4DV3J

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a, bound with streptomycin
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 13
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4dv3J00
3W1YC 4NEZA 4NXNJ 5A2QU 1XNQJ 2UXCJ 1N32J 4DV7J 1HNXJ 4HHUA 4JI1J 1J5EJ 2F4VJ 4JI2J 4DR2J 3R2CJ 4GKJJ 5BR8J 3J80U 4B3MJ 1N33J 5IT9U 1XNRJ 4K0KJ 4JI8J 4DUZJ 2UUBJ 1HNZJ 2KVQE 2VQFJ 3D3CJ 3J7AN 1XMOJ 5FLXU 4JI4J 4LFAJ 2UU9J 4RJVA 5LMNJ 5IWAJ 3JAMU 1I94J 1IBKJ 4V1Ak 4DR7J 4DV0J 4LF5J 2E5LJ 2UXDJ 4LFBJ 4JI3J 4LF4J 4LF8J 4NEYA 2UUCJ 4LFCJ 4X65J 3T1HJ 4DR1J 3J81U 4LF9J 4JI6J 2UUAJ 4JI5J 4DV2J 4B3TJ 4DR4J 4AQYJ 4LF7J 1HR0J 2UXBJ 4OX9J 4DV3J 4DR3J 5LM7E 3IMQJ 4B3SJ 1FJGJ 4JYAJ 2MQ8A 2KL8A 4DV5J 2MTLA 4JV5J 4KYZA 4NXMJ 4DV6J 3R2DJ 1XMQJ 3T1YJ 1HNWJ 4KHPJ 4DR6J 3D3BJ 4LF6J 2VQEJ 4PWWA 4X62J 4KY3A 4YHHJ 4YY3J 4DUYJ 4DV1J 4DV4J 1N36J 4DR5J 5LMUJ 4JI7J 1IBMJ 2HHHJ 2ZM6J 4GKKJ 4JI0J 4X64J 5AJ3J 1IBLJ 1N34J 2MEWA 4B3RJ 3OTOJ 4X66J
chains in the Genus database with same CATH superfamily
3TVZA 4MIAA 3W1YC 1WOOA 4PPDA 3VVUA 4O3NA 5D77A 2R8HA 1S1UA 3RB6A 1L3TA 4CH7A 1RAOA 4DUZF 1N32J 4X2BA 3ZZ0A 3LF0A 2MQLA 4PYAA 1JLFA 1WI6A 3C6UB 3MI7X 3OFFA 5K9FA 1FJ7A 2V9KA 2E1MC 4NL5A 2KG1A 1X4FA 3MM5B 4A46A 1YKWA 1MWZA 1HBUB 2UVVA 3NLCA 1YLXA 4URQU 1B0PA 1N54B 3RBXA 4DN9A 4J9PA 4C3LA 4IG3B 2UXCF 2HHUA 4LVNP 1NPPA 3WHIA 2IVYA 1TU0B 1RAJA 3WIUA 2FHOB 4ZPVR 3K5OA 4N5SA 2MJUA 5J2QA 4GKJF 2C3PA 4L3KA 4ZVRB 2B56A 1T8EA 5CQGA 1CQMA 1RQ0A 2FUG9 2IM2A 2V2QA 1M5HA 4F7VA 1JXEA 5LSOA 3QAEA 3X3UA 3I55S 2AEJA 2CQ1A 5EHHA 1FEHA 3CCTA 3MPYA 2V4QA 2H4YB 1IM4A 2RIJA 4PWUA 2DNMA 1V3ZA 3C6TA 4RZRA 3ILLA 4I64A 1N56A 2G4BA 3EE3A 4GRSA 1VQ7S 2OLWA 1IKWA 1LWCA 1LWFA 2OD4A 3ZTOA 3RUBL 2C2NA 4L3NA 4LSNB 3CDEA 1N48A 4RPFA 1WI8A 3D4JA 3J80Y 1RT7A 3MM9B 1X7VA 2ZH5A 1FXRA 1TELA 3S01A 4KV8B 2IRXA 4ZVUB 1VBYA 2I2YA 2HQCA 1QUPA 2DNHA 4TU8A 2YKAA 3TAPA 1Z2LA 1AT1B 5KG7A 4GC6A 2IVMA 1UKUA 1ZBTA 2EVZA 1RU1A 1NB2A 4Y00A 5LXYA 3J81j 3SMZA 4IUFA 2V5HG 3NGUA 5K14B 3NNHA 3NS5A 2WSFC 3Q8VA 4DN0A 1AXQA 3MECA 1LFWA 4LR9A 5D78A 1YVFA 1EETA 2V2ZA 1JLFB 1FXLA 3C6UA 2VFSA 1UWAA 1DQ8A 2HEKA 4KO0A 5DQIA 2ZH4A 2Q79A 2YWFA 1VQYA 3JAMY 2W7OA 4M5DB 5D0GA 3IWXA 2ASLA 3R5BA 1K47A 2BJ3A 3UCUP 3CCUS 2MQQA 1GXTA 3S8SA 2KYZA 1WOSA 3DU6A 5L9XA 2A6MA 3MUTP 2HNZA 5C2CA 2VG6B 3MMCA 1UVMA 3TNVA 1RABB 1Y7PA 2GZOA 2Y3YA 2AYBA 4YDXA 4U8YA 5E3QA 5KFYA 2XSJB 4F25A 3V81A 2RHSB 2WHOA 5KFTA 4RUCA 1WSVA 2Z8QA 3EGZA 3NBPA 5ETTA 5LM7E 4Q45A 1HBNA 1YZ7A 2D1CA 2LEPA 1XMOF 3MFIA 2OHDA 3MM7B 3W2VB 3MCMA 2HHVA 1EARA 1XK8A 1JLCA 2KB2A 3PRBA 4E2FB 2N4DA 5CCLA 3CCLS 1NDCA 1U0SA 4HH0A 2FTRA 1FTRA 4DUTA 1F9HA 3CIMA 2C42A 4WFZA 4QW8A 1VK3A 2R7QA 3UD5A 3G8TA 2VQEJ 4LSNA 3H59A 3UN5A 1YJTA 1FRIA 2M7SA 4ANEA 1REVB 4HHJA 4C8LA 2LCWA 2DNLA 3LUYA 4J9SA 2XULA 4OZ3A 5F8IA 2K7JA 4DL4A 1U1RA 3CXCR 2CQPA 4X62J 4LF4F 3IR5B 3MEKA 3MCSA 3HJVA 1L3VA 4X65F 3R1HA 1UEUA 4IFYA 1UETA 2VBWA 2UZAA 2YVSA 5C42A 1RBLA 4JV0A 1EETB 4LIWA 4DU8A 1ZS6A 3HKZD 4Z2XA 2RQCA 5DQGA 4PRFA 3H20A 2Z58B 3KKFA 4DG1A 5KG6A 4TYAA 3TX8A 1PJ5A 4X62F 4JI5F 4ITSA 3VGTA 3JQJA 5D0EA 1UVJA 1HW9A 5JVHQ 3VALA 1EP4B 4QYZJ 3EJMA 3QAUA 3BYRA 4RW9B 4J9OA 2FJXA 1VBKA 4K2JA 1TZ0A 1F6TA 1DQAA 2P9EA 1V3RA 5HI7A 2P8IA 3WC0A 4B3MJ 1RHRB 3Q8SB 2PIIA 3UCZP 1R43A 4K50A 1N33J 2QC3A 3DOMA 1IBCB 2SXLA 2R7VA 1RA7A 3HKWA 3RRKA 4K0KJ 3DLJA 4RX6A 2RQKA 1RT3B 3FEYB 4ED5A 4UZCA 3TR5A 1WC4A 1X4EA 4BC7A 2H51B 2E5GA 3O3LA 5DDQC 4D3GA 1JLCB 1RZMA 3GIRA 5HVGA 3V4IB 4U7UK 3LH2S 3SQOP 1PAUB 4J90A 1N88A 5J1EB 2XYGB 2IYIA 4P72A 2KXNB 2DVIA 3MEDA 4LFAJ 4BDPA 3WX8A 3FQLA 1EAYC 2B4PA 3GCXP 2Z4PA 1U2RA 3JAMU 3NXZA 2WB4A 2BEFA 3TUJC 2J5AA 1U1KA 1YJNS 2PN6A 5D4PA 4NI2A 2XY6A 4MFBA 1EZZB 4I0WA 4NE9C 3U02A 4DR1F 4Q0BA 2K8GA 1KOOA 4B08A 3QJJA 1VGYA 3EZOA 1MMNA 5F41A 1TK5A 2UXDJ 1MSWD 1VFJA 3H25A 3DLKB 2V67A 1QJHA 1FDBA 4IFVA 2UUCJ 2Y9HA 4FP9A 2N7YA 5ETRA 2ZH7A 4FNIA 4ILRA 3QIPA 4CDIA 4F04B 4WCEQ 1KLMA 3BF4A 4O3OA 1M5KC 1NJXA 1EX8A 1D0EA 6FDRA 2QG9B 3AY0A 3M6XA 5GAHI 3I5AA 4J9RA 4DXLA 4JI6J 2FLOA 4WZMA 2HZVA 1HQUA 3N28A 3ZTQA 5C7PA 3CIZA 1X4AA 1QAIA 5HP1A 4PQAA 2BE2B 2RQ4A 2W01A 2XHCA 5E7OB 2W9CA 1C1BA 1NDLA 4DI6A 1HKAA 5I3QA 3AB2B 3M2UB 3QFWA 3AB4B 3BSCA 2FJAB 1Y10A 2BYCA 2DNOA 2OPSB 4OJ1A 5J2MB 2OIHA 1F5BA 2J7WA 2MQNA 3BSAA 4YS2A 2UXBJ 1T94A 2OO4A 3DDIA 3HZEA 5E3RA 2AYMA 1YGYA 3CCQS 3I32A 1XMBA 4ID5B 2QFJA 2ZOMA 1LW2B 3LAKA 3Q89A 2FJVA 2V8DA 2VQFF 1WDDA 3EDQB 2QZ8A 1X0PA 1HYSB 4MYTA 1P9YA 1YSJA 1CBKA 2PMHA 1NHUA 2YKMB 3GCWP 4OI2A 4DL7A 2FY8A 2BW7A 3TW0A 4F0MA 1M5VC 1CJUB 5IT9Y 1GFWB 1FE4A 3A8KA 4AL7A 3OSPA 5HJXA 2P2CB 1KWMA 4NLUA 1C0UA 2LVWA 1R8HA 3TOQA 5SUHA 4R5PB 1OSDA 3E51A 1GXUA 2AYEA 2AQ4A 2DY1A 4ANDA 4PQUB 1I1GA 2HPUA 2XYHB 2JWNA 3M8QA 1FVSA 3CJTA 3PJXA 2JFDA 3BBBA 2HLTA 4X84A 5LT5A 2RDJA 3NMRA 4ILLA 4KHPJ 2N4CA 3R7NB 1BXNA 5T41A 2YNFB 5IM0B 5KT4A 3M9MB 3D3BJ 3HHLC 3V4MA 2DH8A 3PW4A 4HEA9 3PX6A 1B99A 4LF6J 1WG4A 2G0JA 2LA4A 4KY3A 1P1LA 3TQEA 4DV4J 2HMIB 4J91A 4I2QA 3QZ8A 2R8IA 3FSIA 1TV6B 3MURP 2RAQA 4Y34A 2DCUB 3GB0A 3GFZA 4I2PB 3W9IA 3KLFB 3M30A 2YX4A 3MZIA 4PG8A 3QWUA 1NK9A 1N5QA 1VRUB 2XWXA 3HD2A 4ICLB 1YBUA 3DMJB 3GTYX 1T9VA 1DJ0A 3FZBA 3PNIA 3IM9A 3N9UC 3AA9A 3W60A 4K0KF 2R8KA 2C2OB 3AD7C 3GG0A 3HXMA 1X5TA 5AE1A 3DLGB 1HNIB 4CTAA 3H5YA 1HLWA 2BZ2A 1IKYA 3W5YA 2DNQA 3BV8A 4F0KA 2Y1IA 3MEEB 2IHR1 3T5LA 1HARA 3RAMA 4RBVA 1P8GA 1M5PC 2FGOA 2DBBA 2ILZA 3A8JA 4ID5A 3JQKA 4QR2A 2OPPB 3TJ9A 3CD6S 2B4VA 2DRAA 2HK2A 2W1BA 3BKTA 4I6YA 2BABA 5ETKA 4FNHA 4WYWA 4U67Q 2DR5A 2YQ1A 1KQSR 1C4CA 2Q1LA 5A76A 4FF4A 4LF1A 2JEIA 2G0CA 2M5YA 3JQMA 4G1QA 1B64A 4JOUA 3BKUA 4ZLJA 3P96A 1WUUA 1DBDA 3SCJE 5HN0A 3MUVP 1VJQA 5G0RB 4ZPBA 7FD1A 2XMAA 1WKLA 4KHRA 1WC5A 2YPYA 4K5SA 5JVGQ 1B7YB 3TA1A 5LSRA 5A8KA 4K4TA 3ENQA 3M8SA 3R7BB 2I0XA 3W9HA 4AL5A 1Q8LA 2JL9A 3UR0A 4URSA 2XNQA 2HMIA 2RQMA 2F8EX 2VPZB 2A6OA 3QYYA 3T6BA 2E9TA 3D6TB 4ZP6A 4DR5F 3G87A 3DI6B 4ZVGA 5KFFA 4K4WA 3HO1A 3BPDA 1NJWA 4FXDA 3M30B 2HGMA 2NLWA 3K8VA 2OPRA 2BX6A 3I31A 3SSRA 1C1CB 4QWAA 1S4EA 1M1HA 1FDDA 2ERRA 2KJWA 4LF7F 5HMXA 2PO4A 5H9FJ 2R2UA 4OHZA 1KQGB 2ALZA 2GHVC 2ZD1A 2Y1RI 3DM2B 4RO0A 2GA7A 3VR1A 4CTAB 2UU9F 2R3VA 4YB1P 3B8HA 2JH3A 1YITS 2HVDA 2PEBA 2QSWA 3B54A 3FGVA 4ZCIA 4CO5A 5DG8A 1FRJA 3DGVA 3ZZUA 2IMWP 2HIYA 4PG4A 2ZH8A 3SSQA 3KYLA 1F3VA 3TUIC 4K4VA 3DRRA 4C2MA 3SZ2A 1DAXA 4Y0FA 3M8ZA 2WSCC 1S1WA 4DPYA 5L1IA 1VK8A 2OTLS 1ROFA 3OD2A 3OLAA 4KGZB 1WELA 4HLBA 1T3OA 3FMWA 2C2ZB 3PHTA 4ANCA 4F4WA 3NAIA 1ITPA 5CD4A 3HT0A 3T1YF 3MCNA 1U09A 3TVYA 2GVDB 4OHWA 4LF6F 4FF3A 3ET6B 1AYEA 4HL9A 2DT9A 3TWZA 5H9EJ 4YY3F 3RRGA 1FO1A 2H1YA 4P2SA 2DNPA 2HQIA 4RW8A 1SJ4P 1E6VA 1RTIB 1H7XA 2O66A 2HRUA 3IA0A 3ITHB 3MM6A 2I6WA 3CPWR 1YX2A 1A9NB 2RF2B 1RWWB 2DCLA 1HD1A 2FC8A 1RU2A 3V5RA 5F8NA 1JLBA 1REGX 3DGPA 3GP9A 4DV1J 3ZXWA 4YY3J 3O8WA 2OSRA 3CC4S 3F56A 4M5NA 1RT2B 2BQ3A 1IBMJ 4F67A 3FQKA 4RNFA 2IJFA 2MY8A 5AJ3J 1SJFA 1IBLJ 2K06A 1JLQB 2CJXB 1PG5B 1RLDA 1R8CA 2C3YA 4FVCA 4ZCKA 4A8WA 5G4DA 1NRKA 1Q95G 1Y5NB 1CC7A 3M2VB 2DHXA 3CTRA 5A2QU 1Z2ZA 3OPKA 4GVBB 2D9OA 2VV5A 3IR6B 4EO8A 2ZH9A 2CNOB 2H54B 4CM0A 5I3UA 1NJZA 1RP5A 2MKSA 6FD1A 1WC6A 3MPWA 2HWTA 2D3OR 2IFXA 3FCHA 3PR5B 3DLLQ 2XG8A 3AJDA 2XMMA 1Q7LB 3BH6B 3H2LA 4X4UA 3FMBA 4ECUA 4NCAA 2CQGA 4UQTA 3KLEB 1RAAB 3PX0A 2PI5A 1J5OB 2NS1B 4O3RA 2KHCA 1DTTB 3MMBA 4CNYA 4I67A 2HVEA 2DNNA 2QLJB 3PIOQ 4CH1A 2VFUA 2BKOA 5KFWA 4Y2MA 3C14A 5K8PA 3WZ0A 1F5CA 1FF2A 3LGNA 4NYZA 2WVFA 4NMLA 2EKYA 3G82B 4DU7A 3SI8A 1V9OA 2GAHC 3CCJS 1RYSA 2LQ9A 3EDRB 2Y1JA 1ZH5A 4C8ZA 5KT5A 4Q7AA 5IWAJ 2OTJS 4OHXA 2LQ5A 4J9VA 4OHVA 3ZZTA 2F63A 3GMGA 4M95A 1RTIA 3MM6B 4NLQA 3TA0A 1GMWA 1MN9A 4DL0C 3AFGA 3WQPA 4ZPWR 2AX1A 4FDFA 4LF2A 3U7JA 3KDNA 4ETZA 1PJ7A 3QBCA 4NLXA 5IXUA 2E5LJ 4OHYA 1VYAA 5CYQA 3PX4A 1J2VA 1RT5B 3KJFB 4KT0C 1FRXA 5D6GA 4LUBA 3BGRA 4B9TA 3H98A 5DG7A 5E3PA 2RU9A 4NA2A 4KE5A 2VBXA 4KO0B 3M2RA 3VGSA 1PC4A 4PWDA 3MMAB 2NXEA 2LXFA 3TJAA 5C25B 4F2SA 2FVCA 2CXEA 3FBBA 2R7TA 2V34A 4CT9A 3I4HX 2DR6A 2FJBB 4NLDA 3U1LA 3OVSA 3MM5A 2J6SA 2KZZA 2WBMA 2KG0A 3CCWA 2GQCA 3EGVA 3BB5A 1FKPB 3TQ1A 2VODA 2BM1A 2L48A 4NLOA 3AOCA 4J7CA 3ZZYA 1JJ2R 1B3TA 1AUSL 5EN1A 3IP0A 4DF8A 1U1NA 2I5JA 1N8RT 4DBQA 2V2VA 3C14B 4ZVSB 4H4MB 5E2QA 4CLLA 4DPUA 4C4WA 2KTQA 3SFGA 5L39A 2Z2ZA 5CD4H 2UUTA 2IDLA 4I7FB 4RL1A 1Q82T 3CUNA 2DR8A 1BLUA 3FJ2A 2HIQA 1S7HA 2YNGB 3K7RA 3N5FA 1UEVA 3R27A 4ZPDA 3HLUA 4TU9A 1NKEA 1YK9A 4CLKA 4USIA 3OTOF 2MHEA 2BVZA 1RWMB 2GCFA 5CH7B 3CJKB 4CO4A 4USUA 4ENOA 2N82B 2DGWA 4UOHA 3OHBA 1YWXA 2LXUA 4WP8A 2CG4A 5H1SV 8AT1B 1AZSB 3CULA 2HHTA 1RWNB 1S59A 3IR7B 3D6MB 1G3OA 3BO3A 3RJMB 3KHLA 1HWJA 2QLXA 2GIFA 2DHAA 2F5GA 3ZC4A 2YH1A 3PYEA 1F2HA 3EPIA 3DCAA 2CZ9A 1HNWJ 1HWLA 1CULA 2QFIA 3LWLA 1G6BA 3T3FA 1TL5A 2GVZB 5D0RA 5B0EA 4KH0B 2AJ4A 1SIZA 1N36J 3KDOA 3CVKA 2R42A 5LMUJ 3BH7B 4NMXA 3GLJA 4MJKA 4UQGA 2IM1A 2WOMA 1EP4A 2Y0BB 3FFIA 3GYNA 3QPIA 4E8UA 1S6PA 1KOHA 2L9DA 3ENAA 1HWUA 2DKOB 1DARA 3MD1A 4ED4A 1U47A 1S1TB 2VH7A 2X3GA 3KLIB 3LGMA 3LP0B 3MEGA 4DCJB 1XR6A 4X4SA 4DV7J 1TL3B 4ALZA 1JXLA 5DGAA 1HPZA 1S1XA 2B4OA 2BBEA 2COLA 2RRNA 3EGNA 3EGWB 3IBWA 3A3NB 5KFDA 2Y8YA 2R8GA 2VG6A 3MMCB 4USHA 4ZLPA 1RT4A 1TQLA 2XLJA 4OYOA 1S1UB 1XNRJ 1AB8A 3NWGA 3I0SB 1RWVB 4HDHA 4PR6A 1F2GA 2ATCB 2XI3A 1F9FA 1KP6A 1Y0HA 1HQEB 2GO8A 2Q6BA 4I7FA 3RG6A 3W66A 5IWAF 4YQWA 3VAHA 2GQ2A 2EBGA 3PM9A 2O3DA 1HI1A 2I1RA 2IC3A 4XK8C 1RA6A 3HHLB 3OTBA 3T5HA 4JI0F 1PJ6A 4K4SA 1OS5A 1CG2A 1BQNA 4OYAA 1IWAA 2OFHX 3D1OA 5A8WB 1LV5A 2RT3A 3PY8A 5ETQA 1S1VB 3FDSA 4LF5F 2VIHA 3KNGA 2M8HA 2ZHBA 4H54A 3GU0A 2MZSA 2YQ3A 1YG0A 2LKZA 2RNEA 3P5TL 3QT6A 1YZ6A 4Q0BB 2VL1A 4P2MA 3MXHP 1H7WA 2E1AA 1CLFA 3HVWA 3BO4A 4KB7A 4V1Ak 3H5SA 4DR7J 2DNYA 2GMJA 2VD3A 4L76A 2Q6CA 1K1SA 3OJUA 4DLEA 3B78A 3KWMA 2JEFA 2GVZA 2OSQA 4LF5J 2HVHA 2OMOA 4C11B 2C3OA 5M2PA 4X4VA 2RVJA 3M6WA 1UMJA 3ZFVA 4JI3J 2HKEA 2DPIA 1YJRA 3G2XA 3PJWA 3AXMA 3F44A 4LF4J 2AF6A 1RTHB 2B4UA 4JI7F 3KK3A 4WFXA 4X65J 1R27B 1MROA 4OFZA 3W5XA 1S6OA 5A6PA 4Q8FA 1ICEB 3M7VA 4QIWD 2EKNA 3FZ2A 2Z30B 3A1YG 3JS9A 1WC1A 2X1AA 4L6V3 4MK7A 4PXDA 2AV5A 3ZTPA 3HD1A 5KFZA 4KKOB 4JI5J 1TFWA 3X1LB 3A8IA 5KFCA 4EZ9A 2POKA 3MWBA 5THWA 3IN5A 3Q22A 1IR0A 1LQ9A 3S1TA 3OR1B 5DM7Q 4FVMA 2DD8S 4G65A 2J0QD 1QVFR 4A8XA 1VBXA 1GTHA 5CZVA 2M8DB 1HQEA 4IG0A 1Q4RA 2RJZA 3NEKA 1RT3A 1X8DA 2GHWA 1PCAA 4OZNA 4ECQA 4M5LA 2BA9A 4KH1B 2PMWA 4MTPA 3DXSX 1YIJS 1FDAA 3M8YA 2N7CA 3N6NA 3KG1A 3ETMA 1QAYA 3OTDA 5J1EA 1N52B 3OR2A 2E29A 4OZ1A 2HS0A 4WF9Q 4EZ6A 1I6JA 1H2UX 1F0XA 2VDIA 2WVCA 3FRZA 3H5UA 4FXWA 4U9RA 2MKHA 5KFMA 1S9EA 3VAJA 3Q2SC 4U7UD 2NXNA 1IR1A 1FCAA 3D54A 1VQ5S 2B7CB 2CQHA 5DETA 4ELTA 5IS2A 4H4KA 1WHYA 2A18A 1SBRA 4NASA 4B3MF 2DGSA 1N33F 4CZCA 2BOAA 4WKYA 2DGTA 4G1PA 1LOUA 3B4DA 4AQYF 1C0TA 1RHQB 3A12A 3D9BA 3PACA 4LRDA 5A8RA 3R3TA 4X4RA 3GFXA 4FYYB 1WTBA 4ZVPB 4CLUA 4JV5F 3KXDA 4DV7F 3J7AN 5BJRA 4ZN3A 1H2TZ 1WDTA 1Z4UA 2ZBPA 2L3MA 2R2SA 3FCWA 1KLMB 1JMTA 1REVA 1H98A 2UVRA 3G6ES 4W98A 4DR4F 3QGHA 3P45B 4ECYA 2QA1A 2IAJB 2XTJP 3H2VE 3AHPA 4KGMA 3SQGA 4X66J 3NCQA 3MAQA 4KAIA 5EUHA 1PO6A 3C15B 1I5OB 2QMUB 1IKXB 1U1QA 1WNEA 3AQOA 4YHHF 4ILMA 2C28A 4K4UA 5L1LA 1HNXJ 4YOEA 4KIAA 1IQZA 1CVJA 4FYVB 3SCLE 1E6YB 3D66A 4JP8A 2OEMA 4K5RA 4N8NA 4NLWA 3Q0AA 4JI2J 1TKZA 2OGUA 4PCQA 4ES2A 2DHGA 1TL1A 2HAIA 4R8UA 3T19A 5I4MA 2E44A 1YI2S 5L9NA 2RH3A 5F3TA 5GAGU 1Q86T 4JI4F 1IJEB 1LW2A 2F65A 2UV8G 3A3OB 1A7GE 1RT1A 4K59A 2UUBJ 2V68A 5KG2A 1RT6B 2CJKA 1UPMB 2CWXA 2HAFA 1CJTB 1FWPA 2H3EB 2QIFA 1S4FA 4MAKA 4M5HA 4MIBA 3OXLA 3GIKA 1BWEA 2LU1A 2DGOA 3BO2A 4IR9A 4ED6A 4LFBF 1FJEB 2GAGC 2G2ZA 2LLZA 4OZ2A 5F0UA 4C0BA 1TKDA 2E5JA 5BYRA 4F50A 4F8RA 4MT1A 1N6QA 1WEYA 1NBEB 2HNDA 4IRCA 5F8GA 3E8OA 2YNFA 2Q43A 2D69A 4NPOA 1MNEA 2DK2A 2K7KA 4KHPF 4RNMA 2CPXA 1KTQA 1X4CA 2KT5A 2FJEB 3Q8QB 3CCVS 2BANB 3DLEB 4LFBJ 5HATA 3MTKA 2AP6A 3FBFA 2CQCA 4NZ0A 1EKSA 5HVHA 5A0YB 1UP1A 3SSSA 1T9XA 2HNYB 1OYEA 3LGHA 2EG1A 1FT8A 1S9GA 4K8RA 3PYGA 4PXBA 4YEAA 5ETNA 5DRKA 3M1VA 1B7FA 1D8ZA 3PFOA 4LRFA 2AYGA 5HAOA 2A2DA 1RXOB 2KVIA 2YH0A 3QLHB 3NGDA 3KMSA 3K59A 2E9ZA 1UCNA 1HR0F 1PIEA 4OYIA 1S9FA 1OMSA 4PUOA 4NLVA 2OPQB 5DS7A 3NCRA 3OJSA 2EK1A 4J9UE 1JJCB 2N3OA 3T5KA 2XNRA 1X5OA 2Q3PA 4ZP8A 3DXBA 2J7UA 1HMVA 4CLYA 5D3GB 2ZH2A 3L95X 1HQUB 5IOLA 2JNJA 4ETXA 1NDKA 3TZZA 1KKHA 3BKFA 3KMQA 4PKDB 3CMQA 4DPXA 2ILYA 4V19X 3BDPA 1RTJA 3P3DA 3DRSA 1DFDA 2RUGA 3L9ZA 1S6QB 2QT7A 2CQ2A 4YMEA 2U2FA 2GIQA 2CJ9A 4ZA1A 5KG1A 3SCKE 1WG1A 4RW8B 4WBFA 4JV5J 3ONQA 3KJNB 1T9TA 2BXJA 4OX9F 1IJFB 1T03A 4J9QA 4NLTA 1HYSA 4QYZK 2NYIA 4Z7YA 3CO0P 3DGPB 5B0BA 4DSKA 1Q8BA 2B8QA 3KJVA 2YKNB 3G6YA 2C22A 1VQSA 4B9SA 1RBOB 4OI0A 3CEDA 1NXIA 2RHQB 1FD2A 3L7OA 5HANA 3RZAA 3AH6A 3SYZA 1C0UB 4QPXA 5J2NA 1G1XA 4R5PA 3PO4A 2QMWA 3CE8A 3V6KA 2VG7A 2D3UA 3MPUB 5CXTA 1U48A 1S9GB 3MR6A 3KUEA 1LKZA 2IPOB 2F8MA 4M63A 4O44A 1L3SA 2G1HA 2CIMA 3QLHA 4IOBA 5I3UB 4DMZA 4CLZA 4Z7CA 3GILA 3W63A 5M2RA 1SUQB 4B3OB 4PUOB 1WJ9A 3DRPA 2UP1A 1R6YA 5I3PA 3TVKA 1IKVB 1BHNA 1FRHA 1GMVA 1H0HB 2WB1D 2WSEC 3HI9A 2G2YA 2HK3A 2FLPA 2UUBF 3EYZA 2ZE2B 2B9WA 1J5EJ 2V2KA 1ZOTA 2GHPA 2RS8A 2FLNA 1DQ9A 1H6KX 2DIUA 3UVJB 3ETOA 2O1PA 4HKQA 3HVRA 3DOKB 1O0PA 3VZIA 3DRSB 2HBRB 3WIVA 3AD9C 3P8BB 2CPEA 3HULA 1T9UA 4MKBA 1F3FA 1RACB 2BJ7A 1CPZA 2ZKTA 1PAEX 3HSDA 4X4TA 1WEXA 1Y00A 3M6UA 3KLGA 3BQ1A 4DQRA 2AD9A 1FNXH 1R3NA 3MR2A 2FLLA 3RYLA 2VZ9A 3LP2B 2J0XA 5CHCB 2HQ3A 4OX7A 4DV0F 2EFOA 1VOMA 2CPHA 1FJCA 4OI1A 1ELOA 4DV5F 1CJKA 3IS9B 4Y6IA 2UU9J 2QL9B 4Y2KA 1SV5A 4DQIA 1EB0A 3PO5A 3G6VA 3MF5A 3V6HA 2XMKA 3OL9A 3ITHA 2VOOA 3D28A 1XN9A 1YQHA 1MWQA 2JLFA 4G1QB 2XM3A 3ENVA 1WKKA 1SJ1A 4F4YA 2WVDA 4DQSA 4DFMA 4WE1B 4LF9F 2BQRA 1U1MA 2BV3A 4DV0J 4HACB 4OYMA 5FDLA 2IM0A 3CCSS 2FVPA 1XBWA 1BQXA 2YNIB 4ZOSA 3JTOA 5KG0A 1J27A 2ZVSA 3M8WA 4ZS6A 1PKUA 2EK6A 3DDKA 1KQKA 4RW4A 3RU0A 3IO1A 4NEYA 3UI3A 2R7WA 1XJWB 4CO3A 1X9SA 3NKYA 2DPJA 4B02A 4XO0A 3D67A 1L3UA 3PEJA 2KFNA 1U45A 4M5GA 4DZ6A 2DIVA 3Q8PB 3RAQA 2PSZA 3W64A 5GAEI 2JLEA 3Q8RB 2WBRA 3UDLA 3CJ2A 2ZBIA 4WK1A 3R5DA 1NSAA 3SDEA 1LXNA 2MMYA 4A8YA 2FVRA 1TVRA 2HNZB 2L08A 2XGQA 1UTAA 1NH8A 2M52A 1SL0A 4C8OA 2EFQA 1NJIT 2OUGA 1K44A 4RW7A 6AT1B 3RW7A 2PEHA 2B9XA 5KOXA 1BD6A 2WONB 3N79A 4YB6A 2DR7A 2AJ0A 3MGJA 5KFVA 4USJC 1PBUA 2XS7A 3NG8A 2GFFA 4XIUA 3I96A 2MJNA 4ES3A 1N5YA 4ZVTB 1C2PA 3G71S 1HBUA 1D1UA 3NAHA 2W9BB 1NZ8A 1TMJA 4RW6B 5CYMB 4XPCA 1LNQA 2ZOFA 2ZZNA 3G82A 2W8KA 5HQLA 1UA1A 2E7XA 3UNGC 5AJ3F 1IBLF 3RB4A 1OWXA 3UN2A 1X4GA 4EEYA 2YWHA 4WXOA 2RE1A 2G2OA 4DOZA 3BQ0A 1XQIA 4BWMA 3WDOA 3UO0A 4HR2A 1QE1B 2PDAA 4UOCA 4DCOB 2EW9A 3KK1A 3OXGA 3QFHA 2ZH1A 2MKYA 3D68A 1SJ3P 1MU2A 1IVZA 4P52A 1VQNS 1JLAB 4O4RA 3G4SS 1BQMA 3NOGA 4I68A 1T9WA 2VFRA 2BRLA 2R2TA 3IWLA 4HACA 1FK9B 1R8AA 1SQEA 4CWBA 1KFDA 4B3RF 1WOPA 5C5JA 1VR6A 4LR7A 2VONA 5HL7Q 1LWFB 3O44A 4QQBA 1X0FA 5HMZA 1SJRA 2HFSA 4ECZA 2AT1B 4HDGA 2QJ3A 3HHKA 4FKXA 4QU6A 1RT7B 1TKXB 4NRUA 4Y28C 5LOQA 1XC9A 4OX6A 1AW0A 5K14A 2DHSA 3EVMA 2W2PP 1U2FA 3M8PB 1YJUA 3UDEA 3F73A 2Z2YB 1VC0A 1WF2A 5D4NA 2MZRA 4B3RJ 2HGNA 1RADB 4G6VB 5E3CA 1U4BA 2W24A 4NEZA 5JJBA 5KAKA 2I38A 2LXIA 4K7QA 2WW8A 4K2XA 3NWRA 4R0JA 4U8VA 2P9GA 1S5ZA 3MAHA 4RW7B 4ELVA 2ZHAA 4NCGA 4P7TA 5I42B 5BR8J 4A8SA 2CRLA 1UJ4A 3QIDA 1FERA 4FKYA 2FJDB 3ZTSA 4H4MA 2H5IB 3EM1A 3HF5A 4WFNQ 2W9BA 4RUAA 1SVDA 1BC6A 4E0DA 3NBPB 2ZBQA 3I4PA 3OFHA 3RBZA 4DV1F 3IG1A 2AGOA 3MEDB 5CZXA 4FYDA 1CQNA 3BJYA 2ABYA 4KRWA 1HHTP 4DFPA 3CJ0A 5L46A 1KRPA 4IG3A 2J9EA 5JUMA 1NJYA 1UL3A 2E9RX 1DURA 2HBZB 3MM7A 5F8HA 1OY9A 4S0MA 5DQHA 1YRXA 1W2BR 2E7WA 1M5SA 3TYTA 1RHMB 1FX2A 1XR5A 2I9SA 3H0PA 4ZP7A 5KFIA 5CYJA 3RBEA 1NK5A 3NNAA 3SV3A 2ZC4A 3DLKA 1H3DA 3FSXA 2OAUA 3NCPA 3HVAA 3DKDA 2HWHA 1VRTA 2CZVC 5C2GA 3WC2A 3QGIA 2F8HA 2R9LA 2JEGA 5H9FK 5L38A 1LWXA 2GS8A 4OQJA 1AFJA 1AA1B 1VLOA 4MH8A 5RUBA 4K4XA 1ZPVA 5KFGA 3V6JA 4ED0A 1DTQB 5DO2A 2J0WA 1HBMA 2QO3A 3D5MA 1KSPA 2XY5A 2RMLA 2J8SA 2YX1A 1I94F 5IT4A 2WOMB 4LBIA 2QLWA 2PC6A 2V4RA 3T1HJ 3RB3A 4QWDA 2W9CB 2NREA 4ZPCA 3VGVA 2MLZA 3AD8C 1VCTA 4Y2CA 4KTQA 1UZDA 1U0HB 2GGPA 2XMVA 3CD5A 1RSCA 4RW9A 1NO8A 4C8NA 1IR2A 1H72C 1T0TV 4URGA 5E5NA 2R4FA 4P9SA 1RT4B 3DC2A 3I0RB 1S0MA 3MOZA 2VFVA 3W5ZA 2FIUA 2BJEA 2MY7A 1U1OA 2LP4A 3T5JA 2F1FA 5HK4A 2F7VA 2HW3A 3V6DA 1SC3B 3AJ1A 1T95A 3DHXA 1WWHA 3FC9A 4L72B 3D6FB 2NSCA 2VC0A 1Y4ZB 3CCES 2MQOA 3RTVA 2JOQA 2GMHA 2U1AA 3PCOB 4EYIB 8ATCB 4J9LA 4PXEA 2DYAA 4TLRA 3MAAB 3RGIA 5HROA 5J1PA 5DG9A 4DV3J 4NA3A 2GNKA 2C3UA 3CDUA 1KVIA 2DGUA 2NPFA 2KM8C 5FIIA 3MM8B 2E5HA 4NRTA 1ZTWA 2I5JB 2FPHX 2MGZA 1UWBB 2W2MP 1NM2A 2ZWPA 4IQMA 1BY9A 2H9ZA 3S6EA 3RBDA 1KNZA 4QCLA 2ZBCA 1SC4B 2Z2LA 2ZITA 3EMTA 3VTIA 1HFEL 4FBUA 3MOJB 5LMNF 1S97A 4KYZA 3SV4A 5U47A 4HYKA 4F3MA 2B6AA 2I8EA 2HHPA 3EUNA 2D41A 4WU3A 3MUMP 1SH3A 3R2DJ 5HBMA 7AT1B 4NI2B 3PIPQ 1X9MA 1JK9B 1RAEB 3OXFA 4YN3B 1AZSA 3GFHA 4IH5A 3BGUA 2DH9A 4UUWA 5KFRA 3FRYA 4C3MA 4ECRA 1MG7A 3R5GA 2HBQB 1U25A 4OYZA 1Y3KA 2AIRB 2A0FB 3IGVA 4JI8F 1JB0C 1KHVA 2IYGA 2CA9A 3W7BA 5K8OA 5LXRA 2NQPA 3CMAS 3L4BC 4H4KC 3W65A 4DX8H 4ZMMA 4JI7J 4JI0J 3KK2A 1TUWA 3NNCA 1CULB 3MPDA 1SJQA 4UUXA 1AUDA 4PG6A 2X1GA 2V9WA 4HHHA 5HMWA 1TUGB 3GJTB 3K0JA 4NXNJ 1IM6A 1XNQJ 2UXCJ 2GJ2A 4WTOB 3OTCA 2VQEF 3W8PA 3ISZA 1FTCA 3BSNA 4AXIA 3A13A 3EWGA 4B3TF 2IY5B 4MMOA 4MK9A 3HSJA 5LJ5Y 4F3QA 2AMCB 3AQPA 5HP1B 1KS2A 4X4NA 3FBEA 2M0GB 3P4UB 3KLIA 1R7IA 4DDFA 2VC1A 2KYXA 2ZEJA 1K8AT 4CP5A 3CCRS 1B70B 4HT7A 3MAAA 4RKUC 1KQFB 1MMLA 2Z56B 5HROB 2XLIA 3CWJA 4M8LA 1OQ3A 5HQ8A 1VQKS 4PG5A 2ALYB 3OR2B 2NSBA 5J2MA 5ETSA 4LQ3A 2JFKA 4O0NA 5BYSA 3OUYA 3QT5A 4NZ7A 2Q66A 1CJUA 4ECWA 2DGXA 1R8BA 1V5IB 3PRVA 1DHMA 3GWCA 3DNCA 4OZJA 4JYAF 2V8VA 5GADI 2GV1A 1N5TA 4P71A 3W9JA 2DJWA 3LO3A 4TYBA 5EGYA 2EXUA 5KFKA 1NB7A 4RJVA 4DPOA 3DFEA 3V4IA 3T9NA 1AFIA 4UTGA 3M8QB 1S48A 4RUBA 1S1VA 1Q1KA 4N56A 2HFZA 3DI6A 2O5DA 5IM0A 1IQTA 3QQCD 1XMQF 1WSRA 1YBTA 1PILA 5E0OA 1C1CA 2Z2MA 1X31C 3M1VB 4NLPA 3ZZPA 1OYDA 3KLVA 2XS5A 1L5UA 4I2PA 4DEZA 3T9ZA 3AOBA 2HHHF 2F9JA 2YPZA 4LF7J 2B9YA 2DITA 4A8OA 4LIRA 4M5IA 5D4OA 3SXLA 3W3SA 2G0IA 1IKXA 2NPIA 1NKBA 2OJ3A 1HMVB 1X4BA 1K1QA 2CPJA 1R89A 1NU4A 2W7AA 5J1NA 2UXDF 4IFVB 1NHKL 3I82A 3PW2A 2UUAJ 2VBYA 5D8HB 1V3SA 4MYUA 5L1JA 3C19A 3R5CA 2CVIA 3IRXA 4DV2J 2EC0A 4LMZA 4BBYA 2XZWA 4EMDA 2ASJA 5BXIA 4DR7F 1CS4B 1RTDA 1S0VA 1RBAA 2M9KA 4AQYJ 1JLGA 1ZAWA 3ZZRA 2BR0A 4ZIWA 2V50A 4G3IA 2LDYA 2JVRA 1FFGB 2IJNA 2QYCA 3CJ3A 3O2IA 4F4KA 2VJVA 1CJTA 3ULHA 4B9MA 1TL4A 4KJIA 2HHSA 3PG9A 4P73A 3HM9A 4DR3J 3P49B 2BDPA 1RCXB 3LAMA 5GMDA 4QWBA 4ES1A 1RCOB 3BR8A 4RR5A 3U1NA 1VI7A 4A8KA 3C8YA 2H65B 1XEZA 4IQXA 1OPIA 3KLHB 1OY8A 1EQMA 2KL8A 3ILOA 4CLSA 4CYUB 5G0RA 2QL5B 4ZVEA 3I56S 3PTWA 1UA0A 3GJQB 2J6TA 2CQIA 3M4XA 1VHIA 4WKRA 4JI2F 2OD6A 3OSNA 1XR7A 4O4GA 2O01C 1KEKA 1O8BA 3Q2TC 4ZHRB 4ZVFA 4DX7A 2MKJA 3HT3A 1ZZFA 1PBAA 1Z1ZA 2MLXA 1BUXA 4BWJA 3R8YA 5KFXA 4CNZA 4YR2A 3GPAA 2EFPA 3TO8A 4NXNF 4WP3A 2FDNA 1VDHA 1WG5A 2OPRB 3C16B 3BSOA 4DUYJ 3HP6A 2M2BA 4P2XA 4I56A 2V69A 1NSKL 2GC8A 1AROP 3HVTB 4I4BA 1UJ6A 4D3HA 3J7YU 3R97A 4ED8A 2DEIA 4ELUA 1QAJA 2V8GA 2E1CA 1LW0B 3A3PB 2ZNYA 4TY9A 3SBMA 3UDCA 3PYFA 3QT7A 4HH1A 1ZPWX 4ZDNA 1K73T 3PFEA 5KT6A 4JI1J 3N4WA 3OVBA 3QO9A 2CQBA 2FZGB 2AEFA 1VRQC 5MAOA 4ICLA 4GKJJ 1K0VA 2B9EA 4OI4A 3KLGB 4O0IA 3H4DA 4LT6A 3K5NA 4MIWA 3HSGA 2NYHA 4EK2A 2CDQA 3P5BP 5EX3A 1M1GA 4M5MA 2VF3A 3BDEA 1TKZB 3HHEA 4UW2A 5KFJA 4H4OA 3PR4A 1WKJA 2MZQA 3HDSA 3LPEA 5EDWA 2YWGA 2QE5A 2QEXS 2KI2A 4EBEA 3C6TB 1Q8KA 1QUVA 2QSFA 2W4PA 2JDJA 3ET6A 4I6AA 1HBOB 2NZ4A 1W7WA 5KFBA 4KC5A 1U24A 4NZ6A 4ZLNA 4NWBA 4ZVHA 4J37A 3B82A 2XC9A 5HLFA 4OZ5A 2ADCA 1T05A 4FXVA 2XB2D 4QIVA 2GVDA 5DDPC 4ED7A 5T14A 3RAXA 2F4VF 1RAIB 5F0WA 1ZZNA 3PJ9A 4C97A 2K1RB 4C6AA 1M1KT 1FDNA 1SI9A 2XMTA 2XI2A 1HNVA 4YP3A 5DLGA 2BRKA 5B0DA 2C3MA 1RWPB 4O23A 1WF1A 4IDKA 4NLSA 2UUAF 1FWKA 1V5VA 1Q0NA 3SCIE 4DV2F 1S12A 1TL7B 2FD2A 1TK8A 2GW8A 4LF8J 1WEZA 3OTOJ 1TVRB 2CJAA 2QN6B 1JX4A 2OEKA 2GQQA 1N34F 5HJYA 3KOAA 4DR1J 2HHXA 4PAAA 2QLFB 5F3ZA 2BE9B 3ELHA 2WONA 4IKAA 1HD0A 1HNXF 3TZWA 4A4JA 4YUDA 4PYDA 3VV2B 1UEKA 5E33A 4GVBA 2OH2A 5DZ7A 3G9CA 3OV7A 4QIEA 1J5OA 3NS6A 5DZ6A 5C24A 3Q83A 1K9MT 1JIHA 2YNGA 2LA6A 3ZO7A 2DNKA 2OPQA 4LRAA 2VPXB 1S99A 3DU5A 3ZNUA 4OJGA 1U8WA 1OO0B 4JI6F 3DYAA 5ADZA 5HO4A 3H4BA 3CMES 4TKTA 2XZDB 2W7PA 5FD1A 1QE1A 4WTYA 5IFMA 2IMOA 3LPYA 2YQ0A 2YY3A 2C2MB 3DLBA 2VKZG 4QZVB 4HI2A 3CJ8A 4KPCA 4C98A 2B7BB 3Q86A 4TQSA 1CJKB 3G86A 3IS9A 1RGVA 3RR8A 2EEYA 2LEAA 2MQ8A 4F4XA 1ZYQA 2L9WA 4NCBA 1U02A 2VG5B 1OY6A 2R7OA 4KFBB 1GMUA 5D0HA 2R7XA 2FY1A 3BR9A 2UV8A 2QA2A 3HFVA 3B4MA 2ZKUA 4Y65A 1HI0P 4EO6A 2FB0A 2MKKA 3C66A 3E3XA 1RT5A 2JEJA 3C2PA 1WACA 4W90B 1URRA 2B5JA 4DQQA 5AXMA 1TL7A 1GK8A 4Q44A 1QSSA 1OQ6A 2ZC3A 3HX9A 5CYQB 1NMEB 1RK8A 1VLYA 1IXKA 2RDIA 4WXWA 1D09B 5J2NB 5SZTA 5GAEU 1F9EB 5KG5A 1VQ8S 2X3DA 3MECB 4ZCLA 3EZUA 5AXNA 2ASYA 2LQJA 2XZTB 1JLBB 2G13A 5E3AA 4I69A 2YNHB 2W9AA 5F8JA 4IR1A 1HA1A 5IQ6A 1Y11A 4GO5X 2OKQA 3POTB 2IA0A 1TP7A 2ROEA 3VQTA 5KFEA 4RNNA 4DLGA 3DOMB 1KHWA 2HVZA 2Z0GA 5FJ4A 2ZUGA 2JC1A 3PW0A 1SPBP 2BUNA 4OJ3A 4R0EA 5C24B 3JSBA 1SUQA 3R2CJ 2VPWB 3I5BA 1XERA 4YDDB 4TXSA 1IKVA 3JB9k 4CO0A 4LSLB 4QOTA 5ETMA 5GAHU 4Q5VA 2UUWA 2CADA 2JLGA 1Q5YA 1S10A 2AEMA 3Q24A 3BGFA 5IC4B 3N5BA 3MD3A 1JLEB 2AKWB 3KLEA 1VQ4S 2NZCA 1VIXA 3HFKA 1L3KA 2VG5A 3NP5A 4KFBA 2B3TB 3PZPA 2XCAA 1FJGF 1NSQA 1SL1A 1MU2B 1X5PA 3ENWA 1U6FA 1X4DA 3QZ7A 2HSEB 3AODA 4F4AA 3CGIA 3IXQA 1QY7A 1SKWA 4C7QA 4ZK7M 3NGRA 2EFVA 2WZ1A 1S6UA 3K8WA 2K2PA 1NK8A 1D9AA 3FK4A 1UJ5A 1W26A 3FSYA 4PG7A 3CDWA 2DNZA 4V19J 1EJ7L 1NCLA 1SC1B 3UCGA 3QIPB 4WP9A 1HL6A 3RW6A 4DX5A 1X5SA 3TEGA 2IBOA 2EPIA 5D15A 1LWCB 1U0HA 2GGPB 3FFIB 1XTZA 2WAQD 5ETVA 5DJBA 2XO6A 1HNZF 3HJFA 1F1BB 3LP1A 5A2QY 4ZVOB 2FHJD 4DJBA 5K8NA 3W62A 2L41A 3AOAA 3DRXA 4KBIA 5C42B 2AU0A 1TL3A 2XSFA 4ID8A 2E5LF 2UXBF 5HSPA 1HWIA 1PYTA 1QSLA 1TMMA 3V2UC 2FGCA 4DS5A 4O3PA 2Y0SD 1ZA2B 1GH8A 2AJ1A 2MDAA 4CI0B 2HS4A 4DPTA 4DS4A 3I0SA 1NK6A 3CJSA 4QWEA 4FS1A 1NH7A 4GC7A 3L7PA 3VAMA 1S0OA 3IG1B 1CJVA 2N3LA 1FFSB 3LW5C 2HHWA 4E98A 5EWEA 1FD8A 2E7VA 3SEOA 4FZVA 2HFVA 3NS7B 3CF5Q 1LWEA 3LALA 4Y3CA 4O3SA 2Y8WA 2CJQA 3UQSA 2V8PA 1MWYA 3H40A 1PYSB 1RWKB 1VQPS 2B6AB 4I6WA 2HRTA 3JSYA 5IT0A 1KVJA 4DV5J 2MTLA 2XEXA 1QTMA 3RRHA 1KFSA 3RR7A 5F9LA 5A8RB 2E1RA 2YXLA 4MFBB 4A8MP 1TAUA 3W2VA 1EKRA 2VBZA 4FS2A 2C2RA 1NEEA 2K3IA 2LYVA 3OQ2A 2QA4S 4NXMJ 1VS3A 4X64F 3PKYA 3J7A1 1VC5A 2W25A 3FEXB 5AXLA 4OYBA 3T1YJ 3IRWP 4EWTA 3FUYA 3DLHA 4J9NA 1D8YA 3CCZA 1VRUA 3IAM9 1MROB 4RUHA 4AFFA 2WTFA 4XDDA 1FKOA 1IUJA 2BJDA 2JX2A 1FNOA 4EUVA 4NXMF 3PKMA 2W4CA 3VGUA 1S77D 2HBYB 2H48B 3TJ8A 4X64J 1SQFA 3NOCA 1N0UA 1HNIA 4WYLA 3E01A 4OMFG 4TNOA 4XDCA 5KFQA 4NYOA 3T1HF 3M32B 4X4PA 3UW1A 4IRDA 4C8YA 4ZPTR 2G1DA 4W4MA 2XBPA 3K17A 4LRCA 4UOGA 3M8RA 1TKXA 2BE2A 1HWKA 3DOLB 1MMDA 1ZM4A 1GTEA 4JB8B 1N36F 2DNGA 3L7UA 2FHKA 5K5MA 1VISA 3IWNC 2KT3A 1WC3A 3QGPA 5B7WA 4C8KA 1GNKA 1SXLA 2OPSA 3IGNA 4KQZA 3BM7A 4OI6A 2HYIB 3JTPA 4A8QA 1LWEB 1O5JA 4LREA 5AXKA 2BMBA 1ZAVA 4P2FA 2ZBRA 4NCGB 1QD1A 1X4HA 2GMLA 2PA3A 4GMKA 4ZKAA 1FVQA 5ITHA 5F8LA 2KFYA 4J9KA 2V0NA 1TKTA 1SH2A 1FHTA 1U6BA 2ZM6F 4DX6A 3IC1A 4MKYA 3HCXA 1JKHA 1RHJB 5DDRC 1N6QB 4KGXB 1WTFA 5E41A 1OSCA 1RLCL 1NUEA 2XO7A 2A3JA 4ZIVA 1NK7A 5CA5A 4PXCA 1BQNB 2RRAA 1IBKJ 4P7VA 3TAQA 1HHQA 5GAGI 5GVQA 5KFOA 2CZ4A 2M88A 2XS2A 5BR8F 1TK0A 2UVUA 4BS2A 3BPSP 2NXJA 4IO9Q 4EU0A 4PQUA 2JZ5A 4IH6A 3GJRB 3QRPA 1GX5A 4PPZA 3OLBA 1C0TB 3MFHA 3THPA 1KVKA 2LQ8A 2YX7A 2LQBA 3LANA 1FRMA 4GO7X 2ZD1B 2EWHA 3DM2A 3E01B 1RWUA 3OFGA 2MQPA 1H74A 4DV3F 1U1LA 3R6LB 3DMJA 3CDAA 1GMWD 3J81U 1P27B 1BGXT 2PT0A 1UPPA 4ZN1A 4WFAQ 2OMLA 4CRJA 4BHQA 5LL6d 5KOWA 1RTDB 2CYYA 1E6YA 3K5PA 1LK7A 4CLFA 4JI3F 1WD6A 1BWVA 3THVA 1JQGA 3C15A 3F41A 3IFEA 2CUYA 1NHVA 2APOA 3N6LA 1RTJB 3DLGA 1QTNB 1GQEA 3SIPB 4N77A 1UAWA 3IBFB 5K8MA 3GONA 1NK4A 3VCDA 2GO9A 3RB0A 1YTYA 1IWGA 1B4SA 1TL1B 3LA0A 5KG4A 4R8UB 4P10A 4C0HA 1TKTB 5KT2A 3G8SA 4NX9A 3ZNJ1 1VQOS 5JXSA 2MKIA 2BJ9A 3KLHA 2BQUA 4TQRA 3BZQA 4DSJA 3TP2A 1JKHB 2AZ1A 4NA1A 3V6DB 1YRTA 2CG8A 2F40A 3KHRA 4JYAJ 1RT6A 2DEJA 4UT4A 1RWXB 5KTQA 2DISA 3R6GB 4C48A 1TR0A 3NRBA 4ZHRA 3ZZZA 4YR0A 2LECA 5J2PA 2NUUG 3FCVA 4QR1A 5HQMA 3OW2R 2HQGA 1PGZA 3BN4A 4F2RA 1FE0A 2QV6A 4DCPB 1NAQA 2VB6A 4ATNA 2IRUA 4OJHA 3R9LA 3MCOA 1MN7A 4FPRA 1UFKA 3EXYA 2DY9A 1S9EB 2KN4A 4Q2LA 1UFWA 3D1HA 1UZHA 3HZGA 4O44B 1XMQJ 2ZFHA 4ZLLA 5A8KB 3JYTB 3UPFA 1NK0A 3GIMA 2DNRA 2IM3A 1WORA 1A6LA 2DB1A 3MR7A 2DGQA 2NUHA 4KSEB 2ZDPA 2H4WB 4Q2MA 2BANA 3DLEA 4BLGA 2HHHJ 4IYQA 3K58A 2JJ4D 2KT2A 1P1TA 1UVNA 1H73A 4BCAA 3WBZA 3MMJA 2W8LA 2QTWA 4DPWA 3IM8A 4I2QB 2DGVA 3VZHA 1YJ9S 3QGGA 4TY8A 1XWLA 4NLYA 3M05A 3KK2B 3GV7B 2XMJA 3ZTRA 3D2WA 5F8MA 3JSRA 2WCXA 5D3GA 2IAJA 4ZPAA 1RAGB 2AWZA 2FHMA 1HIYA 1FESA 2L9NA 4G1IA 2H5JB 3E2EA 3U1MA 2ZHOA 8RUCA 3MPVA 4UF4A 2RKIA 3ICLA 4X66F 5GMEA 3CC2S 4B17A 2VU5A 5LSLA 4JI8J 1IKYB 3HFZB 3K89A 3BEGB 2MYFA 4YFUA 3ZZOA 4DR3F 5HLFB 3A8EA 1T05B 4MKVA 2ADBA 5J2PB 1BE4A 1XMOJ 1RYRA 1XNRF 3KG0A 2HGLA 2DH7A 5FLXY 4JV1A 2OPPA 3D0IE 1IKWB 4WIQA 3Q8YA 3JSMA 4USTA 1CC8A 1XNQF 2KFZA 5LMNJ 3BYPA 1HNVB 2X1FA 3PEHA 4LJMA 5HMYA 4QYRA 3OL8A 4WZQA 1WC0A 4OI3A 2VFTA 2YNIA 4UOFA 5KT7A 4KV8A 2P5VA 1U8SA 2CJBA 3A4TA 4ZITA 3VAFA 1Q7YT 2D9PA 1Q79A 1ZM9A 3M2RB 2QMXA 4NOHA 3J81Y 3N01A 3CJ4A 3PYDA 3PVXA 1H38A 4K4ZA 1YDLA 2MB0B 4USVA 4OX8A 2XQCA 1SL2A 1VQ9S 4EI2A 1RAHB 2AZ3A 3I6PA 3D0GE 1X9WA 3GIJA 2KRBA 3GE9A 2JVOA 4LFCJ 2IJRA 4B9LA 3GSDA 2W2NP 2MZTA 4QU7A 4QJVA 1N5SA 4AE5A 4M5DA 2P9CA 4DQPA 3DN9A 1FEEA 3U27A 4YR3A 5A0YA 3Q8UA 4IOAQ 5IV3A 2PI4A 2D3ZA 2FZCB 2WK4A 4GVLA 1KC8T 3DRPB 3W61A 4B3TJ 1OPZA 2XMWA 4O3QA 3VF0B 2QX0A 3MDFA 2ZZMA 1U26A 2XSJA 4DR4J 4AYBD 1T7PA 3PDNA 2AJQA 1ZM3A 3ADAC 1JXVA 3CJ5A 3VQSA 4XAKA 1G7CB 1HBNB 3ILIA 1SB6A 4AXJA 1N5VA 4CO2A 2B43A 2AW0A 3NGKA 3IRXB 4H4OB 1F5AA 3FKBA 3T6JA 3VHQA 3I5CA 4DUYF 2ACMA 1HQ2A 2GJIA 3GV8B 4ERDA 1OIAA 4USWA 1G2EA 1EQ0A 4KHMA 4LBPA 5T7LA 2ROGA 2CWKA 2EG2A 3LP2A 1DTTA 3EZ5A 1HBOA 4F02A 3BGOP 1QVGR 1YRUA 3VAIA 1JLAA 4I1TA 4QPTA 4B9NA 3HK2A 3OHAA 4LR8A 2HZCA 1LXJA 1FA0A 2BKPA 2FZKB 3DRRB 4F3OA 3CDBA 2DO0A 2KM8B 4LFAF 1KBRA 5F9NA 4ED3A 3I87A 4DSFA 1JWWA 4CLTA 1RDRA 4USMA 1Q5VA 5EX0A 4PWDB 2K1RA 2E5IA 2XCPA 4AUKA 2LMIA 2R8JA 1FXDA 2MPUA 3PV8A 1H2VZ 3AJ2A 4L74A 2B0GA 4IFYB 4OLPA 3IAS9 4RU2A 4DFJA 4DR6J 3VVTA 2DO4A 3QRRA 3HSZA 2EFNA 1RJJA 1R8PA 1S6PB 2XMUA 4PWWA 3FNNA 2V6AA 1RUSA 4YHHJ 3KHGA 2VICA 2FHJA 2R7RA 2VA2A 2DTJA 4YB5A 4DG1B 3MMAA 5KFAA 2HWIA 3GQCA 1KDNA 2X1BA 1FRKA 3MR5A 3CD0A 4DSIA 4RW4B 4ED1A 4FF1A 2MEWA 2AX0A 1RTZA 2ZOGA 2IA6A 2JHEA 2KXFA 4RNOA 4LSZB 4OYXA 1NSPA 2CQ0A 4R25A 1EHWA 3TZYA 1RT2A 4LSLA 4LRBA 1R6VA 4ZJLA 1RHUB 3NGTA 4NLRA 4B9UA 2GIRA 4AD6A 3QJPA 2KZMA 2VUGA 2FVQA 4DSEA 2PA8D 2AJ2A 2EI5A 2IDEA 4RWXA 3AXKA 4B3OA 1LW0A 3J80U 4P74A 1YJ7A 3PW7A 4A8FA 3FBCA 2A10A 4RLEA 3EVWA 3HHLA 5B08A 3AAWB 3G8QA 1QLNA 3OBIA 3BS9A 5CYMA 1APSA 3FVYA 5AT1B 3US5A 4FBTA 1WHVA 4B3SJ 1UFLA 2VPYB 2UUCF 2CNLB 1ZAXA 4RBTA 1N5YB 2KVQE 2KKHA 2W4DA 1PC5A 3D3CJ 3D7SB 4OYPA 3QRQA 3V81B 1X60A 3H90A 2MSTA 4B3SF 3CCMS 1S7IA 2CKWA 2RUSA 3DRYA 1VQMS 1QSYA 1HI8A 1VRTB 5L8RC 3HMJG 5DM6Q 5EWFA 1BQMB 2LDIA 4JI4J 5KFNA 2H5EA 4P6QA 3GYGA 4WFYA 2WW4A 3H5XA 3CJKA 2VOPA 3F0NA 1M0SA 5J2QB 1K0TA 4KR0B 3BQ2A 1R0AA 1UVKA 1XIQA 2RSQA 2WVEA 2HFNA 4LFCF 4JI1F 3OTEA 3WX4A 4QW9A 1G4CA 3KK3B 2R2RA 1B0VA 1FFWB 2GX8A 2P6SA 2WRMA 3LP1B 4KPYA 1SV5B 2A2CA 4HT5A 3NMAA 4IO1A 4OYWA 2DR9A 2HG4A 3OT9A 5B0GA 4Q8EA 2CFXA 4WPAA 2KXHA 1QAXA 1GX6A 1YJVA 4CLWA 1O51A 4DV4F 4FYXB 4M94A 2VJUA 4ECVA 4DHVA 2YNHA 3Q23A 2DRDA 2RB7A 3AT1B 3GFYA 1I3OB 3MM9A 1S1TA 3L09A 3MEGB 4HTJA 4F4ZA 1C1BB 1KLNA 4LF9J 3BGRB 5KT3A 2A1BA 4FN5A 4U7CA 2J9DE 9ATCB 1D9FA 1YBAA 1ZA1B 2BW2A 2D7SA 2YTCA 2MZJA 4CIOA 2Y1LB 1HPZB 1S1XB 4M5KA 2J6UA 3HHNB 2C2KB 2BJ1A 3UN3A 1RAFB 4OZLA 1HHSA 3KUGA 2J76E 3T41A 4DL5A 2HVIA 3MM8A 1P9QC 3LTOA 1HR0J 1JLEA 5K20B 3M9OB 1QM9A 2CPIA 4F0HA 2XLKA 1S79A 1CSJA 2CPDA 2RDDA 2YBVA 2ZVIA 2XGPA 4LF8F 5M2UA 3JXOA 3KG4A 3QWPA 4LQ9A 3H8YA 4ECTA 4B9VA 4Z37A 2R7SA 3PRDA 2IC3B 1VBZA 1ACMB 1JJ4A 3KTQA 4DR6F 4N8OA 3LWMA 4XPEA 1RE1B 1F60B 4RW6A 1U2CA 4CT8A 1R0AB 4RWWA 1RHKB 5JMNA 2BKNA 1B0TA 2M4MA 4EGLA 3D1QA 2X7IA 4CQ1A 3N6MA 3J7ZT 3HPOA 4EBDA 4U95A 4ED2A 2KO1A 2V8HA 1GXLA 1R0CB 3H7HB 1DLOA 3KK1B 2HQFA 2KH9A 1NZAA 1HBMB 2JC0A 2HFOA 5KFSA 3M9NB 2D74B 4M1KA 3CT9A 4F36A 5D4LA 3OVAA 4N76A 5KFPA 2AHOB 2NCKL 3N0VA 2ZJRQ 2ZJQQ 1S72S 3M32A 4N41A 1ZTTA 1FNMA 2CPFA 1FK9A 1I51B 2RILA 2CVEA 1UW9A 4DR5J 1O6XA 2NXUA 1TFYA 1KN6A 1MW7A 3MHYA 3UDVA 4TU7A 2QA4G 5KFHA 1N34J 1HW8A 1RTHA 1Y5LB 2BACA 4JV2A 1CEZA 1ZM2A 3EVOA 1FRLA 1GEHA 3GG1A 4LVOP 1N4LA 5ETLA 2HZAA 5CCMA 2IVFB 4N7TA 2YKPA 3ISNC 3QATA 3SFUA 4NLGA 3OR1A 2OFGX 2AGPA 2QGFB 5CAAA 4UY85 3M8PA 4ZVQB 4A48A 4ZP9A 1UVIA 4UZBA 4Y2AA 4KKOA 4IG0B 1TTHB 2CQDA 3R5JB 2C1EB 1EIYB 4W92B 3C3LA 3PHEA 3POTA 5IT9U 2CAJA 1U1PA 2CQ3A 5KG3A 4CO1A 4QIFA 2C2EA 2UVWA 4MKAA 1YHQS 2MLYA 2KRRA 3K2YA 1PYOB 2EFGA 1HNZJ 4KGKA 1J5EF 1URNA 2VKRA 3J7Z5 2VQFJ 5ETPA 2MGZB 3DHWC 4LBHA 4FYWB 4IH7A 2NR0A 2MKCA 2PFDA 3ISND 4OV1A 4WK3A 2F3JA 4Q43A 1FI4A 2YKMA 4QIGA 3QSIA 5B0CA 2B51A 3CO9A 1U49A 4KGVB 4HTIA 2YKQA 2QL7B 4C0OC 2VA3A 4YB7A 1DLOB 3MTJA 3LOUA 4UY8T 1Q16B 4U96A 5A8WA 5LJ3Y 3UE2A 4DZDA 2JRSA 3GYXB 3NGSA 1WF0A 2YKOA 1NNDA 3K57A 2XYPB 4DFKA 3C46A 2HNYA 1SQGA 5AE3A 3KUHA 1HNWF 3T1AA 1FKOB 3D6HB 5HBMB 5GADU 3G96A 4C3KA 4EBCA 3NY0A 2RRBA 2BOPA 4JBCA 4C11A 4QBUA 3GR0A 2MSSA 1SIWB 2V63A 1DTQA 4TLQA 5IC6B 2PGCA 1TV6A 2F9DA 3I9V9 1SKSA 4X4QA 4RBUA 3CSKA 1W2IA 1VQ6S 2ZWOA 3KFWX 3SQGB 2MXYA 3MR3A 1JLGB 2ROPA 1VMBA 3JTNA 2D3O1 3P6YC 4RNHA 4DL2A 2QYGA 1IN0A 3GSIA 3B6BA 5B09A 3GV5B 1V6HA 2CNNB 1RKIA 3D0HE 3TAMA 2J0SD 1S6QA 1PSDA 2HFUA 5EWGA 2IIHA 2AJFE 2JSXA 3UR3C 4EFAC 1VC6A 1SH0A 2P6TA 3I9ZA 3PXGa 3TUZC 3EX7B 3DDNA 3MEEA 4J9MA 4OX9J 3TX0A 3I0RA 1T9YA 2FQQB 3UFCX 1UVLA 1KTVA 1UW4A 1RI7A 3M2UA 5DDOC 5H9EK 4CLPA 1KR4A 3CC7S 3K5MA 2DXDA 2HLUA 3IMQJ 1T3NA 1BMQB 2V94A 1LEOA 1CJVB 3O1LA 2RU3A 4IOCQ 3OUYB 1JNZB 1QDUB 3TZXA 3BGLA 3KJVB 4L73A 4HI1A 3R7SB 3OFEA 5CABA 5DLFA 2PFFB 9RUBA 1D9DA 4ER8A 4WJBA 2HNDB 1T02A 3TUPA 2MQMA 1IBKF 2ACYA 4USKA 5BYQA 2VG7B 1UWBA 3UD3P 4P75A 1W25A 2O67A 3VAGA 2CQ4A 2J9DA 5B0AA 4JUZA 1S0NA 1Y5IB 4QR0A 2XY7A 3HVTA 3UNYA 4N47A 1JLQA 3G6XA 2J9CA 2HHQA 1GT8A 2DXEA 4WIIA 3M2VA 3LQVA 2KHDA 2IBKA 4DL6A 1P6TA 3GR1A 3VWSA 2ZM6J 4GKKJ 2ZZTA 7FDRA 1SKRA 3TI0A 4DV6F 3R1LA 3W2WA 3BBFA 2BJ8A 2ZE2A 3QO9B 4Y2IA 4TN2A 2EBEA 3H2UB 2G9OA 3TEHB 2F4VJ 2DHHA 1A0OB 2RKIB 3DOKA 3TAMB 2HRYA 4HHUA 1RWOB 3ILJA 1CS4A 3KLFA 3R5AA 3MMBB 4X4OA 1FKAF 5DGBA 4DR2J 4GKKF 2E66A 3EPGA 4PABA 4MK8A 1RB0A 4FPIA 2FJWA 2HURA 2PE8A 4ECXA 3VAKA 2VASA 3DOLA 2IRYA 2CNKB 2ZDOA 1S57A 5KFUA 3UWTA 3KNAA 1M5OC 4K4YA 4ZJOA 2GJFA 4DUZJ 3QJLA 4PZVA 2RS2A 1Y3JA 1R0BG 2VDHA 2ZUAA 4DWIA 1MLAA 2DXFA 1ULRA 2V4JB 3GJSB 3GZ7A 4CYUA 1KD1T 1S1WB 5FLXU 4ZCMA 1DY3A 1T03B 1RT1B 2X51A 4A47A 5B0FA 4WU2A 3HHLD 2AGQA 1TUVA 4CH0S 4DL3A 5FDLB 4O4GB 2K3KA 4RU9A 2FC9A 1I94J 2HQDA 5AE2A 3THTA 5IZHA 2FVSA 3NL0A 2KU7A 2ZH3A 2ZJPQ 1Q78A 2J8AA 2WVBA 3CJQA 3JYTA 2LEBA 4DF4A 1U6ZA 2ASDA 1ZETA 1SCJB 2CDRB 2YKNA 4AT1B 3C16A 3OL7A 4BC9A 2VHGA 4OL8A 1NLKL 2F4FA 2ATLA 1VQLS 5C25A 5KFLA 3CD7A 3SDEB 1N0VC 2LU2A 3W2WB 1IBMF 4OV6A 5LMUF 5A6WA 3S7RA 3J7YI 1U7LA 5ETOA 3TA2A 1NKCA 1TAQA 4F26A 3IBCB 4TY8B 1FKPA 2QLBB 2LFVA 1RISA 2ZNZA 2XHWA 1WHWA 4IRKA 4CM2A 5IQQA 3DYAB 3UVJA 2YWEA 4WFBQ 2KDOA 3UD4P 2J7KA 1SC6A 4WWSA 3L3CA 4TVAB 5T7LB 3TANA 1NPRA 3CW2C 2CPYA 4J5OA 3GIIA 1DRZA 4CCHA 5IV4A 2YWWA 1DZ5A 2OELA 5HVFA 1R31A 1YJWS 1WHXA 1VJWA 1LK5A 1SKUB 2B8PA 2EC2A 2QRRA 3HHDA 1NPKA 3H42A 2FYXA 1C4AA 2V4JA 2XWYA 1NDPA 1Q8IA 3BBCA 4C8MA 2M70A 2PMZD 3JSMB 1FJGJ 5MLCV 3CB4A 1OJ4A 2BM0A 3QNWB 1FWLA 1FX4A 4QWCA 4OLOA 4C9DA 2BE7D 3AA8A 1JJHA 2HS3A 2W2OP 4HVZA 4FF2A 2MZ1A 2B5JB 3QT8A 4OZ0A 3OL6A 4L75A 4XTTA 1T11A 1JNRB 3O6QA 3BN7A 4ZJQA 3K5LA 3QSYB 1VIOA 1Y9OA 4EYHB 4DV6J 2M3DA 3EICA 4U6PA 3CNQP 1Q53A 3KHHA 2OEJA 3TRGA 3FEZA 2Z57B 2W2QP 4M5JA 5L1KA 3CJRA 4AL6A 1Q81T 4DSLA 4OIXA 3KJQB 5GMKa 2R7UA 3QMQA 3PW5A 3EXCX 1LFPA 2MHNA 2RD5C 3BREA 3O5TB 4WE1A 2C2DA 1M90T 1N32F 2KJVA 1GAOA 2PD1A 2YWKA 4ECSA 2E1PA 1E6VB 1D3WA 4PEOA 3TARA 1S49A 2NXCA 4IDKB 3LP0A 4DR2F 1RKJA 2OP5A 2OI2A 1KONA 1VHFA 4NYPA 1S76D 2RF2A 2DRBA 2CPZA 2ZH6A 2CJYB 3W8GA 3M6VA 5I42A
chains in the Genus database with same CATH topology
3W1YC 4NEZA 4NXNJ 5A2QU 1XNQJ 2UXCJ 1N32J 4DV7J 1HNXJ 4HHUA 4JI1J 1J5EJ 2F4VJ 4JI2J 4DR2J 3R2CJ 4GKJJ 5BR8J 3J80U 4B3MJ 1N33J 5IT9U 1XNRJ 4K0KJ 4JI8J 4DUZJ 2UUBJ 1HNZJ 2KVQE 2VQFJ 3D3CJ 3J7AN 1XMOJ 5FLXU 4JI4J 4LFAJ 2UU9J 4RJVA 5LMNJ 5IWAJ 3JAMU 1I94J 1IBKJ 4V1Ak 4DR7J 4DV0J 4LF5J 2E5LJ 2UXDJ 4LFBJ 4JI3J 4LF4J 4LF8J 4NEYA 2UUCJ 4LFCJ 4X65J 3T1HJ 4DR1J 3J81U 4LF9J 4JI6J 2UUAJ 4JI5J 4DV2J 4B3TJ 4DR4J 4AQYJ 4LF7J 1HR0J 2UXBJ 4OX9J 4DV3J 4DR3J 5LM7E 3IMQJ 4B3SJ 1FJGJ 4JYAJ 2MQ8A 2KL8A 4DV5J 2MTLA 4JV5J 4KYZA 4NXMJ 4DV6J 3R2DJ 1XMQJ 3T1YJ 1HNWJ 4KHPJ 4DR6J 3D3BJ 4LF6J 2VQEJ 4PWWA 4X62J 4KY3A 4YHHJ 4YY3J 4DUYJ 4DV1J 4DV4J 1N36J 4DR5J 5LMUJ 4JI7J 1IBMJ 2HHHJ 2ZM6J 4GKKJ 4JI0J 4X64J 5AJ3J 1IBLJ 1N34J 2MEWA 4B3RJ 3OTOJ 4X66J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W1Y C;  4NEZ A;  4NXN J;  5A2Q U;  1XNQ J;  2UXC J;  1N32 J;  4DV7 J;  1HNX J;  4HHU A;  4JI1 J;  1J5E J;  2F4V J;  4JI2 J;  4DR2 J;  3R2C J;  4GKJ J;  5BR8 J;  3J80 U;  4B3M J;  1N33 J;  5IT9 U;  1XNR J;  4K0K J;  4JI8 J;  4DUZ J;  2UUB J;  1HNZ J;  2KVQ E;  2VQF J;  3D3C J;  3J7A N;  1XMO J;  5FLX U;  4JI4 J;  4LFA J;  2UU9 J;  4RJV A;  5LMN J;  5IWA J;  3JAM U;  1I94 J;  1IBK J;  4V1A k;  4DR7 J;  4DV0 J;  4LF5 J;  2E5L J;  2UXD J;  4LFB J;  4JI3 J;  4LF4 J;  4LF8 J;  4NEY A;  2UUC J;  4LFC J;  4X65 J;  3T1H J;  4DR1 J;  3J81 U;  4LF9 J;  4JI6 J;  2UUA J;  4JI5 J;  4DV2 J;  4B3T J;  4DR4 J;  4AQY J;  4LF7 J;  1HR0 J;  2UXB J;  4OX9 J;  4DV3 J;  4DR3 J;  5LM7 E;  3IMQ J;  4B3S J;  1FJG J;  4JYA J;  2MQ8 A;  2KL8 A;  4DV5 J;  2MTL A;  4JV5 J;  4KYZ A;  4NXM J;  4DV6 J;  3R2D J;  1XMQ J;  3T1Y J;  1HNW J;  4KHP J;  4DR6 J;  3D3B J;  4LF6 J;  2VQE J;  4PWW A;  4X62 J;  4KY3 A;  4YHH J;  4YY3 J;  4DUY J;  4DV1 J;  4DV4 J;  1N36 J;  4DR5 J;  5LMU J;  4JI7 J;  1IBM J;  2HHH J;  2ZM6 J;  4GKK J;  4JI0 J;  4X64 J;  5AJ3 J;  1IBL J;  1N34 J;  2MEW A;  4B3R J;  3OTO J;  4X66 J; 
#chains in the Genus database with same CATH topology
 3TVZ A;  4MIA A;  3W1Y C;  1WOO A;  4PPD A;  3VVU A;  4O3N A;  5D77 A;  2R8H A;  1S1U A;  3RB6 A;  1L3T A;  4CH7 A;  1RAO A;  4DUZ F;  1N32 J;  4X2B A;  3ZZ0 A;  3LF0 A;  2MQL A;  4PYA A;  1JLF A;  1WI6 A;  3C6U B;  3MI7 X;  3OFF A;  5K9F A;  1FJ7 A;  2V9K A;  2E1M C;  4NL5 A;  2KG1 A;  1X4F A;  3MM5 B;  4A46 A;  1YKW A;  1MWZ A;  1HBU B;  2UVV A;  3NLC A;  1YLX A;  4URQ U;  1B0P A;  1N54 B;  3RBX A;  4DN9 A;  4J9P A;  4C3L A;  4IG3 B;  2UXC F;  2HHU A;  4LVN P;  1NPP A;  3WHI A;  2IVY A;  1TU0 B;  1RAJ A;  3WIU A;  2FHO B;  4ZPV R;  3K5O A;  4N5S A;  2MJU A;  5J2Q A;  4GKJ F;  2C3P A;  4L3K A;  4ZVR B;  2B56 A;  1T8E A;  5CQG A;  1CQM A;  1RQ0 A;  2FUG 9;  2IM2 A;  2V2Q A;  1M5H A;  4F7V A;  1JXE A;  5LSO A;  3QAE A;  3X3U A;  3I55 S;  2AEJ A;  2CQ1 A;  5EHH A;  1FEH A;  3CCT A;  3MPY A;  2V4Q A;  2H4Y B;  1IM4 A;  2RIJ A;  4PWU A;  2DNM A;  1V3Z A;  3C6T A;  4RZR A;  3ILL A;  4I64 A;  1N56 A;  2G4B A;  3EE3 A;  4GRS A;  1VQ7 S;  2OLW A;  1IKW A;  1LWC A;  1LWF A;  2OD4 A;  3ZTO A;  3RUB L;  2C2N A;  4L3N A;  4LSN B;  3CDE A;  1N48 A;  4RPF A;  1WI8 A;  3D4J A;  3J80 Y;  1RT7 A;  3MM9 B;  1X7V A;  2ZH5 A;  1FXR A;  1TEL A;  3S01 A;  4KV8 B;  2IRX A;  4ZVU B;  1VBY A;  2I2Y A;  2HQC A;  1QUP A;  2DNH A;  4TU8 A;  2YKA A;  3TAP A;  1Z2L A;  1AT1 B;  5KG7 A;  4GC6 A;  2IVM A;  1UKU A;  1ZBT A;  2EVZ A;  1RU1 A;  1NB2 A;  4Y00 A;  5LXY A;  3J81 j;  3SMZ A;  4IUF A;  2V5H G;  3NGU A;  5K14 B;  3NNH A;  3NS5 A;  2WSF C;  3Q8V A;  4DN0 A;  1AXQ A;  3MEC A;  1LFW A;  4LR9 A;  5D78 A;  1YVF A;  1EET A;  2V2Z A;  1JLF B;  1FXL A;  3C6U A;  2VFS A;  1UWA A;  1DQ8 A;  2HEK A;  4KO0 A;  5DQI A;  2ZH4 A;  2Q79 A;  2YWF A;  1VQY A;  3JAM Y;  2W7O A;  4M5D B;  5D0G A;  3IWX A;  2ASL A;  3R5B A;  1K47 A;  2BJ3 A;  3UCU P;  3CCU S;  2MQQ A;  1GXT A;  3S8S A;  2KYZ A;  1WOS A;  3DU6 A;  5L9X A;  2A6M A;  3MUT P;  2HNZ A;  5C2C A;  2VG6 B;  3MMC A;  1UVM A;  3TNV A;  1RAB B;  1Y7P A;  2GZO A;  2Y3Y A;  2AYB A;  4YDX A;  4U8Y A;  5E3Q A;  5KFY A;  2XSJ B;  4F25 A;  3V81 A;  2RHS B;  2WHO A;  5KFT A;  4RUC A;  1WSV A;  2Z8Q A;  3EGZ A;  3NBP A;  5ETT A;  5LM7 E;  4Q45 A;  1HBN A;  1YZ7 A;  2D1C A;  2LEP A;  1XMO F;  3MFI A;  2OHD A;  3MM7 B;  3W2V B;  3MCM A;  2HHV A;  1EAR A;  1XK8 A;  1JLC A;  2KB2 A;  3PRB A;  4E2F B;  2N4D A;  5CCL A;  3CCL S;  1NDC A;  1U0S A;  4HH0 A;  2FTR A;  1FTR A;  4DUT A;  1F9H A;  3CIM A;  2C42 A;  4WFZ A;  4QW8 A;  1VK3 A;  2R7Q A;  3UD5 A;  3G8T A;  2VQE J;  4LSN A;  3H59 A;  3UN5 A;  1YJT A;  1FRI A;  2M7S A;  4ANE A;  1REV B;  4HHJ A;  4C8L A;  2LCW A;  2DNL A;  3LUY A;  4J9S A;  2XUL A;  4OZ3 A;  5F8I A;  2K7J A;  4DL4 A;  1U1R A;  3CXC R;  2CQP A;  4X62 J;  4LF4 F;  3IR5 B;  3MEK A;  3MCS A;  3HJV A;  1L3V A;  4X65 F;  3R1H A;  1UEU A;  4IFY A;  1UET A;  2VBW A;  2UZA A;  2YVS A;  5C42 A;  1RBL A;  4JV0 A;  1EET B;  4LIW A;  4DU8 A;  1ZS6 A;  3HKZ D;  4Z2X A;  2RQC A;  5DQG A;  4PRF A;  3H20 A;  2Z58 B;  3KKF A;  4DG1 A;  5KG6 A;  4TYA A;  3TX8 A;  1PJ5 A;  4X62 F;  4JI5 F;  4ITS A;  3VGT A;  3JQJ A;  5D0E A;  1UVJ A;  1HW9 A;  5JVH Q;  3VAL A;  1EP4 B;  4QYZ J;  3EJM A;  3QAU A;  3BYR A;  4RW9 B;  4J9O A;  2FJX A;  1VBK A;  4K2J A;  1TZ0 A;  1F6T A;  1DQA A;  2P9E A;  1V3R A;  5HI7 A;  2P8I A;  3WC0 A;  4B3M J;  1RHR B;  3Q8S B;  2PII A;  3UCZ P;  1R43 A;  4K50 A;  1N33 J;  2QC3 A;  3DOM A;  1IBC B;  2SXL A;  2R7V A;  1RA7 A;  3HKW A;  3RRK A;  4K0K J;  3DLJ A;  4RX6 A;  2RQK A;  1RT3 B;  3FEY B;  4ED5 A;  4UZC A;  3TR5 A;  1WC4 A;  1X4E A;  4BC7 A;  2H51 B;  2E5G A;  3O3L A;  5DDQ C;  4D3G A;  1JLC B;  1RZM A;  3GIR A;  5HVG A;  3V4I B;  4U7U K;  3LH2 S;  3SQO P;  1PAU B;  4J90 A;  1N88 A;  5J1E B;  2XYG B;  2IYI A;  4P72 A;  2KXN B;  2DVI A;  3MED A;  4LFA J;  4BDP A;  3WX8 A;  3FQL A;  1EAY C;  2B4P A;  3GCX P;  2Z4P A;  1U2R A;  3JAM U;  3NXZ A;  2WB4 A;  2BEF A;  3TUJ C;  2J5A A;  1U1K A;  1YJN S;  2PN6 A;  5D4P A;  4NI2 A;  2XY6 A;  4MFB A;  1EZZ B;  4I0W A;  4NE9 C;  3U02 A;  4DR1 F;  4Q0B A;  2K8G A;  1KOO A;  4B08 A;  3QJJ A;  1VGY A;  3EZO A;  1MMN A;  5F41 A;  1TK5 A;  2UXD J;  1MSW D;  1VFJ A;  3H25 A;  3DLK B;  2V67 A;  1QJH A;  1FDB A;  4IFV A;  2UUC J;  2Y9H A;  4FP9 A;  2N7Y A;  5ETR A;  2ZH7 A;  4FNI A;  4ILR A;  3QIP A;  4CDI A;  4F04 B;  4WCE Q;  1KLM A;  3BF4 A;  4O3O A;  1M5K C;  1NJX A;  1EX8 A;  1D0E A;  6FDR A;  2QG9 B;  3AY0 A;  3M6X A;  5GAH I;  3I5A A;  4J9R A;  4DXL A;  4JI6 J;  2FLO A;  4WZM A;  2HZV A;  1HQU A;  3N28 A;  3ZTQ A;  5C7P A;  3CIZ A;  1X4A A;  1QAI A;  5HP1 A;  4PQA A;  2BE2 B;  2RQ4 A;  2W01 A;  2XHC A;  5E7O B;  2W9C A;  1C1B A;  1NDL A;  4DI6 A;  1HKA A;  5I3Q A;  3AB2 B;  3M2U B;  3QFW A;  3AB4 B;  3BSC A;  2FJA B;  1Y10 A;  2BYC A;  2DNO A;  2OPS B;  4OJ1 A;  5J2M B;  2OIH A;  1F5B A;  2J7W A;  2MQN A;  3BSA A;  4YS2 A;  2UXB J;  1T94 A;  2OO4 A;  3DDI A;  3HZE A;  5E3R A;  2AYM A;  1YGY A;  3CCQ S;  3I32 A;  1XMB A;  4ID5 B;  2QFJ A;  2ZOM A;  1LW2 B;  3LAK A;  3Q89 A;  2FJV A;  2V8D A;  2VQF F;  1WDD A;  3EDQ B;  2QZ8 A;  1X0P A;  1HYS B;  4MYT A;  1P9Y A;  1YSJ A;  1CBK A;  2PMH A;  1NHU A;  2YKM B;  3GCW P;  4OI2 A;  4DL7 A;  2FY8 A;  2BW7 A;  3TW0 A;  4F0M A;  1M5V C;  1CJU B;  5IT9 Y;  1GFW B;  1FE4 A;  3A8K A;  4AL7 A;  3OSP A;  5HJX A;  2P2C B;  1KWM A;  4NLU A;  1C0U A;  2LVW A;  1R8H A;  3TOQ A;  5SUH A;  4R5P B;  1OSD A;  3E51 A;  1GXU A;  2AYE A;  2AQ4 A;  2DY1 A;  4AND A;  4PQU B;  1I1G A;  2HPU A;  2XYH B;  2JWN A;  3M8Q A;  1FVS A;  3CJT A;  3PJX A;  2JFD A;  3BBB A;  2HLT A;  4X84 A;  5LT5 A;  2RDJ A;  3NMR A;  4ILL A;  4KHP J;  2N4C A;  3R7N B;  1BXN A;  5T41 A;  2YNF B;  5IM0 B;  5KT4 A;  3M9M B;  3D3B J;  3HHL C;  3V4M A;  2DH8 A;  3PW4 A;  4HEA 9;  3PX6 A;  1B99 A;  4LF6 J;  1WG4 A;  2G0J A;  2LA4 A;  4KY3 A;  1P1L A;  3TQE A;  4DV4 J;  2HMI B;  4J91 A;  4I2Q A;  3QZ8 A;  2R8I A;  3FSI A;  1TV6 B;  3MUR P;  2RAQ A;  4Y34 A;  2DCU B;  3GB0 A;  3GFZ A;  4I2P B;  3W9I A;  3KLF B;  3M30 A;  2YX4 A;  3MZI A;  4PG8 A;  3QWU A;  1NK9 A;  1N5Q A;  1VRU B;  2XWX A;  3HD2 A;  4ICL B;  1YBU A;  3DMJ B;  3GTY X;  1T9V A;  1DJ0 A;  3FZB A;  3PNI A;  3IM9 A;  3N9U C;  3AA9 A;  3W60 A;  4K0K F;  2R8K A;  2C2O B;  3AD7 C;  3GG0 A;  3HXM A;  1X5T A;  5AE1 A;  3DLG B;  1HNI B;  4CTA A;  3H5Y A;  1HLW A;  2BZ2 A;  1IKY A;  3W5Y A;  2DNQ A;  3BV8 A;  4F0K A;  2Y1I A;  3MEE B;  2IHR 1;  3T5L A;  1HAR A;  3RAM A;  4RBV A;  1P8G A;  1M5P C;  2FGO A;  2DBB A;  2ILZ A;  3A8J A;  4ID5 A;  3JQK A;  4QR2 A;  2OPP B;  3TJ9 A;  3CD6 S;  2B4V A;  2DRA A;  2HK2 A;  2W1B A;  3BKT A;  4I6Y A;  2BAB A;  5ETK A;  4FNH A;  4WYW A;  4U67 Q;  2DR5 A;  2YQ1 A;  1KQS R;  1C4C A;  2Q1L A;  5A76 A;  4FF4 A;  4LF1 A;  2JEI A;  2G0C A;  2M5Y A;  3JQM A;  4G1Q A;  1B64 A;  4JOU A;  3BKU A;  4ZLJ A;  3P96 A;  1WUU A;  1DBD A;  3SCJ E;  5HN0 A;  3MUV P;  1VJQ A;  5G0R B;  4ZPB A;  7FD1 A;  2XMA A;  1WKL A;  4KHR A;  1WC5 A;  2YPY A;  4K5S A;  5JVG Q;  1B7Y B;  3TA1 A;  5LSR A;  5A8K A;  4K4T A;  3ENQ A;  3M8S A;  3R7B B;  2I0X A;  3W9H A;  4AL5 A;  1Q8L A;  2JL9 A;  3UR0 A;  4URS A;  2XNQ A;  2HMI A;  2RQM A;  2F8E X;  2VPZ B;  2A6O A;  3QYY A;  3T6B A;  2E9T A;  3D6T B;  4ZP6 A;  4DR5 F;  3G87 A;  3DI6 B;  4ZVG A;  5KFF A;  4K4W A;  3HO1 A;  3BPD A;  1NJW A;  4FXD A;  3M30 B;  2HGM A;  2NLW A;  3K8V A;  2OPR A;  2BX6 A;  3I31 A;  3SSR A;  1C1C B;  4QWA A;  1S4E A;  1M1H A;  1FDD A;  2ERR A;  2KJW A;  4LF7 F;  5HMX A;  2PO4 A;  5H9F J;  2R2U A;  4OHZ A;  1KQG B;  2ALZ A;  2GHV C;  2ZD1 A;  2Y1R I;  3DM2 B;  4RO0 A;  2GA7 A;  3VR1 A;  4CTA B;  2UU9 F;  2R3V A;  4YB1 P;  3B8H A;  2JH3 A;  1YIT S;  2HVD A;  2PEB A;  2QSW A;  3B54 A;  3FGV A;  4ZCI A;  4CO5 A;  5DG8 A;  1FRJ A;  3DGV A;  3ZZU A;  2IMW P;  2HIY A;  4PG4 A;  2ZH8 A;  3SSQ A;  3KYL A;  1F3V A;  3TUI C;  4K4V A;  3DRR A;  4C2M A;  3SZ2 A;  1DAX A;  4Y0F A;  3M8Z A;  2WSC C;  1S1W A;  4DPY A;  5L1I A;  1VK8 A;  2OTL S;  1ROF A;  3OD2 A;  3OLA A;  4KGZ B;  1WEL A;  4HLB A;  1T3O A;  3FMW A;  2C2Z B;  3PHT A;  4ANC A;  4F4W A;  3NAI A;  1ITP A;  5CD4 A;  3HT0 A;  3T1Y F;  3MCN A;  1U09 A;  3TVY A;  2GVD B;  4OHW A;  4LF6 F;  4FF3 A;  3ET6 B;  1AYE A;  4HL9 A;  2DT9 A;  3TWZ A;  5H9E J;  4YY3 F;  3RRG A;  1FO1 A;  2H1Y A;  4P2S A;  2DNP A;  2HQI A;  4RW8 A;  1SJ4 P;  1E6V A;  1RTI B;  1H7X A;  2O66 A;  2HRU A;  3IA0 A;  3ITH B;  3MM6 A;  2I6W A;  3CPW R;  1YX2 A;  1A9N B;  2RF2 B;  1RWW B;  2DCL A;  1HD1 A;  2FC8 A;  1RU2 A;  3V5R A;  5F8N A;  1JLB A;  1REG X;  3DGP A;  3GP9 A;  4DV1 J;  3ZXW A;  4YY3 J;  3O8W A;  2OSR A;  3CC4 S;  3F56 A;  4M5N A;  1RT2 B;  2BQ3 A;  1IBM J;  4F67 A;  3FQK A;  4RNF A;  2IJF A;  2MY8 A;  5AJ3 J;  1SJF A;  1IBL J;  2K06 A;  1JLQ B;  2CJX B;  1PG5 B;  1RLD A;  1R8C A;  2C3Y A;  4FVC A;  4ZCK A;  4A8W A;  5G4D A;  1NRK A;  1Q95 G;  1Y5N B;  1CC7 A;  3M2V B;  2DHX A;  3CTR A;  5A2Q U;  1Z2Z A;  3OPK A;  4GVB B;  2D9O A;  2VV5 A;  3IR6 B;  4EO8 A;  2ZH9 A;  2CNO B;  2H54 B;  4CM0 A;  5I3U A;  1NJZ A;  1RP5 A;  2MKS A;  6FD1 A;  1WC6 A;  3MPW A;  2HWT A;  2D3O R;  2IFX A;  3FCH A;  3PR5 B;  3DLL Q;  2XG8 A;  3AJD A;  2XMM A;  1Q7L B;  3BH6 B;  3H2L A;  4X4U A;  3FMB A;  4ECU A;  4NCA A;  2CQG A;  4UQT A;  3KLE B;  1RAA B;  3PX0 A;  2PI5 A;  1J5O B;  2NS1 B;  4O3R A;  2KHC A;  1DTT B;  3MMB A;  4CNY A;  4I67 A;  2HVE A;  2DNN A;  2QLJ B;  3PIO Q;  4CH1 A;  2VFU A;  2BKO A;  5KFW A;  4Y2M A;  3C14 A;  5K8P A;  3WZ0 A;  1F5C A;  1FF2 A;  3LGN A;  4NYZ A;  2WVF A;  4NML A;  2EKY A;  3G82 B;  4DU7 A;  3SI8 A;  1V9O A;  2GAH C;  3CCJ S;  1RYS A;  2LQ9 A;  3EDR B;  2Y1J A;  1ZH5 A;  4C8Z A;  5KT5 A;  4Q7A A;  5IWA J;  2OTJ S;  4OHX A;  2LQ5 A;  4J9V A;  4OHV A;  3ZZT A;  2F63 A;  3GMG A;  4M95 A;  1RTI A;  3MM6 B;  4NLQ A;  3TA0 A;  1GMW A;  1MN9 A;  4DL0 C;  3AFG A;  3WQP A;  4ZPW R;  2AX1 A;  4FDF A;  4LF2 A;  3U7J A;  3KDN A;  4ETZ A;  1PJ7 A;  3QBC A;  4NLX A;  5IXU A;  2E5L J;  4OHY A;  1VYA A;  5CYQ A;  3PX4 A;  1J2V A;  1RT5 B;  3KJF B;  4KT0 C;  1FRX A;  5D6G A;  4LUB A;  3BGR A;  4B9T A;  3H98 A;  5DG7 A;  5E3P A;  2RU9 A;  4NA2 A;  4KE5 A;  2VBX A;  4KO0 B;  3M2R A;  3VGS A;  1PC4 A;  4PWD A;  3MMA B;  2NXE A;  2LXF A;  3TJA A;  5C25 B;  4F2S A;  2FVC A;  2CXE A;  3FBB A;  2R7T A;  2V34 A;  4CT9 A;  3I4H X;  2DR6 A;  2FJB B;  4NLD A;  3U1L A;  3OVS A;  3MM5 A;  2J6S A;  2KZZ A;  2WBM A;  2KG0 A;  3CCW A;  2GQC A;  3EGV A;  3BB5 A;  1FKP B;  3TQ1 A;  2VOD A;  2BM1 A;  2L48 A;  4NLO A;  3AOC A;  4J7C A;  3ZZY A;  1JJ2 R;  1B3T A;  1AUS L;  5EN1 A;  3IP0 A;  4DF8 A;  1U1N A;  2I5J A;  1N8R T;  4DBQ A;  2V2V A;  3C14 B;  4ZVS B;  4H4M B;  5E2Q A;  4CLL A;  4DPU A;  4C4W A;  2KTQ A;  3SFG A;  5L39 A;  2Z2Z A;  5CD4 H;  2UUT A;  2IDL A;  4I7F B;  4RL1 A;  1Q82 T;  3CUN A;  2DR8 A;  1BLU A;  3FJ2 A;  2HIQ A;  1S7H A;  2YNG B;  3K7R A;  3N5F A;  1UEV A;  3R27 A;  4ZPD A;  3HLU A;  4TU9 A;  1NKE A;  1YK9 A;  4CLK A;  4USI A;  3OTO F;  2MHE A;  2BVZ A;  1RWM B;  2GCF A;  5CH7 B;  3CJK B;  4CO4 A;  4USU A;  4ENO A;  2N82 B;  2DGW A;  4UOH A;  3OHB A;  1YWX A;  2LXU A;  4WP8 A;  2CG4 A;  5H1S V;  8AT1 B;  1AZS B;  3CUL A;  2HHT A;  1RWN B;  1S59 A;  3IR7 B;  3D6M B;  1G3O A;  3BO3 A;  3RJM B;  3KHL A;  1HWJ A;  2QLX A;  2GIF A;  2DHA A;  2F5G A;  3ZC4 A;  2YH1 A;  3PYE A;  1F2H A;  3EPI A;  3DCA A;  2CZ9 A;  1HNW J;  1HWL A;  1CUL A;  2QFI A;  3LWL A;  1G6B A;  3T3F A;  1TL5 A;  2GVZ B;  5D0R A;  5B0E A;  4KH0 B;  2AJ4 A;  1SIZ A;  1N36 J;  3KDO A;  3CVK A;  2R42 A;  5LMU J;  3BH7 B;  4NMX A;  3GLJ A;  4MJK A;  4UQG A;  2IM1 A;  2WOM A;  1EP4 A;  2Y0B B;  3FFI A;  3GYN A;  3QPI A;  4E8U A;  1S6P A;  1KOH A;  2L9D A;  3ENA A;  1HWU A;  2DKO B;  1DAR A;  3MD1 A;  4ED4 A;  1U47 A;  1S1T B;  2VH7 A;  2X3G A;  3KLI B;  3LGM A;  3LP0 B;  3MEG A;  4DCJ B;  1XR6 A;  4X4S A;  4DV7 J;  1TL3 B;  4ALZ A;  1JXL A;  5DGA A;  1HPZ A;  1S1X A;  2B4O A;  2BBE A;  2COL A;  2RRN A;  3EGN A;  3EGW B;  3IBW A;  3A3N B;  5KFD A;  2Y8Y A;  2R8G A;  2VG6 A;  3MMC B;  4USH A;  4ZLP A;  1RT4 A;  1TQL A;  2XLJ A;  4OYO A;  1S1U B;  1XNR J;  1AB8 A;  3NWG A;  3I0S B;  1RWV B;  4HDH A;  4PR6 A;  1F2G A;  2ATC B;  2XI3 A;  1F9F A;  1KP6 A;  1Y0H A;  1HQE B;  2GO8 A;  2Q6B A;  4I7F A;  3RG6 A;  3W66 A;  5IWA F;  4YQW A;  3VAH A;  2GQ2 A;  2EBG A;  3PM9 A;  2O3D A;  1HI1 A;  2I1R A;  2IC3 A;  4XK8 C;  1RA6 A;  3HHL B;  3OTB A;  3T5H A;  4JI0 F;  1PJ6 A;  4K4S A;  1OS5 A;  1CG2 A;  1BQN A;  4OYA A;  1IWA A;  2OFH X;  3D1O A;  5A8W B;  1LV5 A;  2RT3 A;  3PY8 A;  5ETQ A;  1S1V B;  3FDS A;  4LF5 F;  2VIH A;  3KNG A;  2M8H A;  2ZHB A;  4H54 A;  3GU0 A;  2MZS A;  2YQ3 A;  1YG0 A;  2LKZ A;  2RNE A;  3P5T L;  3QT6 A;  1YZ6 A;  4Q0B B;  2VL1 A;  4P2M A;  3MXH P;  1H7W A;  2E1A A;  1CLF A;  3HVW A;  3BO4 A;  4KB7 A;  4V1A k;  3H5S A;  4DR7 J;  2DNY A;  2GMJ A;  2VD3 A;  4L76 A;  2Q6C A;  1K1S A;  3OJU A;  4DLE A;  3B78 A;  3KWM A;  2JEF A;  2GVZ A;  2OSQ A;  4LF5 J;  2HVH A;  2OMO A;  4C11 B;  2C3O A;  5M2P A;  4X4V A;  2RVJ A;  3M6W A;  1UMJ A;  3ZFV A;  4JI3 J;  2HKE A;  2DPI A;  1YJR A;  3G2X A;  3PJW A;  3AXM A;  3F44 A;  4LF4 J;  2AF6 A;  1RTH B;  2B4U A;  4JI7 F;  3KK3 A;  4WFX A;  4X65 J;  1R27 B;  1MRO A;  4OFZ A;  3W5X A;  1S6O A;  5A6P A;  4Q8F A;  1ICE B;  3M7V A;  4QIW D;  2EKN A;  3FZ2 A;  2Z30 B;  3A1Y G;  3JS9 A;  1WC1 A;  2X1A A;  4L6V 3;  4MK7 A;  4PXD A;  2AV5 A;  3ZTP A;  3HD1 A;  5KFZ A;  4KKO B;  4JI5 J;  1TFW A;  3X1L B;  3A8I A;  5KFC A;  4EZ9 A;  2POK A;  3MWB A;  5THW A;  3IN5 A;  3Q22 A;  1IR0 A;  1LQ9 A;  3S1T A;  3OR1 B;  5DM7 Q;  4FVM A;  2DD8 S;  4G65 A;  2J0Q D;  1QVF R;  4A8X A;  1VBX A;  1GTH A;  5CZV A;  2M8D B;  1HQE A;  4IG0 A;  1Q4R A;  2RJZ A;  3NEK A;  1RT3 A;  1X8D A;  2GHW A;  1PCA A;  4OZN A;  4ECQ A;  4M5L A;  2BA9 A;  4KH1 B;  2PMW A;  4MTP A;  3DXS X;  1YIJ S;  1FDA A;  3M8Y A;  2N7C A;  3N6N A;  3KG1 A;  3ETM A;  1QAY A;  3OTD A;  5J1E A;  1N52 B;  3OR2 A;  2E29 A;  4OZ1 A;  2HS0 A;  4WF9 Q;  4EZ6 A;  1I6J A;  1H2U X;  1F0X A;  2VDI A;  2WVC A;  3FRZ A;  3H5U A;  4FXW A;  4U9R A;  2MKH A;  5KFM A;  1S9E A;  3VAJ A;  3Q2S C;  4U7U D;  2NXN A;  1IR1 A;  1FCA A;  3D54 A;  1VQ5 S;  2B7C B;  2CQH A;  5DET A;  4ELT A;  5IS2 A;  4H4K A;  1WHY A;  2A18 A;  1SBR A;  4NAS A;  4B3M F;  2DGS A;  1N33 F;  4CZC A;  2BOA A;  4WKY A;  2DGT A;  4G1P A;  1LOU A;  3B4D A;  4AQY F;  1C0T A;  1RHQ B;  3A12 A;  3D9B A;  3PAC A;  4LRD A;  5A8R A;  3R3T A;  4X4R A;  3GFX A;  4FYY B;  1WTB A;  4ZVP B;  4CLU A;  4JV5 F;  3KXD A;  4DV7 F;  3J7A N;  5BJR A;  4ZN3 A;  1H2T Z;  1WDT A;  1Z4U A;  2ZBP A;  2L3M A;  2R2S A;  3FCW A;  1KLM B;  1JMT A;  1REV A;  1H98 A;  2UVR A;  3G6E S;  4W98 A;  4DR4 F;  3QGH A;  3P45 B;  4ECY A;  2QA1 A;  2IAJ B;  2XTJ P;  3H2V E;  3AHP A;  4KGM A;  3SQG A;  4X66 J;  3NCQ A;  3MAQ A;  4KAI A;  5EUH A;  1PO6 A;  3C15 B;  1I5O B;  2QMU B;  1IKX B;  1U1Q A;  1WNE A;  3AQO A;  4YHH F;  4ILM A;  2C28 A;  4K4U A;  5L1L A;  1HNX J;  4YOE A;  4KIA A;  1IQZ A;  1CVJ A;  4FYV B;  3SCL E;  1E6Y B;  3D66 A;  4JP8 A;  2OEM A;  4K5R A;  4N8N A;  4NLW A;  3Q0A A;  4JI2 J;  1TKZ A;  2OGU A;  4PCQ A;  4ES2 A;  2DHG A;  1TL1 A;  2HAI A;  4R8U A;  3T19 A;  5I4M A;  2E44 A;  1YI2 S;  5L9N A;  2RH3 A;  5F3T A;  5GAG U;  1Q86 T;  4JI4 F;  1IJE B;  1LW2 A;  2F65 A;  2UV8 G;  3A3O B;  1A7G E;  1RT1 A;  4K59 A;  2UUB J;  2V68 A;  5KG2 A;  1RT6 B;  2CJK A;  1UPM B;  2CWX A;  2HAF A;  1CJT B;  1FWP A;  2H3E B;  2QIF A;  1S4F A;  4MAK A;  4M5H A;  4MIB A;  3OXL A;  3GIK A;  1BWE A;  2LU1 A;  2DGO A;  3BO2 A;  4IR9 A;  4ED6 A;  4LFB F;  1FJE B;  2GAG C;  2G2Z A;  2LLZ A;  4OZ2 A;  5F0U A;  4C0B A;  1TKD A;  2E5J A;  5BYR A;  4F50 A;  4F8R A;  4MT1 A;  1N6Q A;  1WEY A;  1NBE B;  2HND A;  4IRC A;  5F8G A;  3E8O A;  2YNF A;  2Q43 A;  2D69 A;  4NPO A;  1MNE A;  2DK2 A;  2K7K A;  4KHP F;  4RNM A;  2CPX A;  1KTQ A;  1X4C A;  2KT5 A;  2FJE B;  3Q8Q B;  3CCV S;  2BAN B;  3DLE B;  4LFB J;  5HAT A;  3MTK A;  2AP6 A;  3FBF A;  2CQC A;  4NZ0 A;  1EKS A;  5HVH A;  5A0Y B;  1UP1 A;  3SSS A;  1T9X A;  2HNY B;  1OYE A;  3LGH A;  2EG1 A;  1FT8 A;  1S9G A;  4K8R A;  3PYG A;  4PXB A;  4YEA A;  5ETN A;  5DRK A;  3M1V A;  1B7F A;  1D8Z A;  3PFO A;  4LRF A;  2AYG A;  5HAO A;  2A2D A;  1RXO B;  2KVI A;  2YH0 A;  3QLH B;  3NGD A;  3KMS A;  3K59 A;  2E9Z A;  1UCN A;  1HR0 F;  1PIE A;  4OYI A;  1S9F A;  1OMS A;  4PUO A;  4NLV A;  2OPQ B;  5DS7 A;  3NCR A;  3OJS A;  2EK1 A;  4J9U E;  1JJC B;  2N3O A;  3T5K A;  2XNR A;  1X5O A;  2Q3P A;  4ZP8 A;  3DXB A;  2J7U A;  1HMV A;  4CLY A;  5D3G B;  2ZH2 A;  3L95 X;  1HQU B;  5IOL A;  2JNJ A;  4ETX A;  1NDK A;  3TZZ A;  1KKH A;  3BKF A;  3KMQ A;  4PKD B;  3CMQ A;  4DPX A;  2ILY A;  4V19 X;  3BDP A;  1RTJ A;  3P3D A;  3DRS A;  1DFD A;  2RUG A;  3L9Z A;  1S6Q B;  2QT7 A;  2CQ2 A;  4YME A;  2U2F A;  2GIQ A;  2CJ9 A;  4ZA1 A;  5KG1 A;  3SCK E;  1WG1 A;  4RW8 B;  4WBF A;  4JV5 J;  3ONQ A;  3KJN B;  1T9T A;  2BXJ A;  4OX9 F;  1IJF B;  1T03 A;  4J9Q A;  4NLT A;  1HYS A;  4QYZ K;  2NYI A;  4Z7Y A;  3CO0 P;  3DGP B;  5B0B A;  4DSK A;  1Q8B A;  2B8Q A;  3KJV A;  2YKN B;  3G6Y A;  2C22 A;  1VQS A;  4B9S A;  1RBO B;  4OI0 A;  3CED A;  1NXI A;  2RHQ B;  1FD2 A;  3L7O A;  5HAN A;  3RZA A;  3AH6 A;  3SYZ A;  1C0U B;  4QPX A;  5J2N A;  1G1X A;  4R5P A;  3PO4 A;  2QMW A;  3CE8 A;  3V6K A;  2VG7 A;  2D3U A;  3MPU B;  5CXT A;  1U48 A;  1S9G B;  3MR6 A;  3KUE A;  1LKZ A;  2IPO B;  2F8M A;  4M63 A;  4O44 A;  1L3S A;  2G1H A;  2CIM A;  3QLH A;  4IOB A;  5I3U B;  4DMZ A;  4CLZ A;  4Z7C A;  3GIL A;  3W63 A;  5M2R A;  1SUQ B;  4B3O B;  4PUO B;  1WJ9 A;  3DRP A;  2UP1 A;  1R6Y A;  5I3P A;  3TVK A;  1IKV B;  1BHN A;  1FRH A;  1GMV A;  1H0H B;  2WB1 D;  2WSE C;  3HI9 A;  2G2Y A;  2HK3 A;  2FLP A;  2UUB F;  3EYZ A;  2ZE2 B;  2B9W A;  1J5E J;  2V2K A;  1ZOT A;  2GHP A;  2RS8 A;  2FLN A;  1DQ9 A;  1H6K X;  2DIU A;  3UVJ B;  3ETO A;  2O1P A;  4HKQ A;  3HVR A;  3DOK B;  1O0P A;  3VZI A;  3DRS B;  2HBR B;  3WIV A;  3AD9 C;  3P8B B;  2CPE A;  3HUL A;  1T9U A;  4MKB A;  1F3F A;  1RAC B;  2BJ7 A;  1CPZ A;  2ZKT A;  1PAE X;  3HSD A;  4X4T A;  1WEX A;  1Y00 A;  3M6U A;  3KLG A;  3BQ1 A;  4DQR A;  2AD9 A;  1FNX H;  1R3N A;  3MR2 A;  2FLL A;  3RYL A;  2VZ9 A;  3LP2 B;  2J0X A;  5CHC B;  2HQ3 A;  4OX7 A;  4DV0 F;  2EFO A;  1VOM A;  2CPH A;  1FJC A;  4OI1 A;  1ELO A;  4DV5 F;  1CJK A;  3IS9 B;  4Y6I A;  2UU9 J;  2QL9 B;  4Y2K A;  1SV5 A;  4DQI A;  1EB0 A;  3PO5 A;  3G6V A;  3MF5 A;  3V6H A;  2XMK A;  3OL9 A;  3ITH A;  2VOO A;  3D28 A;  1XN9 A;  1YQH A;  1MWQ A;  2JLF A;  4G1Q B;  2XM3 A;  3ENV A;  1WKK A;  1SJ1 A;  4F4Y A;  2WVD A;  4DQS A;  4DFM A;  4WE1 B;  4LF9 F;  2BQR A;  1U1M A;  2BV3 A;  4DV0 J;  4HAC B;  4OYM A;  5FDL A;  2IM0 A;  3CCS S;  2FVP A;  1XBW A;  1BQX A;  2YNI B;  4ZOS A;  3JTO A;  5KG0 A;  1J27 A;  2ZVS A;  3M8W A;  4ZS6 A;  1PKU A;  2EK6 A;  3DDK A;  1KQK A;  4RW4 A;  3RU0 A;  3IO1 A;  4NEY A;  3UI3 A;  2R7W A;  1XJW B;  4CO3 A;  1X9S A;  3NKY A;  2DPJ A;  4B02 A;  4XO0 A;  3D67 A;  1L3U A;  3PEJ A;  2KFN A;  1U45 A;  4M5G A;  4DZ6 A;  2DIV A;  3Q8P B;  3RAQ A;  2PSZ A;  3W64 A;  5GAE I;  2JLE A;  3Q8R B;  2WBR A;  3UDL A;  3CJ2 A;  2ZBI A;  4WK1 A;  3R5D A;  1NSA A;  3SDE A;  1LXN A;  2MMY A;  4A8Y A;  2FVR A;  1TVR A;  2HNZ B;  2L08 A;  2XGQ A;  1UTA A;  1NH8 A;  2M52 A;  1SL0 A;  4C8O A;  2EFQ A;  1NJI T;  2OUG A;  1K44 A;  4RW7 A;  6AT1 B;  3RW7 A;  2PEH A;  2B9X A;  5KOX A;  1BD6 A;  2WON B;  3N79 A;  4YB6 A;  2DR7 A;  2AJ0 A;  3MGJ A;  5KFV A;  4USJ C;  1PBU A;  2XS7 A;  3NG8 A;  2GFF A;  4XIU A;  3I96 A;  2MJN A;  4ES3 A;  1N5Y A;  4ZVT B;  1C2P A;  3G71 S;  1HBU A;  1D1U A;  3NAH A;  2W9B B;  1NZ8 A;  1TMJ A;  4RW6 B;  5CYM B;  4XPC A;  1LNQ A;  2ZOF A;  2ZZN A;  3G82 A;  2W8K A;  5HQL A;  1UA1 A;  2E7X A;  3UNG C;  5AJ3 F;  1IBL F;  3RB4 A;  1OWX A;  3UN2 A;  1X4G A;  4EEY A;  2YWH A;  4WXO A;  2RE1 A;  2G2O A;  4DOZ A;  3BQ0 A;  1XQI A;  4BWM A;  3WDO A;  3UO0 A;  4HR2 A;  1QE1 B;  2PDA A;  4UOC A;  4DCO B;  2EW9 A;  3KK1 A;  3OXG A;  3QFH A;  2ZH1 A;  2MKY A;  3D68 A;  1SJ3 P;  1MU2 A;  1IVZ A;  4P52 A;  1VQN S;  1JLA B;  4O4R A;  3G4S S;  1BQM A;  3NOG A;  4I68 A;  1T9W A;  2VFR A;  2BRL A;  2R2T A;  3IWL A;  4HAC A;  1FK9 B;  1R8A A;  1SQE A;  4CWB A;  1KFD A;  4B3R F;  1WOP A;  5C5J A;  1VR6 A;  4LR7 A;  2VON A;  5HL7 Q;  1LWF B;  3O44 A;  4QQB A;  1X0F A;  5HMZ A;  1SJR A;  2HFS A;  4ECZ A;  2AT1 B;  4HDG A;  2QJ3 A;  3HHK A;  4FKX A;  4QU6 A;  1RT7 B;  1TKX B;  4NRU A;  4Y28 C;  5LOQ A;  1XC9 A;  4OX6 A;  1AW0 A;  5K14 A;  2DHS A;  3EVM A;  2W2P P;  1U2F A;  3M8P B;  1YJU A;  3UDE A;  3F73 A;  2Z2Y B;  1VC0 A;  1WF2 A;  5D4N A;  2MZR A;  4B3R J;  2HGN A;  1RAD B;  4G6V B;  5E3C A;  1U4B A;  2W24 A;  4NEZ A;  5JJB A;  5KAK A;  2I38 A;  2LXI A;  4K7Q A;  2WW8 A;  4K2X A;  3NWR A;  4R0J A;  4U8V A;  2P9G A;  1S5Z A;  3MAH A;  4RW7 B;  4ELV A;  2ZHA A;  4NCG A;  4P7T A;  5I42 B;  5BR8 J;  4A8S A;  2CRL A;  1UJ4 A;  3QID A;  1FER A;  4FKY A;  2FJD B;  3ZTS A;  4H4M A;  2H5I B;  3EM1 A;  3HF5 A;  4WFN Q;  2W9B A;  4RUA A;  1SVD A;  1BC6 A;  4E0D A;  3NBP B;  2ZBQ A;  3I4P A;  3OFH A;  3RBZ A;  4DV1 F;  3IG1 A;  2AGO A;  3MED B;  5CZX A;  4FYD A;  1CQN A;  3BJY A;  2ABY A;  4KRW A;  1HHT P;  4DFP A;  3CJ0 A;  5L46 A;  1KRP A;  4IG3 A;  2J9E A;  5JUM A;  1NJY A;  1UL3 A;  2E9R X;  1DUR A;  2HBZ B;  3MM7 A;  5F8H A;  1OY9 A;  4S0M A;  5DQH A;  1YRX A;  1W2B R;  2E7W A;  1M5S A;  3TYT A;  1RHM B;  1FX2 A;  1XR5 A;  2I9S A;  3H0P A;  4ZP7 A;  5KFI A;  5CYJ A;  3RBE A;  1NK5 A;  3NNA A;  3SV3 A;  2ZC4 A;  3DLK A;  1H3D A;  3FSX A;  2OAU A;  3NCP A;  3HVA A;  3DKD A;  2HWH A;  1VRT A;  2CZV C;  5C2G A;  3WC2 A;  3QGI A;  2F8H A;  2R9L A;  2JEG A;  5H9F K;  5L38 A;  1LWX A;  2GS8 A;  4OQJ A;  1AFJ A;  1AA1 B;  1VLO A;  4MH8 A;  5RUB A;  4K4X A;  1ZPV A;  5KFG A;  3V6J A;  4ED0 A;  1DTQ B;  5DO2 A;  2J0W A;  1HBM A;  2QO3 A;  3D5M A;  1KSP A;  2XY5 A;  2RML A;  2J8S A;  2YX1 A;  1I94 F;  5IT4 A;  2WOM B;  4LBI A;  2QLW A;  2PC6 A;  2V4R A;  3T1H J;  3RB3 A;  4QWD A;  2W9C B;  2NRE A;  4ZPC A;  3VGV A;  2MLZ A;  3AD8 C;  1VCT A;  4Y2C A;  4KTQ A;  1UZD A;  1U0H B;  2GGP A;  2XMV A;  3CD5 A;  1RSC A;  4RW9 A;  1NO8 A;  4C8N A;  1IR2 A;  1H72 C;  1T0T V;  4URG A;  5E5N A;  2R4F A;  4P9S A;  1RT4 B;  3DC2 A;  3I0R B;  1S0M A;  3MOZ A;  2VFV A;  3W5Z A;  2FIU A;  2BJE A;  2MY7 A;  1U1O A;  2LP4 A;  3T5J A;  2F1F A;  5HK4 A;  2F7V A;  2HW3 A;  3V6D A;  1SC3 B;  3AJ1 A;  1T95 A;  3DHX A;  1WWH A;  3FC9 A;  4L72 B;  3D6F B;  2NSC A;  2VC0 A;  1Y4Z B;  3CCE S;  2MQO A;  3RTV A;  2JOQ A;  2GMH A;  2U1A A;  3PCO B;  4EYI B;  8ATC B;  4J9L A;  4PXE A;  2DYA A;  4TLR A;  3MAA B;  3RGI A;  5HRO A;  5J1P A;  5DG9 A;  4DV3 J;  4NA3 A;  2GNK A;  2C3U A;  3CDU A;  1KVI A;  2DGU A;  2NPF A;  2KM8 C;  5FII A;  3MM8 B;  2E5H A;  4NRT A;  1ZTW A;  2I5J B;  2FPH X;  2MGZ A;  1UWB B;  2W2M P;  1NM2 A;  2ZWP A;  4IQM A;  1BY9 A;  2H9Z A;  3S6E A;  3RBD A;  1KNZ A;  4QCL A;  2ZBC A;  1SC4 B;  2Z2L A;  2ZIT A;  3EMT A;  3VTI A;  1HFE L;  4FBU A;  3MOJ B;  5LMN F;  1S97 A;  4KYZ A;  3SV4 A;  5U47 A;  4HYK A;  4F3M A;  2B6A A;  2I8E A;  2HHP A;  3EUN A;  2D41 A;  4WU3 A;  3MUM P;  1SH3 A;  3R2D J;  5HBM A;  7AT1 B;  4NI2 B;  3PIP Q;  1X9M A;  1JK9 B;  1RAE B;  3OXF A;  4YN3 B;  1AZS A;  3GFH A;  4IH5 A;  3BGU A;  2DH9 A;  4UUW A;  5KFR A;  3FRY A;  4C3M A;  4ECR A;  1MG7 A;  3R5G A;  2HBQ B;  1U25 A;  4OYZ A;  1Y3K A;  2AIR B;  2A0F B;  3IGV A;  4JI8 F;  1JB0 C;  1KHV A;  2IYG A;  2CA9 A;  3W7B A;  5K8O A;  5LXR A;  2NQP A;  3CMA S;  3L4B C;  4H4K C;  3W65 A;  4DX8 H;  4ZMM A;  4JI7 J;  4JI0 J;  3KK2 A;  1TUW A;  3NNC A;  1CUL B;  3MPD A;  1SJQ A;  4UUX A;  1AUD A;  4PG6 A;  2X1G A;  2V9W A;  4HHH A;  5HMW A;  1TUG B;  3GJT B;  3K0J A;  4NXN J;  1IM6 A;  1XNQ J;  2UXC J;  2GJ2 A;  4WTO B;  3OTC A;  2VQE F;  3W8P A;  3ISZ A;  1FTC A;  3BSN A;  4AXI A;  3A13 A;  3EWG A;  4B3T F;  2IY5 B;  4MMO A;  4MK9 A;  3HSJ A;  5LJ5 Y;  4F3Q A;  2AMC B;  3AQP A;  5HP1 B;  1KS2 A;  4X4N A;  3FBE A;  2M0G B;  3P4U B;  3KLI A;  1R7I A;  4DDF A;  2VC1 A;  2KYX A;  2ZEJ A;  1K8A T;  4CP5 A;  3CCR S;  1B70 B;  4HT7 A;  3MAA A;  4RKU C;  1KQF B;  1MML A;  2Z56 B;  5HRO B;  2XLI A;  3CWJ A;  4M8L A;  1OQ3 A;  5HQ8 A;  1VQK S;  4PG5 A;  2ALY B;  3OR2 B;  2NSB A;  5J2M A;  5ETS A;  4LQ3 A;  2JFK A;  4O0N A;  5BYS A;  3OUY A;  3QT5 A;  4NZ7 A;  2Q66 A;  1CJU A;  4ECW A;  2DGX A;  1R8B A;  1V5I B;  3PRV A;  1DHM A;  3GWC A;  3DNC A;  4OZJ A;  4JYA F;  2V8V A;  5GAD I;  2GV1 A;  1N5T A;  4P71 A;  3W9J A;  2DJW A;  3LO3 A;  4TYB A;  5EGY A;  2EXU A;  5KFK A;  1NB7 A;  4RJV A;  4DPO A;  3DFE A;  3V4I A;  3T9N A;  1AFI A;  4UTG A;  3M8Q B;  1S48 A;  4RUB A;  1S1V A;  1Q1K A;  4N56 A;  2HFZ A;  3DI6 A;  2O5D A;  5IM0 A;  1IQT A;  3QQC D;  1XMQ F;  1WSR A;  1YBT A;  1PIL A;  5E0O A;  1C1C A;  2Z2M A;  1X31 C;  3M1V B;  4NLP A;  3ZZP A;  1OYD A;  3KLV A;  2XS5 A;  1L5U A;  4I2P A;  4DEZ A;  3T9Z A;  3AOB A;  2HHH F;  2F9J A;  2YPZ A;  4LF7 J;  2B9Y A;  2DIT A;  4A8O A;  4LIR A;  4M5I A;  5D4O A;  3SXL A;  3W3S A;  2G0I A;  1IKX A;  2NPI A;  1NKB A;  2OJ3 A;  1HMV B;  1X4B A;  1K1Q A;  2CPJ A;  1R89 A;  1NU4 A;  2W7A A;  5J1N A;  2UXD F;  4IFV B;  1NHK L;  3I82 A;  3PW2 A;  2UUA J;  2VBY A;  5D8H B;  1V3S A;  4MYU A;  5L1J A;  3C19 A;  3R5C A;  2CVI A;  3IRX A;  4DV2 J;  2EC0 A;  4LMZ A;  4BBY A;  2XZW A;  4EMD A;  2ASJ A;  5BXI A;  4DR7 F;  1CS4 B;  1RTD A;  1S0V A;  1RBA A;  2M9K A;  4AQY J;  1JLG A;  1ZAW A;  3ZZR A;  2BR0 A;  4ZIW A;  2V50 A;  4G3I A;  2LDY A;  2JVR A;  1FFG B;  2IJN A;  2QYC A;  3CJ3 A;  3O2I A;  4F4K A;  2VJV A;  1CJT A;  3ULH A;  4B9M A;  1TL4 A;  4KJI A;  2HHS A;  3PG9 A;  4P73 A;  3HM9 A;  4DR3 J;  3P49 B;  2BDP A;  1RCX B;  3LAM A;  5GMD A;  4QWB A;  4ES1 A;  1RCO B;  3BR8 A;  4RR5 A;  3U1N A;  1VI7 A;  4A8K A;  3C8Y A;  2H65 B;  1XEZ A;  4IQX A;  1OPI A;  3KLH B;  1OY8 A;  1EQM A;  2KL8 A;  3ILO A;  4CLS A;  4CYU B;  5G0R A;  2QL5 B;  4ZVE A;  3I56 S;  3PTW A;  1UA0 A;  3GJQ B;  2J6T A;  2CQI A;  3M4X A;  1VHI A;  4WKR A;  4JI2 F;  2OD6 A;  3OSN A;  1XR7 A;  4O4G A;  2O01 C;  1KEK A;  1O8B A;  3Q2T C;  4ZHR B;  4ZVF A;  4DX7 A;  2MKJ A;  3HT3 A;  1ZZF A;  1PBA A;  1Z1Z A;  2MLX A;  1BUX A;  4BWJ A;  3R8Y A;  5KFX A;  4CNZ A;  4YR2 A;  3GPA A;  2EFP A;  3TO8 A;  4NXN F;  4WP3 A;  2FDN A;  1VDH A;  1WG5 A;  2OPR B;  3C16 B;  3BSO A;  4DUY J;  3HP6 A;  2M2B A;  4P2X A;  4I56 A;  2V69 A;  1NSK L;  2GC8 A;  1ARO P;  3HVT B;  4I4B A;  1UJ6 A;  4D3H A;  3J7Y U;  3R97 A;  4ED8 A;  2DEI A;  4ELU A;  1QAJ A;  2V8G A;  2E1C A;  1LW0 B;  3A3P B;  2ZNY A;  4TY9 A;  3SBM A;  3UDC A;  3PYF A;  3QT7 A;  4HH1 A;  1ZPW X;  4ZDN A;  1K73 T;  3PFE A;  5KT6 A;  4JI1 J;  3N4W A;  3OVB A;  3QO9 A;  2CQB A;  2FZG B;  2AEF A;  1VRQ C;  5MAO A;  4ICL A;  4GKJ J;  1K0V A;  2B9E A;  4OI4 A;  3KLG B;  4O0I A;  3H4D A;  4LT6 A;  3K5N A;  4MIW A;  3HSG A;  2NYH A;  4EK2 A;  2CDQ A;  3P5B P;  5EX3 A;  1M1G A;  4M5M A;  2VF3 A;  3BDE A;  1TKZ B;  3HHE A;  4UW2 A;  5KFJ A;  4H4O A;  3PR4 A;  1WKJ A;  2MZQ A;  3HDS A;  3LPE A;  5EDW A;  2YWG A;  2QE5 A;  2QEX S;  2KI2 A;  4EBE A;  3C6T B;  1Q8K A;  1QUV A;  2QSF A;  2W4P A;  2JDJ A;  3ET6 A;  4I6A A;  1HBO B;  2NZ4 A;  1W7W A;  5KFB A;  4KC5 A;  1U24 A;  4NZ6 A;  4ZLN A;  4NWB A;  4ZVH A;  4J37 A;  3B82 A;  2XC9 A;  5HLF A;  4OZ5 A;  2ADC A;  1T05 A;  4FXV A;  2XB2 D;  4QIV A;  2GVD A;  5DDP C;  4ED7 A;  5T14 A;  3RAX A;  2F4V F;  1RAI B;  5F0W A;  1ZZN A;  3PJ9 A;  4C97 A;  2K1R B;  4C6A A;  1M1K T;  1FDN A;  1SI9 A;  2XMT A;  2XI2 A;  1HNV A;  4YP3 A;  5DLG A;  2BRK A;  5B0D A;  2C3M A;  1RWP B;  4O23 A;  1WF1 A;  4IDK A;  4NLS A;  2UUA F;  1FWK A;  1V5V A;  1Q0N A;  3SCI E;  4DV2 F;  1S12 A;  1TL7 B;  2FD2 A;  1TK8 A;  2GW8 A;  4LF8 J;  1WEZ A;  3OTO J;  1TVR B;  2CJA A;  2QN6 B;  1JX4 A;  2OEK A;  2GQQ A;  1N34 F;  5HJY A;  3KOA A;  4DR1 J;  2HHX A;  4PAA A;  2QLF B;  5F3Z A;  2BE9 B;  3ELH A;  2WON A;  4IKA A;  1HD0 A;  1HNX F;  3TZW A;  4A4J A;  4YUD A;  4PYD A;  3VV2 B;  1UEK A;  5E33 A;  4GVB A;  2OH2 A;  5DZ7 A;  3G9C A;  3OV7 A;  4QIE A;  1J5O A;  3NS6 A;  5DZ6 A;  5C24 A;  3Q83 A;  1K9M T;  1JIH A;  2YNG A;  2LA6 A;  3ZO7 A;  2DNK A;  2OPQ A;  4LRA A;  2VPX B;  1S99 A;  3DU5 A;  3ZNU A;  4OJG A;  1U8W A;  1OO0 B;  4JI6 F;  3DYA A;  5ADZ A;  5HO4 A;  3H4B A;  3CME S;  4TKT A;  2XZD B;  2W7P A;  5FD1 A;  1QE1 A;  4WTY A;  5IFM A;  2IMO A;  3LPY A;  2YQ0 A;  2YY3 A;  2C2M B;  3DLB A;  2VKZ G;  4QZV B;  4HI2 A;  3CJ8 A;  4KPC A;  4C98 A;  2B7B B;  3Q86 A;  4TQS A;  1CJK B;  3G86 A;  3IS9 A;  1RGV A;  3RR8 A;  2EEY A;  2LEA A;  2MQ8 A;  4F4X A;  1ZYQ A;  2L9W A;  4NCB A;  1U02 A;  2VG5 B;  1OY6 A;  2R7O A;  4KFB B;  1GMU A;  5D0H A;  2R7X A;  2FY1 A;  3BR9 A;  2UV8 A;  2QA2 A;  3HFV A;  3B4M A;  2ZKU A;  4Y65 A;  1HI0 P;  4EO6 A;  2FB0 A;  2MKK A;  3C66 A;  3E3X A;  1RT5 A;  2JEJ A;  3C2P A;  1WAC A;  4W90 B;  1URR A;  2B5J A;  4DQQ A;  5AXM A;  1TL7 A;  1GK8 A;  4Q44 A;  1QSS A;  1OQ6 A;  2ZC3 A;  3HX9 A;  5CYQ B;  1NME B;  1RK8 A;  1VLY A;  1IXK A;  2RDI A;  4WXW A;  1D09 B;  5J2N B;  5SZT A;  5GAE U;  1F9E B;  5KG5 A;  1VQ8 S;  2X3D A;  3MEC B;  4ZCL A;  3EZU A;  5AXN A;  2ASY A;  2LQJ A;  2XZT B;  1JLB B;  2G13 A;  5E3A A;  4I69 A;  2YNH B;  2W9A A;  5F8J A;  4IR1 A;  1HA1 A;  5IQ6 A;  1Y11 A;  4GO5 X;  2OKQ A;  3POT B;  2IA0 A;  1TP7 A;  2ROE A;  3VQT A;  5KFE A;  4RNN A;  4DLG A;  3DOM B;  1KHW A;  2HVZ A;  2Z0G A;  5FJ4 A;  2ZUG A;  2JC1 A;  3PW0 A;  1SPB P;  2BUN A;  4OJ3 A;  4R0E A;  5C24 B;  3JSB A;  1SUQ A;  3R2C J;  2VPW B;  3I5B A;  1XER A;  4YDD B;  4TXS A;  1IKV A;  3JB9 k;  4CO0 A;  4LSL B;  4QOT A;  5ETM A;  5GAH U;  4Q5V A;  2UUW A;  2CAD A;  2JLG A;  1Q5Y A;  1S10 A;  2AEM A;  3Q24 A;  3BGF A;  5IC4 B;  3N5B A;  3MD3 A;  1JLE B;  2AKW B;  3KLE A;  1VQ4 S;  2NZC A;  1VIX A;  3HFK A;  1L3K A;  2VG5 A;  3NP5 A;  4KFB A;  2B3T B;  3PZP A;  2XCA A;  1FJG F;  1NSQ A;  1SL1 A;  1MU2 B;  1X5P A;  3ENW A;  1U6F A;  1X4D A;  3QZ7 A;  2HSE B;  3AOD A;  4F4A A;  3CGI A;  3IXQ A;  1QY7 A;  1SKW A;  4C7Q A;  4ZK7 M;  3NGR A;  2EFV A;  2WZ1 A;  1S6U A;  3K8W A;  2K2P A;  1NK8 A;  1D9A A;  3FK4 A;  1UJ5 A;  1W26 A;  3FSY A;  4PG7 A;  3CDW A;  2DNZ A;  4V19 J;  1EJ7 L;  1NCL A;  1SC1 B;  3UCG A;  3QIP B;  4WP9 A;  1HL6 A;  3RW6 A;  4DX5 A;  1X5S A;  3TEG A;  2IBO A;  2EPI A;  5D15 A;  1LWC B;  1U0H A;  2GGP B;  3FFI B;  1XTZ A;  2WAQ D;  5ETV A;  5DJB A;  2XO6 A;  1HNZ F;  3HJF A;  1F1B B;  3LP1 A;  5A2Q Y;  4ZVO B;  2FHJ D;  4DJB A;  5K8N A;  3W62 A;  2L41 A;  3AOA A;  3DRX A;  4KBI A;  5C42 B;  2AU0 A;  1TL3 A;  2XSF A;  4ID8 A;  2E5L F;  2UXB F;  5HSP A;  1HWI A;  1PYT A;  1QSL A;  1TMM A;  3V2U C;  2FGC A;  4DS5 A;  4O3P A;  2Y0S D;  1ZA2 B;  1GH8 A;  2AJ1 A;  2MDA A;  4CI0 B;  2HS4 A;  4DPT A;  4DS4 A;  3I0S A;  1NK6 A;  3CJS A;  4QWE A;  4FS1 A;  1NH7 A;  4GC7 A;  3L7P A;  3VAM A;  1S0O A;  3IG1 B;  1CJV A;  2N3L A;  1FFS B;  3LW5 C;  2HHW A;  4E98 A;  5EWE A;  1FD8 A;  2E7V A;  3SEO A;  4FZV A;  2HFV A;  3NS7 B;  3CF5 Q;  1LWE A;  3LAL A;  4Y3C A;  4O3S A;  2Y8W A;  2CJQ A;  3UQS A;  2V8P A;  1MWY A;  3H40 A;  1PYS B;  1RWK B;  1VQP S;  2B6A B;  4I6W A;  2HRT A;  3JSY A;  5IT0 A;  1KVJ A;  4DV5 J;  2MTL A;  2XEX A;  1QTM A;  3RRH A;  1KFS A;  3RR7 A;  5F9L A;  5A8R B;  2E1R A;  2YXL A;  4MFB B;  4A8M P;  1TAU A;  3W2V A;  1EKR A;  2VBZ A;  4FS2 A;  2C2R A;  1NEE A;  2K3I A;  2LYV A;  3OQ2 A;  2QA4 S;  4NXM J;  1VS3 A;  4X64 F;  3PKY A;  3J7A 1;  1VC5 A;  2W25 A;  3FEX B;  5AXL A;  4OYB A;  3T1Y J;  3IRW P;  4EWT A;  3FUY A;  3DLH A;  4J9N A;  1D8Y A;  3CCZ A;  1VRU A;  3IAM 9;  1MRO B;  4RUH A;  4AFF A;  2WTF A;  4XDD A;  1FKO A;  1IUJ A;  2BJD A;  2JX2 A;  1FNO A;  4EUV A;  4NXM F;  3PKM A;  2W4C A;  3VGU A;  1S77 D;  2HBY B;  2H48 B;  3TJ8 A;  4X64 J;  1SQF A;  3NOC A;  1N0U A;  1HNI A;  4WYL A;  3E01 A;  4OMF G;  4TNO A;  4XDC A;  5KFQ A;  4NYO A;  3T1H F;  3M32 B;  4X4P A;  3UW1 A;  4IRD A;  4C8Y A;  4ZPT R;  2G1D A;  4W4M A;  2XBP A;  3K17 A;  4LRC A;  4UOG A;  3M8R A;  1TKX A;  2BE2 A;  1HWK A;  3DOL B;  1MMD A;  1ZM4 A;  1GTE A;  4JB8 B;  1N36 F;  2DNG A;  3L7U A;  2FHK A;  5K5M A;  1VIS A;  3IWN C;  2KT3 A;  1WC3 A;  3QGP A;  5B7W A;  4C8K A;  1GNK A;  1SXL A;  2OPS A;  3IGN A;  4KQZ A;  3BM7 A;  4OI6 A;  2HYI B;  3JTP A;  4A8Q A;  1LWE B;  1O5J A;  4LRE A;  5AXK A;  2BMB A;  1ZAV A;  4P2F A;  2ZBR A;  4NCG B;  1QD1 A;  1X4H A;  2GML A;  2PA3 A;  4GMK A;  4ZKA A;  1FVQ A;  5ITH A;  5F8L A;  2KFY A;  4J9K A;  2V0N A;  1TKT A;  1SH2 A;  1FHT A;  1U6B A;  2ZM6 F;  4DX6 A;  3IC1 A;  4MKY A;  3HCX A;  1JKH A;  1RHJ B;  5DDR C;  1N6Q B;  4KGX B;  1WTF A;  5E41 A;  1OSC A;  1RLC L;  1NUE A;  2XO7 A;  2A3J A;  4ZIV A;  1NK7 A;  5CA5 A;  4PXC A;  1BQN B;  2RRA A;  1IBK J;  4P7V A;  3TAQ A;  1HHQ A;  5GAG I;  5GVQ A;  5KFO A;  2CZ4 A;  2M88 A;  2XS2 A;  5BR8 F;  1TK0 A;  2UVU A;  4BS2 A;  3BPS P;  2NXJ A;  4IO9 Q;  4EU0 A;  4PQU A;  2JZ5 A;  4IH6 A;  3GJR B;  3QRP A;  1GX5 A;  4PPZ A;  3OLB A;  1C0T B;  3MFH A;  3THP A;  1KVK A;  2LQ8 A;  2YX7 A;  2LQB A;  3LAN A;  1FRM A;  4GO7 X;  2ZD1 B;  2EWH A;  3DM2 A;  3E01 B;  1RWU A;  3OFG A;  2MQP A;  1H74 A;  4DV3 F;  1U1L A;  3R6L B;  3DMJ A;  3CDA A;  1GMW D;  3J81 U;  1P27 B;  1BGX T;  2PT0 A;  1UPP A;  4ZN1 A;  4WFA Q;  2OML A;  4CRJ A;  4BHQ A;  5LL6 d;  5KOW A;  1RTD B;  2CYY A;  1E6Y A;  3K5P A;  1LK7 A;  4CLF A;  4JI3 F;  1WD6 A;  1BWV A;  3THV A;  1JQG A;  3C15 A;  3F41 A;  3IFE A;  2CUY A;  1NHV A;  2APO A;  3N6L A;  1RTJ B;  3DLG A;  1QTN B;  1GQE A;  3SIP B;  4N77 A;  1UAW A;  3IBF B;  5K8M A;  3GON A;  1NK4 A;  3VCD A;  2GO9 A;  3RB0 A;  1YTY A;  1IWG A;  1B4S A;  1TL1 B;  3LA0 A;  5KG4 A;  4R8U B;  4P10 A;  4C0H A;  1TKT B;  5KT2 A;  3G8S A;  4NX9 A;  3ZNJ 1;  1VQO S;  5JXS A;  2MKI A;  2BJ9 A;  3KLH A;  2BQU A;  4TQR A;  3BZQ A;  4DSJ A;  3TP2 A;  1JKH B;  2AZ1 A;  4NA1 A;  3V6D B;  1YRT A;  2CG8 A;  2F40 A;  3KHR A;  4JYA J;  1RT6 A;  2DEJ A;  4UT4 A;  1RWX B;  5KTQ A;  2DIS A;  3R6G B;  4C48 A;  1TR0 A;  3NRB A;  4ZHR A;  3ZZZ A;  4YR0 A;  2LEC A;  5J2P A;  2NUU G;  3FCV A;  4QR1 A;  5HQM A;  3OW2 R;  2HQG A;  1PGZ A;  3BN4 A;  4F2R A;  1FE0 A;  2QV6 A;  4DCP B;  1NAQ A;  2VB6 A;  4ATN A;  2IRU A;  4OJH A;  3R9L A;  3MCO A;  1MN7 A;  4FPR A;  1UFK A;  3EXY A;  2DY9 A;  1S9E B;  2KN4 A;  4Q2L A;  1UFW A;  3D1H A;  1UZH A;  3HZG A;  4O44 B;  1XMQ J;  2ZFH A;  4ZLL A;  5A8K B;  3JYT B;  3UPF A;  1NK0 A;  3GIM A;  2DNR A;  2IM3 A;  1WOR A;  1A6L A;  2DB1 A;  3MR7 A;  2DGQ A;  2NUH A;  4KSE B;  2ZDP A;  2H4W B;  4Q2M A;  2BAN A;  3DLE A;  4BLG A;  2HHH J;  4IYQ A;  3K58 A;  2JJ4 D;  2KT2 A;  1P1T A;  1UVN A;  1H73 A;  4BCA A;  3WBZ A;  3MMJ A;  2W8L A;  2QTW A;  4DPW A;  3IM8 A;  4I2Q B;  2DGV A;  3VZH A;  1YJ9 S;  3QGG A;  4TY8 A;  1XWL A;  4NLY A;  3M05 A;  3KK2 B;  3GV7 B;  2XMJ A;  3ZTR A;  3D2W A;  5F8M A;  3JSR A;  2WCX A;  5D3G A;  2IAJ A;  4ZPA A;  1RAG B;  2AWZ A;  2FHM A;  1HIY A;  1FES A;  2L9N A;  4G1I A;  2H5J B;  3E2E A;  3U1M A;  2ZHO A;  8RUC A;  3MPV A;  4UF4 A;  2RKI A;  3ICL A;  4X66 F;  5GME A;  3CC2 S;  4B17 A;  2VU5 A;  5LSL A;  4JI8 J;  1IKY B;  3HFZ B;  3K89 A;  3BEG B;  2MYF A;  4YFU A;  3ZZO A;  4DR3 F;  5HLF B;  3A8E A;  1T05 B;  4MKV A;  2ADB A;  5J2P B;  1BE4 A;  1XMO J;  1RYR A;  1XNR F;  3KG0 A;  2HGL A;  2DH7 A;  5FLX Y;  4JV1 A;  2OPP A;  3D0I E;  1IKW B;  4WIQ A;  3Q8Y A;  3JSM A;  4UST A;  1CC8 A;  1XNQ F;  2KFZ A;  5LMN J;  3BYP A;  1HNV B;  2X1F A;  3PEH A;  4LJM A;  5HMY A;  4QYR A;  3OL8 A;  4WZQ A;  1WC0 A;  4OI3 A;  2VFT A;  2YNI A;  4UOF A;  5KT7 A;  4KV8 A;  2P5V A;  1U8S A;  2CJB A;  3A4T A;  4ZIT A;  3VAF A;  1Q7Y T;  2D9P A;  1Q79 A;  1ZM9 A;  3M2R B;  2QMX A;  4NOH A;  3J81 Y;  3N01 A;  3CJ4 A;  3PYD A;  3PVX A;  1H38 A;  4K4Z A;  1YDL A;  2MB0 B;  4USV A;  4OX8 A;  2XQC A;  1SL2 A;  1VQ9 S;  4EI2 A;  1RAH B;  2AZ3 A;  3I6P A;  3D0G E;  1X9W A;  3GIJ A;  2KRB A;  3GE9 A;  2JVO A;  4LFC J;  2IJR A;  4B9L A;  3GSD A;  2W2N P;  2MZT A;  4QU7 A;  4QJV A;  1N5S A;  4AE5 A;  4M5D A;  2P9C A;  4DQP A;  3DN9 A;  1FEE A;  3U27 A;  4YR3 A;  5A0Y A;  3Q8U A;  4IOA Q;  5IV3 A;  2PI4 A;  2D3Z A;  2FZC B;  2WK4 A;  4GVL A;  1KC8 T;  3DRP B;  3W61 A;  4B3T J;  1OPZ A;  2XMW A;  4O3Q A;  3VF0 B;  2QX0 A;  3MDF A;  2ZZM A;  1U26 A;  2XSJ A;  4DR4 J;  4AYB D;  1T7P A;  3PDN A;  2AJQ A;  1ZM3 A;  3ADA C;  1JXV A;  3CJ5 A;  3VQS A;  4XAK A;  1G7C B;  1HBN B;  3ILI A;  1SB6 A;  4AXJ A;  1N5V A;  4CO2 A;  2B43 A;  2AW0 A;  3NGK A;  3IRX B;  4H4O B;  1F5A A;  3FKB A;  3T6J A;  3VHQ A;  3I5C A;  4DUY F;  2ACM A;  1HQ2 A;  2GJI A;  3GV8 B;  4ERD A;  1OIA A;  4USW A;  1G2E A;  1EQ0 A;  4KHM A;  4LBP A;  5T7L A;  2ROG A;  2CWK A;  2EG2 A;  3LP2 A;  1DTT A;  3EZ5 A;  1HBO A;  4F02 A;  3BGO P;  1QVG R;  1YRU A;  3VAI A;  1JLA A;  4I1T A;  4QPT A;  4B9N A;  3HK2 A;  3OHA A;  4LR8 A;  2HZC A;  1LXJ A;  1FA0 A;  2BKP A;  2FZK B;  3DRR B;  4F3O A;  3CDB A;  2DO0 A;  2KM8 B;  4LFA F;  1KBR A;  5F9N A;  4ED3 A;  3I87 A;  4DSF A;  1JWW A;  4CLT A;  1RDR A;  4USM A;  1Q5V A;  5EX0 A;  4PWD B;  2K1R A;  2E5I A;  2XCP A;  4AUK A;  2LMI A;  2R8J A;  1FXD A;  2MPU A;  3PV8 A;  1H2V Z;  3AJ2 A;  4L74 A;  2B0G A;  4IFY B;  4OLP A;  3IAS 9;  4RU2 A;  4DFJ A;  4DR6 J;  3VVT A;  2DO4 A;  3QRR A;  3HSZ A;  2EFN A;  1RJJ A;  1R8P A;  1S6P B;  2XMU A;  4PWW A;  3FNN A;  2V6A A;  1RUS A;  4YHH J;  3KHG A;  2VIC A;  2FHJ A;  2R7R A;  2VA2 A;  2DTJ A;  4YB5 A;  4DG1 B;  3MMA A;  5KFA A;  2HWI A;  3GQC A;  1KDN A;  2X1B A;  1FRK A;  3MR5 A;  3CD0 A;  4DSI A;  4RW4 B;  4ED1 A;  4FF1 A;  2MEW A;  2AX0 A;  1RTZ A;  2ZOG A;  2IA6 A;  2JHE A;  2KXF A;  4RNO A;  4LSZ B;  4OYX A;  1NSP A;  2CQ0 A;  4R25 A;  1EHW A;  3TZY A;  1RT2 A;  4LSL A;  4LRB A;  1R6V A;  4ZJL A;  1RHU B;  3NGT A;  4NLR A;  4B9U A;  2GIR A;  4AD6 A;  3QJP A;  2KZM A;  2VUG A;  2FVQ A;  4DSE A;  2PA8 D;  2AJ2 A;  2EI5 A;  2IDE A;  4RWX A;  3AXK A;  4B3O A;  1LW0 A;  3J80 U;  4P74 A;  1YJ7 A;  3PW7 A;  4A8F A;  3FBC A;  2A10 A;  4RLE A;  3EVW A;  3HHL A;  5B08 A;  3AAW B;  3G8Q A;  1QLN A;  3OBI A;  3BS9 A;  5CYM A;  1APS A;  3FVY A;  5AT1 B;  3US5 A;  4FBT A;  1WHV A;  4B3S J;  1UFL A;  2VPY B;  2UUC F;  2CNL B;  1ZAX A;  4RBT A;  1N5Y B;  2KVQ E;  2KKH A;  2W4D A;  1PC5 A;  3D3C J;  3D7S B;  4OYP A;  3QRQ A;  3V81 B;  1X60 A;  3H90 A;  2MST A;  4B3S F;  3CCM S;  1S7I A;  2CKW A;  2RUS A;  3DRY A;  1VQM S;  1QSY A;  1HI8 A;  1VRT B;  5L8R C;  3HMJ G;  5DM6 Q;  5EWF A;  1BQM B;  2LDI A;  4JI4 J;  5KFN A;  2H5E A;  4P6Q A;  3GYG A;  4WFY A;  2WW4 A;  3H5X A;  3CJK A;  2VOP A;  3F0N A;  1M0S A;  5J2Q B;  1K0T A;  4KR0 B;  3BQ2 A;  1R0A A;  1UVK A;  1XIQ A;  2RSQ A;  2WVE A;  2HFN A;  4LFC F;  4JI1 F;  3OTE A;  3WX4 A;  4QW9 A;  1G4C A;  3KK3 B;  2R2R A;  1B0V A;  1FFW B;  2GX8 A;  2P6S A;  2WRM A;  3LP1 B;  4KPY A;  1SV5 B;  2A2C A;  4HT5 A;  3NMA A;  4IO1 A;  4OYW A;  2DR9 A;  2HG4 A;  3OT9 A;  5B0G A;  4Q8E A;  2CFX A;  4WPA A;  2KXH A;  1QAX A;  1GX6 A;  1YJV A;  4CLW A;  1O51 A;  4DV4 F;  4FYX B;  4M94 A;  2VJU A;  4ECV A;  4DHV A;  2YNH A;  3Q23 A;  2DRD A;  2RB7 A;  3AT1 B;  3GFY A;  1I3O B;  3MM9 A;  1S1T A;  3L09 A;  3MEG B;  4HTJ A;  4F4Z A;  1C1B B;  1KLN A;  4LF9 J;  3BGR B;  5KT3 A;  2A1B A;  4FN5 A;  4U7C A;  2J9D E;  9ATC B;  1D9F A;  1YBA A;  1ZA1 B;  2BW2 A;  2D7S A;  2YTC A;  2MZJ A;  4CIO A;  2Y1L B;  1HPZ B;  1S1X B;  4M5K A;  2J6U A;  3HHN B;  2C2K B;  2BJ1 A;  3UN3 A;  1RAF B;  4OZL A;  1HHS A;  3KUG A;  2J76 E;  3T41 A;  4DL5 A;  2HVI A;  3MM8 A;  1P9Q C;  3LTO A;  1HR0 J;  1JLE A;  5K20 B;  3M9O B;  1QM9 A;  2CPI A;  4F0H A;  2XLK A;  1S79 A;  1CSJ A;  2CPD A;  2RDD A;  2YBV A;  2ZVI A;  2XGP A;  4LF8 F;  5M2U A;  3JXO A;  3KG4 A;  3QWP A;  4LQ9 A;  3H8Y A;  4ECT A;  4B9V A;  4Z37 A;  2R7S A;  3PRD A;  2IC3 B;  1VBZ A;  1ACM B;  1JJ4 A;  3KTQ A;  4DR6 F;  4N8O A;  3LWM A;  4XPE A;  1RE1 B;  1F60 B;  4RW6 A;  1U2C A;  4CT8 A;  1R0A B;  4RWW A;  1RHK B;  5JMN A;  2BKN A;  1B0T A;  2M4M A;  4EGL A;  3D1Q A;  2X7I A;  4CQ1 A;  3N6M A;  3J7Z T;  3HPO A;  4EBD A;  4U95 A;  4ED2 A;  2KO1 A;  2V8H A;  1GXL A;  1R0C B;  3H7H B;  1DLO A;  3KK1 B;  2HQF A;  2KH9 A;  1NZA A;  1HBM B;  2JC0 A;  2HFO A;  5KFS A;  3M9N B;  2D74 B;  4M1K A;  3CT9 A;  4F36 A;  5D4L A;  3OVA A;  4N76 A;  5KFP A;  2AHO B;  2NCK L;  3N0V A;  2ZJR Q;  2ZJQ Q;  1S72 S;  3M32 A;  4N41 A;  1ZTT A;  1FNM A;  2CPF A;  1FK9 A;  1I51 B;  2RIL A;  2CVE A;  1UW9 A;  4DR5 J;  1O6X A;  2NXU A;  1TFY A;  1KN6 A;  1MW7 A;  3MHY A;  3UDV A;  4TU7 A;  2QA4 G;  5KFH A;  1N34 J;  1HW8 A;  1RTH A;  1Y5L B;  2BAC A;  4JV2 A;  1CEZ A;  1ZM2 A;  3EVO A;  1FRL A;  1GEH A;  3GG1 A;  4LVO P;  1N4L A;  5ETL A;  2HZA A;  5CCM A;  2IVF B;  4N7T A;  2YKP A;  3ISN C;  3QAT A;  3SFU A;  4NLG A;  3OR1 A;  2OFG X;  2AGP A;  2QGF B;  5CAA A;  4UY8 5;  3M8P A;  4ZVQ B;  4A48 A;  4ZP9 A;  1UVI A;  4UZB A;  4Y2A A;  4KKO A;  4IG0 B;  1TTH B;  2CQD A;  3R5J B;  2C1E B;  1EIY B;  4W92 B;  3C3L A;  3PHE A;  3POT A;  5IT9 U;  2CAJ A;  1U1P A;  2CQ3 A;  5KG3 A;  4CO1 A;  4QIF A;  2C2E A;  2UVW A;  4MKA A;  1YHQ S;  2MLY A;  2KRR A;  3K2Y A;  1PYO B;  2EFG A;  1HNZ J;  4KGK A;  1J5E F;  1URN A;  2VKR A;  3J7Z 5;  2VQF J;  5ETP A;  2MGZ B;  3DHW C;  4LBH A;  4FYW B;  4IH7 A;  2NR0 A;  2MKC A;  2PFD A;  3ISN D;  4OV1 A;  4WK3 A;  2F3J A;  4Q43 A;  1FI4 A;  2YKM A;  4QIG A;  3QSI A;  5B0C A;  2B51 A;  3CO9 A;  1U49 A;  4KGV B;  4HTI A;  2YKQ A;  2QL7 B;  4C0O C;  2VA3 A;  4YB7 A;  1DLO B;  3MTJ A;  3LOU A;  4UY8 T;  1Q16 B;  4U96 A;  5A8W A;  5LJ3 Y;  3UE2 A;  4DZD A;  2JRS A;  3GYX B;  3NGS A;  1WF0 A;  2YKO A;  1NND A;  3K57 A;  2XYP B;  4DFK A;  3C46 A;  2HNY A;  1SQG A;  5AE3 A;  3KUH A;  1HNW F;  3T1A A;  1FKO B;  3D6H B;  5HBM B;  5GAD U;  3G96 A;  4C3K A;  4EBC A;  3NY0 A;  2RRB A;  2BOP A;  4JBC A;  4C11 A;  4QBU A;  3GR0 A;  2MSS A;  1SIW B;  2V63 A;  1DTQ A;  4TLQ A;  5IC6 B;  2PGC A;  1TV6 A;  2F9D A;  3I9V 9;  1SKS A;  4X4Q A;  4RBU A;  3CSK A;  1W2I A;  1VQ6 S;  2ZWO A;  3KFW X;  3SQG B;  2MXY A;  3MR3 A;  1JLG B;  2ROP A;  1VMB A;  3JTN A;  2D3O 1;  3P6Y C;  4RNH A;  4DL2 A;  2QYG A;  1IN0 A;  3GSI A;  3B6B A;  5B09 A;  3GV5 B;  1V6H A;  2CNN B;  1RKI A;  3D0H E;  3TAM A;  2J0S D;  1S6Q A;  1PSD A;  2HFU A;  5EWG A;  2IIH A;  2AJF E;  2JSX A;  3UR3 C;  4EFA C;  1VC6 A;  1SH0 A;  2P6T A;  3I9Z A;  3PXG a;  3TUZ C;  3EX7 B;  3DDN A;  3MEE A;  4J9M A;  4OX9 J;  3TX0 A;  3I0R A;  1T9Y A;  2FQQ B;  3UFC X;  1UVL A;  1KTV A;  1UW4 A;  1RI7 A;  3M2U A;  5DDO C;  5H9E K;  4CLP A;  1KR4 A;  3CC7 S;  3K5M A;  2DXD A;  2HLU A;  3IMQ J;  1T3N A;  1BMQ B;  2V94 A;  1LEO A;  1CJV B;  3O1L A;  2RU3 A;  4IOC Q;  3OUY B;  1JNZ B;  1QDU B;  3TZX A;  3BGL A;  3KJV B;  4L73 A;  4HI1 A;  3R7S B;  3OFE A;  5CAB A;  5DLF A;  2PFF B;  9RUB A;  1D9D A;  4ER8 A;  4WJB A;  2HND B;  1T02 A;  3TUP A;  2MQM A;  1IBK F;  2ACY A;  4USK A;  5BYQ A;  2VG7 B;  1UWB A;  3UD3 P;  4P75 A;  1W25 A;  2O67 A;  3VAG A;  2CQ4 A;  2J9D A;  5B0A A;  4JUZ A;  1S0N A;  1Y5I B;  4QR0 A;  2XY7 A;  3HVT A;  3UNY A;  4N47 A;  1JLQ A;  3G6X A;  2J9C A;  2HHQ A;  1GT8 A;  2DXE A;  4WII A;  3M2V A;  3LQV A;  2KHD A;  2IBK A;  4DL6 A;  1P6T A;  3GR1 A;  3VWS A;  2ZM6 J;  4GKK J;  2ZZT A;  7FDR A;  1SKR A;  3TI0 A;  4DV6 F;  3R1L A;  3W2W A;  3BBF A;  2BJ8 A;  2ZE2 A;  3QO9 B;  4Y2I A;  4TN2 A;  2EBE A;  3H2U B;  2G9O A;  3TEH B;  2F4V J;  2DHH A;  1A0O B;  2RKI B;  3DOK A;  3TAM B;  2HRY A;  4HHU A;  1RWO B;  3ILJ A;  1CS4 A;  3KLF A;  3R5A A;  3MMB B;  4X4O A;  1FKA F;  5DGB A;  4DR2 J;  4GKK F;  2E66 A;  3EPG A;  4PAB A;  4MK8 A;  1RB0 A;  4FPI A;  2FJW A;  2HUR A;  2PE8 A;  4ECX A;  3VAK A;  2VAS A;  3DOL A;  2IRY A;  2CNK B;  2ZDO A;  1S57 A;  5KFU A;  3UWT A;  3KNA A;  1M5O C;  4K4Y A;  4ZJO A;  2GJF A;  4DUZ J;  3QJL A;  4PZV A;  2RS2 A;  1Y3J A;  1R0B G;  2VDH A;  2ZUA A;  4DWI A;  1MLA A;  2DXF A;  1ULR A;  2V4J B;  3GJS B;  3GZ7 A;  4CYU A;  1KD1 T;  1S1W B;  5FLX U;  4ZCM A;  1DY3 A;  1T03 B;  1RT1 B;  2X51 A;  4A47 A;  5B0F A;  4WU2 A;  3HHL D;  2AGQ A;  1TUV A;  4CH0 S;  4DL3 A;  5FDL B;  4O4G B;  2K3K A;  4RU9 A;  2FC9 A;  1I94 J;  2HQD A;  5AE2 A;  3THT A;  5IZH A;  2FVS A;  3NL0 A;  2KU7 A;  2ZH3 A;  2ZJP Q;  1Q78 A;  2J8A A;  2WVB A;  3CJQ A;  3JYT A;  2LEB A;  4DF4 A;  1U6Z A;  2ASD A;  1ZET A;  1SCJ B;  2CDR B;  2YKN A;  4AT1 B;  3C16 A;  3OL7 A;  4BC9 A;  2VHG A;  4OL8 A;  1NLK L;  2F4F A;  2ATL A;  1VQL S;  5C25 A;  5KFL A;  3CD7 A;  3SDE B;  1N0V C;  2LU2 A;  3W2W B;  1IBM F;  4OV6 A;  5LMU F;  5A6W A;  3S7R A;  3J7Y I;  1U7L A;  5ETO A;  3TA2 A;  1NKC A;  1TAQ A;  4F26 A;  3IBC B;  4TY8 B;  1FKP A;  2QLB B;  2LFV A;  1RIS A;  2ZNZ A;  2XHW A;  1WHW A;  4IRK A;  4CM2 A;  5IQQ A;  3DYA B;  3UVJ A;  2YWE A;  4WFB Q;  2KDO A;  3UD4 P;  2J7K A;  1SC6 A;  4WWS A;  3L3C A;  4TVA B;  5T7L B;  3TAN A;  1NPR A;  3CW2 C;  2CPY A;  4J5O A;  3GII A;  1DRZ A;  4CCH A;  5IV4 A;  2YWW A;  1DZ5 A;  2OEL A;  5HVF A;  1R31 A;  1YJW S;  1WHX A;  1VJW A;  1LK5 A;  1SKU B;  2B8P A;  2EC2 A;  2QRR A;  3HHD A;  1NPK A;  3H42 A;  2FYX A;  1C4A A;  2V4J A;  2XWY A;  1NDP A;  1Q8I A;  3BBC A;  4C8M A;  2M70 A;  2PMZ D;  3JSM B;  1FJG J;  5MLC V;  3CB4 A;  1OJ4 A;  2BM0 A;  3QNW B;  1FWL A;  1FX4 A;  4QWC A;  4OLO A;  4C9D A;  2BE7 D;  3AA8 A;  1JJH A;  2HS3 A;  2W2O P;  4HVZ A;  4FF2 A;  2MZ1 A;  2B5J B;  3QT8 A;  4OZ0 A;  3OL6 A;  4L75 A;  4XTT A;  1T11 A;  1JNR B;  3O6Q A;  3BN7 A;  4ZJQ A;  3K5L A;  3QSY B;  1VIO A;  1Y9O A;  4EYH B;  4DV6 J;  2M3D A;  3EIC A;  4U6P A;  3CNQ P;  1Q53 A;  3KHH A;  2OEJ A;  3TRG A;  3FEZ A;  2Z57 B;  2W2Q P;  4M5J A;  5L1K A;  3CJR A;  4AL6 A;  1Q81 T;  4DSL A;  4OIX A;  3KJQ B;  5GMK a;  2R7U A;  3QMQ A;  3PW5 A;  3EXC X;  1LFP A;  2MHN A;  2RD5 C;  3BRE A;  3O5T B;  4WE1 A;  2C2D A;  1M90 T;  1N32 F;  2KJV A;  1GAO A;  2PD1 A;  2YWK A;  4ECS A;  2E1P A;  1E6V B;  1D3W A;  4PEO A;  3TAR A;  1S49 A;  2NXC A;  4IDK B;  3LP0 A;  4DR2 F;  1RKJ A;  2OP5 A;  2OI2 A;  1KON A;  1VHF A;  4NYP A;  1S76 D;  2RF2 A;  2DRB A;  2CPZ A;  2ZH6 A;  2CJY B;  3W8G A;  3M6V A;  5I42 A; 
#chains in the Genus database with same CATH homology
 3W1Y C;  4NEZ A;  4NXN J;  5A2Q U;  1XNQ J;  2UXC J;  1N32 J;  4DV7 J;  1HNX J;  4HHU A;  4JI1 J;  1J5E J;  2F4V J;  4JI2 J;  4DR2 J;  3R2C J;  4GKJ J;  5BR8 J;  3J80 U;  4B3M J;  1N33 J;  5IT9 U;  1XNR J;  4K0K J;  4JI8 J;  4DUZ J;  2UUB J;  1HNZ J;  2KVQ E;  2VQF J;  3D3C J;  3J7A N;  1XMO J;  5FLX U;  4JI4 J;  4LFA J;  2UU9 J;  4RJV A;  5LMN J;  5IWA J;  3JAM U;  1I94 J;  1IBK J;  4V1A k;  4DR7 J;  4DV0 J;  4LF5 J;  2E5L J;  2UXD J;  4LFB J;  4JI3 J;  4LF4 J;  4LF8 J;  4NEY A;  2UUC J;  4LFC J;  4X65 J;  3T1H J;  4DR1 J;  3J81 U;  4LF9 J;  4JI6 J;  2UUA J;  4JI5 J;  4DV2 J;  4B3T J;  4DR4 J;  4AQY J;  4LF7 J;  1HR0 J;  2UXB J;  4OX9 J;  4DV3 J;  4DR3 J;  5LM7 E;  3IMQ J;  4B3S J;  1FJG J;  4JYA J;  2MQ8 A;  2KL8 A;  4DV5 J;  2MTL A;  4JV5 J;  4KYZ A;  4NXM J;  4DV6 J;  3R2D J;  1XMQ J;  3T1Y J;  1HNW J;  4KHP J;  4DR6 J;  3D3B J;  4LF6 J;  2VQE J;  4PWW A;  4X62 J;  4KY3 A;  4YHH J;  4YY3 J;  4DUY J;  4DV1 J;  4DV4 J;  1N36 J;  4DR5 J;  5LMU J;  4JI7 J;  1IBM J;  2HHH J;  2ZM6 J;  4GKK J;  4JI0 J;  4X64 J;  5AJ3 J;  1IBL J;  1N34 J;  2MEW A;  4B3R J;  3OTO J;  4X66 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...