMA A;  2OPQ B;  4DEZ A;  1PJ5 A;  2K3I A;  4C3M A;  2N3O A;  4J9P A;  4B9T A;  1M5O C;  4ECZ A;  3ADA C;  1JKH B;  3KHG A;  4M5D A;  3AJ2 A;  3F73 A;  2GNK A;  2OPR B;  2MQ8 A;  3W64 A;  3OHA A;  5HQ8 A;  4KY3 A;  2ZVS A;  5HO4 A;  2YNH B;  2OPQ A;  3TW0 A;  4LSN A;  3V4M A;  4NLS A;  3CB4 A;  1JKH A;  2RDI A;  3S6E A;  2V69 A;  4OL8 A;  2OPR A;  4J9U E;  4O3O A;  3ZTQ A;  2UUA F;  2ZNZ A;  2DNO A;  2YNH A;  2AHO B;  4MYT A;  5DS7 A;  2OPS B;  1SUQ A;  3HHE A;  3RW7 A;  4DX6 A;  4C11 B;  2IJR A;  4OQJ A;  4XTT A;  1Q7L B;  3PX4 A;  4I7F A;  3IP0 A;  4WFZ A;  3TVY A;  3FJ2 A;  1UJ5 A;  1QUV A;  3CCM S;  3UR3 C;  2OFG X;  3WX4 A;  1FTR A;  4GO5 X;  4ID8 A;  4G65 A;  1JJC B;  3LWM A;  2ZH2 A;  5BR8 J;  4WFX A;  4NA1 A;  3TJA A;  4ZIV A;  4PG4 A;  1RAJ A;  2R7V A;  1TKT A;  4C11 A;  1H2U X;  2XCP A;  2NRE A;  3KK2 B;  2R4F A;  2E5L F;  1KWM A;  4Q0B B;  2XMW A;  4HHH A;  4X4N A;  2FJD B;  3QRP A;  2ATL A;  3OXF A;  1B7F A;  3GJS B;  4QR0 A;  4TLQ A;  1Q86 T;  4NCB A;  1FJ7 A;  1UTA A;  4OI1 A;  3ENW A;  4I2P B;  4D3G A;  1C1B B;  3AOD A;  4Q0B A;  2J7U A;  4NI2 B;  3ZTR A;  3MR5 A;  4BBY A;  1FWK A;  3RAQ A;  2MJU A;  2M9K A;  3DYA A;  3EJM A;  3P5B P;  2CNO B;  4OJ1 A;  2GJF A;  5LSL A;  2JWN A;  4TLR A;  3TAM B;  1IM4 A;  4I2P A;  1C1B A;  3PW0 A;  1FA0 A;  3L9Z A;  4X4V A;  5KT5 A;  2AU0 A;  4F4X A;  2Q6C A;  4NI2 A;  4UY8 T;  1TKD A;  4USW A;  5BYQ A;  2K2P A;  1YJT A;  3OTD A;  1R43 A;  2ZH6 A;  5A2Q U;  2UU9 J;  4DL7 A;  4PXD A;  2HEK A;  4DV1 J;  4GO7 X;  1FWP A;  3FQK A;  2BV3 A;  3GIK A;  2XMJ A;  1UZD A;  3B8H A;  3SYZ A;  3UDL A;  1F6T A;  1FVS A;  3UW1 A;  3GTY X;  4OZ2 A;  1S99 A;  3GJQ B;  4GKJ F;  3THP A;  1KVK A;  5J2P B;  4IRD A;  1FJE B;  3GV8 B;  1FDN A;  1IBK J;  1TL3 B;  2MHE A;  2VFV A;  3EWG A;  3DLG B;  3QGI A;  2ZEJ A;  1SC6 A;  4RL1 A;  4UOG A;  2F8H A;  1WOR A;  2DRB A;  4ZP8 A;  4ED4 A;  5J2P A;  3CDW A;  2MKH A;  1GNK A;  4DV0 J;  2Y1J A;  2OO4 A;  4OJH A;  3M8P B;  4OJG A;  3ENQ A;  2HND B;  1NB7 A;  2R7R A;  3U27 A;  3MCN A;  2MEW A;  4WYL A;  2J7K A;  5D6G A;  2HQD A;  5AE2 A;  3LAM A;  1NDP A;  2LMI A;  4P2S A;  2JEF A;  4RU9 A;  2RE1 A;  1RB0 A;  3MMJ A;  1H6K X;  1FRI A;  3DLK B;  4BCA A;  5EDW A;  3M8P A;  1S0O A;  2JC0 A;  3NXZ A;  4H4M B;  1JWW A;  4FNI A;  3LUY A;  2GIQ A;  2GJ2 A;  5DZ6 A;  2DVI A;  3W61 A;  3AOB A;  3BPS P;  3KJQ B;  4KQZ A;  2V5H G;  1IKY A;  3A4T A;  2KHC A;  4FXD A;  3CO0 P;  1OY9 A;  2G1H A;  3C66 A;  5LXY A;  3U1L A;  1EQ0 A;  1R27 B;  4DR1 F;  2J5A A;  2ASY A;  2ZOG A;  1SL2 A;  4H4M A;  4NAS A;  4ZHR B;  2MB0 B;  3QFH A;  1KQG B;  2ZHO A;  1O6X A;  4NXM J;  4OZL A;  3CCQ S;  4GC7 A;  1ZA2 B;  2NYH A;  3UCG A;  4CT8 A;  4IH6 A;  4RNH A;  4Y65 A;  5CXT A;  4BWJ A;  3R5D A;  2PI4 A;  2EBG A;  3MD3 A;  3AJ1 A;  1VQO S;  2JVR A;  4ZHR A;  4ZMM A;  4C8Y A;  2BQ3 A;  1AZS B;  4FYW B;  1RBO B;  1RCO B;  5C24 B;  3PYD A;  1L5U A;  2DIS A;  1DQ8 A;  1BD6 A;  1NDC A;  3UDV A;  3IM9 A;  3OFF A;  4AND A;  1PO6 A;  4KGZ B;  3QGP A;  3M8Z A;  5HLF A;  2GMH A;  2H4W B;  2MQO A;  2YWW A;  1AZS A;  3HSJ A;  3EM1 A;  3W8G A;  3I96 A;  1L3T A;  2VPW B;  2YKN A;  4EI2 A;  1EJ7 L;  4ED1 A;  3F41 A;  2QTW A;  1KON A;  3OFG A;  1YBA A;  2I6W A;  1KNZ A;  1VQP S;  1N6Q B;  4NPO A;  3BJY A;  3CJ4 A;  5L39 A;  2YKM B;  2D1C A;  2JJ4 D;  3M1V B;  2E5J A;  2JC1 A;  2FJA B;  3W1Y C;  4QWA A;  1J2V A;  4ZPA A;  4EBE A;  2E5I A;  4WFB Q;  2D3Z A;  3EUN A;  2A6O A;  4DZD A;  1YG0 A;  3GCX P;  5KFL A;  1KEK A;  3DDI A;  2GO9 A;  2ROG A;  1CC7 A;  4K5S A;  1N6Q A;  2HBQ B;  4UOC A;  3MEK A;  2YKM A;  1XMQ J;  4HAC B;  4Y2M A;  3W66 A;  4JOU A;  1G6B A;  1EKR A;  2CQP A;  1TKZ B;  2VJV A;  4ES2 A;  2XI2 A;  5E3P A;  2FVS A;  1MLA A;  4IOC Q;  5ETS A;  1ROF A;  3L7O A;  2BJ9 A;  3EVM A;  4ECW A;  1R3N A;  2FUG 9;  3N5B A;  2CPH A;  4P74 A;  2FJE B;  5HJY A;  2F4V J;  4UOH A;  5AJ3 J;  3RB0 A;  3LAN A;  4FXV A;  1J5E J;  4DDF A;  3LPY A;  3KNA A;  2AJ1 A;  2H5E A;  2LA6 A;  4HAC A;  3HI9 A;  1LNQ A;  3KUH A;  1B70 B;  1XEZ A;  3Q22 A;  3MUM P;  1TKZ A;  2V63 A;  2KU7 A;  1DQ9 A;  2HWT A;  2XYH B;  2BJ1 A;  1NK9 A;  2H5J B;  1V5V A;  2EFN A;  2DPJ A;  4L73 A;  4IO1 A;  3CD5 A;  3JTN A;  3FSI A;  2UXD J;  1M5V C;  4M63 A;  2C3P A;  1TAQ A;  1FXR A;  2Z56 B;  4DLG A;  2OTL S;  3VTI A;  1NZA A;  1BHN A;  3TR5 A;  2YXL A;  2E66 A;  2Z58 B;  2QIF A;  4RBU A;  3ULH A;  3D54 A;  1FCA A;  2D3O 1;  5GAD U;  1H74 A;  2EVZ A;  4OZJ A;  5IQQ A;  1MN9 A;  3OSP A;  5D0E A;  1RTH B;  2QE5 A;  1VQK S;  3D68 A;  3UWT A;  2G9O A;  1X4F A;  2WVD A;  4RW6 B;  3W2V B;  5A6P A;  4QU6 A;  2NXE A;  2WW4 A;  5EGY A;  3VGT A;  4A46 A;  3ZO7 A;  4DQS A;  4O3N A;  1RTH A;  1FNX H;  3HHD A;  2HGL A;  2DNP A;  1MG7 A;  3AD9 C;  2C3M A;  4OFZ A;  3OTO F;  2IVF B;  4DI6 A;  4L72 B;  1QLN A;  5KG0 A;  4LFB J;  1HNX J;  3D1O A;  1X9M A;  2IM0 A;  4QBU A;  2W2N P;  3NOC A;  5L38 A;  1KN6 A;  2NLW A;  1D1U A;  2F9J A;  4M5M A;  2GIR A;  4LVO P;  3HHL D;  2HIY A;  1SJR A;  2DYA A;  4B3M F;  4IRK A;  3G2X A;  4OI3 A;  1NCL A;  3OL6 A;  3IWL A;  2E9T A;  4RW7 A;  2NUU G;  1N0U A;  3FQL A;  3ZXW A;  1JK9 B;  3SCL E;  5GAG I;  3TA0 A;  2HFS A;  4Z2X A;  3W9H A;  4QWD A;  2XO7 A;  5GAG U;  4OLO A;  4H54 A;  2FHJ A;  2I38 A;  2QSW A;  3HM9 A;  1U1O A;  3PX6 A;  2CA9 A;  3PIO Q;  2JH3 A;  3TUP A;  3BSC A;  2JFD A;  3KWM A;  5JXS A;  9RUB A;  3AD7 C;  4OLP A;  1I94 F;  5K8O A;  2BJE A;  2D41 A;  2KH9 A;  2VD3 A;  1KTV A;  1YVF A;  1MMD A;  2GQC A;  1M5P C;  3AA8 A;  1FER A;  1V3Z A;  4IG0 A;  3J81 j;  3R5B A;  1T05 B;  5C25 B;  4NCG B;  3KK1 B;  2IVY A;  1BWE A;  3QMQ A;  3TEH B;  4IOA Q;  4CTA B;  2NXC A;  1TFY A;  3T5J A;  3NGT A;  1AXQ A;  1ZM2 A;  3ZZT A;  3QSI A;  3VF0 B;  5KFC A;  5L1I A;  2CJA A;  4Z7C A;  2JHE A;  2VA3 A;  3OSN A;  1BQM B;  3D67 A;  1T05 A;  5C25 A;  4NCG A;  5HVF A;  1SL0 A;  2Q79 A;  1T03 B;  1YRT A;  3BSN A;  1Y5L B;  4Y28 C;  4CTA A;  3TAR A;  5IWA J;  2JLG A;  1RAO A;  5B0C A;  4C8M A;  5B7W A;  2ZBI A;  2XZD B;  5KFD A;  2XMM A;  4DFJ A;  3PFO A;  1HYS B;  3D5M A;  4OX9 F;  4AQY J;  1HNI B;  1IWG A;  1FRH A;  1HWL A;  1IWA A;  2UUC J;  3CCW A;  1T03 A;  1U2R A;  1WOS A;  1OQ3 A;  3UN2 A;  3KHH A;  3U1M A;  4IOB A;  4V19 X;  3P5T L;  4EGL A;  3M8Y A;  1HI1 A;  3QRR A;  2Y9H A;  1HYS A;  5D4L A;  3KLF B;  4B17 A;  2VV5 A;  5THW A;  5H1S V;  1DFD A;  1HNI A;  3D6H B;  3MEE A;  5A76 A;  1Q5V A;  1RT7 A;  5KFU A;  4KSE B;  1ULR A;  4FN5 A;  4WWS A;  3C2P A;  2DRD A;  4L74 A;  3W60 A;  1FJG J;  2P2C B;  3ZNU A;  4J9Q A;  1RTZ A;  1GXL A;  5HSP A;  3OL7 A;  2V8H A;  4KR0 B;  3BGL A;  4LIW A;  1TZ0 A;  2BRK A;  1OO0 B;  2H1Y A;  4F67 A;  1NJW A;  4QPT A;  3M8S A;  1AT1 B;  4MMO A;  3KLF A;  3HVR A;  4TU8 A;  3D3C J;  2YX1 A;  1WOP A;  1GEH A;  3DLE A;  3SSQ A;  2ZHA A;  2I2Y A;  1DTQ A;  2CQD A;  4MKB A;  4C8Z A;  2C3U A;  1K44 A;  4ZIT A;  1K73 T;  5GMD A;  3UDC A;  4CNZ A;  1G7C B;  3CDA A;  5FDL B;  5HBM B;  4MKV A;  2DGX A;  3AXM A;  4KC5 A;  3NNA A;  3PY8 A;  3NS5 A;  3AAW B;  1B3T A;  4LF4 J;  3JSR A;  2XEX A;  3MAQ A;  5K8M A;  1XR5 A;  2HG4 A;  3ILO A;  4MH8 A;  3SV3 A;  5FDL A;  3K17 A;  1X4D A;  3RU0 A;  2B9E A;  3CSK A;  2C1E B;  4QYZ J;  2XG8 A;  4UZC A;  4QIG A;  1T3N A;  3DRX A;  1HNZ J;  3RR8 A;  1UA1 A;  4B3R J;  4UQT A;  4JI8 J;  2X3D A;  3T5H A;  4J9O A;  1MML A;  3DM2 B;  2ZZT A;  2PA3 A;  1YIT S;  2PSZ A;  1GXU A;  4JYA F;  1WI8 A;  2JRS A;  1N33 J;  2BAB A;  2EC2 A;  4ED3 A;  3WHI A;  3H8Y A;  2XI3 A;  3SCJ E;  4X65 F;  1HHT P;  2DNK A;  1DY3 A;  4B3T F;  3DM2 A;  3GU0 A;  4F8R A;  2G2Y A;  2ZJQ Q;  2W7O A;  3WX8 A;  3G6X A;  4N5S A;  3DRP B;  3GG0 A;  2CPI A;  4ZVS B;  3O1L A;  3ET6 B;  4L3N A;  1VQS A;  1WEZ A;  3MGJ A;  2QT7 A;  2ZFH A;  2CPY A;  2XMU A;  2Z0G A;  2JNJ A;  3HF5 A;  2B5J B;  1PAU B;  4KRW A;  3K89 A;  3ILL A;  1B4S A;  1R8C A;  3JQM A;  1ITP A;  1KLM B;  1SH3 A;  3DRP A;  4RNF A;  1QTM A;  1LWC A;  3H7H B;  4CLL A;  1YI2 S;  4G1P A;  4LF2 A;  2XHW A;  3ET6 A;  5DO2 A;  1YRU A;  1FT8 A;  4KGK A;  4MK8 A;  3LGM A;  4UT4 A;  1ZM3 A;  2HQF A;  1SQG A;  2B5J A;  1JNZ B;  5B08 A;  4DN0 A;  1XNQ J;  1T3O A;  4C3K A;  3SMZ A;  2CQ2 A;  1Y11 A;  1JNR B;  4HHU A;  1JXL A;  2AF6 A;  1M1K T;  4ZVU B;  3U1N A;  1X4H A;  3UO0 A;  2E5H A;  4N47 A;  6FD1 A;  5JMN A;  1VQ6 S;  2MZQ A;  3G8S A;  2Z2Y B;  3IBW A;  2PD1 A;  1QD1 A;  4I6W A;  2CPE A;  2YVS A;  1HNW F;  2M8H A;  4N8N A;  2I9S A;  2BAC A;  3CJ0 A;  3BM7 A;  1CJK A;  4K4W A;  2R8G A;  1MWQ A;  4DPY A;  2RRN A;  1PIE A;  5T41 A;  5KFJ A;  3D4J A;  3EDR B;  4OZ5 A;  5F9N A;  1HIY A;  3MPV A;  4PG8 A;  4WKY A;  3CJ5 A;  3CD0 A;  2Y8W A;  1ZET A;  3R5J B;  3A8I A;  5I3P A;  4DFM A;  3N28 A;  4C48 A;  2Z8Q A;  4E0D A;  2V8G A;  2RQK A;  2KFZ A;  2BQR A;  4WP8 A;  3DLH A;  3PRV A;  3Q2S C;  4WK3 A;  4HHJ A;  3OPK A;  1JLB B;  4C9D A;  3OUY B;  1ARO P;  2LLZ A;  2WAQ D;  3UVJ B;  4PWD B;  4PAB A;  3FEZ A;  1REG X;  1XR7 A;  2J8S A;  3NCR A;  1UCN A;  3RYL A;  2KKH A;  4KTQ A;  3HFK A;  5K5M A;  1BLU A;  1RYS A;  3NGU A;  3C6U B;  4OZ3 A;  4GKK J;  1JLB A;  3OUY A;  4PWD A;  1RI7 A;  1JXE A;  1U2F A;  4F4W A;  4LF9 J;  1BXN A;  2ZZN A;  4FBT A;  1WKL A;  2BJ3 A;  2BM0 A;  1CPZ A;  5HMY A;  2A3J A;  1VIS A;  3PCO B;  2LVW A;  4UY8 5;  5BR8 F;  1SIZ A;  4RW8 B;  4L76 A;  2ZKT A;  4ZIW A;  5M2U A;  1LW0 B;  2FJB B;  5ETL A;  4BLG A;  3DLB A;  4KHR A;  3JXO A;  2DKO B;  2MGZ B;  2QLJ B;  4QR2 A;  1S76 D;  2PFD A;  2OML A;  3Q23 A;  3G8T A;  2KJW A;  4ZPT R;  1RT6 B;  3BGO P;  4CM0 A;  4ZPB A;  3AQP A;  3MUR P;  3BKF A;  3ZTP A;  1VQ7 S;  3V81 B;  4CDI A;  1WTF A;  1LW0 A;  1UWB B;  3K5O A;  4MK7 A;  3R3T A;  4XO0 A;  1TEL A;  2ROP A;  4F4Z A;  3OT9 A;  4ED8 A;  1N5V A;  3CNQ P;  3JYT B;  1K47 A;  4K4Z A;  4DUT A;  1RCX B;  3V81 A;  3V6H A;  2FIU A;  2CVI A;  4HT5 A;  3NAH A;  3EVO A;  2AGO A;  2ASJ A;  1UWB A;  2FDN A;  1WG4 A;  2XNQ A;  5IM0 A;  2L9D A;  2RHS B;  2UU9 F;  4DV1 F;  2ZIT A;  5KFI A;  4W92 B;  5AXL A;  3RRK A;  3JYT A;  2JEI A;  3KJV A;  3DU6 A;  3CJK B;  1QVG R;  5KFQ A;  4RNM A;  3PNI A;  3C6T B;  2MZS A;  2C28 A;  4UW2 A;  1XN9 A;  1FJC A;  3OJS A;  2KT5 A;  2K7J A;  5HVH A;  3BGU A;  2FJV A;  2QC3 A;  2XSF A;  4ILL A;  4O3S A;  5LJ5 Y;  1N5Q A;  3J7A 1;  2L41 A;  1DBD A;  1IBK F;  4ZPW R;  4PG7 A;  3CJK A;  4NMX A;  3SBM A;  4DV6 J;  3GIJ A;  2X1F A;  3C6T A;  1FD2 A;  1GTE A;  3UD5 A;  1MSW D;  3GR0 A;  4BC7 A;  3F44 A;  2QLX A;  1SVD A;  2DR8 A;  4DV0 F;  2RUG A;  1YLX A;  5JJB A;  4NLQ A;  1F9H A;  3PIP Q;  1PGZ A;  5GAH I;  2ZHB A;  3TWZ A;  2OI2 A;  3HZE A;  4B3O A;  3C19 A;  2UXC J;  3J7Y U;  4DFP A;  3VVU A;  4CLY A;  2QYC A;  2AGQ A;  1XMO J;  4ECV A;  4G1I A;  1WEL A;  4EO6 A;  4USV A;  3G6Y A;  1TFW A;  2MSS A;  3RBZ A;  2V4J B;  2D74 B;  4I4B A;  4DCO B;  4WII A;  2YNF B;  1RT5 B;  2RNE A;  1IBM F;  5HMZ A;  2Y3Y A;  3CD7 A;  1L3K A;  4DWI A;  1U1N A;  3M8Q B;  4ILM A;  3JQK A;  1NSQ A;  3ICL A;  3QGH A;  3HPO A;  3CWJ A;  2V4J A;  1C4C A;  3FSY A;  4NXM F;  1VBX A;  3BPD A;  2YNF A;  2BOA A;  3MR6 A;  3W62 A;  3D1H A;  3RTV A;  1U09 A;  3O8W A;  4IR9 A;  4L75 A;  5KFN A;  3M8Q A;  1I1G A;  4RNO A;  2XQC A;  2XY6 A;  3PR5 B;  2ZZM A;  1B99 A;  1LOU A;  4Y3C A;  7AT1 B;  2EKN A;  1S1U B;  2KO1 A;  3TAQ A;  1WAC A;  4KKO B;  3HHK A;  1WC6 A;  3UPF A;  3L95 X;  2QFJ A;  3C16 B;  3S1T A;  2BXJ A;  1WC5 A;  4CO0 A;  1WD6 A;  3PFE A;  4UQG A;  4QCL A;  4AD6 A;  1S1W B;  2E5L J;  3I56 S;  4F25 A;  2E1A A;  4DOZ A;  2ZWO A;  1S1U A;  2LEA A;  4LF6 J;  3TJ9 A;  1U1M A;  3TZW A;  1U26 A;  3DGV A;  1N54 B;  4KKO A;  1S7H A;  4DN9 A;  4J9R A;  3C16 A;  4RPF A;  3VGV A;  3W2W B;  4Y00 A;  4AYB D;  5CD4 H;  2MZ1 A;  1KTQ A;  5E3Q A;  3QRQ A;  2YH0 A;  4DQI A;  2HHT A;  2VAS A;  1S1W A;  4QIE A;  3LP0 B;  5HAO A;  1YKW A;  4QYZ K;  5HN0 A;  4CLF A;  4JV5 J;  4F02 A;  5DGA A;  3DDN A;  3N4W A;  5H9E J;  2W1B A;  4YDD B;  2HGN A;  2JEJ A;  1UKU A;  2D7S A;  5IC6 B;  3T5K A;  2AT1 B;  3O2I A;  1X31 C;  5E33 A;  4X64 J;  1RP5 A;  1S6U A;  3HFV A;  3LP0 A;  2QL9 B;  4CLS A;  1XMQ F;  2DRA A;  2IM3 A;  2DBB A;  2X3G A;  4V1A k;  1QM9 A;  3FBB A;  1LWF B;  3O44 A;  2EW9 A;  4RW9 A;  4HTI A;  2ZWP A;  1S12 A;  2F4V F;  1UPM B;  2DNZ A;  5AJ3 F;  4CH1 A;  1P6T A;  1WI6 A;  1KOO A;  1JB0 C;  1J5E F;  1E6Y B;  4DX8 H;  2HS4 A;  2OJ3 A;  4TYB A;  1LWF A;  2IDE A;  5LSO A;  3IWX A;  1LXN A;  1BUX A;  2R2T A;  3CVK A;  1F3V A;  4ZCM A;  5K8N A;  3WIU A;  2OIH A;  3MXH P;  5DG9 A;  4WU3 A;  1U0S A;  4GVB B;  1Z1Z A;  1T8E A;  4WK1 A;  3H20 A;  4NA3 A;  2UXD F;  1E6Y A;  3HT0 A;  1SJQ A;  3MCS A;  1ELO A;  4M1K A;  2V94 A;  2CVE A;  3EZO A;  3MMA A;  4DBQ A;  2GC8 A;  2DNN A;  3M05 A;  2GV1 A;  4KHM A;  2KYZ A;  2FVP A;  3GE9 A;  3Q8V A;  2H3E B;  3NS6 A;  4GVB A;  3HHL C;  1TK0 A;  3RG6 A;  3I32 A;  2B56 A;  1S48 A;  4E98 A;  3BO2 A;  3KDO A;  3ZZU A;  4ELT A;  4FF2 A;  3CTR A;  4WU2 A;  4FYV B;  1TK8 A;  2YBV A;  2IY5 B;  3Q2T C;  3T9N A;  3T5L A;  4J37 A;  3R7S B;  5J1N A;  3JTO A;  1FVQ A;  5SUH A;  1XJW B;  1V3R A;  1FX4 A;  3IAS 9;  4QIW D;  1KP6 A;  2BR0 A;  2LU1 A;  3AQO A;  3N79 A;  2X7I A;  2QLB B;  5CA5 A;  3KKF A;  1AUS L;  2YQ3 A;  2NS1 B;  2WON B;  1NRK A;  1RAD B;  1FRJ A;  4C8O A;  3H4B A;  4IUF A;  2AIR B;  1JLQ A;  4P7V A;  1HNX F;  3BR9 A;  1HLW A;  3DDK A;  1TUW A;  4JB8 B;  5J1P A;  2W9B B;  4DSF A;  2WON A;  1FKA F;  1FX2 A;  4NLW A;  3A13 A;  3K8V A;  3MPY A;  1B0P A;  3DOK B;  2B9Y A;  2OTJ S;  3D6T B;  3K5L A;  2HK2 A;  2G13 A;  2M3D A;  4BC9 A;  2W9B A;  5A0Y A;  1ZA1 B;  4YB1 P;  3UE2 A;  4ALZ A;  2HAF A;  1VC0 A;  1RDR A;  2XYP B;  5EX3 A;  2MJN A;  2K06 A;  3QAE A;  2X1B A;  2IJF A;  2V9W A;  4Q45 A;  4X4S A;  1PJ7 A;  4C6A A;  1PCA A;  3OQ2 A;  3MTJ A;  4NLT A;  4TKT A;  3GG1 A;  2KM8 C;  1X60 A;  3ZTS A;  1ICE B;  2GFF A;  3C3L A;  1U6F A;  3J7Z 5;  5CQG A;  3W7B A;  1HD1 A;  1CEZ A;  3LOU A;  3OV7 A;  4WTY A;  1CQM A;  3UI3 A;  2EI5 A;  1XER A;  2QMU B;  3MPD A;  3THV A;  3KLH B;  4EZ9 A;  3DNC A;  2LFV A;  5IOL A;  1N0V C;  5DLG A;  2Q6B A;  5L1K A;  2DTJ A;  1DZ5 A;  5F8J A;  3UNG C;  4C3L A;  1URR A;  4ZPV R;  1LK7 A;  3KJN B;  2IBK A;  3CT9 A;  4ZVP B;  2ALZ A;  4DR6 J;  2J9E A;  1RWK B;  5H9F J;  1S0V A;  3KLH A;  4GC6 A;  1TU0 B;  3ILI A;  5HAT A;  1J5O B;  4PCQ A;  1MRO A;  4B02 A;  4AQY F;  3MR2 A;  6AT1 B;  3T1H J;  4DR7 J;  2VFS A;  2UXB J;  4K4S A;  3JTP A;  3IS9 A;  2UUC F;  3M32 B;  2O01 C;  1CUL B;  1X0F A;  4OHW A;  1Q8L A;  4KH0 B;  4LRB A;  3KLE B;  2KG0 A;  4E2F B;  2PMH A;  2NPI A;  1NM2 A;  3BO3 A;  1NSP A;  1APS A;  2LEP A;  4LIR A;  2CYY A;  1Q81 T;  1J5O A;  4QU7 A;  2B8Q A;  2KRB A; 
#chains in the Genus database with same CATH homology
 4JV5 J;  5LMU J;  4YHH J;  1HR0 J;  3R2C J;  3J81 U;  4JI2 J;  4DV5 J;  5LM7 E;  2ZM6 J;  4LFB J;  1HNX J;  4NXN J;  2UUA J;  1N36 J;  4DUY J;  3T1Y J;  4GKK J;  2UXD J;  4LF5 J;  1I94 J;  4JI6 J;  3OTO J;  4JI0 J;  3W1Y C;  4NXM J;  4LF9 J;  4LFA J;  5FLX U;  4DR1 J;  1HNW J;  4DV0 J;  4X64 J;  1FJG J;  1HNZ J;  4DV2 J;  4B3R J;  4X66 J;  2UXC J;  4V1A k;  2VQF J;  4JI8 J;  4LFC J;  2MEW A;  2KVQ E;  2HHH J;  2UUB J;  2KL8 A;  1XMO J;  4DR6 J;  2MTL A;  5A2Q U;  4RJV A;  2UU9 J;  4LF8 J;  4DV1 J;  1XMQ J;  3D3B J;  4DV3 J;  3JAM U;  3D3C J;  5BR8 J;  1XNQ J;  4DUZ J;  2E5L J;  4DV4 J;  1XNR J;  2MQ8 A;  4B3M J;  1N33 J;  4PWW A;  4DV7 J;  5IWA J;  3IMQ J;  1IBL J;  1IBM J;  5LMN J;  3T1H J;  4LF6 J;  4HHU A;  4DR7 J;  4KY3 A;  4KHP J;  2UXB J;  4JYA J;  3J7A N;  4NEZ A;  2F4V J;  5AJ3 J;  4DR3 J;  4JI3 J;  4JI1 J;  4LF7 J;  5IT9 U;  4NEY A;  1N32 J;  4DR2 J;  4AQY J;  4DV6 J;  1J5E J;  3R2D J;  4B3S J;  4KYZ A;  2UUC J;  4YY3 J;  4DR4 J;  4K0K J;  1IBK J;  4JI7 J;  4DR5 J;  2VQE J;  4OX9 J;  4X65 J;  4B3T J;  4X62 J;  4JI5 J;  4LF4 J;  3J80 U;  4GKJ J;  1N34 J;  4JI4 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...