4DV3J

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a, bound with streptomycin
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 13
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4dv3J00
5LMNJ 4DR3J 4KY3A 4PWWA 4DV5J 2UUCJ 2UXCJ 4NEZA 2VQEJ 1N36J 4HHUA 2UU9J 4DR5J 4DV0J 4KYZA 4JI3J 2VQFJ 2E5LJ 4LF4J 1HR0J 4LFAJ 3IMQJ 1HNWJ 4DV7J 4LF7J 4RJVA 2UUAJ 4YY3J 1N33J 1FJGJ 5IWAJ 4DV1J 3W1YC 4K0KJ 1XMOJ 1N32J 4JI8J 1I94J 4X65J 3OTOJ 5IT9U 4JI5J 1XNQJ 2KL8A 4NXMJ 1XNRJ 2MTLA 1IBLJ 4B3TJ 4DR1J 3JAMU 4LF5J 5LM7E 3R2CJ 3J81U 5AJ3J 1IBKJ 4LF8J 5FLXU 4DUYJ 4GKKJ 5BR8J 3J7AN 2UUBJ 4X62J 3T1YJ 4B3RJ 4JI1J 4JV5J 4JI6J 5LMUJ 5A2QU 4DV6J 4JI0J 4LFCJ 2UXBJ 3R2DJ 1HNXJ 4DV4J 4JI2J 4LF6J 1XMQJ 4KHPJ 4JYAJ 2F4VJ 3D3BJ 4V1Ak 4OX9J 2UXDJ 2KVQE 4LFBJ 4DV2J 4B3SJ 4DUZJ 4JI4J 4B3MJ 3D3CJ 4X64J 1J5EJ 2HHHJ 2ZM6J 4YHHJ 4DR4J 4AQYJ 1HNZJ 1N34J 4JI7J 4DV3J 2MEWA 4LF9J 4GKJJ 4DR2J 2MQ8A 3T1HJ 4DR6J 1IBMJ 4NXNJ 4NEYA 3J80U 4DR7J 4X66J
chains in the Genus database with same CATH superfamily
3M6VA 1M5VC 1NK6A 1Y3JA 2CQBA 4IQMA 5L1JA 4IFYA 4WKYA 3TA2A 1RAOA 5E33A 2CAJA 2DNZA 4OI6A 1DTQA 4J9KA 5MLCV 1KTQA 4KAIA 4NXMJ 1RI7A 3OFGA 4DZ6A 2HFUA 5DJBA 4IOAQ 3PDNA 4KH0B 4LRCA 2IMWP 2ZH3A 1LFWA 2IDLA 3DLEA 4DV7F 1WTBA 5HLFA 1TZ0A 3P8BB 4YMEA 1FRKA 1VC0A 3HULA 2ZVIA 1F60B 3MEEA 3CWJA 1GTHA 2OI2A 1HHTP 4L76A 4PG6A 3FQKA 1FVQA 2QA4S 2MKYA 3RTVA 4P7VA 4C7QA 3H90A 4ELVA 2B9XA 4ICLA 5KG6A 3DYAA 5F8HA 3UR3C 3CF5Q 4J91A 2HBQB 1J2VA 2YXLA 2VG6B 2VHGA 3CSKA 5DM6Q 2LU2A 3ZTOA 1HFEL 2QMWA 1A9NB 4M5LA 2ASYA 1VC5A 2XB2D 4LF1A 4ED6A 4WP9A 4M63A 2ZH7A 4LF4F 3IR5B 2N3OA 3M2RB 3TR5A 2LCWA 3CE8A 1C0TB 5E3CA 2NXEA 1BUXA 1D9DA 5EWGA 1N8RT 3ETMA 2AWZA 4L75A 4EO8A 5BYQA 4J9QA 3RAQA 3OJSA 3FSYA 3R1HA 4LF8F 4RUAA 4ILMA 3GB0A 2V8PA 4B3MJ 2B51A 4ID5B 3TAMB 3F56A 5ETLA 4RW7B 1FFSB 4X4QA 4XO0A 2BJ8A 1Q1KA 2BOAA 1AFJA 4WIQA 2ADBA 3PHTA 4CO2A 2FYXA 3HHEA 1NSAA 1WOSA 2OTJS 1K1QA 1MLAA 4CP5A 1IKVB 2QL7B 2UU9J 2COLA 5HK4A 4ZOSA 1HR0J 1N56A 5KT2A 3EGVA 3CCJS 2UUAJ 3B6BA 4QIFA 5HSPA 1MMNA 3HHLB 1RA6A 3CC2S 1FJEB 4KFBA 2MSSA 4IKAA 2UUWA 3KG0A 1X31C 1KLMB 3MUVP 1RLCL 1NJIT 2XNRA 2KVIA 2MLZA 3S7RA 3OTBA 2PN6A 3HCXA 3NKYA 2OJ3A 3CCLS 2W4DA 2LDIA 2CPIA 1FKAF 4CYUB 2UXBJ 4NLUA 3PW0A 2XEXA 2CWXA 2H5JB 1RBLA 3HHKA 2BA9A 2RU3A 1U1OA 5HMXA 3KLEA 1RT4A 4X62F 1T11A 4FF2A 4ED5A 1HMVA 3M8SA 3Q86A 2MY7A 3ISND 4B9TA 3K59A 4ZJQA 2IBOA 5K8OA 4ZPDA 2W4PA 2K2PA 3V2UC 1RTHB 3DLGB 1Q7LB 5CCMA 3C15B 3I31A 1FO1A 3QO9B 5DO2A 2DGQA 1MU2B 1RTIA 2R7WA 2LA4A 2E5LJ 2OHDA 1Q78A 4DR4F 1YRXA 4O0IA 2YX1A 2HHSA 3K5LA 3CULA 1PGZA 4ZPTR 2AJ4A 3QZ8A 2CZ9A 2J76E 4C97A 3HZGA 1JNZB 2RAQA 1AYEA 3T5LA 2CQ2A 4C8KA 5KFZA 1PILA 1EJ7L 4U95A 1UETA 1NEEA 3T41A 1IBKJ 2GVZA 1DURA 1RGVA 2GAHC 4DL5A 6FD1A 3SQOP 4FBTA 2HHVA 1PC4A 4C8OA 3H5UA 1HLWA 1UAWA 2V5HG 3G8SA 5BYSA 4X65F 3K5MA 4QIWD 2ATLA 2JJ4D 4NZ7A 1S5ZA 2P9CA 3EM1A 2ZJRQ 3TANA 2FVCA 4O23A 3A4TA 3N6NA 1Y5IB 3LO3A 4X64J 2ZOMA 1GXLA 2OUGA 3G86A 3Q0AA 2DEIA 3AXMA 3EYZA 2HQFA 2QRRA 2MQLA 3DOLA 3UVJB 2WSFC 2KT3A 2WVCA 2W7PA 4TLRA 5EX3A 1VJWA 3C16B 3H4BA 4RUBA 3PNIA 4DV0J 2L9WA 4KYZA 2RDIA 1M5PC 3Q23A 2ALZA 3QT6A 3EZOA 3Q89A 3KXDA 1S10A 1YJNS 1FJGJ 2W24A 3BKFA 2KJWA 5MAOA 2MJUA 4B3SF 1IBMF 3A8IA 3M9MB 4ECUA 1YRTA 2FD2A 2AX0A 5ITHA 2AJFE 2L9DA 2DRBA 4EUVA 4WE1B 2VQFF 4LR7A 4CH1A 1FNXH 2FJAB 2J6SA 3R3TA 2VG6A 3H2VE 2J7KA 5F9LA 1BXNA 3IAM9 2Z58B 1EIYB 3D3BJ 1QSSA 3H5SA 2Q43A 4YDXA 4HH1A 2HHPA 2R2SA 1ZM4A 3NRBA 1AXQA 2HIQA 2GHPA 1HPZB 2CJ9A 3BDEA 2B4VA 3GIKA 1NZAA 4ZCKA 2J0SD 3LWMA 4WFAQ 4MK7A 3FMBA 4Z2XA 4GKJJ 4XAKA 2YWGA 3Q8VA 1F5AA 3MUTP 3QBCA 3L95X 5BJRA 2BANA 3T1YF 2D69A 1L3KA 4DPOA 2BX6A 3P5TL 2CQ0A 1B7FA 3CMAS 4Q44A 2ZHOA 4OJHA 1TV6A 4PXBA 2OO4A 2I0XA 3O5TB 1CJVA 1XBWA 5KFEA 1VRTA 3FBBA 3MR2A 1FK9B 1G1XA 3QMQA 2AEFA 4NASA 5F41A 3NGUA 2BKPA 1LV5A 2MPUA 4NCBA 2XHWA 1RADB 2BW7A 2IRXA 3HKZD 1WHVA 1NB7A 3MGJA 4M5NA 3C14A 2UP1A 1NPRA 5EDWA 2MXYA 3QT8A 1TFWA 1NHVA 4K50A 2OGUA 1T05B 1P27B 2DGUA 2J7WA 4P2FA 2K7JA 2G13A 2GCFA 3DN9A 4ZIVA 9ATCB 1YBUA 1GT8A 2GA7A 1Y5NB 4PEOA 3KWMA 3M8ZA 2ZJPQ 4CYUA 4QPTA 1C4CA 1YHQS 3EDQB 2ZOGA 3MCMA 4QWDA 1WC6A 5L1IA 3TQEA 5CXTA 1WF1A 4FF4A 3MOJB 1FJCA 3OBIA 5M2PA 1VFJA 2HHHF 1HD0A 1VDHA 4HI1A 3PKYA 3HJVA 2ALYB 5L39A 2DXEA 2RH3A 1N33J 3ZTQA 1REVA 3Q24A 2CNNB 3OTEA 3I5AA 1H73A 2IYIA 3CDAA 3Q8QB 4Q0BB 4YUDA 3F73A 4P6QA 3GJRB 2YNFB 3C15A 5FLXU 1NBEB 3QO9A 1U4BA 2MZTA 2HGLA 4B08A 4DU8A 5DZ6A 4LIWA 2PMHA 3JTNA 5A2QU 3JS9A 4ATNA 2E1AA 4ECZA 4JYAJ 3I4HX 3CJ3A 1FX2A 3M2VA 2E7WA 4UOGA 3IS9B 3C6TB 1JLBA 1ZM9A 2LVWA 2ZE2B 3IC1A 4H4KC 3OTDA 1X4HA 1JJ2R 4EEYA 1U2RA 3MR6A 3KMSA 2HMIB 3K5PA 4CH7A 1FRMA 2AMCB 3P5BP 5FLXY 4RO0A 4TYAA 3MMAB 4DU7A 1OQ3A 2C2NA 4OLPA 1OO0B 5A2QY 4ZHRA 5IWAJ 3PV8A 4K0KJ 1RAGB 2R8JA 2FZCB 2XI2A 2IRYA 4B3TJ 2DCLA 1S9EB 5DDQC 3C16A 1XIQA 2FGOA 2WONA 2CXEA 2CQPA 4N77A 1IKYB 1A6LA 3PRVA 5HP1A 5IXUA 2BABA 3ZZOA 1VQ8S 4BCAA 4OHYA 2O5DA 1VK3A 3KYLA 1LKZA 2V6AA 1I94F 1MMDA 3OT9A 2ZZNA 1SUQA 3OL7A 3I6PA 2JNJA 5C24B 2XGQA 4OHXA 2DEJA 4WE1A 4KGMA 1Z2LA 3VVUA 3EGZA 1B99A 3A8JA 1S7HA 3CDBA 5HQLA 3DRPA 1CEZA 1X5SA 1NK7A 3KUGA 3SDEB 1HPZA 2V2KA 4K4VA 4GVBA 4R5PB 1YTYA 4DSFA 5EUHA 3DXBA 2IA0A 4DQRA 4EI2A 4JV1A 2V67A 4RBUA 1S1WB 4B02A 3HJFA 1WG5A 3EDRB 3QYYA 4F02A 2QA2A 4N76A 3AT1B 1FWKA 4NLYA 4C8MA 3MMBB 4Z7YA 3MM7B 1U1MA 2WSEC 3BKUA 2DO4A 4DV1F 1DLOB 2XBPA 4IFVB 3OTOF 1KQGB 3GJTB 1IBLF 4PPDA 1FK9A 4IUFA 1PJ6A 5J1PA 3AB2B 1CVJA 3N79A 2VODA 4YHHJ 1RXOB 3THPA 4LRDA 4DV6F 4ZN3A 3J7YU 5F0UA 1HBMB 4CLUA 1T05A 1SJQA 3G71S 1UCNA 1Q81T 4DR7J 4Q2LA 4P7TA 2D9OA 4JUZA 4RW9B 2IA6A 1RKIA 4O44B 1LEOA 1R8BA 1CLFA 2J9DE 4WYWA 2RQCA 2P5VA 3D54A 2ZITA 1H6KX 2IAJB 1OY8A 3D6TB 4LT6A 2ZHAA 1IM6A 5GAGU 1MSWD 2B56A 2ACMA 2Q79A 2NXCA 1QE1B 3KMQA 2B9WA 4RBVA 1Y3KA 2VQEF 2MKSA 4MH8A 3M1VB 3SZ2A 4DFJA 1R0AA 3GYXB 2W9CA 1M5SA 3BB5A 4JV2A 2XCAA 4QWCA 4YOEA 1XMOF 4NXNF 1U1PA 2RVJA 5KTQA 1SV5A 1I1GA 1NH7A 3RBDA 4ANDA 1BC6A 5K8NA 2RSQA 4DHVA 4DL0C 1HI1A 2RRNA 5CD4A 5A8RB 5D4PA 1TQLA 3JQMA 3G87A 3M30A 3LGMA 4RNMA 2BJ1A 3J80U 4AL7A 2B5JB 4F3OA 4KY3A 3R9LA 4IR1A 4N8NA 2CPHA 1UVIA 1AUDA 1K9MT 2I8EA 3NS6A 1JXVA 2B7BB 2EXUA 5GADU 2GQCA 3B82A 4MFBA 2KJVA 1PO6A 2XG8A 1T9YA 1T0TV 3S6EA 5BXIA 3ZZYA 4M95A 4ZVUB 4X4RA 1V6HA 4AE5A 2YQ1A 3ISZA 2YQ3A 4M5HA 4NA1A 1WTFA 5D0HA 1KP6A 1NHKL 2P2CB 4KPCA 3HFZB 2MGZB 1SKSA 3PW4A 4J9LA 1WI8A 3BQ0A 1IKYA 2ZM6J 1U47A 1TR0A 4B3RF 4OLOA 2XYGB 2HVDA 2AHOB 2F8MA 2CPFA 2NS1B 4LF6F 3PY8A 4LR9A 3PW2A 1YQHA 3L4BC 5CZVA 5HMYA 1DJ0A 3X1LB 1RWXB 4TQRA 3V6KA 4M5KA 3NNAA 1EX8A 2KT5A 3W7BA 2FHKA 2VB6A 3ENVA 3DKDA 4FS2A 1V3SA 4DSIA 5GAEU 3MR7A 4YP3A 3IAS9 4OYWA 1HBOB 3QFWA 2J7UA 1EQMA 4OX6A 3J81j 2NQPA 1VS3A 3FEXB 3RZAA 3FZ2A 2E66A 3MTKA 2QSFA 5LMNF 3D2WA 2UXCF 4ZCIA 1LW0B 3KKFA 5AE2A 1U7LA 3IA0A 7FD1A 4R5PA 4ZJLA 4IRCA 1FE4A 3NGDA 1TVRB 2C3MA 2QEXS 2OEKA 2VBYA 1N32F 1X7VA 2V69A 2D3O1 5IQ6A 3TZYA 3HT0A 4TY8B 2DR9A 4I67A 1TL3B 3A12A 3GV8B 3MMBA 3QWPA 1RAIB 1NKCA 3Q22A 4PXDA 3T1HJ 2C22A 1ZH5A 4OX9F 1S9GA 3MZIA 4CI0B 3GSDA 5EWEA 2GGPB 1FT8A 3CDWA 3IFEA 1LWXA 3PTWA 3UD5A 3EXCX 3L3CA 3QRRA 2NREA 1URNA 3H98A 2VPYB 1G2EA 1WDTA 1OWXA 5DGBA 1UPPA 5SZTA 2V9WA 3E01A 4KGZB 1HBMA 1NJYA 2KH9A 4FNHA 2XSJA 2YWHA 4NPOA 2EBEA 3D5MA 1RT3B 3DCAA 4TU9A 3L09A 3AA8A 2Y8YA 3R5JB 4EGLA 1S7IA 3MPDA 3RB4A 2DITA 1Q8IA 2CVIA 2IAJA 2XO6A 4LBHA 1RLDA 3EMTA 1VISA 2M5YA 3RJMB 4Y2KA 2CG8A 1YIJS 1MROB 3RRKA 3KJNB 3K7RA 1N6QB 4TKTA 4K59A 1RWKB 4KIAA 1UJ6A 1VIOA 1IJEB 4LSLB 4N47A 1UWAA 4DSKA 4ANCA 1HYSB 3BSNA 3BGRB 1S0OA 1K1SA 4C98A 1SCJB 4DPTA 5A76A 2AEJA 2BACA 2HHQA 1N5SA 3PX0A 2G2ZA 3K5OA 4DV3F 1K8AT 4LF9F 2CPYA 4YN3B 4FYXB 2F8EX 2RUSA 5HQMA 1J5OB 2QZ8A 3I55S 2ZH9A 1XNRJ 3TZWA 3DLKB 5B08A 2MB0B 2UUCF 2B5JA 1TTHB 2C28A 3K58A 1YDLA 4OZLA 1FD2A 1UJ5A 1U6BA 3QNWB 1X9SA 1KONA 3HSDA 2FUG9 1Q95G 1DQ9A 3ZTPA 2N82B 1TK8A 3R97A 2GO8A 3D0HE 1N0VC 4NYPA 4ILRA 4LF7F 4F0HA 2Q3PA 2XWYA 2LQJA 2IVYA 2FC9A 4ECVA 2RDDA 4NA2A 4OJ1A 3KLFB 4BC7A 1HBNB 1NZ8A 2JEJA 1G3OA 3NGTA 1YG0A 2GHWA 1JQGA 2MGZA 2OPRB 2X3GA 4KKOA 4KGXB 2MHEA 1VQYA 1HNIA 1Q7YT 1RT7B 1Y7PA 1GXTA 5DG9A 1RWOB 4EBDA 2YNHB 2M70A 4EMDA 3OQ2A 2N3LA 1KR4A 3FBEA 3FC9A 2UVWA 1RT6A 2DGTA 1IKWA 3IO1A 4LVNP 2N4CA 1GX6A 1DQ8A 1F3FA 3MAQA 3OFFA 3D67A 3HMJG 3DHXA 2NUUG 4OV6A 1S6QA 3QIDA 4JI2J 2F3JA 1RHMB 1UWBB 4NLGA 4ZP9A 1XEZA 2CQCA 4F4YA 3MCOA 2GAGC 1GFWB 5KFLA 3GU0A 1UVKA 1TVRA 3H5XA 1SB6A 2IFXA 1VBXA 3HI9A 4IRDA 4Q2MA 2F4VF 1WG4A 2RILA 4CNYA 4RWXA 3PFOA 3DLBA 2Z8QA 2B9EA 4KE5A 3U1NA 3ILJA 2YKAA 2KDOA 1TL3A 5KG1A 1F2HA 5E0OA 2CVEA 5F8MA 3A1YG 3G82B 4ZPVR 2GO9A 2FHJA 3JSRA 2Y0BB 4HT5A 1NRKA 3THVA 3L7UA 3MF5A 1HQ2A 1QD1A 1ELOA 2QV6A 2JFDA 4OZ1A 2YH1A 3G96A 3CEDA 4UZCA 1FXDA 1PJ5A 2QT7A 2QJ3A 4LFCJ 2F7VA 1NHUA 1I6JA 4O3NA 4HL9A 4NXMF 1U2FA 1RE1B 2P9EA 5CYJA 3G4SS 1QLNA 4B3SJ 1S1UB 1NUEA 2OPQB 2RNEA 3RGIA 3RRGA 1Z4UA 2XMVA 2ASJA 2DKOB 4LVOP 4IDKA 3UPFA 3T9ZA 5D3GB 4JBCA 4QW9A 4MKVA 4B9SA 1HWJA 4Y2CA 4F50A 3GE9A 2E29A 1Y9OA 2KXNB 1KTVA 1N6QA 2BZ2A 4KPYA 2R7QA 1Q53A 5GVQA 4PQUA 1D1UA 1T3OA 3NCPA 2CQ3A 2EFOA 5I3PA 2YWKA 4FYYB 4DR1J 4N5SA 3D68A 3OLBA 3SV4A 3V81B 5SUHA 3T1YJ 2B8PA 3LGNA 4CLYA 1T9WA 2AGOA 2XLKA 3CJ5A 1Q16B 5K14A 2KG1A 5H9FJ 3FMWA 2FQQB 1N0UA 5CD4H 3E2EA 3RRHA 1S99A 2RT3A 3R5DA 4DQIA 1NPKA 2IDEA 1TKDA 1EKRA 2MKIA 3W64A 2YKMA 2A6MA 5EWFA 4H4MB 3ADAC 2ZZMA 1D8YA 1K73T 1VOMA 3IBFB 2VFRA 2MJNA 4NMXA 4B3MF 4U7UK 5E3QA 1TKXB 4C48A 4DL6A 3DRRA 4HYKA 1JLCB 2AYGA 3VWSA 4YY3J 2C2MB 3M8PB 4PWUA 3SCIE 2ABYA 2NLWA 2AV5A 1XNQJ 3R5CA 1N5YB 1NJWA 1Y4ZB 2YQ0A 2V9KA 4ECXA 3D6MB 5IQQA 2UU9F 5KFQA 5DG8A 1HR0F 2QE5A 1WSVA 2QLFB 2UUAF 1NK0A 4FF1A 4A8OA 4KHPJ 2QN6B 4ILLA 2HHXA 4FXDA 3CD7A 4K4TA 5KAKA 4LFBJ 1NM2A 1NKEA 4LIRA 3DRYA 1J5EJ 3MEGA 1X4GA 3O1LA 2UXBF 3D6FB 3TO8A 4ED1A 3HDSA 3GR1A 2AJ1A 5I3UB 1QTNB 6FDRA 2BMBA 4ED8A 4OQJA 4MMOA 3GFHA 4Y0FA 4HDHA 3MPVA 4NOHA 5KFCA 2ZH1A 2HQDA 1ZM2A 1ZOTA 4HT7A 2VC1A 2FHJD 3NL0A 4C8NA 3CD0A 3QIPB 3SI8A 2GV1A 3UNYA 2MTLA 2MQNA 3MAHA 3KK1B 4DUYJ 4G1IA 1T95A 1F9HA 4PABA 1HD1A 4QYRA 5KFAA 1VRUB 1WKLA 2E5LF 3VV2B 4QIGA 3PYDA 2KB2A 2ZOFA 3DDNA 4YB7A 3W63A 5C5JA 2BM1A 2B8QA 2JC0A 1B3TA 1WUUA 1IBKF 1FCAA 3M6WA 2WBRA 2FZKB 3SSQA 4WF9Q 1TL4A 1KFDA 1JLGA 3KNAA 2MQPA 1CC8A 3KDNA 2NR0A 4WIIA 1V5VA 3W8PA 3J7ZT 2JSXA 4BHQA 2OPQA 4X64F 3ET6A 2PSZA 1MWYA 1VJQA 2DIVA 3ZZ0A 5D6GA 2PEHA 3ENQA 2JL9A 2J9DA 3QGGA 5D3GA 2B0GA 3H20A 5HQ8A 3E51A 3H40A 2C3YA 3OTCA 8RUCA 4TU7A 2UUBJ 4DV0F 3C46A 4O4GB 1LWFB 2DGOA 3D0IE 4NZ6A 4LUBA 5KG4A 5JMNA 1FJGF 3CCVS 2J0WA 3PEJA 4IO9Q 2ZH5A 3U02A 4PWDB 4OZ2A 5KT5A 1TL1A 1TUGB 1UEVA 2FLPA 3OL9A 2B43A 3V81A 3FCHA 2CG4A 2GS8A 1UKUA 1P8GA 4RW6A 3TUZC 3DOKB 2W8LA 1M1GA 4DR2J 3WIUA 4RW4B 2MKHA 2HVEA 1EETB 4X66J 2ROPA 4DCPB 3IM9A 1KC8T 3MM8A 4JI3J 3WX4A 2BQUA 3TUJC 4GKJF 1JXEA 4H4MA 5B0BA 2OPPA 4I2PB 5C25B 4AUKA 4O3SA 2M52A 4CLPA 1JNRB 1WNEA 3LALA 4B17A 3ZO7A 4J9OA 1CBKA 3PHEA 5KFKA 2ZBPA 2BUNA 4ZJOA 2KFZA 4I2QB 5IM0A 2J6TA 2BXJA 1N5YA 1LOUA 4ES2A 1U02A 3PZPA 4DUZJ 1H72C 3HSJA 2P6TA 3UQSA 3W2VB 2LXFA 3OR1B 4A46A 2G1DA 3QJJA 4NXNJ 1WC1A 4FYVB 3G6YA 4P74A 2DNKA 3BGFA 3FSIA 3MDFA 1ZPVA 1VGYA 3M8QB 3AQPA 1YBAA 2ATCB 4Q8EA 1PYOB 3M9NB 2M2BA 1PAUB 2RE1A 1OPIA 4MKAA 4AXJA 1X5OA 3A3OB 2OEJA 4UY8T 4JI7F 4ZPAA 2LDYA 4NRUA 1N33F 4FS1A 2VICA 2BOPA 5KFXA 2CJYB 3NGRA 3DGPB 1KN6A 3VGUA 1X5TA 2E5IA 2F5GA 3KG1A 4DV2J 1BMQB 1KSPA 2DGWA 6AT1B 3LP1B 1S1TA 1XR6A 5HVHA 1NDPA 4F25A 1SL0A 4EFAC 4OYXA 5H9FK 3LA0A 1BQNB 1VK8A 3QSIA 1L3SA 4JYAF 3IG1B 2B4PA 1VQSA 3NG8A 3CCUS 1LK5A 2FVSA 1TL7A 5KFSA 4XIUA 3OW2R 4Y34A 5ETOA 4FKXA 5LMUF 3KHGA 1S59A 4WFBQ 1O5JA 1VQ9S 3MM9A 2KZZA 3P3DA 3QT7A 2RKIA 5AJ3J 2YNGB 3KG4A 3I0RA 3I87A 1S12A 2FJVA 2F40A 2NPIA 5J2PA 1JJHA 2BQRA 4G1PA 3OXGA 1VQOS 3GZ7A 1M90T 3V6DA 5KG7A 4G65A 5IWAF 1CG2A 1RAHB 2DPJA 4K0KF 3DMJA 3KHHA 4E98A 4B3TF 4DX5A 3BBBA 1FD8A 2EFGA 3DOMB 2DYAA 2B9YA 3BGOP 4BLGA 1B4SA 1FESA 1FRHA 3TOQA 4O4GA 1LWFA 2HNDB 4OYMA 2D9PA 4OHVA 2JEIA 3FJ2A 3P4UB 2AW0A 3A3PB 2CUYA 3KLIB 3IRXB 4K4XA 4IOCQ 5HI7A 3UCGA 2YNIB 5HVGA 1XTZA 3CDEA 2BJ9A 3W9JA 3W9HA 1U24A 1SXLA 1NSQA 4OHWA 3DOKA 4ETXA 4USMA 2DBBA 2OMLA 3UN3A 1CS4B 1EKSA 2FHMA 3GG0A 2OFGX 4CLFA 2LKZA 2VUGA 4NMLA 4HTIA 2XNQA 1NCLA 3BSCA 4CLWA 2G4BA 1DTQB 4LQ3A 3KK3A 1XMBA 2I38A 3EXYA 3MR3A 4QYZJ 1U0HB 1TMJA 4P10A 4WJBA 3V4MA 5B7WA 2QSWA 3OXFA 4Y2MA 3IR6B 3GLJA 3JTPA 2CNKB 5D15A 3HD1A 2E44A 1U6FA 1MW7A 2YWFA 1K47A 5ETTA 3ZZTA 3T6BA 2CYYA 4I2QA 5HLFB 2AJQA 4DR6J 3H8YA 1NO8A 4ZLJA 2E5JA 1XWLA 2HS3A 1OJ4A 1RT1B 1OSCA 3W2VA 2FVQA 2CDRB 4YFUA 4YHHF 3OR1A 1FEEA 3ZC4A 3AJ2A 2AYMA 2D3UA 4W90B 2WOMB 2ZNZA 2DHHA 3NCQA 2QX0A 4F36A 3HK2A 2AEMA 5HVFA 3I82A 2ACYA 2ROGA 2E1MC 4DR7F 2OSRA 3NXZA 1CPZA 1M1HA 3CCQS 1T94A 4PYAA 2QMUB 2BV3A 4JI6J 4DOZA 3UI3A 4ZA1A 4AD6A 3T5KA 4HI2A 2HFVA 1BWEA 1GH8A 1ZYQA 3H42A 5CYQA 1RWMB 3J7YI 3HVRA 4MIBA 2X1AA 2NZCA 4X4PA 1D0EA 4RUCA 3H4DA 1RP5A 4B3OA 3GMGA 1H2UX 3TVZA 4KC5A 4PYDA 2BJDA 3CCMS 2AGPA 3DGPA 2F1FA 4F3QA 4MKYA 4QU6A 5GAGI 2XGPA 4KR0B 1LW2B 4DV5J 4IH6A 4GC6A 2X7IA 2EFNA 2CJKA 2BRLA 1FTCA 2PFFB 2PEBA 4LF7J 2LA6A 1P1LA 1UA1A 3Q8YA 1DRZA 2DB1A 3IG1A 3QZ7A 4J9PA 2B4OA 2CQHA 1PG5B 2PC6A 4DPUA 3W2WA 2ZH6A 1RTJA 2MQMA 1RWPB 2AP6A 4ZLNA 2MQQA 4R8UA 2LQBA 2PT0A 3R2DJ 4MYUA 3M2UB 5EN1A 1KQFB 3POTA 4KFBB 2O1PA 1Y0HA 2YNGA 2WB1D 4FPIA 1B70B 1X9WA 1N5QA 2ZFHA 1KRPA 3PRDA 2JDJA 1GXUA 5J1EA 3FDSA 2GMHA 3TW0A 3JQKA 1ZA2B 3J7A1 4QR2A 2MQ8A 1T02A 1DHMA 1FFGB 5GADI 3EE3A 3DOMA 1NAQA 2X3DA 3W66A 2CPZA 4B9MA 4DMZA 4K5SA 3U7JA 4DPXA 2ZM6F 1L3VA 3KLEB 1RT4B 1WKJA 1RT5A 2DNHA 3M8RA 1HMVB 1WEYA 3IXQA 4HHJA 1RSCA 3RBZA 3KLIA 2UVUA 1RU1A 2QL9B 1FEHA 1SJ3P 2DVIA 2YVSA 4UQGA 3VALA 4ERDA 2ZDPA 3CCSS 1B0VA 1RTIB 3X3UA 2DCUB 4EYIB 2MQOA 1MG7A 1HNXJ 3UDEA 4BC9A 4FXVA 5F9NA 3BYPA 1KLNA 1S6PA 5ETNA 1HQUB 2UXDJ 5KFHA 4TY9A 2KI2A 1YJ7A 2G9OA 2GVZB 2QLBB 3D7SB 3DXSX 7FDRA 4ZVQB 4GMKA 4P9SA 4ECRA 2K7KA 4CLLA 3DU6A 5F8IA 2YPYA 2B6AA 3SSSA 3QQCD 4EBEA 1U0HA 4MJKA 4ED7A 1DFDA 3PO4A 5GAEI 5IT0A 2M3DA 5KT6A 4ECTA 3MD3A 2J5AA 3O8WA 1SQFA 4ZMMA 2DNPA 3PG9A 4QCLA 3T1HF 4A8FA 2HFNA 1B0PA 4J37A 2ZH8A 5IC4B 1BGXT 3R2CJ 3DOLB 2OFHX 3TJAA 1RT1A 2XY5A 3UCUP 4PG8A 1P6TA 5LOQA 2A1BA 1VHIA 1YJ9S 2G1HA 1JLQA 2WOMA 2VPZB 2RF2B 5E5NA 4Y00A 3C19A 5DRKA 4YR2A 1KNZA 2EK1A 5HJYA 2FHOB 1W25A 2RRBA 1DTTB 3DHWC 1Q8BA 2DRAA 2A0FB 2ASLA 5B0GA 1OYDA 4DX8H 4OV1A 3CJ0A 1YJUA 3LPEA 3TA0A 2IM3A 3PR4A 5LSOA 1RHJB 1FRIA 3BBCA 1D3WA 2ASDA 2XS7A 3JQJA 4KV8B 2YKPA 3AHPA 2H48B 2Y1LB 2JRSA 1Y11A 2OPSA 4ZK7M 1U1RA 4B9VA 2IYGA 3UDVA 1MNEA 2FJWA 2VDIA 1VBYA 4U6PA 2ILYA 1IWGA 4C8LA 4ZIWA 1HQEA 4CO3A 3CC4S 1F5CA 2Z0GA 2V34A 2PIIA 1LW2A 1ACMB 2BANB 1JLAA 4FP9A 4KB7A 1YVFA 1VBKA 3BGUA 2Y1IA 3JTOA 1TV6B 2C2ZB 2LEBA 3L7PA 1XNRF 1S1XB 5E41A 1CJVB 5C42A 1VRTB 4JI4J 2DHSA 3AD7C 4QYZK 1RISA 1JXLA 2EFPA 4WKRA 4DZDA 1B0TA 2QFIA 3CJ2A 3UN2A 3M2UA 3C14B 2ROEA 2W2PP 3MAAA 3RW7A 4U67Q 5KT7A 2GHVC 3OUYA 4UZBA 3GQCA 5IS2A 3VAFA 2DT9A 4E8UA 4DR5J 2GW8A 1NJZA 2I1RA 3PIPQ 3OD2A 2Z2YB 1WD6A 3PKMA 2YH0A 2DNYA 1OQ6A 3TQ1A 1IVZA 4DCOB 3RB3A 3W9IA 3PYFA 4NE9C 2H3EB 4MYTA 4CM2A 2E1RA 3GG1A 4J90A 5KFJA 3ILLA 2E7XA 1D8ZA 2CA9A 4P52A 3PW5A 3FRZA 5I42B 1NXIA 3VVTA 1NH8A 1O51A 5LXRA 3OFEA 2E9TA 4LSNB 2CIMA 1WACA 1REVB 3NS5A 2J0QD 4NCAA 4NCGA 3E3XA 1R6VA 2WAQD 2WZ1A 4QQBA 3GSIA 4MTPA 4O3OA 5F8LA 3UNGC 1U45A 1GMWD 4AFFA 5KG5A 1M0SA 3CMQA 1UW9A 2VA3A 3MECB 1VYAA 3H0PA 4HACA 1S6OA 4JI2F 2DNGA 2BE9B 2BE7D 1U2CA 5D0RA 5KG3A 1K0VA 1HQUA 3D0GE 4I6WA 2XTJP 3M2VB 2RQKA 1JLFA 4QWBA 3HM9A 1T9UA 1RT2B 3NEKA 4FVCA 1ZETA 1JLBB 2H4WB 1P9QC 3HKWA 4Q5VA 4K4SA 1IM4A 5GMKa 5A0YA 3BO4A 2FJDB 2QTWA 1OYEA 4DL4A 1SKUB 3TP2A 1ZTTA 3AY0A 1S4EA 2KRBA 4FYDA 3RAXA 1BQMB 1FI4A 1FDNA 4K5RA 4ZHRB 3BREA 3OSNA 1AFIA 1FHTA 2VOOA 2YBVA 4U96A 3VAHA 2V8VA 1ZS6A 2HYIB 2R7VA 4L73A 3IM8A 1BY9A 3W5ZA 3TWZA 2G2OA 5DQHA 4K8RA 4LBPA 2WONB 2JEFA 3HFKA 3KUEA 2HNZA 5HP1B 1R8PA 4LFCF 1OSDA 4ZPCA 2QYGA 3W60A 4Z37A 1S9FA 1WHYA 2RF2A 4KQZA 2CNOB 2MLYA 2KN4A 2BJ3A 1Q5YA 4DWIA 1QAYA 1DTTA 4UUWA 1SUQB 3OPKA 2VBWA 2MY8A 4DV4F 1S77D 1UZHA 4NI2A 3K2YA 5DLGA 3TX8A 3DLHA 3GFZA 5J2NA 2VA2A 2VFSA 5HANA 2VFTA 1V3RA 3W8GA 4M5DB 3J81U 2Y0SD 2DHAA 3DRPB 2QO3A 4K2JA 4G6VB 2HNYB 4IOBA 4KV8A 4CT8A 3K0JA 3M6XA 2J9EA 3JXOA 4GVBB 2ZVSA 2MLXA 3SCJE 5KFIA 4ZVFA 3OVSA 1IR1A 1V3ZA 3W5XA 4DR1F 2HKEA 4DL3A 2MMYA 3BKTA 2FJBB 3I0SB 4ED4A 2CPJA 4WCEQ 2H65B 3HXMA 1FERA 3LWLA 1N34J 4B9NA 3HPOA 1WF2A 1ZZNA 1S1XA 3UD3P 3J81Y 4Q8FA 2CPEA 4RKUC 1VC6A 4ITSA 1KS2A 3IR7B 3RYLA 3HSZA 4WFNQ 2BJ7A 4IYQA 5EHHA 3MMCA 2IIHA 5G0RA 5GAHU 3IGVA 1AZSA 5DZ7A 3MI7X 3UE2A 3QGHA 2E9ZA 4P2SA 4BWMA 2Z2ZA 1UP1A 4MIWA 4PR6A 3P96A 1YLXA 4WBFA 4U8VA 2RQMA 1VQ6S 3TJ8A 1HWUA 5KT3A 4YY3F 2CNLB 4CDIA 3MOZA 1TMMA 1VQMS 2ZD1A 2BQ3A 4QIEA 1XNQF 5AXKA 1SQGA 4LRFA 3GR0A 2L9NA 2KVQE 5CAAA 3P6YC 4QZVB 3OR2A 1S6UA 4JI7J 5I42A 3TEHB 1R0AB 4J9UE 2W9CB 3DC2A 4U8YA 3F0NA 1F6TA 4KHPF 4LSNA 4DSEA 1TKZA 4LFBF 2O66A 1SV5B 5CYMB 1SC6A 1J5EF 1QTMA 2GFFA 3BBFA 1EP4A 5HO4A 4KRWA 2H1YA 1U49A 3MECA 3PO5A 4JI8J 2VBXA 2IM1A 1VRQC 4ZDNA 3VAMA 3H7HB 4RR5A 2Z2MA 2HK3A 2F9DA 3M30B 1NU4A 1RAJA 2H5EA 4A8QA 1N54B 2ZBIA 1CJTA 1RT2A 4N56A 1Q4RA 1ITPA 1OS5A 5LMUJ 2Y1RI 2NSBA 1W2BR 1RWUA 3D1OA 4A8XA 4DR3F 4MFBB 1RU2A 4D3HA 5B09A 5DETA 4DUYF 2IY5B 1YX2A 4OJGA 3UCZP 2QA1A 1S0NA 2HRUA 4CO1A 2BM0A 1D9AA 2VG7B 4IRKA 5KFVA 1BQMA 2HRYA 2H54B 4A4JA 2V8DA 1C4AA 4AXIA 3EX7B 4CTAA 2HWIA 3I9ZA 1GMUA 3DLLQ 3GIIA 1XJWB 2EWHA 4DDFA 3HD2A 3G6VA 3QJLA 4C2MA 1KDNA 1FF2A 4ECWA 3MR5A 4IH5A 4DJBA 1I51B 3KNGA 4J9SA 4XTTA 2CPXA 5H1SV 3EGNA 1KHWA 1IR2A 1P1TA 2DHXA 3CVKA 5CA5A 4ZVTB 1JX4A 1OIAA 2M0GB 3GCWP 2GNKA 4JV5J 1TAUA 1U6ZA 2EBGA 4RL1A 4F4ZA 1HA1A 4DFKA 5A6PA 2D74B 2DR6A 3PJ9A 1XMQJ 5KFGA 5DDPC 1NK8A 4M5DA 3DI6A 1KQKA 1EAYC 4ALZA 5FJ4A 1AROP 4WFXA 2XMAA 4CZCA 2UUBF 3ITHA 2HNYA 4KT0C 1FFWB 3ZTRA 3UDLA 1EARA 3SIPB 3G9CA 3PXGa 1C0UB 1PC5A 1CQMA 1SVDA 1CJKB 2XCPA 2FVRA 3LW5C 5FDLB 2DNMA 4M5MA 5K20B 2BDPA 1U8SA 3N6MA 2XC9A 1H98A 1WC0A 3I0SA 2YKNA 2VDHA 3QFHA 4FYWB 5AXMA 4OL8A 3MPWA 4GO7X 1HHQA 1EZZB 1QUVA 1T3NA 4DR2F 5IV4A 2L48A 4OI1A 1J27A 2IMOA 4X66F 4LQ9A 1T03A 2OAUA 1TUWA 1VHFA 1S9GB 3M6UA 1QY7A 4WZMA 3L9ZA 4MT1A 4JI3F 2OLWA 2OSQA 1RJJA 4HEA9 3EUNA 3D6HB 1G7CB 3GIRA 4KHMA 3ONQA 3E01B 1N5TA 3LP0A 4P2MA 2XSJB 1Y10A 3QSYB 4I7FB 2A6OA 4W92B 3R6LB 3FGVA 1U8WA 2WRMA 2Q6CA 1X4DA 3P45B 1YJWS 3K57A 2V4JA 4YDDB 3PM9A 1LXJA 4DUZF 3CT9A 1A7GE 4D3GA 1V5IB 1JMTA 4P71A 4DX7A 1RDRA 3QPIA 1YZ7A 2ZKTA 3AD8C 3R5AA 4XDCA 2V8HA 2ZBRA 3FBCA 1S0VA 4W98A 4XPCA 3TUIC 4C11B 3HP6A 4DSLA 2O01C 2XMKA 1VBZA 2EI5A 2CADA 3HHLC 5CYMA 4QWEA 2K8GA 1URRA 4PKDB 2MDAA 1XR5A 2GJIA 2Q1LA 1NK5A 4XDDA 3W3SA 2D41A 5HMWA 5D4LA 4U7UD 5L8RC 4BS2A 5KFTA 2XY6A 1NK4A 1M5HA 3GFXA 3NGKA 2ZWPA 2HQ3A 4CT9A 3R7BB 1HNZJ 1VQ4S 3KK2B 1SL2A 4O3PA 2ILZA 4M1KA 3RG6A 4RNOA 4UUXA 5F3TA 3QT5A 1YITS 2XZWA 5IT4A 2CQGA 4JOUA 4DV2F 2BKNA 2AJ0A 2EEYA 2IM2A 1IR0A 2YY3A 1RB0A 5C7PA 8ATCB 3M8YA 2VG7A 5J2MB 4DS5A 2ZJQQ 1RAFB 5I3QA 3CNQP 1RCOB 2JLFA 3J80Y 2WVFA 4ZVGA 5BR8J 4KKOB 3OL8A 2YKOA 5RUBA 4QOTA 1HNIB 1YJRA 5EX0A 1T9XA 1JKHB 4WU2A 2NPFA 2VKZG 2CPDA 4ZCMA 1NJXA 5LL6d 1RT6B 3KLHA 3Q8RB 1IKWB 5AJ3F 4C0OC 3B78A 3WIVA 4OYAA 1NK9A 4M5JA 3UDCA 2HW3A 3BGLA 2OELA 2GX8A 2JX2A 3AH6A 2KT2A 2XQCA 1CSJA 3MEKA 5D4OA 1AT1B 5KFRA 3M32A 3DU5A 4DLGA 1PIEA 1S6QB 5E3AA 3JB9k 1VQ5S 3VGVA 4NYOA 1FNOA 4NLDA 4QBUA 2PFDA 1HNWJ 4A8WA 3HVAA 1N5VA 1C0UA 2JOQA 4QPXA 2W2NP 1U48A 2NYIA 2ZUGA 3CGIA 1CJKA 3ZNJ1 2PI5A 4JI5J 3SCLE 5FDLA 4A47A 4DQSA 4USUA 2A10A 3DLJA 1T9TA 3OSPA 4F4WA 3OV7A 3OHAA 1DAXA 1XC9A 2A18A 1JLEA 4LREA 3LF0A 3IWLA 3FQLA 1G4CA 1X0PA 3OJUA 2I6WA 3EZ5A 5T7LB 2L08A 2PO4A 4DUTA 2WTFA 2LP4A 2C2DA 5L1LA 1VQNS 1RQ0A 2ZZTA 3CO0P 4FXWA 3GJQB 4RZRA 4OFZA 1Q79A 1WEXA 4NYZA 1IUJA 3DGVA 4BBYA 3KOAA 3T19A 4IG0A 1CJUA 2WVBA 3G6XA 2DNRA 4NEYA 4F2SA 2BVZA 1JIHA 3Q83A 4DLEA 3HHNB 2XMUA 1R43A 4ZVRB 4I7FA 4OI0A 5ETPA 4O4RA 3G8QA 1PBAA 4PPZA 2J6UA 3BN4A 3PJXA 2F63A 4DF4A 4IDKB 2DGVA 5B0AA 4ID8A 2RUGA 2EC2A 4DR6F 4C3KA 2FJEB 2ZKUA 1OY6A 3CMES 4LBIA 3C3LA 1Q8KA 2R4FA 4H4OB 2BW2A 3FCWA 1RHRB 5LSLA 3NGSA 5C2GA 3O3LA 1L5UA 1SJ4P 4A8YA 4RW8B 5EGYA 1SC1B 2JWNA 1MMLA 3LAMA 1PBUA 1S97A 3T1AA 3GONA 4C11A 4PQUB 5ETRA 3TZZA 2HG4A 2V0NA 1T7PA 2SXLA 4CH0S 2ZUAA 1HI8A 3NMAA 4Q45A 2WVEA 5K8MA 4JI6F 4UW2A 4F4XA 2U1AA 3FK4A 3VTIA 5L1KA 3ZNUA 3JSBA 1YJVA 1KBRA 3AODA 4IR9A 2HBRB 2K06A 2X51A 2NSCA 2HVIA 2Z30B 1SH3A 1PAEX 1X0FA 5K14B 2E7VA 3SEOA 3GCXP 5LT5A 1S48A 2I5JA 3HO1A 4DSJA 3KK2A 3DRXA 1LK7A 3CCRS 2YKMB 3US5A 1C1CA 2Z57B 2MZJA 2ERRA 3HZEA 5AXNA 4WU3A 2CZVC 1WDDA 4DV5F 4J7CA 3NBPA 4NZ0A 4KGVB 5J2MA 2C42A 3DRRB 4FPRA 2OMOA 2J0XA 2WW8A 3D4JA 4ENOA 4ECYA 4J9MA 3CTRA 3BQ2A 1V9OA 1RWNB 3WDOA 1R7IA 4PG5A 1JKHA 3S1TA 5DQIA 2V50A 5HJXA 2W9AA 1X4EA 4A8MP 2FVPA 1WJ9A 3OHBA 3QRQA 2KRRA 2R7TA 5LXYA 3OLAA 4HHUA 3KDOA 1WHWA 2C2EA 1VLOA 4RPFA 1Y5LB 3O44A 2VD3A 4Y6IA 1L3TA 3MEGB 5J2QB 4LF2A 4RU9A 4PG4A 4ELUA 3GILA 1FRXA 4I69A 1QAJA 1TUVA 2GQ2A 1HWIA 3TI0A 2C3PA 3AD9C 3LP2B 2IPOB 4C0BA 2LQ8A 4C8YA 4JI1J 2GIFA 2MKCA 1WC4A 1KFSA 2H5IB 4CLTA 4U7CA 2DXDA 2PGCA 1N4LA 1VQPS 2J9CA 4ECQA 1OMSA 4E0DA 5F3ZA 4EYHB 2D7SA 2AZ1A 4L72B 1RHKB 4YQWA 2R3VA 5B0DA 2W2QP 2MYFA 3A8KA 5KFOA 1DQAA 3H59A 5CABA 1HNXF 2AYEA 3KUHA 2IJFA 5T7LA 3H2UB 3S8SA 2UXDF 3NLCA 2RIJA 1F1BB 3ENAA 1N36J 3M2RA 4I64A 4LFAJ 1C0TA 5K5MA 1Y00A 3LH2S 1H7WA 2FPHX 2EW9A 4CNZA 2X1BA 1IQZA 3T3FA 2EVZA 4JV0A 1JLGB 4LF5J 1REGX 1CC7A 4M94A 1KKHA 2PA3A 4ID5A 3TAMA 1JK9B 4M5IA 4OYIA 4RW7A 3ET6B 3CW2C 3HHDA 4DV4J 2CZ4A 3JYTB 2W2OP 1NNDA 3MFHA 4KHRA 1RUSA 1IKVA 4H4OA 4YR3A 4C0HA 4XPEA 1TKTB 1X4BA 3JSYA 4WPAA 3HHLA 3RUBL 2W8KA 5IZHA 3ILOA 4RW8A 1KLMA 3N28A 1TELA 5ETVA 1R0BG 1SJRA 3I9V9 1TL1B 2XMMA 3IN5A 2N7CA 4HHHA 4MK8A 2YKQA 2R7RA 5DM7Q 4RW6B 2XM3A 3BH6B 4USKA 4LRAA 4P2XA 2LFVA 1SIWB 1NDKA 1LXNA 5JJBA 3H25A 4WFZA 3K5NA 1UW4A 3EPGA 2V2VA 1SPBP 2IJRA 3C6UB 4QIVA 3MM8B 1RTHA 3DLGA 2YTCA 1LWCB 2ZWOA 2KM8C 2Q66A 1A0OB 2HHWA 4N41A 4RWWA 3BO2A 1PJ7A 2RRAA 1MU2A 2OPPB 2RS2A 1FVSA 2DRDA 2FLLA 1GK8A 3RBEA 4RX6A 4ED0A 4YR0A 2AF6A 1ZAXA 1XR7A 3CUNA 2VOPA 2BRKA 4C4WA 4W4MA 1TU0B 5IM0B 3BS9A 4YB5A 2E5GA 3JSMB 4QWAA 2CKWA 4JI4F 3C2PA 3BH7B 1UEKA 1H7XA 3ICLA 1YI2S 3U1MA 4OZ0A 4UQTA 3CJTA 3NS7B 5G4DA 4PAAA 4F26A 3UWTA 3VAJA 4NLQA 4HDGA 2QYCA 1NLKL 5AE1A 2HWTA 4Y2IA 2PD1A 3BJYA 2HK2A 1S79A 2A2CA 4NLOA 3GFYA 2HURA 3VGSA 3GIMA 3AXKA 1XN9A 3U1LA 4TVAB 4GKKJ 3BO3A 4NLWA 4X4OA 1QJHA 4DR5F 1R8HA 4KJIA 3FVYA 3GP9A 5A8KB 3PFEA 1UZDA 3N6LA 2QMXA 2IC3B 2M9KA 3CCES 1RWWB 4JI0J 1H3DA 4X2BA 3SV3A 4I6YA 4CO5A 5J2QA 3R6GB 2DHGA 3UVJA 4ECSA 4C3LA 2R8IA 2LECA 2ZDOA 1KVJA 4X4VA 1FE0A 4DN0A 2JH3A 4PZVA 3LP2A 2XMTA 4AQYJ 2W2MP 1QAIA 3KJVB 2KYXA 2IVMA 2V2QA 2M7SA 1RHUB 5ADZA 2E5HA 4DR3J 2HAIA 3KTQA 2GZOA 3V4IB 2Y1JA 4YS2A 3ZFVA 4TU8A 1S1TB 4DBQA 1U25A 3VQTA 4WK3A 2PDAA 2DNLA 1M5OC 1KVKA 1O0PA 2R7OA 2F8HA 2MZRA 1ZPWX 1TL7B 4F4KA 2FLNA 4M8LA 3BQ1A 4NWBA 3I32A 3KJFB 1APSA 3AJ1A 1FRJA 1KHVA 3MM9B 5KFFA 2JHEA 2HFZA 5L9XA 1KQSR 5B0CA 2RKIB 3WHIA 2JC1A 3VAIA 2R2TA 3I0RB 3M4XA 3EICA 3HHLD 5J2PB 4TQSA 2H51B 3H5YA 4USTA 1ZTWA 4YB6A 2IJNA 4DS4A 3V6DB 1U1KA 3JYTA 2R8KA 3ULHA 1H38A 3DMJB 3VQSA 3LPYA 2W1BA 1Q82T 4TLQA 1TK0A 1YK9A 3W61A 1Q5VA 2OH2A 2OP5A 3K89A 1TKTA 1GNKA 4OI3A 2ZBCA 3CDUA 3I56S 5KFPA 4ZLLA 2QFJA 1Q86T 7AT1B 2VBZA 3O6QA 4OZ3A 5E3RA 3PR5B 3KHRA 2VASA 5KFBA 4QW8A 4CLZA 3FUYA 2JLGA 2LMIA 4EU0A 3B4DA 2XLJA 3GV5B 2Z4PA 4L3KA 1R27B 4L3NA 4L6V3 2EC0A 4ELTA 1XQIA 2QLJB 3ZTSA 4XK8C 2KM8B 2EKNA 2RB7A 2QLWA 2C2OB 3EGWB 3UO0A 3C6UA 3IP0A 3R7SB 4ED2A 1LWCA 5F8GA 4Q0BA 5K9FA 2R7SA 2LEAA 2RHQB 1RBAA 1UPMB 2YNFA 4AL5A 4WXWA 1FDDA 3KK3B 4A8SA 4G3IA 2W7OA 3K8VA 2DY1A 4X4NA 2R9LA 2GMLA 4WP3A 1TAQA 1N34F 4RNHA 2FLOA 1RYRA 4RLEA 2KFNA 4WFYA 2C2RA 1N48A 2BKOA 3IS9A 4WWSA 1T8EA 3RW6A 2WK4A 3C6TA 3K8WA 1Z2ZA 1DARA 3JSMA 4P72A 2CJBA 2ZE2A 2HQGA 3MCSA 1UL3A 4F3MA 1N88A 1E6YB 1KVIA 2JVRA 2V94A 1ZAWA 2HMIA 1X4AA 2BR0A 3V6JA 3WC2A 2IM0A 1I5OB 3KJQB 3MMAA 2DR7A 2MKJA 5A6WA 3Q2TC 1X8DA 5A8KA 2RHSB 3PRBA 2R2RA 2NCKL 2L41A 3AB4B 2V8GA 2QA4G 1QUPA 3QAUA 3TVKA 2IC3A 1VMBA 2Y3YA 3CJRA 5C2CA 2XY7A 4NLTA 1M5KC 2NZ4A 4CIOA 1BD6A 3NWGA 1S9EA 4EO6A 3W62A 5GAHI 2XSFA 2AX1A 5ETMA 5CYQB 1RA7A 3B8HA 1DBDA 3IMQJ 2EFQA 5M2RA 2V4QA 2A2DA 3R5GA 3KJVA 3R5BA 4B3OB 1HWLA 2HZVA 3SFGA 4ED3A 2AU0A 3KLVA 1BLUA 2QG9B 1JJ4A 1WWHA 3QLHB 5M2UA 2HZCA 1WF0A 4UT4A 5D0EA 4NRTA 5C24A 1YWXA 3TVYA 3R1LA 5B0EA 2R7UA 3V4IA 5D78A 4C6AA 1HHSA 4DPYA 3D28A 2KXHA 3SFUA 4HH0A 1GEHA 1YJTA 3IBCB 4JI8F 2HFSA 2UVVA 2P6SA 4NLRA 2HAFA 3SDEA 3NOGA 5L46A 2VG5B 3A13A 4HLBA 5AXLA 2VU5A 2E1PA 3BDPA 3W2WB 2VV5A 2EFVA 2KYZA 1TFYA 3FFIB 1RTJB 1S1WA 4UOHA 5FD1A 1T9VA 3QATA 1UVJA 3MPUB 4R8UB 4TN2A 2VFVA 1UFWA 3CD5A 2CWKA 2WHOA 2UV8A 2UUTA 3LUYA 3POTB 3QAEA 4J9VA 1VCTA 5J1NA 5CHCB 5CQGA 1SBRA 5KFYA 3MM7A 4R0JA 4X4UA 4AL6A 1VQLS 1DLOA 4DV7J 2LEPA 5KFDA 2KZMA 5J1EB 4Y3CA 4IFVA 1BHNA 2YX4A 3GIJA 4OI4A 1FDAA 1QSYA 3N4WA 4UF4A 2GQQA 4WTOB 1U0SA 2DIUA 4E2FB 1EB0A 1U09A 2HS0A 2ZNYA 4UOFA 1QSLA 3PACA 4LSZB 1X9MA 1RT5B 2MKKA 1MWQA 3R8YA 4ZVHA 2LQ9A 4RW9A 3CJ4A 3N5FA 4O44A 1GX5A 3LOUA 4DX6A 3DNCA 2W9BB 5HN0A 1UVNA 4QR0A 2VFUA 4MIAA 4JV5F 3UD4P 4K4UA 3D1QA 1ZA1B 2Y8WA 2MEWA 4CO0A 1QE1A 2QLXA 3BV8A 4UOCA 2BYCA 4ZVPB 1WC5A 3SYZA 1XMQF 3CJQA 3CD6S 2MZ1A 2R2UA 1VIXA 5HROB 4ZVSB 1RTDB 1S6PB 2KU7A 3M1VA 3IWNC 2E9RX 3Q8SB 3BSAA 4LF4J 5DLFA 4EBCA 3GTYX 3THTA 3OL6A 1R89A 1M1KT 5D77A 2AQ4A 2E1CA 1FWLA 2B6AB 2J8AA 3MTJA 4ZP7A 3NWRA 4HR2A 1GAOA 1RACB 1VI7A 5F8NA 2ZC3A 4LF8J 2H4YB 2QIFA 2HQIA 3D66A 5A8RA 1FWPA 4OHZA 1YRUA 2VKRA 1DZ5A 1WEZA 4H4KA 2XMJA 3HVWA 1YSJA 3AJDA 3EVWA 1HW9A 2NXNA 1ZM3A 2R8HA 3KLGB 1F5BA 1WOOA 2FY8A 3Q2SC 4PUOB 5KFWA 1E6YA 1XERA 2G0CA 4HKQA 3T5JA 1JLQB 1LWEB 2XYPB 4ZS6A 4CO4A 3MD1A 3SXLA 3FEYB 2NUHA 1RZMA 2XI3A 1JB0C 5LJ5Y 3CO9A 3VAKA 4G1QB 5F8JA 2FTRA 2C3OA 2HBYB 3TARA 4YB1P 3TAPA 1RYSA 4IG3B 3L7OA 3ZZUA 1SQEA 3PJWA 2O3DA 4X62J 4OX7A 1PSDA 1PYSB 2V4RA 1HIYA 3WBZA 5DGAA 3PCOB 2OPSB 1TL5A 2F65A 3QLHA 2X1FA 2O67A 3D9BA 3R27A 1HQEB 5D4NA 4PRFA 4HTJA 3MHYA 3HVTB 4ZVOB 4HVZA 3VF0B 3EZUA 4DR4J 2Z2LA 1R8AA 1JLAB 1HBOA 2HLTA 2FZGB 2DPIA 4I4BA 1LW0A 2DNNA 2P9GA 2WB4A 1X4FA 2VG5A 4MAKA 4NLSA 2U2FA 5C42B 4CLKA 3VAGA 4URQU 1KEKA 5LSRA 4USWA 4NX9A 1HNZF 3FFIA 4GO5X 5CH7B 2MZQA 3FBFA 4PQAA 4ZP6A 4X65J 4TY8A 4X4SA 4LRBA 4IQXA 3MAAB 9RUBA 4DI6A 1U1NA 4I6AA 2HZAA 3OUYB 4OYZA 1SJ1A 4FN5A 4ZPWR 4GVLA 5E2QA 1HL6A 3BZQA 2D3OR 2GGPA 1FNMA 2K1RB 2PMZD 4C3MA 5ETKA 3CIZA 2EKYA 1YGYA 4QJVA 3VCDA 2XWXA 3AOAA 3NY0A 2B7CB 5BR8F 2PE8A 3D3CJ 2CQDA 3RBXA 4TXSA 1K44A 1SKWA 1U1LA 4ZP8A 2KHDA 1WOPA 3ILIA 3UR0A 1R31A 1AB8A 3HLUA 4O0NA 1RT3A 1IBMJ 2AGQA 3MM6B 2AZ3A 2K3IA 2Y9HA 2VF3A 2GIQA 4CCHA 4NCGB 2W9BA 4EZ9A 4C9DA 2VQFJ 1KWMA 1GQEA 3FRYA 3MPYA 3CPWR 3E8OA 3MUMP 5HAOA 4WTYA 1S49A 5D8HB 3FSXA 5IT9U 4HACB 5HROA 1MROA 4WXOA 1RTDA 3GPAA 3DM2B 2WCXA 4EZ6A 1P9YA 2XYHB 5KFUA 1SC3B 2C1EB 4RNNA 3F44A 1HNWF 1CQNA 1JLFB 1U26A 4KSEB 1WORA 4QR1A 2VJVA 1GMWA 4LSLA 2G2YA 4JI5F 2DR8A 4OYOA 1HYSA 5A0YB 4FDFA 3BGRA 1NDLA 2ZEJA 4RUHA 2EK6A 2HFOA 4X4TA 3BPSP 5GMEA 3VR1A 3IGNA 2ZH4A 2B3TB 3NNHA 3MMJA 3HF5A 4JP8A 1NSKL 3GYGA 4PCQA 1J5OA 3DLKA 3AOCA 5IT9Y 1FDBA 2VPXB 1PCAA 4OMFG 2DTJA 5KFNA 4PWWA 4LR8A 3DRSB 2G0IA 3KLGA 4WK1A 2HGNA 2W7AA 3CCTA 4PUOA 1C2PA 4LMZA 5KG2A 1GTEA 1F2GA 2JLEA 4FF3A 2ZBQA 2HNZB 1LWEA 3TX0A 4FBUA 4J9NA 5L38A 1W7WA 2HS4A 1FXLA 4K2XA 4DCJB 3IBWA 4DFPA 1KD1T 3F41A 3KLFA 4Z7CA 4QU7A 1HBNA 4OJ3A 3PYGA 1O6XA 2HQCA 4ZN1A 2J8SA 2KKHA 2OPRA 1ROFA 3C8YA 4G1QA 4NI2B 1BE4A 5J2NB 2OIHA 2CQ4A 4F2RA 4IG3A 1RT7A 2DJWA 3HX9A 3N0VA 2YNHA 4IO1A 2MZSA 2GJFA 2D1CA 2HHHJ 4V19J 3NP5A 1HW8A 2DK2A 1UFKA 3OVAA 4KH1B 2LYVA 3OFHA 4URGA 1BWVA 3VZHA 1KOOA 4WP8A 1ZAVA 2DXFA 1SL1A 4OYBA 1PKUA 1S57A 3MEDB 3AQOA 2KO1A 3FCVA 3HVTA 1YZ6A 2DNOA 1HKAA 2GJ2A 3PX4A 4USHA 2FC8A 5A8WB 4RBTA 2M4MA 4R0EA 5JXSA 1ZBTA 2EG2A 3AAWB 2BJEA 1UWBA 2XULA 3Q8PB 1S1VB 3KFWX 1WKKA 4DQQA 3MM5B 5KG0A 3T5HA 3LAKA 1RKJA 5BYRA 2XS5A 4J5OA 2LQ5A 2BEFA 1F9EB 2FJXA 4DL7A 3RB0A 3W65A 1WG1A 3C66A 2IVFB 5DG7A 3HFVA 2XMWA 2XO7A 4DL2A 4P73A 3UFCX 1UEUA 4OZ5A 2V63A 2WW4A 3MMCB 2ADCA 3LGHA 3NAHA 1UTAA 5G0RB 1F3VA 3BN7A 1AZSB 2M8HA 5DQGA 3ETOA 4C8ZA 4DFMA 4K4YA 3G82A 1NPPA 1VQ7S 5ETQA 2W01A 1CULB 5F0WA 2K1RA 3FZBA 5B0FA 3BR8A 1TK5A 2ZD1B 1VQKS 3ZZPA 4MKBA 5H9EJ 2EG1A 4I68A 2HBZB 3PYEA 4ES3A 3CB4A 4GC7A 1EQ0A 1N52B 1WSRA 4RJVA 5HBMB 2HVHA 3OR2B 4CWBA 4DEZA 1I94J 3TEGA 2XZDB 3IWXA 1S1UA 4ZLPA 3MM6A 4X84A 3T6JA 1TKZB 2XZTB 4TYBA 4A48A 1LQ9A 3TAQA 3RR7A 2F4FA 2FB0A 2C2KB 3SCKE 2AKWB 1EP4B 3SQGB 1I3OB 1NDCA 1R6YA 2PI4A 3U27A 1RWVB 3M9OB 4K7QA 1SH2A 2A3JA 4V19X 2HHUA 3DM2A 3GJSB 1ZZFA 4S0MA 3QWUA 4JB8B 2Z56B 3FNNA 4JI1F 4USIA 2P8IA 3I96A 1CJTB 3P49B 5KOWA 3WQPA 2DO0A 1IWAA 3BR9A 4I56A 2GIRA 1C1BB 2HIYA 1RCXB 4Y65A 1W26A 2RS8A 4AT1B 4BDPA 3R7NB 1MN9A 1H2VZ 4KO0B 4NL5A 2H9ZA 1W2IA 4F8RA 3EPIA 1Q8LA 3NNCA 2DH7A 2M8DB 1FKPB 2RDJA 4H54A 2LXUA 4DV1J 4TNOA 3HT3A 2FDNA 3TA1A 4WZQA 5AT1B 3OTOJ 4FNIA 3SSRA 1IBLJ 4CTAB 4PXCA 2DGXA 1IJFB 1N36F 3ISNC 2IRUA 3DRSA 2KFYA 3M05A 2VJUA 2R7XA 4LFAF 1HNVB 5ETSA 1HWKA 4DPWA 4DV6J 2BE2B 2KG0A 3ZZRA 4LF5F 1WHXA 5THWA 1FTRA 1TKXA 2R8GA 3QGIA 1JLCA 3M8PA 4USJC 5IOLA 5KFMA 1UFLA 5JVGQ 2HVZA 1KOHA 4ZCLA 5I4MA 3PX6A 4FKYA 3EJMA 3B4MA 1AA1B 3CIMA 2UZAA 2VQEJ 3DI6B 2HEKA 2WSCC 2AIRB 1QAXA 3ITHB 4DG1B 1SC4B 1B64A 2N7YA 5KOXA 3V6HA 3DDIA 1XMOJ 4WYLA 2JEGA 4EK2A 5T14A 3QJPA 2W25A 3MWBA 4O3RA 3MEDA 1NSPA 4O3QA 4IH7A 2HGMA 2DY9A 2GVDB 3OVBA 5GMDA 1F0XA 5DDRC 1NB2A 2YKNB 1QVGR 2EPIA 5A8WA 4RU2A 1RAEB 2GMJA 4KGKA 3RAMA 3IRWP 3TUPA 1AUSL 1S1VA 1SH0A 1FJ7A 5I3UA 1HBUB 3VHQA 2VONA 3MM5A 2ZH2A 5CZXA 5IFMA 1MWZA 4N7TA 3M7VA 3BM7A 5DS7A 1LNQA 1T03B 1G6BA 4ER8A 1VLYA 2VZ9A 3MURP 3WZ0A 3QIPA 3TRGA 4GRSA 3KK1A 1IKXB 5CCLA 1VRUA 2FY1A 2XHCA 1YKWA 5U47A 3LP0B 1SJFA 4NLPA 2VL1A 3N5BA 3SMZA 1IBCB 3MFIA 5L9NA 4OI2A 1SKRA 3W5YA 1CULA 2F9JA 2RMLA 2AJ2A 3CJKB 2XS2A 3CXCR 2YPZA 2V4JB 5LM7E 2CJXB 3T9NA 8AT1B 1PYTA 1H0HB 3EWGA 1BQXA 2CRLA 4CM0A 2GC8A 4OYPA 3J7AN 2FGCA 3J7Z5 4F67A 1FRLA 2DGSA 4B3RJ 2PMWA 5HBMA 3TJ9A 5T41A 4LF6J 1TP7A 2HSEB 1E6VB 4V1Ak 2OEMA 1MN7A 2XLIA 4UTGA 4GKKF 3N9UC 2WBMA 3KHLA 3HSGA 2QGFB 2HLUA 4DF8A 1B7YB 4ZKAA 3NAIA 4JI0F 2NYHA 3G6ES 3GWCA 3SQGA 2N4DA 2CDQA 1RK8A 4DQPA 1IXKA 3NOCA 3A3NB 5LMNJ 2UXCJ 2FIUA 3AFGA 1RHQB 2JZ5A 3TZXA 3M8WA 1OPZA 1X5PA 4URSA 3D1HA 4PXEA 5LJ3Y 2JFKA 3RU0A 3V5RA 4AQYF 2RJZA 2D3ZA 3W1YC 4I1TA 4PWDA 3PVXA 1N32J 3MCNA 2M88A 3LQVA 3QGPA 3WX8A 1UVMA 1C1BA 1SI9A 4OZJA 4DN9A 1FKOB 4K4ZA 5DDOC 5IV3A 3GYNA 4LJMA 2C3UA 5HATA 3OXLA 2AD9A 1FX4A 4KO0A 1D9FA 3CJSA 1RTZA 1H2TZ 2AYBA 1UJ4A 4RW4A 1FKPA 4CLSA 3CJ8A 1S72S 2HPUA 4K4WA 1EETA 4BWJA 4OX9J 4OIXA 2V2ZA 1QVFR 2QC3A 2MSTA 4CRJA 1RABB 4IFYB 2DISA 2DH8A 1HNVA 2DNQA 2YX7A 2ZC4A 4NLXA 3ENWA 4B9LA 1R0CB 1R3NA 4I2PA 5C25A 2BE2A 1IQTA 1HARA 3I4PA 3VZIA 1WI6A 2HRTA 4FZVA 4NEZA 3KLHB 3NMRA 2QL5B 3DLEB 5H9EK 1AW0A 1EHWA 1UA0A 3NCRA 3M32B 3UN5A 5HL7Q 2KL8A 3BSOA 1F9FA 3ZZZA 1HI0P 4I0WA 4R25A 2LLZA 4FVMA 2G0JA 3I5CA 3O2IA 3LTOA 2K3KA 2LU1A 3MEEB 3LANA 2HWHA 4ANEA 1GMVA 1O8BA 1WELA 2VIHA 1RBOB 2VH7A 4NLVA 4DG1A 4A8KA 2VC0A 1FXRA 2BBEA 3BEGB 1K0TA 1UMJA 2B4UA 2KXFA 2WVDA 3EVOA 3PEHA 4ICLB 4KTQA 2GVDA 1QDUB 3DYAB 3M8QA 4UY85 2KHCA 1NKBA 1QM9A 2DH9A 3FEZA 4MK9A 3VGTA 3SBMA 1JLEB 4DV3J 1D09B 4LF9J 1ICEB 5JUMA 5HMZA 3FKBA 3ZXWA 2APOA 3N01A 2OKQA 4AYBD 3PW7A 1HBUA 2CFXA 3WC0A 2YWEA 4EWTA 2UUCJ 1FA0A 1NMEB 4J9RA 3K17A 4OX8A 5JVHQ 4CQ1A 2RQ4A 2HHTA 4U9RA 5D0GA 3S01A 4F4AA 1WC3A 4M5GA 5AE3A 2Q6BA 3MXHP 3TYTA 5E3PA 1ULRA 3RB6A 2UVRA 1IKXA 3LP1A 2L3MA 4IG0B 1U1QA 2KTQA 1CJUB 4F0MA 3BYRA 1H74A 4RNFA 4P75A 2DD8S 2OD4A 1RAAB 4L74A 1BQNA 1R8CA 3B54A 2JVOA 4USVA 1X4CA 2I9SA 1L3UA 2PA8D 1VR6A 3CJKA 3GV7B 1S0MA 3UW1A 5E7OB 3AA9A 2ZHBA 2I2YA 4F04B 2CJAA 5K8PA 4DXLA 3EVMA 4ES1A 2UV8G 3QRPA 4ZITA 2YWWA 1YBTA 4PG7A 4B9UA 3Q8UA 3BPDA 1E6VA 3PIOQ 1UVLA 1LFPA 3ELHA 4KBIA 1S76D 4Y2AA 4N8OA 2CQ1A 2W4CA 4Y28C 4F7VA 2RD5C 1JJCB 2IHR1 4F0KA 3CC7S 1Z1ZA 1XK8A 3G8TA 3A8EA 2VPWB 3JAMU 2MHNA 5KT4A 2CQIA 3DFEA 3I5BA 2CJQA 1JWWA 2HNDA 2LXIA 1DY3A 3H2LA 2OTLS 1S4FA 2IBKA 3IRXA 2I5JB 1Q0NA 4ZVEA 1OY9A 4Q43A 4OZNA 2YNIA 5FIIA 2POKA 3RR8A 2F4VJ 3TNVA 4ETZA 1C1CB 2NXUA 1X60A 4NA3A 3AOBA 1FKOA 2X1GA 2R42A 1SIZA 3CCZA 1IN0A 2V68A 3G2XA 3NBPB 2RU9A 3BF4A 5IC6B 2AT1B 3CCWA 3DDKA 2DR5A 1CS4A 2OD6A 4Q7AA 3JAMY 4ZPBA 2NXJA 4YEAA
chains in the Genus database with same CATH topology
5LMNJ 4DR3J 4KY3A 4PWWA 4DV5J 2UUCJ 2UXCJ 4NEZA 2VQEJ 1N36J 4HHUA 2UU9J 4DR5J 4DV0J 4KYZA 4JI3J 2VQFJ 2E5LJ 4LF4J 1HR0J 4LFAJ 3IMQJ 1HNWJ 4DV7J 4LF7J 4RJVA 2UUAJ 4YY3J 1N33J 1FJGJ 5IWAJ 4DV1J 3W1YC 4K0KJ 1XMOJ 1N32J 4JI8J 1I94J 4X65J 3OTOJ 5IT9U 4JI5J 1XNQJ 2KL8A 4NXMJ 1XNRJ 2MTLA 1IBLJ 4B3TJ 4DR1J 3JAMU 4LF5J 5LM7E 3R2CJ 3J81U 5AJ3J 1IBKJ 4LF8J 5FLXU 4DUYJ 4GKKJ 5BR8J 3J7AN 2UUBJ 4X62J 3T1YJ 4B3RJ 4JI1J 4JV5J 4JI6J 5LMUJ 5A2QU 4DV6J 4JI0J 4LFCJ 2UXBJ 3R2DJ 1HNXJ 4DV4J 4JI2J 4LF6J 1XMQJ 4KHPJ 4JYAJ 2F4VJ 3D3BJ 4V1Ak 4OX9J 2UXDJ 2KVQE 4LFBJ 4DV2J 4B3SJ 4DUZJ 4JI4J 4B3MJ 3D3CJ 4X64J 1J5EJ 2HHHJ 2ZM6J 4YHHJ 4DR4J 4AQYJ 1HNZJ 1N34J 4JI7J 4DV3J 2MEWA 4LF9J 4GKJJ 4DR2J 2MQ8A 3T1HJ 4DR6J 1IBMJ 4NXNJ 4NEYA 3J80U 4DR7J 4X66J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMN J;  4DR3 J;  4KY3 A;  4PWW A;  4DV5 J;  2UUC J;  2UXC J;  4NEZ A;  2VQE J;  1N36 J;  4HHU A;  2UU9 J;  4DR5 J;  4DV0 J;  4KYZ A;  4JI3 J;  2VQF J;  2E5L J;  4LF4 J;  1HR0 J;  4LFA J;  3IMQ J;  1HNW J;  4DV7 J;  4LF7 J;  4RJV A;  2UUA J;  4YY3 J;  1N33 J;  1FJG J;  5IWA J;  4DV1 J;  3W1Y C;  4K0K J;  1XMO J;  1N32 J;  4JI8 J;  1I94 J;  4X65 J;  3OTO J;  5IT9 U;  4JI5 J;  1XNQ J;  2KL8 A;  4NXM J;  1XNR J;  2MTL A;  1IBL J;  4B3T J;  4DR1 J;  3JAM U;  4LF5 J;  5LM7 E;  3R2C J;  3J81 U;  5AJ3 J;  1IBK J;  4LF8 J;  5FLX U;  4DUY J;  4GKK J;  5BR8 J;  3J7A N;  2UUB J;  4X62 J;  3T1Y J;  4B3R J;  4JI1 J;  4JV5 J;  4JI6 J;  5LMU J;  5A2Q U;  4DV6 J;  4JI0 J;  4LFC J;  2UXB J;  3R2D J;  1HNX J;  4DV4 J;  4JI2 J;  4LF6 J;  1XMQ J;  4KHP J;  4JYA J;  2F4V J;  3D3B J;  4V1A k;  4OX9 J;  2UXD J;  2KVQ E;  4LFB J;  4DV2 J;  4B3S J;  4DUZ J;  4JI4 J;  4B3M J;  3D3C J;  4X64 J;  1J5E J;  2HHH J;  2ZM6 J;  4YHH J;  4DR4 J;  4AQY J;  1HNZ J;  1N34 J;  4JI7 J;  4DV3 J;  2MEW A;  4LF9 J;  4GKJ J;  4DR2 J;  2MQ8 A;  3T1H J;  4DR6 J;  1IBM J;  4NXN J;  4NEY A;  3J80 U;  4DR7 J;  4X66 J; 
#chains in the Genus database with same CATH topology
 3M6V A;  1M5V C;  1NK6 A;  1Y3J A;  2CQB A;  4IQM A;  5L1J A;  4IFY A;  4WKY A;  3TA2 A;  1RAO A;  5E33 A;  2CAJ A;  2DNZ A;  4OI6 A;  1DTQ A;  4J9K A;  5MLC V;  1KTQ A;  4KAI A;  4NXM J;  1RI7 A;  3OFG A;  4DZ6 A;  2HFU A;  5DJB A;  4IOA Q;  3PDN A;  4KH0 B;  4LRC A;  2IMW P;  2ZH3 A;  1LFW A;  2IDL A;  3DLE A;  4DV7 F;  1WTB A;  5HLF A;  1TZ0 A;  3P8B B;  4YME A;  1FRK A;  1VC0 A;  3HUL A;  2ZVI A;  1F60 B;  3MEE A;  3CWJ A;  1GTH A;  2OI2 A;  1HHT P;  4L76 A;  4PG6 A;  3FQK A;  1FVQ A;  2QA4 S;  2MKY A;  3RTV A;  4P7V A;  4C7Q A;  3H90 A;  4ELV A;  2B9X A;  4ICL A;  5KG6 A;  3DYA A;  5F8H A;  3UR3 C;  3CF5 Q;  4J91 A;  2HBQ B;  1J2V A;  2YXL A;  2VG6 B;  2VHG A;  3CSK A;  5DM6 Q;  2LU2 A;  3ZTO A;  1HFE L;  2QMW A;  1A9N B;  4M5L A;  2ASY A;  1VC5 A;  2XB2 D;  4LF1 A;  4ED6 A;  4WP9 A;  4M63 A;  2ZH7 A;  4LF4 F;  3IR5 B;  2N3O A;  3M2R B;  3TR5 A;  2LCW A;  3CE8 A;  1C0T B;  5E3C A;  2NXE A;  1BUX A;  1D9D A;  5EWG A;  1N8R T;  3ETM A;  2AWZ A;  4L75 A;  4EO8 A;  5BYQ A;  4J9Q A;  3RAQ A;  3OJS A;  3FSY A;  3R1H A;  4LF8 F;  4RUA A;  4ILM A;  3GB0 A;  2V8P A;  4B3M J;  2B51 A;  4ID5 B;  3TAM B;  3F56 A;  5ETL A;  4RW7 B;  1FFS B;  4X4Q A;  4XO0 A;  2BJ8 A;  1Q1K A;  2BOA A;  1AFJ A;  4WIQ A;  2ADB A;  3PHT A;  4CO2 A;  2FYX A;  3HHE A;  1NSA A;  1WOS A;  2OTJ S;  1K1Q A;  1MLA A;  4CP5 A;  1IKV B;  2QL7 B;  2UU9 J;  2COL A;  5HK4 A;  4ZOS A;  1HR0 J;  1N56 A;  5KT2 A;  3EGV A;  3CCJ S;  2UUA J;  3B6B A;  4QIF A;  5HSP A;  1MMN A;  3HHL B;  1RA6 A;  3CC2 S;  1FJE B;  4KFB A;  2MSS A;  4IKA A;  2UUW A;  3KG0 A;  1X31 C;  1KLM B;  3MUV P;  1RLC L;  1NJI T;  2XNR A;  2KVI A;  2MLZ A;  3S7R A;  3OTB A;  2PN6 A;  3HCX A;  3NKY A;  2OJ3 A;  3CCL S;  2W4D A;  2LDI A;  2CPI A;  1FKA F;  4CYU B;  2UXB J;  4NLU A;  3PW0 A;  2XEX A;  2CWX A;  2H5J B;  1RBL A;  3HHK A;  2BA9 A;  2RU3 A;  1U1O A;  5HMX A;  3KLE A;  1RT4 A;  4X62 F;  1T11 A;  4FF2 A;  4ED5 A;  1HMV A;  3M8S A;  3Q86 A;  2MY7 A;  3ISN D;  4B9T A;  3K59 A;  4ZJQ A;  2IBO A;  5K8O A;  4ZPD A;  2W4P A;  2K2P A;  3V2U C;  1RTH B;  3DLG B;  1Q7L B;  5CCM A;  3C15 B;  3I31 A;  1FO1 A;  3QO9 B;  5DO2 A;  2DGQ A;  1MU2 B;  1RTI A;  2R7W A;  2LA4 A;  2E5L J;  2OHD A;  1Q78 A;  4DR4 F;  1YRX A;  4O0I A;  2YX1 A;  2HHS A;  3K5L A;  3CUL A;  1PGZ A;  4ZPT R;  2AJ4 A;  3QZ8 A;  2CZ9 A;  2J76 E;  4C97 A;  3HZG A;  1JNZ B;  2RAQ A;  1AYE A;  3T5L A;  2CQ2 A;  4C8K A;  5KFZ A;  1PIL A;  1EJ7 L;  4U95 A;  1UET A;  1NEE A;  3T41 A;  1IBK J;  2GVZ A;  1DUR A;  1RGV A;  2GAH C;  4DL5 A;  6FD1 A;  3SQO P;  4FBT A;  2HHV A;  1PC4 A;  4C8O A;  3H5U A;  1HLW A;  1UAW A;  2V5H G;  3G8S A;  5BYS A;  4X65 F;  3K5M A;  4QIW D;  2ATL A;  2JJ4 D;  4NZ7 A;  1S5Z A;  2P9C A;  3EM1 A;  2ZJR Q;  3TAN A;  2FVC A;  4O23 A;  3A4T A;  3N6N A;  1Y5I B;  3LO3 A;  4X64 J;  2ZOM A;  1GXL A;  2OUG A;  3G86 A;  3Q0A A;  2DEI A;  3AXM A;  3EYZ A;  2HQF A;  2QRR A;  2MQL A;  3DOL A;  3UVJ B;  2WSF C;  2KT3 A;  2WVC A;  2W7P A;  4TLR A;  5EX3 A;  1VJW A;  3C16 B;  3H4B A;  4RUB A;  3PNI A;  4DV0 J;  2L9W A;  4KYZ A;  2RDI A;  1M5P C;  3Q23 A;  2ALZ A;  3QT6 A;  3EZO A;  3Q89 A;  3KXD A;  1S10 A;  1YJN S;  1FJG J;  2W24 A;  3BKF A;  2KJW A;  5MAO A;  2MJU A;  4B3S F;  1IBM F;  3A8I A;  3M9M B;  4ECU A;  1YRT A;  2FD2 A;  2AX0 A;  5ITH A;  2AJF E;  2L9D A;  2DRB A;  4EUV A;  4WE1 B;  2VQF F;  4LR7 A;  4CH1 A;  1FNX H;  2FJA B;  2J6S A;  3R3T A;  2VG6 A;  3H2V E;  2J7K A;  5F9L A;  1BXN A;  3IAM 9;  2Z58 B;  1EIY B;  3D3B J;  1QSS A;  3H5S A;  2Q43 A;  4YDX A;  4HH1 A;  2HHP A;  2R2S A;  1ZM4 A;  3NRB A;  1AXQ A;  2HIQ A;  2GHP A;  1HPZ B;  2CJ9 A;  3BDE A;  2B4V A;  3GIK A;  1NZA A;  4ZCK A;  2J0S D;  3LWM A;  4WFA Q;  4MK7 A;  3FMB A;  4Z2X A;  4GKJ J;  4XAK A;  2YWG A;  3Q8V A;  1F5A A;  3MUT P;  3QBC A;  3L95 X;  5BJR A;  2BAN A;  3T1Y F;  2D69 A;  1L3K A;  4DPO A;  2BX6 A;  3P5T L;  2CQ0 A;  1B7F A;  3CMA S;  4Q44 A;  2ZHO A;  4OJH A;  1TV6 A;  4PXB A;  2OO4 A;  2I0X A;  3O5T B;  1CJV A;  1XBW A;  5KFE A;  1VRT A;  3FBB A;  3MR2 A;  1FK9 B;  1G1X A;  3QMQ A;  2AEF A;  4NAS A;  5F41 A;  3NGU A;  2BKP A;  1LV5 A;  2MPU A;  4NCB A;  2XHW A;  1RAD B;  2BW7 A;  2IRX A;  3HKZ D;  1WHV A;  1NB7 A;  3MGJ A;  4M5N A;  3C14 A;  2UP1 A;  1NPR A;  5EDW A;  2MXY A;  3QT8 A;  1TFW A;  1NHV A;  4K50 A;  2OGU A;  1T05 B;  1P27 B;  2DGU A;  2J7W A;  4P2F A;  2K7J A;  2G13 A;  2GCF A;  3DN9 A;  4ZIV A;  9ATC B;  1YBU A;  1GT8 A;  2GA7 A;  1Y5N B;  4PEO A;  3KWM A;  3M8Z A;  2ZJP Q;  4CYU A;  4QPT A;  1C4C A;  1YHQ S;  3EDQ B;  2ZOG A;  3MCM A;  4QWD A;  1WC6 A;  5L1I A;  3TQE A;  5CXT A;  1WF1 A;  4FF4 A;  3MOJ B;  1FJC A;  3OBI A;  5M2P A;  1VFJ A;  2HHH F;  1HD0 A;  1VDH A;  4HI1 A;  3PKY A;  3HJV A;  2ALY B;  5L39 A;  2DXE A;  2RH3 A;  1N33 J;  3ZTQ A;  1REV A;  3Q24 A;  2CNN B;  3OTE A;  3I5A A;  1H73 A;  2IYI A;  3CDA A;  3Q8Q B;  4Q0B B;  4YUD A;  3F73 A;  4P6Q A;  3GJR B;  2YNF B;  3C15 A;  5FLX U;  1NBE B;  3QO9 A;  1U4B A;  2MZT A;  2HGL A;  4B08 A;  4DU8 A;  5DZ6 A;  4LIW A;  2PMH A;  3JTN A;  5A2Q U;  3JS9 A;  4ATN A;  2E1A A;  4ECZ A;  4JYA J;  3I4H X;  3CJ3 A;  1FX2 A;  3M2V A;  2E7W A;  4UOG A;  3IS9 B;  3C6T B;  1JLB A;  1ZM9 A;  2LVW A;  2ZE2 B;  3IC1 A;  4H4K C;  3OTD A;  1X4H A;  1JJ2 R;  4EEY A;  1U2R A;  3MR6 A;  3KMS A;  2HMI B;  3K5P A;  4CH7 A;  1FRM A;  2AMC B;  3P5B P;  5FLX Y;  4RO0 A;  4TYA A;  3MMA B;  4DU7 A;  1OQ3 A;  2C2N A;  4OLP A;  1OO0 B;  5A2Q Y;  4ZHR A;  5IWA J;  3PV8 A;  4K0K J;  1RAG B;  2R8J A;  2FZC B;  2XI2 A;  2IRY A;  4B3T J;  2DCL A;  1S9E B;  5DDQ C;  3C16 A;  1XIQ A;  2FGO A;  2WON A;  2CXE A;  2CQP A;  4N77 A;  1IKY B;  1A6L A;  3PRV A;  5HP1 A;  5IXU A;  2BAB A;  3ZZO A;  1VQ8 S;  4BCA A;  4OHY A;  2O5D A;  1VK3 A;  3KYL A;  1LKZ A;  2V6A A;  1I94 F;  1MMD A;  3OT9 A;  2ZZN A;  1SUQ A;  3OL7 A;  3I6P A;  2JNJ A;  5C24 B;  2XGQ A;  4OHX A;  2DEJ A;  4WE1 A;  4KGM A;  1Z2L A;  3VVU A;  3EGZ A;  1B99 A;  3A8J A;  1S7H A;  3CDB A;  5HQL A;  3DRP A;  1CEZ A;  1X5S A;  1NK7 A;  3KUG A;  3SDE B;  1HPZ A;  2V2K A;  4K4V A;  4GVB A;  4R5P B;  1YTY A;  4DSF A;  5EUH A;  3DXB A;  2IA0 A;  4DQR A;  4EI2 A;  4JV1 A;  2V67 A;  4RBU A;  1S1W B;  4B02 A;  3HJF A;  1WG5 A;  3EDR B;  3QYY A;  4F02 A;  2QA2 A;  4N76 A;  3AT1 B;  1FWK A;  4NLY A;  4C8M A;  3MMB B;  4Z7Y A;  3MM7 B;  1U1M A;  2WSE C;  3BKU A;  2DO4 A;  4DV1 F;  1DLO B;  2XBP A;  4IFV B;  3OTO F;  1KQG B;  3GJT B;  1IBL F;  4PPD A;  1FK9 A;  4IUF A;  1PJ6 A;  5J1P A;  3AB2 B;  1CVJ A;  3N79 A;  2VOD A;  4YHH J;  1RXO B;  3THP A;  4LRD A;  4DV6 F;  4ZN3 A;  3J7Y U;  5F0U A;  1HBM B;  4CLU A;  1T05 A;  1SJQ A;  3G71 S;  1UCN A;  1Q81 T;  4DR7 J;  4Q2L A;  4P7T A;  2D9O A;  4JUZ A;  4RW9 B;  2IA6 A;  1RKI A;  4O44 B;  1LEO A;  1R8B A;  1CLF A;  2J9D E;  4WYW A;  2RQC A;  2P5V A;  3D54 A;  2ZIT A;  1H6K X;  2IAJ B;  1OY8 A;  3D6T B;  4LT6 A;  2ZHA A;  1IM6 A;  5GAG U;  1MSW D;  2B56 A;  2ACM A;  2Q79 A;  2NXC A;  1QE1 B;  3KMQ A;  2B9W A;  4RBV A;  1Y3K A;  2VQE F;  2MKS A;  4MH8 A;  3M1V B;  3SZ2 A;  4DFJ A;  1R0A A;  3GYX B;  2W9C A;  1M5S A;  3BB5 A;  4JV2 A;  2XCA A;  4QWC A;  4YOE A;  1XMO F;  4NXN F;  1U1P A;  2RVJ A;  5KTQ A;  1SV5 A;  1I1G A;  1NH7 A;  3RBD A;  4AND A;  1BC6 A;  5K8N A;  2RSQ A;  4DHV A;  4DL0 C;  1HI1 A;  2RRN A;  5CD4 A;  5A8R B;  5D4P A;  1TQL A;  3JQM A;  3G87 A;  3M30 A;  3LGM A;  4RNM A;  2BJ1 A;  3J80 U;  4AL7 A;  2B5J B;  4F3O A;  4KY3 A;  3R9L A;  4IR1 A;  4N8N A;  2CPH A;  1UVI A;  1AUD A;  1K9M T;  2I8E A;  3NS6 A;  1JXV A;  2B7B B;  2EXU A;  5GAD U;  2GQC A;  3B82 A;  4MFB A;  2KJV A;  1PO6 A;  2XG8 A;  1T9Y A;  1T0T V;  3S6E A;  5BXI A;  3ZZY A;  4M95 A;  4ZVU B;  4X4R A;  1V6H A;  4AE5 A;  2YQ1 A;  3ISZ A;  2YQ3 A;  4M5H A;  4NA1 A;  1WTF A;  5D0H A;  1KP6 A;  1NHK L;  2P2C B;  4KPC A;  3HFZ B;  2MGZ B;  1SKS A;  3PW4 A;  4J9L A;  1WI8 A;  3BQ0 A;  1IKY A;  2ZM6 J;  1U47 A;  1TR0 A;  4B3R F;  4OLO A;  2XYG B;  2HVD A;  2AHO B;  2F8M A;  2CPF A;  2NS1 B;  4LF6 F;  3PY8 A;  4LR9 A;  3PW2 A;  1YQH A;  3L4B C;  5CZV A;  5HMY A;  1DJ0 A;  3X1L B;  1RWX B;  4TQR A;  3V6K A;  4M5K A;  3NNA A;  1EX8 A;  2KT5 A;  3W7B A;  2FHK A;  2VB6 A;  3ENV A;  3DKD A;  4FS2 A;  1V3S A;  4DSI A;  5GAE U;  3MR7 A;  4YP3 A;  3IAS 9;  4OYW A;  1HBO B;  3QFW A;  2J7U A;  1EQM A;  4OX6 A;  3J81 j;  2NQP A;  1VS3 A;  3FEX B;  3RZA A;  3FZ2 A;  2E66 A;  3MTK A;  2QSF A;  5LMN F;  3D2W A;  2UXC F;  4ZCI A;  1LW0 B;  3KKF A;  5AE2 A;  1U7L A;  3IA0 A;  7FD1 A;  4R5P A;  4ZJL A;  4IRC A;  1FE4 A;  3NGD A;  1TVR B;  2C3M A;  2QEX S;  2OEK A;  2VBY A;  1N32 F;  1X7V A;  2V69 A;  2D3O 1;  5IQ6 A;  3TZY A;  3HT0 A;  4TY8 B;  2DR9 A;  4I67 A;  1TL3 B;  3A12 A;  3GV8 B;  3MMB A;  3QWP A;  1RAI B;  1NKC A;  3Q22 A;  4PXD A;  3T1H J;  2C22 A;  1ZH5 A;  4OX9 F;  1S9G A;  3MZI A;  4CI0 B;  3GSD A;  5EWE A;  2GGP B;  1FT8 A;  3CDW A;  3IFE A;  1LWX A;  3PTW A;  3UD5 A;  3EXC X;  3L3C A;  3QRR A;  2NRE A;  1URN A;  3H98 A;  2VPY B;  1G2E A;  1WDT A;  1OWX A;  5DGB A;  1UPP A;  5SZT A;  2V9W A;  3E01 A;  4KGZ B;  1HBM A;  1NJY A;  2KH9 A;  4FNH A;  2XSJ A;  2YWH A;  4NPO A;  2EBE A;  3D5M A;  1RT3 B;  3DCA A;  4TU9 A;  3L09 A;  3AA8 A;  2Y8Y A;  3R5J B;  4EGL A;  1S7I A;  3MPD A;  3RB4 A;  2DIT A;  1Q8I A;  2CVI A;  2IAJ A;  2XO6 A;  4LBH A;  1RLD A;  3EMT A;  1VIS A;  2M5Y A;  3RJM B;  4Y2K A;  2CG8 A;  1YIJ S;  1MRO B;  3RRK A;  3KJN B;  3K7R A;  1N6Q B;  4TKT A;  4K59 A;  1RWK B;  4KIA A;  1UJ6 A;  1VIO A;  1IJE B;  4LSL B;  4N47 A;  1UWA A;  4DSK A;  4ANC A;  1HYS B;  3BSN A;  3BGR B;  1S0O A;  1K1S A;  4C98 A;  1SCJ B;  4DPT A;  5A76 A;  2AEJ A;  2BAC A;  2HHQ A;  1N5S A;  3PX0 A;  2G2Z A;  3K5O A;  4DV3 F;  1K8A T;  4LF9 F;  2CPY A;  4YN3 B;  4FYX B;  2F8E X;  2RUS A;  5HQM A;  1J5O B;  2QZ8 A;  3I55 S;  2ZH9 A;  1XNR J;  3TZW A;  3DLK B;  5B08 A;  2MB0 B;  2UUC F;  2B5J A;  1TTH B;  2C28 A;  3K58 A;  1YDL A;  4OZL A;  1FD2 A;  1UJ5 A;  1U6B A;  3QNW B;  1X9S A;  1KON A;  3HSD A;  2FUG 9;  1Q95 G;  1DQ9 A;  3ZTP A;  2N82 B;  1TK8 A;  3R97 A;  2GO8 A;  3D0H E;  1N0V C;  4NYP A;  4ILR A;  4LF7 F;  4F0H A;  2Q3P A;  2XWY A;  2LQJ A;  2IVY A;  2FC9 A;  4ECV A;  2RDD A;  4NA2 A;  4OJ1 A;  3KLF B;  4BC7 A;  1HBN B;  1NZ8 A;  2JEJ A;  1G3O A;  3NGT A;  1YG0 A;  2GHW A;  1JQG A;  2MGZ A;  2OPR B;  2X3G A;  4KKO A;  4KGX B;  2MHE A;  1VQY A;  1HNI A;  1Q7Y T;  1RT7 B;  1Y7P A;  1GXT A;  5DG9 A;  1RWO B;  4EBD A;  2YNH B;  2M70 A;  4EMD A;  3OQ2 A;  2N3L A;  1KR4 A;  3FBE A;  3FC9 A;  2UVW A;  1RT6 A;  2DGT A;  1IKW A;  3IO1 A;  4LVN P;  2N4C A;  1GX6 A;  1DQ8 A;  1F3F A;  3MAQ A;  3OFF A;  3D67 A;  3HMJ G;  3DHX A;  2NUU G;  4OV6 A;  1S6Q A;  3QID A;  4JI2 J;  2F3J A;  1RHM B;  1UWB B;  4NLG A;  4ZP9 A;  1XEZ A;  2CQC A;  4F4Y A;  3MCO A;  2GAG C;  1GFW B;  5KFL A;  3GU0 A;  1UVK A;  1TVR A;  3H5X A;  1SB6 A;  2IFX A;  1VBX A;  3HI9 A;  4IRD A;  4Q2M A;  2F4V F;  1WG4 A;  2RIL A;  4CNY A;  4RWX A;  3PFO A;  3DLB A;  2Z8Q A;  2B9E A;  4KE5 A;  3U1N A;  3ILJ A;  2YKA A;  2KDO A;  1TL3 A;  5KG1 A;  1F2H A;  5E0O A;  2CVE A;  5F8M A;  3A1Y G;  3G82 B;  4ZPV R;  2GO9 A;  2FHJ A;  3JSR A;  2Y0B B;  4HT5 A;  1NRK A;  3THV A;  3L7U A;  3MF5 A;  1HQ2 A;  1QD1 A;  1ELO A;  2QV6 A;  2JFD A;  4OZ1 A;  2YH1 A;  3G96 A;  3CED A;  4UZC A;  1FXD A;  1PJ5 A;  2QT7 A;  2QJ3 A;  4LFC J;  2F7V A;  1NHU A;  1I6J A;  4O3N A;  4HL9 A;  4NXM F;  1U2F A;  1RE1 B;  2P9E A;  5CYJ A;  3G4S S;  1QLN A;  4B3S J;  1S1U B;  1NUE A;  2OPQ B;  2RNE A;  3RGI A;  3RRG A;  1Z4U A;  2XMV A;  2ASJ A;  2DKO B;  4LVO P;  4IDK A;  3UPF A;  3T9Z A;  5D3G B;  4JBC A;  4QW9 A;  4MKV A;  4B9S A;  1HWJ A;  4Y2C A;  4F50 A;  3GE9 A;  2E29 A;  1Y9O A;  2KXN B;  1KTV A;  1N6Q A;  2BZ2 A;  4KPY A;  2R7Q A;  1Q53 A;  5GVQ A;  4PQU A;  1D1U A;  1T3O A;  3NCP A;  2CQ3 A;  2EFO A;  5I3P A;  2YWK A;  4FYY B;  4DR1 J;  4N5S A;  3D68 A;  3OLB A;  3SV4 A;  3V81 B;  5SUH A;  3T1Y J;  2B8P A;  3LGN A;  4CLY A;  1T9W A;  2AGO A;  2XLK A;  3CJ5 A;  1Q16 B;  5K14 A;  2KG1 A;  5H9F J;  3FMW A;  2FQQ B;  1N0U A;  5CD4 H;  3E2E A;  3RRH A;  1S99 A;  2RT3 A;  3R5D A;  4DQI A;  1NPK A;  2IDE A;  1TKD A;  1EKR A;  2MKI A;  3W64 A;  2YKM A;  2A6M A;  5EWF A;  4H4M B;  3ADA C;  2ZZM A;  1D8Y A;  1K73 T;  1VOM A;  3IBF B;  2VFR A;  2MJN A;  4NMX A;  4B3M F;  4U7U K;  5E3Q A;  1TKX B;  4C48 A;  4DL6 A;  3DRR A;  4HYK A;  1JLC B;  2AYG A;  3VWS A;  4YY3 J;  2C2M B;  3M8P B;  4PWU A;  3SCI E;  2ABY A;  2NLW A;  2AV5 A;  1XNQ J;  3R5C A;  1N5Y B;  1NJW A;  1Y4Z B;  2YQ0 A;  2V9K A;  4ECX A;  3D6M B;  5IQQ A;  2UU9 F;  5KFQ A;  5DG8 A;  1HR0 F;  2QE5 A;  1WSV A;  2QLF B;  2UUA F;  1NK0 A;  4FF1 A;  4A8O A;  4KHP J;  2QN6 B;  4ILL A;  2HHX A;  4FXD A;  3CD7 A;  4K4T A;  5KAK A;  4LFB J;  1NM2 A;  1NKE A;  4LIR A;  3DRY A;  1J5E J;  3MEG A;  1X4G A;  3O1L A;  2UXB F;  3D6F B;  3TO8 A;  4ED1 A;  3HDS A;  3GR1 A;  2AJ1 A;  5I3U B;  1QTN B;  6FDR A;  2BMB A;  4ED8 A;  4OQJ A;  4MMO A;  3GFH A;  4Y0F A;  4HDH A;  3MPV A;  4NOH A;  5KFC A;  2ZH1 A;  2HQD A;  1ZM2 A;  1ZOT A;  4HT7 A;  2VC1 A;  2FHJ D;  3NL0 A;  4C8N A;  3CD0 A;  3QIP B;  3SI8 A;  2GV1 A;  3UNY A;  2MTL A;  2MQN A;  3MAH A;  3KK1 B;  4DUY J;  4G1I A;  1T95 A;  1F9H A;  4PAB A;  1HD1 A;  4QYR A;  5KFA A;  1VRU B;  1WKL A;  2E5L F;  3VV2 B;  4QIG A;  3PYD A;  2KB2 A;  2ZOF A;  3DDN A;  4YB7 A;  3W63 A;  5C5J A;  2BM1 A;  2B8Q A;  2JC0 A;  1B3T A;  1WUU A;  1IBK F;  1FCA A;  3M6W A;  2WBR A;  2FZK B;  3SSQ A;  4WF9 Q;  1TL4 A;  1KFD A;  1JLG A;  3KNA A;  2MQP A;  1CC8 A;  3KDN A;  2NR0 A;  4WII A;  1V5V A;  3W8P A;  3J7Z T;  2JSX A;  4BHQ A;  2OPQ A;  4X64 F;  3ET6 A;  2PSZ A;  1MWY A;  1VJQ A;  2DIV A;  3ZZ0 A;  5D6G A;  2PEH A;  3ENQ A;  2JL9 A;  2J9D A;  3QGG A;  5D3G A;  2B0G A;  3H20 A;  5HQ8 A;  3E51 A;  3H40 A;  2C3Y A;  3OTC A;  8RUC A;  4TU7 A;  2UUB J;  4DV0 F;  3C46 A;  4O4G B;  1LWF B;  2DGO A;  3D0I E;  4NZ6 A;  4LUB A;  5KG4 A;  5JMN A;  1FJG F;  3CCV S;  2J0W A;  3PEJ A;  4IO9 Q;  2ZH5 A;  3U02 A;  4PWD B;  4OZ2 A;  5KT5 A;  1TL1 A;  1TUG B;  1UEV A;  2FLP A;  3OL9 A;  2B43 A;  3V81 A;  3FCH A;  2CG4 A;  2GS8 A;  1UKU A;  1P8G A;  4RW6 A;  3TUZ C;  3DOK B;  2W8L A;  1M1G A;  4DR2 J;  3WIU A;  4RW4 B;  2MKH A;  2HVE A;  1EET B;  4X66 J;  2ROP A;  4DCP B;  3IM9 A;  1KC8 T;  3MM8 A;  4JI3 J;  3WX4 A;  2BQU A;  3TUJ C;  4GKJ F;  1JXE A;  4H4M A;  5B0B A;  2OPP A;  4I2P B;  5C25 B;  4AUK A;  4O3S A;  2M52 A;  4CLP A;  1JNR B;  1WNE A;  3LAL A;  4B17 A;  3ZO7 A;  4J9O A;  1CBK A;  3PHE A;  5KFK A;  2ZBP A;  2BUN A;  4ZJO A;  2KFZ A;  4I2Q B;  5IM0 A;  2J6T A;  2BXJ A;  1N5Y A;  1LOU A;  4ES2 A;  1U02 A;  3PZP A;  4DUZ J;  1H72 C;  3HSJ A;  2P6T A;  3UQS A;  3W2V B;  2LXF A;  3OR1 B;  4A46 A;  2G1D A;  3QJJ A;  4NXN J;  1WC1 A;  4FYV B;  3G6Y A;  4P74 A;  2DNK A;  3BGF A;  3FSI A;  3MDF A;  1ZPV A;  1VGY A;  3M8Q B;  3AQP A;  1YBA A;  2ATC B;  4Q8E A;  1PYO B;  3M9N B;  2M2B A;  1PAU B;  2RE1 A;  1OPI A;  4MKA A;  4AXJ A;  1X5O A;  3A3O B;  2OEJ A;  4UY8 T;  4JI7 F;  4ZPA A;  2LDY A;  4NRU A;  1N33 F;  4FS1 A;  2VIC A;  2BOP A;  5KFX A;  2CJY B;  3NGR A;  3DGP B;  1KN6 A;  3VGU A;  1X5T A;  2E5I A;  2F5G A;  3KG1 A;  4DV2 J;  1BMQ B;  1KSP A;  2DGW A;  6AT1 B;  3LP1 B;  1S1T A;  1XR6 A;  5HVH A;  1NDP A;  4F25 A;  1SL0 A;  4EFA C;  4OYX A;  5H9F K;  3LA0 A;  1BQN B;  1VK8 A;  3QSI A;  1L3S A;  4JYA F;  3IG1 B;  2B4P A;  1VQS A;  3NG8 A;  3CCU S;  1LK5 A;  2FVS A;  1TL7 A;  5KFS A;  4XIU A;  3OW2 R;  4Y34 A;  5ETO A;  4FKX A;  5LMU F;  3KHG A;  1S59 A;  4WFB Q;  1O5J A;  1VQ9 S;  3MM9 A;  2KZZ A;  3P3D A;  3QT7 A;  2RKI A;  5AJ3 J;  2YNG B;  3KG4 A;  3I0R A;  3I87 A;  1S12 A;  2FJV A;  2F40 A;  2NPI A;  5J2P A;  1JJH A;  2BQR A;  4G1P A;  3OXG A;  1VQO S;  3GZ7 A;  1M90 T;  3V6D A;  5KG7 A;  4G65 A;  5IWA F;  1CG2 A;  1RAH B;  2DPJ A;  4K0K F;  3DMJ A;  3KHH A;  4E98 A;  4B3T F;  4DX5 A;  3BBB A;  1FD8 A;  2EFG A;  3DOM B;  2DYA A;  2B9Y A;  3BGO P;  4BLG A;  1B4S A;  1FES A;  1FRH A;  3TOQ A;  4O4G A;  1LWF A;  2HND B;  4OYM A;  2D9P A;  4OHV A;  2JEI A;  3FJ2 A;  3P4U B;  2AW0 A;  3A3P B;  2CUY A;  3KLI B;  3IRX B;  4K4X A;  4IOC Q;  5HI7 A;  3UCG A;  2YNI B;  5HVG A;  1XTZ A;  3CDE A;  2BJ9 A;  3W9J A;  3W9H A;  1U24 A;  1SXL A;  1NSQ A;  4OHW A;  3DOK A;  4ETX A;  4USM A;  2DBB A;  2OML A;  3UN3 A;  1CS4 B;  1EKS A;  2FHM A;  3GG0 A;  2OFG X;  4CLF A;  2LKZ A;  2VUG A;  4NML A;  4HTI A;  2XNQ A;  1NCL A;  3BSC A;  4CLW A;  2G4B A;  1DTQ B;  4LQ3 A;  3KK3 A;  1XMB A;  2I38 A;  3EXY A;  3MR3 A;  4QYZ J;  1U0H B;  1TMJ A;  4P10 A;  4WJB A;  3V4M A;  5B7W A;  2QSW A;  3OXF A;  4Y2M A;  3IR6 B;  3GLJ A;  3JTP A;  2CNK B;  5D15 A;  3HD1 A;  2E44 A;  1U6F A;  1MW7 A;  2YWF A;  1K47 A;  5ETT A;  3ZZT A;  3T6B A;  2CYY A;  4I2Q A;  5HLF B;  2AJQ A;  4DR6 J;  3H8Y A;  1NO8 A;  4ZLJ A;  2E5J A;  1XWL A;  2HS3 A;  1OJ4 A;  1RT1 B;  1OSC A;  3W2V A;  2FVQ A;  2CDR B;  4YFU A;  4YHH F;  3OR1 A;  1FEE A;  3ZC4 A;  3AJ2 A;  2AYM A;  2D3U A;  4W90 B;  2WOM B;  2ZNZ A;  2DHH A;  3NCQ A;  2QX0 A;  4F36 A;  3HK2 A;  2AEM A;  5HVF A;  3I82 A;  2ACY A;  2ROG A;  2E1M C;  4DR7 F;  2OSR A;  3NXZ A;  1CPZ A;  1M1H A;  3CCQ S;  1T94 A;  4PYA A;  2QMU B;  2BV3 A;  4JI6 J;  4DOZ A;  3UI3 A;  4ZA1 A;  4AD6 A;  3T5K A;  4HI2 A;  2HFV A;  1BWE A;  1GH8 A;  1ZYQ A;  3H42 A;  5CYQ A;  1RWM B;  3J7Y I;  3HVR A;  4MIB A;  2X1A A;  2NZC A;  4X4P A;  1D0E A;  4RUC A;  3H4D A;  1RP5 A;  4B3O A;  3GMG A;  1H2U X;  3TVZ A;  4KC5 A;  4PYD A;  2BJD A;  3CCM S;  2AGP A;  3DGP A;  2F1F A;  4F3Q A;  4MKY A;  4QU6 A;  5GAG I;  2XGP A;  4KR0 B;  1LW2 B;  4DV5 J;  4IH6 A;  4GC6 A;  2X7I A;  2EFN A;  2CJK A;  2BRL A;  1FTC A;  2PFF B;  2PEB A;  4LF7 J;  2LA6 A;  1P1L A;  1UA1 A;  3Q8Y A;  1DRZ A;  2DB1 A;  3IG1 A;  3QZ7 A;  4J9P A;  2B4O A;  2CQH A;  1PG5 B;  2PC6 A;  4DPU A;  3W2W A;  2ZH6 A;  1RTJ A;  2MQM A;  1RWP B;  2AP6 A;  4ZLN A;  2MQQ A;  4R8U A;  2LQB A;  2PT0 A;  3R2D J;  4MYU A;  3M2U B;  5EN1 A;  1KQF B;  3POT A;  4KFB B;  2O1P A;  1Y0H A;  2YNG A;  2WB1 D;  4FPI A;  1B70 B;  1X9W A;  1N5Q A;  2ZFH A;  1KRP A;  3PRD A;  2JDJ A;  1GXU A;  5J1E A;  3FDS A;  2GMH A;  3TW0 A;  3JQK A;  1ZA2 B;  3J7A 1;  4QR2 A;  2MQ8 A;  1T02 A;  1DHM A;  1FFG B;  5GAD I;  3EE3 A;  3DOM A;  1NAQ A;  2X3D A;  3W66 A;  2CPZ A;  4B9M A;  4DMZ A;  4K5S A;  3U7J A;  4DPX A;  2ZM6 F;  1L3V A;  3KLE B;  1RT4 B;  1WKJ A;  1RT5 A;  2DNH A;  3M8R A;  1HMV B;  1WEY A;  3IXQ A;  4HHJ A;  1RSC A;  3RBZ A;  3KLI A;  2UVU A;  1RU1 A;  2QL9 B;  1FEH A;  1SJ3 P;  2DVI A;  2YVS A;  4UQG A;  3VAL A;  4ERD A;  2ZDP A;  3CCS S;  1B0V A;  1RTI B;  3X3U A;  2DCU B;  4EYI B;  2MQO A;  1MG7 A;  1HNX J;  3UDE A;  4BC9 A;  4FXV A;  5F9N A;  3BYP A;  1KLN A;  1S6P A;  5ETN A;  1HQU B;  2UXD J;  5KFH A;  4TY9 A;  2KI2 A;  1YJ7 A;  2G9O A;  2GVZ B;  2QLB B;  3D7S B;  3DXS X;  7FDR A;  4ZVQ B;  4GMK A;  4P9S A;  4ECR A;  2K7K A;  4CLL A;  3DU6 A;  5F8I A;  2YPY A;  2B6A A;  3SSS A;  3QQC D;  4EBE A;  1U0H A;  4MJK A;  4ED7 A;  1DFD A;  3PO4 A;  5GAE I;  5IT0 A;  2M3D A;  5KT6 A;  4ECT A;  3MD3 A;  2J5A A;  3O8W A;  1SQF A;  4ZMM A;  2DNP A;  3PG9 A;  4QCL A;  3T1H F;  4A8F A;  2HFN A;  1B0P A;  4J37 A;  2ZH8 A;  5IC4 B;  1BGX T;  3R2C J;  3DOL B;  2OFH X;  3TJA A;  1RT1 A;  2XY5 A;  3UCU P;  4PG8 A;  1P6T A;  5LOQ A;  2A1B A;  1VHI A;  1YJ9 S;  2G1H A;  1JLQ A;  2WOM A;  2VPZ B;  2RF2 B;  5E5N A;  4Y00 A;  3C19 A;  5DRK A;  4YR2 A;  1KNZ A;  2EK1 A;  5HJY A;  2FHO B;  1W25 A;  2RRB A;  1DTT B;  3DHW C;  1Q8B A;  2DRA A;  2A0F B;  2ASL A;  5B0G A;  1OYD A;  4DX8 H;  4OV1 A;  3CJ0 A;  1YJU A;  3LPE A;  3TA0 A;  2IM3 A;  3PR4 A;  5LSO A;  1RHJ B;  1FRI A;  3BBC A;  1D3W A;  2ASD A;  2XS7 A;  3JQJ A;  4KV8 B;  2YKP A;  3AHP A;  2H48 B;  2Y1L B;  2JRS A;  1Y11 A;  2OPS A;  4ZK7 M;  1U1R A;  4B9V A;  2IYG A;  3UDV A;  1MNE A;  2FJW A;  2VDI A;  1VBY A;  4U6P A;  2ILY A;  1IWG A;  4C8L A;  4ZIW A;  1HQE A;  4CO3 A;  3CC4 S;  1F5C A;  2Z0G A;  2V34 A;  2PII A;  1LW2 A;  1ACM B;  2BAN B;  1JLA A;  4FP9 A;  4KB7 A;  1YVF A;  1VBK A;  3BGU A;  2Y1I A;  3JTO A;  1TV6 B;  2C2Z B;  2LEB A;  3L7P A;  1XNR F;  1S1X B;  5E41 A;  1CJV B;  5C42 A;  1VRT B;  4JI4 J;  2DHS A;  3AD7 C;  4QYZ K;  1RIS A;  1JXL A;  2EFP A;  4WKR A;  4DZD A;  1B0T A;  2QFI A;  3CJ2 A;  3UN2 A;  3M2U A;  3C14 B;  2ROE A;  2W2P P;  3MAA A;  3RW7 A;  4U67 Q;  5KT7 A;  2GHV C;  3OUY A;  4UZB A;  3GQC A;  5IS2 A;  3VAF A;  2DT9 A;  4E8U A;  4DR5 J;  2GW8 A;  1NJZ A;  2I1R A;  3PIP Q;  3OD2 A;  2Z2Y B;  1WD6 A;  3PKM A;  2YH0 A;  2DNY A;  1OQ6 A;  3TQ1 A;  1IVZ A;  4DCO B;  3RB3 A;  3W9I A;  3PYF A;  4NE9 C;  2H3E B;  4MYT A;  4CM2 A;  2E1R A;  3GG1 A;  4J90 A;  5KFJ A;  3ILL A;  2E7X A;  1D8Z A;  2CA9 A;  4P52 A;  3PW5 A;  3FRZ A;  5I42 B;  1NXI A;  3VVT A;  1NH8 A;  1O51 A;  5LXR A;  3OFE A;  2E9T A;  4LSN B;  2CIM A;  1WAC A;  1REV B;  3NS5 A;  2J0Q D;  4NCA A;  4NCG A;  3E3X A;  1R6V A;  2WAQ D;  2WZ1 A;  4QQB A;  3GSI A;  4MTP A;  4O3O A;  5F8L A;  3UNG C;  1U45 A;  1GMW D;  4AFF A;  5KG5 A;  1M0S A;  3CMQ A;  1UW9 A;  2VA3 A;  3MEC B;  1VYA A;  3H0P A;  4HAC A;  1S6O A;  4JI2 F;  2DNG A;  2BE9 B;  2BE7 D;  1U2C A;  5D0R A;  5KG3 A;  1K0V A;  1HQU A;  3D0G E;  4I6W A;  2XTJ P;  3M2V B;  2RQK A;  1JLF A;  4QWB A;  3HM9 A;  1T9U A;  1RT2 B;  3NEK A;  4FVC A;  1ZET A;  1JLB B;  2H4W B;  1P9Q C;  3HKW A;  4Q5V A;  4K4S A;  1IM4 A;  5GMK a;  5A0Y A;  3BO4 A;  2FJD B;  2QTW A;  1OYE A;  4DL4 A;  1SKU B;  3TP2 A;  1ZTT A;  3AY0 A;  1S4E A;  2KRB A;  4FYD A;  3RAX A;  1BQM B;  1FI4 A;  1FDN A;  4K5R A;  4ZHR B;  3BRE A;  3OSN A;  1AFI A;  1FHT A;  2VOO A;  2YBV A;  4U96 A;  3VAH A;  2V8V A;  1ZS6 A;  2HYI B;  2R7V A;  4L73 A;  3IM8 A;  1BY9 A;  3W5Z A;  3TWZ A;  2G2O A;  5DQH A;  4K8R A;  4LBP A;  2WON B;  2JEF A;  3HFK A;  3KUE A;  2HNZ A;  5HP1 B;  1R8P A;  4LFC F;  1OSD A;  4ZPC A;  2QYG A;  3W60 A;  4Z37 A;  1S9F A;  1WHY A;  2RF2 A;  4KQZ A;  2CNO B;  2MLY A;  2KN4 A;  2BJ3 A;  1Q5Y A;  4DWI A;  1QAY A;  1DTT A;  4UUW A;  1SUQ B;  3OPK A;  2VBW A;  2MY8 A;  4DV4 F;  1S77 D;  1UZH A;  4NI2 A;  3K2Y A;  5DLG A;  3TX8 A;  3DLH A;  3GFZ A;  5J2N A;  2VA2 A;  2VFS A;  5HAN A;  2VFT A;  1V3R A;  3W8G A;  4M5D B;  3J81 U;  2Y0S D;  2DHA A;  3DRP B;  2QO3 A;  4K2J A;  4G6V B;  2HNY B;  4IOB A;  4KV8 A;  4CT8 A;  3K0J A;  3M6X A;  2J9E A;  3JXO A;  4GVB B;  2ZVS A;  2MLX A;  3SCJ E;  5KFI A;  4ZVF A;  3OVS A;  1IR1 A;  1V3Z A;  3W5X A;  4DR1 F;  2HKE A;  4DL3 A;  2MMY A;  3BKT A;  2FJB B;  3I0S B;  4ED4 A;  2CPJ A;  4WCE Q;  2H65 B;  3HXM A;  1FER A;  3LWL A;  1N34 J;  4B9N A;  3HPO A;  1WF2 A;  1ZZN A;  1S1X A;  3UD3 P;  3J81 Y;  4Q8F A;  2CPE A;  4RKU C;  1VC6 A;  4ITS A;  1KS2 A;  3IR7 B;  3RYL A;  3HSZ A;  4WFN Q;  2BJ7 A;  4IYQ A;  5EHH A;  3MMC A;  2IIH A;  5G0R A;  5GAH U;  3IGV A;  1AZS A;  5DZ7 A;  3MI7 X;  3UE2 A;  3QGH A;  2E9Z A;  4P2S A;  4BWM A;  2Z2Z A;  1UP1 A;  4MIW A;  4PR6 A;  3P96 A;  1YLX A;  4WBF A;  4U8V A;  2RQM A;  1VQ6 S;  3TJ8 A;  1HWU A;  5KT3 A;  4YY3 F;  2CNL B;  4CDI A;  3MOZ A;  1TMM A;  1VQM S;  2ZD1 A;  2BQ3 A;  4QIE A;  1XNQ F;  5AXK A;  1SQG A;  4LRF A;  3GR0 A;  2L9N A;  2KVQ E;  5CAA A;  3P6Y C;  4QZV B;  3OR2 A;  1S6U A;  4JI7 J;  5I42 A;  3TEH B;  1R0A B;  4J9U E;  2W9C B;  3DC2 A;  4U8Y A;  3F0N A;  1F6T A;  4KHP F;  4LSN A;  4DSE A;  1TKZ A;  4LFB F;  2O66 A;  1SV5 B;  5CYM B;  1SC6 A;  1J5E F;  1QTM A;  2GFF A;  3BBF A;  1EP4 A;  5HO4 A;  4KRW A;  2H1Y A;  1U49 A;  3MEC A;  3PO5 A;  4JI8 J;  2VBX A;  2IM1 A;  1VRQ C;  4ZDN A;  3VAM A;  3H7H B;  4RR5 A;  2Z2M A;  2HK3 A;  2F9D A;  3M30 B;  1NU4 A;  1RAJ A;  2H5E A;  4A8Q A;  1N54 B;  2ZBI A;  1CJT A;  1RT2 A;  4N56 A;  1Q4R A;  1ITP A;  1OS5 A;  5LMU J;  2Y1R I;  2NSB A;  1W2B R;  1RWU A;  3D1O A;  4A8X A;  4DR3 F;  4MFB B;  1RU2 A;  4D3H A;  5B09 A;  5DET A;  4DUY F;  2IY5 B;  1YX2 A;  4OJG A;  3UCZ P;  2QA1 A;  1S0N A;  2HRU A;  4CO1 A;  2BM0 A;  1D9A A;  2VG7 B;  4IRK A;  5KFV A;  1BQM A;  2HRY A;  2H54 B;  4A4J A;  2V8D A;  1C4A A;  4AXI A;  3EX7 B;  4CTA A;  2HWI A;  3I9Z A;  1GMU A;  3DLL Q;  3GII A;  1XJW B;  2EWH A;  4DDF A;  3HD2 A;  3G6V A;  3QJL A;  4C2M A;  1KDN A;  1FF2 A;  4ECW A;  3MR5 A;  4IH5 A;  4DJB A;  1I51 B;  3KNG A;  4J9S A;  4XTT A;  2CPX A;  5H1S V;  3EGN A;  1KHW A;  1IR2 A;  1P1T A;  2DHX A;  3CVK A;  5CA5 A;  4ZVT B;  1JX4 A;  1OIA A;  2M0G B;  3GCW P;  2GNK A;  4JV5 J;  1TAU A;  1U6Z A;  2EBG A;  4RL1 A;  4F4Z A;  1HA1 A;  4DFK A;  5A6P A;  2D74 B;  2DR6 A;  3PJ9 A;  1XMQ J;  5KFG A;  5DDP C;  1NK8 A;  4M5D A;  3DI6 A;  1KQK A;  1EAY C;  4ALZ A;  5FJ4 A;  1ARO P;  4WFX A;  2XMA A;  4CZC A;  2UUB F;  3ITH A;  2HNY A;  4KT0 C;  1FFW B;  3ZTR A;  3UDL A;  1EAR A;  3SIP B;  3G9C A;  3PXG a;  1C0U B;  1PC5 A;  1CQM A;  1SVD A;  1CJK B;  2XCP A;  2FVR A;  3LW5 C;  5FDL B;  2DNM A;  4M5M A;  5K20 B;  2BDP A;  1U8S A;  3N6M A;  2XC9 A;  1H98 A;  1WC0 A;  3I0S A;  2YKN A;  2VDH A;  3QFH A;  4FYW B;  5AXM A;  4OL8 A;  3MPW A;  4GO7 X;  1HHQ A;  1EZZ B;  1QUV A;  1T3N A;  4DR2 F;  5IV4 A;  2L48 A;  4OI1 A;  1J27 A;  2IMO A;  4X66 F;  4LQ9 A;  1T03 A;  2OAU A;  1TUW A;  1VHF A;  1S9G B;  3M6U A;  1QY7 A;  4WZM A;  3L9Z A;  4MT1 A;  4JI3 F;  2OLW A;  2OSQ A;  1RJJ A;  4HEA 9;  3EUN A;  3D6H B;  1G7C B;  3GIR A;  4KHM A;  3ONQ A;  3E01 B;  1N5T A;  3LP0 A;  4P2M A;  2XSJ B;  1Y10 A;  3QSY B;  4I7F B;  2A6O A;  4W92 B;  3R6L B;  3FGV A;  1U8W A;  2WRM A;  2Q6C A;  1X4D A;  3P45 B;  1YJW S;  3K57 A;  2V4J A;  4YDD B;  3PM9 A;  1LXJ A;  4DUZ F;  3CT9 A;  1A7G E;  4D3G A;  1V5I B;  1JMT A;  4P71 A;  4DX7 A;  1RDR A;  3QPI A;  1YZ7 A;  2ZKT A;  3AD8 C;  3R5A A;  4XDC A;  2V8H A;  2ZBR A;  3FBC A;  1S0V A;  4W98 A;  4XPC A;  3TUI C;  4C11 B;  3HP6 A;  4DSL A;  2O01 C;  2XMK A;  1VBZ A;  2EI5 A;  2CAD A;  3HHL C;  5CYM A;  4QWE A;  2K8G A;  1URR A;  4PKD B;  2MDA A;  1XR5 A;  2GJI A;  2Q1L A;  1NK5 A;  4XDD A;  3W3S A;  2D41 A;  5HMW A;  5D4L A;  4U7U D;  5L8R C;  4BS2 A;  5KFT A;  2XY6 A;  1NK4 A;  1M5H A;  3GFX A;  3NGK A;  2ZWP A;  2HQ3 A;  4CT9 A;  3R7B B;  1HNZ J;  1VQ4 S;  3KK2 B;  1SL2 A;  4O3P A;  2ILZ A;  4M1K A;  3RG6 A;  4RNO A;  4UUX A;  5F3T A;  3QT5 A;  1YIT S;  2XZW A;  5IT4 A;  2CQG A;  4JOU A;  4DV2 F;  2BKN A;  2AJ0 A;  2EEY A;  2IM2 A;  1IR0 A;  2YY3 A;  1RB0 A;  5C7P A;  8ATC B;  3M8Y A;  2VG7 A;  5J2M B;  4DS5 A;  2ZJQ Q;  1RAF B;  5I3Q A;  3CNQ P;  1RCO B;  2JLF A;  3J80 Y;  2WVF A;  4ZVG A;  5BR8 J;  4KKO B;  3OL8 A;  2YKO A;  5RUB A;  4QOT A;  1HNI B;  1YJR A;  5EX0 A;  1T9X A;  1JKH B;  4WU2 A;  2NPF A;  2VKZ G;  2CPD A;  4ZCM A;  1NJX A;  5LL6 d;  1RT6 B;  3KLH A;  3Q8R B;  1IKW B;  5AJ3 F;  4C0O C;  3B78 A;  3WIV A;  4OYA A;  1NK9 A;  4M5J A;  3UDC A;  2HW3 A;  3BGL A;  2OEL A;  2GX8 A;  2JX2 A;  3AH6 A;  2KT2 A;  2XQC A;  1CSJ A;  3MEK A;  5D4O A;  1AT1 B;  5KFR A;  3M32 A;  3DU5 A;  4DLG A;  1PIE A;  1S6Q B;  5E3A A;  3JB9 k;  1VQ5 S;  3VGV A;  4NYO A;  1FNO A;  4NLD A;  4QBU A;  2PFD A;  1HNW J;  4A8W A;  3HVA A;  1N5V A;  1C0U A;  2JOQ A;  4QPX A;  2W2N P;  1U48 A;  2NYI A;  2ZUG A;  3CGI A;  1CJK A;  3ZNJ 1;  2PI5 A;  4JI5 J;  3SCL E;  5FDL A;  4A47 A;  4DQS A;  4USU A;  2A10 A;  3DLJ A;  1T9T A;  3OSP A;  4F4W A;  3OV7 A;  3OHA A;  1DAX A;  1XC9 A;  2A18 A;  1JLE A;  4LRE A;  3LF0 A;  3IWL A;  3FQL A;  1G4C A;  1X0P A;  3OJU A;  2I6W A;  3EZ5 A;  5T7L B;  2L08 A;  2PO4 A;  4DUT A;  2WTF A;  2LP4 A;  2C2D A;  5L1L A;  1VQN S;  1RQ0 A;  2ZZT A;  3CO0 P;  4FXW A;  3GJQ B;  4RZR A;  4OFZ A;  1Q79 A;  1WEX A;  4NYZ A;  1IUJ A;  3DGV A;  4BBY A;  3KOA A;  3T19 A;  4IG0 A;  1CJU A;  2WVB A;  3G6X A;  2DNR A;  4NEY A;  4F2S A;  2BVZ A;  1JIH A;  3Q83 A;  4DLE A;  3HHN B;  2XMU A;  1R43 A;  4ZVR B;  4I7F A;  4OI0 A;  5ETP A;  4O4R A;  3G8Q A;  1PBA A;  4PPZ A;  2J6U A;  3BN4 A;  3PJX A;  2F63 A;  4DF4 A;  4IDK B;  2DGV A;  5B0A A;  4ID8 A;  2RUG A;  2EC2 A;  4DR6 F;  4C3K A;  2FJE B;  2ZKU A;  1OY6 A;  3CME S;  4LBI A;  3C3L A;  1Q8K A;  2R4F A;  4H4O B;  2BW2 A;  3FCW A;  1RHR B;  5LSL A;  3NGS A;  5C2G A;  3O3L A;  1L5U A;  1SJ4 P;  4A8Y A;  4RW8 B;  5EGY A;  1SC1 B;  2JWN A;  1MML A;  3LAM A;  1PBU A;  1S97 A;  3T1A A;  3GON A;  4C11 A;  4PQU B;  5ETR A;  3TZZ A;  2HG4 A;  2V0N A;  1T7P A;  2SXL A;  4CH0 S;  2ZUA A;  1HI8 A;  3NMA A;  4Q45 A;  2WVE A;  5K8M A;  4JI6 F;  4UW2 A;  4F4X A;  2U1A A;  3FK4 A;  3VTI A;  5L1K A;  3ZNU A;  3JSB A;  1YJV A;  1KBR A;  3AOD A;  4IR9 A;  2HBR B;  2K06 A;  2X51 A;  2NSC A;  2HVI A;  2Z30 B;  1SH3 A;  1PAE X;  1X0F A;  5K14 B;  2E7V A;  3SEO A;  3GCX P;  5LT5 A;  1S48 A;  2I5J A;  3HO1 A;  4DSJ A;  3KK2 A;  3DRX A;  1LK7 A;  3CCR S;  2YKM B;  3US5 A;  1C1C A;  2Z57 B;  2MZJ A;  2ERR A;  3HZE A;  5AXN A;  4WU3 A;  2CZV C;  1WDD A;  4DV5 F;  4J7C A;  3NBP A;  4NZ0 A;  4KGV B;  5J2M A;  2C42 A;  3DRR B;  4FPR A;  2OMO A;  2J0X A;  2WW8 A;  3D4J A;  4ENO A;  4ECY A;  4J9M A;  3CTR A;  3BQ2 A;  1V9O A;  1RWN B;  3WDO A;  1R7I A;  4PG5 A;  1JKH A;  3S1T A;  5DQI A;  2V50 A;  5HJX A;  2W9A A;  1X4E A;  4A8M P;  2FVP A;  1WJ9 A;  3OHB A;  3QRQ A;  2KRR A;  2R7T A;  5LXY A;  3OLA A;  4HHU A;  3KDO A;  1WHW A;  2C2E A;  1VLO A;  4RPF A;  1Y5L B;  3O44 A;  2VD3 A;  4Y6I A;  1L3T A;  3MEG B;  5J2Q B;  4LF2 A;  4RU9 A;  4PG4 A;  4ELU A;  3GIL A;  1FRX A;  4I69 A;  1QAJ A;  1TUV A;  2GQ2 A;  1HWI A;  3TI0 A;  2C3P A;  3AD9 C;  3LP2 B;  2IPO B;  4C0B A;  2LQ8 A;  4C8Y A;  4JI1 J;  2GIF A;  2MKC A;  1WC4 A;  1KFS A;  2H5I B;  4CLT A;  4U7C A;  2DXD A;  2PGC A;  1N4L A;  1VQP S;  2J9C A;  4ECQ A;  1OMS A;  4E0D A;  5F3Z A;  4EYH B;  2D7S A;  2AZ1 A;  4L72 B;  1RHK B;  4YQW A;  2R3V A;  5B0D A;  2W2Q P;  2MYF A;  3A8K A;  5KFO A;  1DQA A;  3H59 A;  5CAB A;  1HNX F;  2AYE A;  3KUH A;  2IJF A;  5T7L A;  3H2U B;  3S8S A;  2UXD F;  3NLC A;  2RIJ A;  1F1B B;  3ENA A;  1N36 J;  3M2R A;  4I64 A;  4LFA J;  1C0T A;  5K5M A;  1Y00 A;  3LH2 S;  1H7W A;  2FPH X;  2EW9 A;  4CNZ A;  2X1B A;  1IQZ A;  3T3F A;  2EVZ A;  4JV0 A;  1JLG B;  4LF5 J;  1REG X;  1CC7 A;  4M94 A;  1KKH A;  2PA3 A;  4ID5 A;  3TAM A;  1JK9 B;  4M5I A;  4OYI A;  4RW7 A;  3ET6 B;  3CW2 C;  3HHD A;  4DV4 J;  2CZ4 A;  3JYT B;  2W2O P;  1NND A;  3MFH A;  4KHR A;  1RUS A;  1IKV A;  4H4O A;  4YR3 A;  4C0H A;  4XPE A;  1TKT B;  1X4B A;  3JSY A;  4WPA A;  3HHL A;  3RUB L;  2W8K A;  5IZH A;  3ILO A;  4RW8 A;  1KLM A;  3N28 A;  1TEL A;  5ETV A;  1R0B G;  1SJR A;  3I9V 9;  1TL1 B;  2XMM A;  3IN5 A;  2N7C A;  4HHH A;  4MK8 A;  2YKQ A;  2R7R A;  5DM7 Q;  4RW6 B;  2XM3 A;  3BH6 B;  4USK A;  4LRA A;  4P2X A;  2LFV A;  1SIW B;  1NDK A;  1LXN A;  5JJB A;  3H25 A;  4WFZ A;  3K5N A;  1UW4 A;  3EPG A;  2V2V A;  1SPB P;  2IJR A;  3C6U B;  4QIV A;  3MM8 B;  1RTH A;  3DLG A;  2YTC A;  1LWC B;  2ZWO A;  2KM8 C;  2Q66 A;  1A0O B;  2HHW A;  4N41 A;  4RWW A;  3BO2 A;  1PJ7 A;  2RRA A;  1MU2 A;  2OPP B;  2RS2 A;  1FVS A;  2DRD A;  2FLL A;  1GK8 A;  3RBE A;  4RX6 A;  4ED0 A;  4YR0 A;  2AF6 A;  1ZAX A;  1XR7 A;  3CUN A;  2VOP A;  2BRK A;  4C4W A;  4W4M A;  1TU0 B;  5IM0 B;  3BS9 A;  4YB5 A;  2E5G A;  3JSM B;  4QWA A;  2CKW A;  4JI4 F;  3C2P A;  3BH7 B;  1UEK A;  1H7X A;  3ICL A;  1YI2 S;  3U1M A;  4OZ0 A;  4UQT A;  3CJT A;  3NS7 B;  5G4D A;  4PAA A;  4F26 A;  3UWT A;  3VAJ A;  4NLQ A;  4HDG A;  2QYC A;  1NLK L;  5AE1 A;  2HWT A;  4Y2I A;  2PD1 A;  3BJY A;  2HK2 A;  1S79 A;  2A2C A;  4NLO A;  3GFY A;  2HUR A;  3VGS A;  3GIM A;  3AXK A;  1XN9 A;  3U1L A;  4TVA B;  4GKK J;  3BO3 A;  4NLW A;  4X4O A;  1QJH A;  4DR5 F;  1R8H A;  4KJI A;  3FVY A;  3GP9 A;  5A8K B;  3PFE A;  1UZD A;  3N6L A;  2QMX A;  2IC3 B;  2M9K A;  3CCE S;  1RWW B;  4JI0 J;  1H3D A;  4X2B A;  3SV3 A;  4I6Y A;  4CO5 A;  5J2Q A;  3R6G B;  2DHG A;  3UVJ A;  4ECS A;  4C3L A;  2R8I A;  2LEC A;  2ZDO A;  1KVJ A;  4X4V A;  1FE0 A;  4DN0 A;  2JH3 A;  4PZV A;  3LP2 A;  2XMT A;  4AQY J;  2W2M P;  1QAI A;  3KJV B;  2KYX A;  2IVM A;  2V2Q A;  2M7S A;  1RHU B;  5ADZ A;  2E5H A;  4DR3 J;  2HAI A;  3KTQ A;  2GZO A;  3V4I B;  2Y1J A;  4YS2 A;  3ZFV A;  4TU8 A;  1S1T B;  4DBQ A;  1U25 A;  3VQT A;  4WK3 A;  2PDA A;  2DNL A;  1M5O C;  1KVK A;  1O0P A;  2R7O A;  2F8H A;  2MZR A;  1ZPW X;  1TL7 B;  4F4K A;  2FLN A;  4M8L A;  3BQ1 A;  4NWB A;  3I32 A;  3KJF B;  1APS A;  3AJ1 A;  1FRJ A;  1KHV A;  3MM9 B;  5KFF A;  2JHE A;  2HFZ A;  5L9X A;  1KQS R;  5B0C A;  2RKI B;  3WHI A;  2JC1 A;  3VAI A;  2R2T A;  3I0R B;  3M4X A;  3EIC A;  3HHL D;  5J2P B;  4TQS A;  2H51 B;  3H5Y A;  4UST A;  1ZTW A;  4YB6 A;  2IJN A;  4DS4 A;  3V6D B;  1U1K A;  3JYT A;  2R8K A;  3ULH A;  1H38 A;  3DMJ B;  3VQS A;  3LPY A;  2W1B A;  1Q82 T;  4TLQ A;  1TK0 A;  1YK9 A;  3W61 A;  1Q5V A;  2OH2 A;  2OP5 A;  3K89 A;  1TKT A;  1GNK A;  4OI3 A;  2ZBC A;  3CDU A;  3I56 S;  5KFP A;  4ZLL A;  2QFJ A;  1Q86 T;  7AT1 B;  2VBZ A;  3O6Q A;  4OZ3 A;  5E3R A;  3PR5 B;  3KHR A;  2VAS A;  5KFB A;  4QW8 A;  4CLZ A;  3FUY A;  2JLG A;  2LMI A;  4EU0 A;  3B4D A;  2XLJ A;  3GV5 B;  2Z4P A;  4L3K A;  1R27 B;  4L3N A;  4L6V 3;  2EC0 A;  4ELT A;  1XQI A;  2QLJ B;  3ZTS A;  4XK8 C;  2KM8 B;  2EKN A;  2RB7 A;  2QLW A;  2C2O B;  3EGW B;  3UO0 A;  3C6U A;  3IP0 A;  3R7S B;  4ED2 A;  1LWC A;  5F8G A;  4Q0B A;  5K9F A;  2R7S A;  2LEA A;  2RHQ B;  1RBA A;  1UPM B;  2YNF A;  4AL5 A;  4WXW A;  1FDD A;  3KK3 B;  4A8S A;  4G3I A;  2W7O A;  3K8V A;  2DY1 A;  4X4N A;  2R9L A;  2GML A;  4WP3 A;  1TAQ A;  1N34 F;  4RNH A;  2FLO A;  1RYR A;  4RLE A;  2KFN A;  4WFY A;  2C2R A;  1N48 A;  2BKO A;  3IS9 A;  4WWS A;  1T8E A;  3RW6 A;  2WK4 A;  3C6T A;  3K8W A;  1Z2Z A;  1DAR A;  3JSM A;  4P72 A;  2CJB A;  2ZE2 A;  2HQG A;  3MCS A;  1UL3 A;  4F3M A;  1N88 A;  1E6Y B;  1KVI A;  2JVR A;  2V94 A;  1ZAW A;  2HMI A;  1X4A A;  2BR0 A;  3V6J A;  3WC2 A;  2IM0 A;  1I5O B;  3KJQ B;  3MMA A;  2DR7 A;  2MKJ A;  5A6W A;  3Q2T C;  1X8D A;  5A8K A;  2RHS B;  3PRB A;  2R2R A;  2NCK L;  2L41 A;  3AB4 B;  2V8G A;  2QA4 G;  1QUP A;  3QAU A;  3TVK A;  2IC3 A;  1VMB A;  2Y3Y A;  3CJR A;  5C2C A;  2XY7 A;  4NLT A;  1M5K C;  2NZ4 A;  4CIO A;  1BD6 A;  3NWG A;  1S9E A;  4EO6 A;  3W62 A;  5GAH I;  2XSF A;  2AX1 A;  5ETM A;  5CYQ B;  1RA7 A;  3B8H A;  1DBD A;  3IMQ J;  2EFQ A;  5M2R A;  2V4Q A;  2A2D A;  3R5G A;  3KJV A;  3R5B A;  4B3O B;  1HWL A;  2HZV A;  3SFG A;  4ED3 A;  2AU0 A;  3KLV A;  1BLU A;  2QG9 B;  1JJ4 A;  1WWH A;  3QLH B;  5M2U A;  2HZC A;  1WF0 A;  4UT4 A;  5D0E A;  4NRT A;  5C24 A;  1YWX A;  3TVY A;  3R1L A;  5B0E A;  2R7U A;  3V4I A;  5D78 A;  4C6A A;  1HHS A;  4DPY A;  3D28 A;  2KXH A;  3SFU A;  4HH0 A;  1GEH A;  1YJT A;  3IBC B;  4JI8 F;  2HFS A;  2UVV A;  2P6S A;  4NLR A;  2HAF A;  3SDE A;  3NOG A;  5L46 A;  2VG5 B;  3A13 A;  4HLB A;  5AXL A;  2VU5 A;  2E1P A;  3BDP A;  3W2W B;  2VV5 A;  2EFV A;  2KYZ A;  1TFY A;  3FFI B;  1RTJ B;  1S1W A;  4UOH A;  5FD1 A;  1T9V A;  3QAT A;  1UVJ A;  3MPU B;  4R8U B;  4TN2 A;  2VFV A;  1UFW A;  3CD5 A;  2CWK A;  2WHO A;  2UV8 A;  2UUT A;  3LUY A;  3POT B;  3QAE A;  4J9V A;  1VCT A;  5J1N A;  5CHC B;  5CQG A;  1SBR A;  5KFY A;  3MM7 A;  4R0J A;  4X4U A;  4AL6 A;  1VQL S;  1DLO A;  4DV7 J;  2LEP A;  5KFD A;  2KZM A;  5J1E B;  4Y3C A;  4IFV A;  1BHN A;  2YX4 A;  3GIJ A;  4OI4 A;  1FDA A;  1QSY A;  3N4W A;  4UF4 A;  2GQQ A;  4WTO B;  1U0S A;  2DIU A;  4E2F B;  1EB0 A;  1U09 A;  2HS0 A;  2ZNY A;  4UOF A;  1QSL A;  3PAC A;  4LSZ B;  1X9M A;  1RT5 B;  2MKK A;  1MWQ A;  3R8Y A;  4ZVH A;  2LQ9 A;  4RW9 A;  3CJ4 A;  3N5F A;  4O44 A;  1GX5 A;  3LOU A;  4DX6 A;  3DNC A;  2W9B B;  5HN0 A;  1UVN A;  4QR0 A;  2VFU A;  4MIA A;  4JV5 F;  3UD4 P;  4K4U A;  3D1Q A;  1ZA1 B;  2Y8W A;  2MEW A;  4CO0 A;  1QE1 A;  2QLX A;  3BV8 A;  4UOC A;  2BYC A;  4ZVP B;  1WC5 A;  3SYZ A;  1XMQ F;  3CJQ A;  3CD6 S;  2MZ1 A;  2R2U A;  1VIX A;  5HRO B;  4ZVS B;  1RTD B;  1S6P B;  2KU7 A;  3M1V A;  3IWN C;  2E9R X;  3Q8S B;  3BSA A;  4LF4 J;  5DLF A;  4EBC A;  3GTY X;  3THT A;  3OL6 A;  1R89 A;  1M1K T;  5D77 A;  2AQ4 A;  2E1C A;  1FWL A;  2B6A B;  2J8A A;  3MTJ A;  4ZP7 A;  3NWR A;  4HR2 A;  1GAO A;  1RAC B;  1VI7 A;  5F8N A;  2ZC3 A;  4LF8 J;  2H4Y B;  2QIF A;  2HQI A;  3D66 A;  5A8R A;  1FWP A;  4OHZ A;  1YRU A;  2VKR A;  1DZ5 A;  1WEZ A;  4H4K A;  2XMJ A;  3HVW A;  1YSJ A;  3AJD A;  3EVW A;  1HW9 A;  2NXN A;  1ZM3 A;  2R8H A;  3KLG B;  1F5B A;  1WOO A;  2FY8 A;  3Q2S C;  4PUO B;  5KFW A;  1E6Y A;  1XER A;  2G0C A;  4HKQ A;  3T5J A;  1JLQ B;  1LWE B;  2XYP B;  4ZS6 A;  4CO4 A;  3MD1 A;  3SXL A;  3FEY B;  2NUH A;  1RZM A;  2XI3 A;  1JB0 C;  5LJ5 Y;  3CO9 A;  3VAK A;  4G1Q B;  5F8J A;  2FTR A;  2C3O A;  2HBY B;  3TAR A;  4YB1 P;  3TAP A;  1RYS A;  4IG3 B;  3L7O A;  3ZZU A;  1SQE A;  3PJW A;  2O3D A;  4X62 J;  4OX7 A;  1PSD A;  1PYS B;  2V4R A;  1HIY A;  3WBZ A;  5DGA A;  3PCO B;  2OPS B;  1TL5 A;  2F65 A;  3QLH A;  2X1F A;  2O67 A;  3D9B A;  3R27 A;  1HQE B;  5D4N A;  4PRF A;  4HTJ A;  3MHY A;  3HVT B;  4ZVO B;  4HVZ A;  3VF0 B;  3EZU A;  4DR4 J;  2Z2L A;  1R8A A;  1JLA B;  1HBO A;  2HLT A;  2FZG B;  2DPI A;  4I4B A;  1LW0 A;  2DNN A;  2P9G A;  2WB4 A;  1X4F A;  2VG5 A;  4MAK A;  4NLS A;  2U2F A;  5C42 B;  4CLK A;  3VAG A;  4URQ U;  1KEK A;  5LSR A;  4USW A;  4NX9 A;  1HNZ F;  3FFI A;  4GO5 X;  5CH7 B;  2MZQ A;  3FBF A;  4PQA A;  4ZP6 A;  4X65 J;  4TY8 A;  4X4S A;  4LRB A;  4IQX A;  3MAA B;  9RUB A;  4DI6 A;  1U1N A;  4I6A A;  2HZA A;  3OUY B;  4OYZ A;  1SJ1 A;  4FN5 A;  4ZPW R;  4GVL A;  5E2Q A;  1HL6 A;  3BZQ A;  2D3O R;  2GGP A;  1FNM A;  2K1R B;  2PMZ D;  4C3M A;  5ETK A;  3CIZ A;  2EKY A;  1YGY A;  4QJV A;  3VCD A;  2XWX A;  3AOA A;  3NY0 A;  2B7C B;  5BR8 F;  2PE8 A;  3D3C J;  2CQD A;  3RBX A;  4TXS A;  1K44 A;  1SKW A;  1U1L A;  4ZP8 A;  2KHD A;  1WOP A;  3ILI A;  3UR0 A;  1R31 A;  1AB8 A;  3HLU A;  4O0N A;  1RT3 A;  1IBM J;  2AGQ A;  3MM6 B;  2AZ3 A;  2K3I A;  2Y9H A;  2VF3 A;  2GIQ A;  4CCH A;  4NCG B;  2W9B A;  4EZ9 A;  4C9D A;  2VQF J;  1KWM A;  1GQE A;  3FRY A;  3MPY A;  3CPW R;  3E8O A;  3MUM P;  5HAO A;  4WTY A;  1S49 A;  5D8H B;  3FSX A;  5IT9 U;  4HAC B;  5HRO A;  1MRO A;  4WXO A;  1RTD A;  3GPA A;  3DM2 B;  2WCX A;  4EZ6 A;  1P9Y A;  2XYH B;  5KFU A;  1SC3 B;  2C1E B;  4RNN A;  3F44 A;  1HNW F;  1CQN A;  1JLF B;  1U26 A;  4KSE B;  1WOR A;  4QR1 A;  2VJV A;  1GMW A;  4LSL A;  2G2Y A;  4JI5 F;  2DR8 A;  4OYO A;  1HYS A;  5A0Y B;  4FDF A;  3BGR A;  1NDL A;  2ZEJ A;  4RUH A;  2EK6 A;  2HFO A;  4X4T A;  3BPS P;  5GME A;  3VR1 A;  3IGN A;  2ZH4 A;  2B3T B;  3NNH A;  3MMJ A;  3HF5 A;  4JP8 A;  1NSK L;  3GYG A;  4PCQ A;  1J5O A;  3DLK A;  3AOC A;  5IT9 Y;  1FDB A;  2VPX B;  1PCA A;  4OMF G;  2DTJ A;  5KFN A;  4PWW A;  4LR8 A;  3DRS B;  2G0I A;  3KLG A;  4WK1 A;  2HGN A;  2W7A A;  3CCT A;  4PUO A;  1C2P A;  4LMZ A;  5KG2 A;  1GTE A;  1F2G A;  2JLE A;  4FF3 A;  2ZBQ A;  2HNZ B;  1LWE A;  3TX0 A;  4FBU A;  4J9N A;  5L38 A;  1W7W A;  2HS4 A;  1FXL A;  4K2X A;  4DCJ B;  3IBW A;  4DFP A;  1KD1 T;  3F41 A;  3KLF A;  4Z7C A;  4QU7 A;  1HBN A;  4OJ3 A;  3PYG A;  1O6X A;  2HQC A;  4ZN1 A;  2J8S A;  2KKH A;  2OPR A;  1ROF A;  3C8Y A;  4G1Q A;  4NI2 B;  1BE4 A;  5J2N B;  2OIH A;  2CQ4 A;  4F2R A;  4IG3 A;  1RT7 A;  2DJW A;  3HX9 A;  3N0V A;  2YNH A;  4IO1 A;  2MZS A;  2GJF A;  2D1C A;  2HHH J;  4V19 J;  3NP5 A;  1HW8 A;  2DK2 A;  1UFK A;  3OVA A;  4KH1 B;  2LYV A;  3OFH A;  4URG A;  1BWV A;  3VZH A;  1KOO A;  4WP8 A;  1ZAV A;  2DXF A;  1SL1 A;  4OYB A;  1PKU A;  1S57 A;  3MED B;  3AQO A;  2KO1 A;  3FCV A;  3HVT A;  1YZ6 A;  2DNO A;  1HKA A;  2GJ2 A;  3PX4 A;  4USH A;  2FC8 A;  5A8W B;  4RBT A;  2M4M A;  4R0E A;  5JXS A;  1ZBT A;  2EG2 A;  3AAW B;  2BJE A;  1UWB A;  2XUL A;  3Q8P B;  1S1V B;  3KFW X;  1WKK A;  4DQQ A;  3MM5 B;  5KG0 A;  3T5H A;  3LAK A;  1RKJ A;  5BYR A;  2XS5 A;  4J5O A;  2LQ5 A;  2BEF A;  1F9E B;  2FJX A;  4DL7 A;  3RB0 A;  3W65 A;  1WG1 A;  3C66 A;  2IVF B;  5DG7 A;  3HFV A;  2XMW A;  2XO7 A;  4DL2 A;  4P73 A;  3UFC X;  1UEU A;  4OZ5 A;  2V63 A;  2WW4 A;  3MMC B;  2ADC A;  3LGH A;  3NAH A;  1UTA A;  5G0R B;  1F3V A;  3BN7 A;  1AZS B;  2M8H A;  5DQG A;  3ETO A;  4C8Z A;  4DFM A;  4K4Y A;  3G82 A;  1NPP A;  1VQ7 S;  5ETQ A;  2W01 A;  1CUL B;  5F0W A;  2K1R A;  3FZB A;  5B0F A;  3BR8 A;  1TK5 A;  2ZD1 B;  1VQK S;  3ZZP A;  4MKB A;  5H9E J;  2EG1 A;  4I68 A;  2HBZ B;  3PYE A;  4ES3 A;  3CB4 A;  4GC7 A;  1EQ0 A;  1N52 B;  1WSR A;  4RJV A;  5HBM B;  2HVH A;  3OR2 B;  4CWB A;  4DEZ A;  1I94 J;  3TEG A;  2XZD B;  3IWX A;  1S1U A;  4ZLP A;  3MM6 A;  4X84 A;  3T6J A;  1TKZ B;  2XZT B;  4TYB A;  4A48 A;  1LQ9 A;  3TAQ A;  3RR7 A;  2F4F A;  2FB0 A;  2C2K B;  3SCK E;  2AKW B;  1EP4 B;  3SQG B;  1I3O B;  1NDC A;  1R6Y A;  2PI4 A;  3U27 A;  1RWV B;  3M9O B;  4K7Q A;  1SH2 A;  2A3J A;  4V19 X;  2HHU A;  3DM2 A;  3GJS B;  1ZZF A;  4S0M A;  3QWU A;  4JB8 B;  2Z56 B;  3FNN A;  4JI1 F;  4USI A;  2P8I A;  3I96 A;  1CJT B;  3P49 B;  5KOW A;  3WQP A;  2DO0 A;  1IWA A;  3BR9 A;  4I56 A;  2GIR A;  1C1B B;  2HIY A;  1RCX B;  4Y65 A;  1W26 A;  2RS8 A;  4AT1 B;  4BDP A;  3R7N B;  1MN9 A;  1H2V Z;  4KO0 B;  4NL5 A;  2H9Z A;  1W2I A;  4F8R A;  3EPI A;  1Q8L A;  3NNC A;  2DH7 A;  2M8D B;  1FKP B;  2RDJ A;  4H54 A;  2LXU A;  4DV1 J;  4TNO A;  3HT3 A;  2FDN A;  3TA1 A;  4WZQ A;  5AT1 B;  3OTO J;  4FNI A;  3SSR A;  1IBL J;  4CTA B;  4PXC A;  2DGX A;  1IJF B;  1N36 F;  3ISN C;  2IRU A;  3DRS A;  2KFY A;  3M05 A;  2VJU A;  2R7X A;  4LFA F;  1HNV B;  5ETS A;  1HWK A;  4DPW A;  4DV6 J;  2BE2 B;  2KG0 A;  3ZZR A;  4LF5 F;  1WHX A;  5THW A;  1FTR A;  1TKX A;  2R8G A;  3QGI A;  1JLC A;  3M8P A;  4USJ C;  5IOL A;  5KFM A;  1UFL A;  5JVG Q;  2HVZ A;  1KOH A;  4ZCL A;  5I4M A;  3PX6 A;  4FKY A;  3EJM A;  3B4M A;  1AA1 B;  3CIM A;  2UZA A;  2VQE J;  3DI6 B;  2HEK A;  2WSC C;  2AIR B;  1QAX A;  3ITH B;  4DG1 B;  1SC4 B;  1B64 A;  2N7Y A;  5KOX A;  3V6H A;  3DDI A;  1XMO J;  4WYL A;  2JEG A;  4EK2 A;  5T14 A;  3QJP A;  2W25 A;  3MWB A;  4O3R A;  3MED A;  1NSP A;  4O3Q A;  4IH7 A;  2HGM A;  2DY9 A;  2GVD B;  3OVB A;  5GMD A;  1F0X A;  5DDR C;  1NB2 A;  2YKN B;  1QVG R;  2EPI A;  5A8W A;  4RU2 A;  1RAE B;  2GMJ A;  4KGK A;  3RAM A;  3IRW P;  3TUP A;  1AUS L;  1S1V A;  1SH0 A;  1FJ7 A;  5I3U A;  1HBU B;  3VHQ A;  2VON A;  3MM5 A;  2ZH2 A;  5CZX A;  5IFM A;  1MWZ A;  4N7T A;  3M7V A;  3BM7 A;  5DS7 A;  1LNQ A;  1T03 B;  1G6B A;  4ER8 A;  1VLY A;  2VZ9 A;  3MUR P;  3WZ0 A;  3QIP A;  3TRG A;  4GRS A;  3KK1 A;  1IKX B;  5CCL A;  1VRU A;  2FY1 A;  2XHC A;  1YKW A;  5U47 A;  3LP0 B;  1SJF A;  4NLP A;  2VL1 A;  3N5B A;  3SMZ A;  1IBC B;  3MFI A;  5L9N A;  4OI2 A;  1SKR A;  3W5Y A;  1CUL A;  2F9J A;  2RML A;  2AJ2 A;  3CJK B;  2XS2 A;  3CXC R;  2YPZ A;  2V4J B;  5LM7 E;  2CJX B;  3T9N A;  8AT1 B;  1PYT A;  1H0H B;  3EWG A;  1BQX A;  2CRL A;  4CM0 A;  2GC8 A;  4OYP A;  3J7A N;  2FGC A;  3J7Z 5;  4F67 A;  1FRL A;  2DGS A;  4B3R J;  2PMW A;  5HBM A;  3TJ9 A;  5T41 A;  4LF6 J;  1TP7 A;  2HSE B;  1E6V B;  4V1A k;  2OEM A;  1MN7 A;  2XLI A;  4UTG A;  4GKK F;  3N9U C;  2WBM A;  3KHL A;  3HSG A;  2QGF B;  2HLU A;  4DF8 A;  1B7Y B;  4ZKA A;  3NAI A;  4JI0 F;  2NYH A;  3G6E S;  3GWC A;  3SQG A;  2N4D A;  2CDQ A;  1RK8 A;  4DQP A;  1IXK A;  3NOC A;  3A3N B;  5LMN J;  2UXC J;  2FIU A;  3AFG A;  1RHQ B;  2JZ5 A;  3TZX A;  3M8W A;  1OPZ A;  1X5P A;  4URS A;  3D1H A;  4PXE A;  5LJ3 Y;  2JFK A;  3RU0 A;  3V5R A;  4AQY F;  2RJZ A;  2D3Z A;  3W1Y C;  4I1T A;  4PWD A;  3PVX A;  1N32 J;  3MCN A;  2M88 A;  3LQV A;  3QGP A;  3WX8 A;  1UVM A;  1C1B A;  1SI9 A;  4OZJ A;  4DN9 A;  1FKO B;  4K4Z A;  5DDO C;  5IV3 A;  3GYN A;  4LJM A;  2C3U A;  5HAT A;  3OXL A;  2AD9 A;  1FX4 A;  4KO0 A;  1D9F A;  3CJS A;  1RTZ A;  1H2T Z;  2AYB A;  1UJ4 A;  4RW4 A;  1FKP A;  4CLS A;  3CJ8 A;  1S72 S;  2HPU A;  4K4W A;  1EET A;  4BWJ A;  4OX9 J;  4OIX A;  2V2Z A;  1QVF R;  2QC3 A;  2MST A;  4CRJ A;  1RAB B;  4IFY B;  2DIS A;  2DH8 A;  1HNV A;  2DNQ A;  2YX7 A;  2ZC4 A;  4NLX A;  3ENW A;  4B9L A;  1R0C B;  1R3N A;  4I2P A;  5C25 A;  2BE2 A;  1IQT A;  1HAR A;  3I4P A;  3VZI A;  1WI6 A;  2HRT A;  4FZV A;  4NEZ A;  3KLH B;  3NMR A;  2QL5 B;  3DLE B;  5H9E K;  1AW0 A;  1EHW A;  1UA0 A;  3NCR A;  3M32 B;  3UN5 A;  5HL7 Q;  2KL8 A;  3BSO A;  1F9F A;  3ZZZ A;  1HI0 P;  4I0W A;  4R25 A;  2LLZ A;  4FVM A;  2G0J A;  3I5C A;  3O2I A;  3LTO A;  2K3K A;  2LU1 A;  3MEE B;  3LAN A;  2HWH A;  4ANE A;  1GMV A;  1O8B A;  1WEL A;  2VIH A;  1RBO B;  2VH7 A;  4NLV A;  4DG1 A;  4A8K A;  2VC0 A;  1FXR A;  2BBE A;  3BEG B;  1K0T A;  1UMJ A;  2B4U A;  2KXF A;  2WVD A;  3EVO A;  3PEH A;  4ICL B;  4KTQ A;  2GVD A;  1QDU B;  3DYA B;  3M8Q A;  4UY8 5;  2KHC A;  1NKB A;  1QM9 A;  2DH9 A;  3FEZ A;  4MK9 A;  3VGT A;  3SBM A;  1JLE B;  4DV3 J;  1D09 B;  4LF9 J;  1ICE B;  5JUM A;  5HMZ A;  3FKB A;  3ZXW A;  2APO A;  3N01 A;  2OKQ A;  4AYB D;  3PW7 A;  1HBU A;  2CFX A;  3WC0 A;  2YWE A;  4EWT A;  2UUC J;  1FA0 A;  1NME B;  4J9R A;  3K17 A;  4OX8 A;  5JVH Q;  4CQ1 A;  2RQ4 A;  2HHT A;  4U9R A;  5D0G A;  3S01 A;  4F4A A;  1WC3 A;  4M5G A;  5AE3 A;  2Q6B A;  3MXH P;  3TYT A;  5E3P A;  1ULR A;  3RB6 A;  2UVR A;  1IKX A;  3LP1 A;  2L3M A;  4IG0 B;  1U1Q A;  2KTQ A;  1CJU B;  4F0M A;  3BYR A;  1H74 A;  4RNF A;  4P75 A;  2DD8 S;  2OD4 A;  1RAA B;  4L74 A;  1BQN A;  1R8C A;  3B54 A;  2JVO A;  4USV A;  1X4C A;  2I9S A;  1L3U A;  2PA8 D;  1VR6 A;  3CJK A;  3GV7 B;  1S0M A;  3UW1 A;  5E7O B;  3AA9 A;  2ZHB A;  2I2Y A;  4F04 B;  2CJA A;  5K8P A;  4DXL A;  3EVM A;  4ES1 A;  2UV8 G;  3QRP A;  4ZIT A;  2YWW A;  1YBT A;  4PG7 A;  4B9U A;  3Q8U A;  3BPD A;  1E6V A;  3PIO Q;  1UVL A;  1LFP A;  3ELH A;  4KBI A;  1S76 D;  4Y2A A;  4N8O A;  2CQ1 A;  2W4C A;  4Y28 C;  4F7V A;  2RD5 C;  1JJC B;  2IHR 1;  4F0K A;  3CC7 S;  1Z1Z A;  1XK8 A;  3G8T A;  3A8E A;  2VPW B;  3JAM U;  2MHN A;  5KT4 A;  2CQI A;  3DFE A;  3I5B A;  2CJQ A;  1JWW A;  2HND A;  2LXI A;  1DY3 A;  3H2L A;  2OTL S;  1S4F A;  2IBK A;  3IRX A;  2I5J B;  1Q0N A;  4ZVE A;  1OY9 A;  4Q43 A;  4OZN A;  2YNI A;  5FII A;  2POK A;  3RR8 A;  2F4V J;  3TNV A;  4ETZ A;  1C1C B;  2NXU A;  1X60 A;  4NA3 A;  3AOB A;  1FKO A;  2X1G A;  2R42 A;  1SIZ A;  3CCZ A;  1IN0 A;  2V68 A;  3G2X A;  3NBP B;  2RU9 A;  3BF4 A;  5IC6 B;  2AT1 B;  3CCW A;  3DDK A;  2DR5 A;  1CS4 A;  2OD6 A;  4Q7A A;  3JAM Y;  4ZPB A;  2NXJ A;  4YEA A; 
#chains in the Genus database with same CATH homology
 5LMN J;  4DR3 J;  4KY3 A;  4PWW A;  4DV5 J;  2UUC J;  2UXC J;  4NEZ A;  2VQE J;  1N36 J;  4HHU A;  2UU9 J;  4DR5 J;  4DV0 J;  4KYZ A;  4JI3 J;  2VQF J;  2E5L J;  4LF4 J;  1HR0 J;  4LFA J;  3IMQ J;  1HNW J;  4DV7 J;  4LF7 J;  4RJV A;  2UUA J;  4YY3 J;  1N33 J;  1FJG J;  5IWA J;  4DV1 J;  3W1Y C;  4K0K J;  1XMO J;  1N32 J;  4JI8 J;  1I94 J;  4X65 J;  3OTO J;  5IT9 U;  4JI5 J;  1XNQ J;  2KL8 A;  4NXM J;  1XNR J;  2MTL A;  1IBL J;  4B3T J;  4DR1 J;  3JAM U;  4LF5 J;  5LM7 E;  3R2C J;  3J81 U;  5AJ3 J;  1IBK J;  4LF8 J;  5FLX U;  4DUY J;  4GKK J;  5BR8 J;  3J7A N;  2UUB J;  4X62 J;  3T1Y J;  4B3R J;  4JI1 J;  4JV5 J;  4JI6 J;  5LMU J;  5A2Q U;  4DV6 J;  4JI0 J;  4LFC J;  2UXB J;  3R2D J;  1HNX J;  4DV4 J;  4JI2 J;  4LF6 J;  1XMQ J;  4KHP J;  4JYA J;  2F4V J;  3D3B J;  4V1A k;  4OX9 J;  2UXD J;  2KVQ E;  4LFB J;  4DV2 J;  4B3S J;  4DUZ J;  4JI4 J;  4B3M J;  3D3C J;  4X64 J;  1J5E J;  2HHH J;  2ZM6 J;  4YHH J;  4DR4 J;  4AQY J;  1HNZ J;  1N34 J;  4JI7 J;  4DV3 J;  2MEW A;  4LF9 J;  4GKJ J;  4DR2 J;  2MQ8 A;  3T1H J;  4DR6 J;  1IBM J;  4NXN J;  4NEY A;  3J80 U;  4DR7 J;  4X66 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...