4DV3Q

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a, bound with streptomycin
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 16
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dv3Q00
3CCMA 2AWNA 1AE2A 3CMAA 1MKHA 4HJ8A 1Q7YC 1AH9A 4OONA 1EUJA 2VZAA 3RLNA 1VQNA 1GO3E 1K9MC 4YY3Q 3I4MH 5E7NA 3ULLA 3RNUA 2IY5B 2LXKA 1PV4A 3GO5A 3BU2A 3PSIA 2PMZE 4PZ8A 4A3FH 3J80c 3CCUA 4X64Q 4QL5A 3ICEA 2UXDL 4JI5Q 5ELOA 2HT1A 2GVAA 3I7FA 3U4VA 1VQLA 5IY0A 3RZDH 4XTCS 5IP7G 4HIDA 1UE7A 1IBLL 3ULJA 2HHHQ 2RF4A 4DV3Q 4POFA 3T1YQ 2IT1A 1Q81C 1UEBA 5IYCG 3DLLA 4BBSH 1WI5A 3H0GH 5JJLA 1X65A 2MO0A 2E5LQ 2EXDA 1JB7A 3K80C 4JI3L 1X3GA 3CC2A 3UDFA 4BBRH 1V1QA 1XMQL 1I6HH 4YCVA 1X56A 4JI8L 1EQRA 5C44H 2OWOA 2B63G 1X55A 2EIFA 1IBKQ 4NXMQ 1EOVA 1SRUA 2E2HH 4B3SQ 1N34L 4UP9A 4HJ9A 3AYHB 1C0AA 5C4XG 2ATWA 1YEZA 4L5SA 5FLXc 1HNWL 2GVBA 2WFWA 3RR5A 4WJ4A 5GAGC 3CW2C 2NVYH 4PZ6A 4GKKQ 1AE3A 4LF9Q 4IOAA 1GVPA 1OXVA 1XPUA 3KOJA 4GN3B 1L2FA 4BY1H 5C0XG 1HNZL 1XNQL 3CCJA 2CWAA 5GAHC 1BVSA 2PI2E 1LTLA 1Z9FA 5FJ8G 1YHAA 2AKWB 2EQSA 3HOYG 1B7YB 5FLMH 3ZJYC 1JJCB 2I5LX 4LF5L 1VQGA 3B6YA 2FXQA 3OTOL 3RN5A 2IHEA 3BZCA 4POGA 4X62Q 1QVGA 1YZ6A 3PV0A 2JEAI 1YHBA 1FL0A 1S3OA 3U50C 1TWGH 3KFUA 1QVCA 3HKSA 1N32Q 1VQAA 4GOPB 4L5TA 4DR3Q 1Y1VG 1IBLQ 4KHPL 1CSQA 1V43A 4KLKA 1GKHA 3L2PA 4IPHA 3PIPA 5M5YH 4BXXH 1E7ZA 3M4QA 2JA5G 1WFQA 4HJAA 1EFWA 3L7ZC 4YCWA 4X66L 3S2DH 3KYHC 3PUYA 1J5EQ 1RIPA 1PH5A 1G291 2Q2TA 4A3MG 1VQ4A 5IT9c 1QZGA 3A5UA 3HOZH 3CF5A 1P8LA 4GKJQ 1E3PA 1E22A 2Q2IA 3PCOB 5HGQA 1N34Q 2I0QA 3PO2G 3S1QH 1LM0A 4C3HH 1OTCA 3JC66 2KENA 3F2BA 3VDYA 2Q2HA 3F8TA 3ULPA 3G6EA 4YY3L 3CXCA 1KIXA 3S2HH 3JAMc 1QVFA 4IO9A 1NMGA 3I2ZA 1YI2A 1OXUA 3T1HQ 1FGUA 1CKMA 4R4OA 2ZTCA 3HOWH 3FKIG 3STBD 4X64L 4P73A 2VUMG 1X3EA 4JI5L 1GM5A 2UU9Q 4DV5Q 4A3BH 1YJ9A 2I5HA 3HOXG 1PFSA 2KCMA 4P72A 4A3EG 1HZCA 2YV5A 1PYSB 2R7DA 4P71A 3OTOQ 4MNOA 2HHHL 4BY7H 5C3EG 4DAYB 2JA6G 3HOUG 1N33Q 1NE3A 4JOIA 4MTNA 4RMFA 5IYDG 1KD1C 3U58A 5ELNA 2XTIA 4DK3C 3SGIA 1ASYA 2WP8J 3NENA 5JJKA 1VQ6A 1WCMH 3RLFA 2VY3A 3CCLA 2AHOB 4IFDI 3TRZA 3BZKA 4L5RC 4PG3A 1I5FA 1N9WA 2K52A 4A3DH 1IBKL 1EYGA 3PUZA 1JE5A 2BH2A 3BJUA 2JE6I 5DLQE 1SE8A 2ID0A 4LFCQ 2GN5A 2ZJQA 3S17H 4JBMA 1VQKA 4LF8L 2R92G 4JI0Q 5EAYA 1ASZA 2AWOA 4QGUA 3GD7A 4LF4Q 2YTYA 3M9BA 5JEAJ 1NJIC 4LF9L 1MIUA 1TWAH 2IX0A 3UE0A 1NBWA 2B3GA 4EQ5A 4DR5L 1A63A 4A3KG 3PF4A 4Y52H 4AYBE 3J80i 1VS0A 4GOPA 2NZOA 1IZ6A 5IP9G 1CKNB 4Y7NH 1JMCA 5C0XI 5IP7H 1Q46A 4TQUS 1HR0Q 4X62L 2N3SA 4YWKA 4O0AA 3D0FA 1EWIA 5GAEC 4JI2L 4JI6Q 5IYCH 2WB1G 1H95A 1X6OA 1N32L 4YHHL 1L1OB 2JQOA 4QIWE 4R4CA 4DR3L 4LF7Q 4IOCA 2R7FA 2HIVA 1YJNA 2KHIA 1KQSA 1OXSC 2ALYB 2VL6A 1EQQA 4IFDG 3J7ZC 4JV5L 2PI2A 3A5ZB 3K7UC 4OXPA 2NZHA 1CKOA 4UP7A 3UE1A 4DUZL 3M7NA 4A75A 2B63H 4J15A 3GTKH 1W2BA 5JJIA 4AYBG 2I5MX 1I3QH 3KJPA 4X65L 5M3FG 1VQPA 1TWHH 1J5EL 4JI7Q 3PO3G 4QY7A 1PHJA 5C4XH 4B3MQ 1U5KA 2K14A 4ALPA 3CP0A 4GKJL 1G51A 2MNAA 3F2DA 3MXNB 4LUVA 1XNRL 3H3VI 1UE6A 4LF8Q 5J3BA 4JG2A 2YYZA 4PZ7A 4DR6L 3J81c 2CFMA 2YTVA 2YTXA 4LFAQ 5K36G 1K8AC 4IJLA 4UPAA 3KF6B 4P74A 4GOPC 5FJ8H 4JBJA 3T1HL 3E9HA 1PA6A 3HOYH 4LF6L 4C3IH 1Y1WG 4DR5Q 5IE8A 1E24A 3AFQA 4B3RQ 2F3IA 1I94Q 4TVAB 4DV5L 1YIJA 2UU9L 2ASBA 1KXLA 2C35B 2UXCQ 1PYBA 1PH9A 4DK6C 2VS1A 4R1JA 1Y1VH 2BH8A 2CKZB 1C9OA 1N33L 2JA8G 2ZTDA 1XMOL 4JI2Q 2ZM6Q 1M90C 4B3TQ 5IYBG 4GN4B 3S14H 4A3GG 4O2DA 4YHHQ 2JA5H 1VQOA 4BA2I 2N78A 4LFBL 1HR0W 4IPGA 1VCIA 3EIVA 2NVTH 1TWCH 2JA7G 2QGQA 4R4TA 4A76A 2JK8A 4FDBA 3CCQA 3RLOA 3J81j 4A3MH 2K75A 4JV5Q 4DUZQ 1PH1A 3H3VH 2WAQE 1HNWQ 2RCNA 1E1TA 4DNIA 4DR7Q 1HNXQ 4LFCL 3PO2H 4X65Q 4A93G 2PNHA 2N8NA 3I55A 4DR1L 4JI0L 1SROA 1CKNA 2K5VA 3PUXA 5M5XH 5AJ3Q 3H15A 3CCSA 5BR8Q 4LF4L 1VQDA 3I4NG 1NY4A 3L0OA 4DV1Q 1XNRQ 2KHJA 2Z6KA 3GDEA 2ZJRA 4HIMA 4R4QA 3JAMi 2VQFQ 4ME3A 4DR4Q 2DUDA 4DR6Q 1OXXK 3CQZH 1S40A 3FKIH 1L1OA 1X54A 2VUMH 1KRSA 2JEBI 2MFIA 4UY8C 3DM3A 1HJPA 2HQLA 2Y0SE 1UE1A 2PQAA 3HOXH 1VQMA 1MJEA 4LF6Q 4A3EH 4DV7L 3FHWA 1HR0L 4DV6Q 4JI4Q 4JBKA 3J7A5 2WAQG 2R93G 5C3EH 3OYYA 3F1ZA 2JA6H 3HOUH 3M85A 5IYDH 3EBEA 4H02A 4DR2Q 4JI6L 1NTGA 2NVQH 1VQFA 1X3FA 3E0EA 5M3MG 4EX5A 4LF7L 3NEMA 2F4VQ 1D8LA 1Y14B 1OXTA 1XPOA 4HIOA 4A4IA 1XMOQ 3HKZE 3I4OA 2R7ZG 2IX1A 5LMUL 4AH6A 4MZ9A 3OW2A 3K7AH 1SR3A 4LFBQ 4GLXA 1BKBA 3K81C 4A3JG 4JI7L 4HJ5A 5LMNQ 2LSSA 3S15H 2UUCL 3KF6A 1T9HA 2IHFA 4B3ML 2R92H 2DGYA 2Y0SG 2QA4A 3HOVG 1VQJA 3TEHB 3F2CA 3CD6A 1N8RC 2Q2UA 2K5HA 4QQBX 3GTLH 1YNXA 4JYAL 1E1OA 2MQHA 1G6PA 4YCUA 1V9PA 5JEAG 2Z6KC 1KC8C 4DR1Q 4OO1G 3EN2A 1TWFH 2BA0A 4A3KH 5C4JH 3A0JA 4LFAL 4PMWA 1PVOA 1A0IA 1BBWA 1B8AA 1L1OC 4A3IG 1JT8A 1QZHA 2F52A 1VQIA 1Q86C 5IP9H 4IPDA 2KCTA 4DV0L 5HY6A 1JJGA 2VQEL 4C3JH 3CMEA 1N36L 2OCEA 4B3RL 1HZBA 1I94L 1KHIA 2UUAQ 3CPWA 3CAMA 3M4OH 4A3CG 2UXCL 2ZJPA 4P75A 1UWVA 1YITA 2D0OA 1SMXA 4DV7Q 1CSPA 1HZAA 4JCVE 4NXNL 1Z47A 1MJCA 3K8AA 2N49A 4JOIC 2ZM6L 3AQQA 4B3TL 3IRBA 3CCEA 2CWPA 1QUQB 1VQ7A 4RG1A 1L0WA 4DV4Q 1TXYA 2B29A 3TS0A 4HIKA 3E9IA 2OTLA 2PQAB 2K50A 5M3FH 3PO3H 3HFZB 3NELA 4OX9Q 4QJFA 1WOCA 5LMUQ 2OTJA 4GNXB 4DR7L 1IBML 1HNXL 4GLVB 2K4KA 3NBHB 2UUCQ 1LYLA 3CPFA 3I4MG 5AJ3L 1C7YA 2BA1A 1CUKA 1W3SA 5BR8L 1VQCA 1VQ9A 2UUBQ 3AEVA 2A1AA 1DGSA 3I56A 1FJGQ 3J81i 1WJJA 4DV1L 4A3FG 3ER0A 4JYAQ 4DAMA 1Q12A 2E2JH 2CCZA 5LMNW 2VQFL 4AQYQ 2NVXH 4DR4L 3TQYA 1Y1WH 3FP9A 1YBYA 4YWMA 3CC7A 3KLWA 2LXJA 3KDFB 4APVA 4KI0A 1XJVA 3MEFA 1VQBA 4DV0Q 2UXBQ 1Q1BA 3GTGH 3GTPH 4IFDJ 2VQEQ 4DV6L 4JI4L 4BBSG 1KAWA 1U0LA 3S24A 1N36Q 3U4ZA 3H0GG 1IXRA 4YWLA 1RL2A 3G4SA 2OQ0A 2JA8H 3S1NH 4DR2L 4R4IA 2NN6I 5IWAL 5IYBH 4A3GH 2K5NA 2MO1A 4JI1L 4BBRG 4DV2Q 2F4VL 1BBUA 5C44G 4NXNQ 4K0KQ 2H5XA 1SLJA 4JC0A 2JA7H 3W1BA 3PGZA 3GTMH 2RHQB 5GQOA 4DUYL 4KHZA 2HIXA 1KRTA 4XIGS 4X6AH 4LUZA 3LGJA 5LMNL 4A93H 1I50H 2JJQA 5GADC 4GLAC 1K83H 1YHQA 1PH6A 1VQ5A 2A19A 4DKAC 2ZTEA 1IBMQ 1VQHA 3GTOH 1WYDA 3RZOH 3I4NH 1J6QA 5C0XJ 1K8GA 4BY1G 3S1MH 5M5WH 1K3RA 1P16A 2UXDQ 1IYJB 3GTJH 1B70B 2JA9A 5FLMG 1R9TH 4OO1I 4BA1I 1PH8A 1K73C 1HH2P 3S1RH 1A8VA 1PH3A 1IL2A 1NMFA 1QUQA 3G48A 4OWWB 3PF5A 2E8GA 3PUWA 2A8VA 2OQKA 1YVCA 2YU9H 3CC4A 4LNQA 3PIOA 2UUAL 2R93H 1PH4A 4GS3A 5M3MH 4AIMA 2NN6G 3STBC 4JI3Q 2VW9A 4BXXG 1XMQQ 2KBNA 5GROA 4JI8Q 4GNXA 2VNUD 4DV4L 3G71A 5IWAQ 3PUVA 4JI1Q 2R7ZH 4LUOA 1VQEA 4C2MH 1XTDA 1JJ2A 3HOZG 1Q1EA 4A3JH 4A3LH 1HZ9A 3AFPA 3W1GA 1XPRA 3GTQH 3M3YH 4OX9L 3TS2A 3KJOA 3HOVH 4DUYQ 1KL9A 5H1SE 2Z0SA 3CCRA 3ERSX 3UDXA 4LW1A 4A3LG 3KDFA 4NPSA 1PH7A 4OWXB 2RHSB 3D31A 3Q8DA 1HNZQ 1XNQQ 1X9NA 2UUBL 1K0RA 1S72A 2D0PA 1FJGL 4JBWA 1SN8A 2E2IH 4WJ3M 4A3IH 3S16H 3HOWG 4LF5Q 4AQYL 3UDIA 2V1CC 2QEXA 4OWTB 4DPGA 2R6GA 4DV3L 4A3BG 3T1YL 4HJ7A 1O7IA 3M4PA 2AMCB 1GD7A 3RN2A 4LWCA 1FVIA 2E5LL 4BY7G 2UXBL 4A3CH 4NB3A 4KHPQ 3HKZG 2L15A 3WWVA 3CCVA 1VQ8A 4GNXC 3A74A 2D62A 1YJWA 4NXML 4L5QA 1Q82C 1WCMG 4DV2L 4X66Q 3W5OA 3K0XA 1PH2A 1A62A 1EIFA 1M1KC 4B3SL 2WB1E 2ES2A 4IPCA 1SFOH 4IJHA 1EIYB 4K0KL 1Q8KA 3TREA 4GN5A 4A3DG 3UDGA 3KF8B 1LUZA 2XGTA 1D7QA 4UP8A 2CQOA 4GKKL 1UE5A
chains in the Genus database with same CATH superfamily
4CJ1B 4A3DB 1WTOA 2F0GA 2QW7A 3I73A 5A35A 3RLNA 5E7NA 3RNUA 4K8IA 4DNTB 2PMZE 1RTOA 1H9MA 4A3FH 4L63B 4QL5A 2SOBA 3ICEA 2XRQD 2UXDL 3W2DA 2X6GA 1IL8A 1JQYD 3T1YQ 2RA4A 2WB1B 1WI5A 1UNSA 1CTMA 2KA7A 1JB7A 3K80C 2JYOA 2B2TC 1V1QA 1I6HH 3HGBA 1G6ZA 2EY6A 1RKNA 3T51B 1N34L 3AYHB 4JW0A 2WFWA 1VDZA 1YNNC 4IOAA 1OXVA 3O13A 3TZDA 4QIWB 5G3LD 4EQNA 1HNZL 4K5VA 1SNCA 3CCJA 1FNUA 5GAHC 5FJ8G 2PI2E 2NVXB 4O1NA 3ZJYC 1VQGA 5EPKA 1CA6A 4X62Q 1QVGA 4KV6A 3PV0A 1YHBA 4C3IB 1FL0A 3GTGB 1TWGH 1QVCA 1VQAA 4L5TA 1Y1VG 1GKHA 3L2PA 5M5YH 3QG1A 2AUKA 3MXGA 3S2DH 3CHBD 2JA5B 3HOZH 3A5UA 1EYDA 5HGQA 3PCOB 5T1IA 3S1QH 1GHKA 2KOLA 1I50B 1LM0A 2GA4B 2NZ1D 3JC66 4ME5A 3CKIB 2MP1A 1LACA 1STGA 3VDYA 2Q2HA 1F9PA 3I4NB 1KIXA 4IO9A 1NMGA 1OXUA 3T1HQ 1D5XC 1HQRD 4P2CB 1WTWA 3G7LA 2VUMG 4H44C 4DAPA 3OW7A 1CZGA 4JI5L 2UU9Q 1EY4A 1TS2A 4KN7C 2I5HA 4OIKA 3QOLA 2KCMA 4KY5A 2EYPA 1MHWC 2R7DA 3OTOQ 2WAQB 3J7YW 1NE3A 4RMFA 3HOXB 2V4DA 4UAIA 3U58A 1JORA 1TS5A 2B2VA 1ASYA 2WP8J 1NUCA 5JJKA 1PXUA 1WCMH 5KYIA 4IFDI 1EZ6A 4PG3A 1N9WA 4A3DH 1IBKL 1EYGA 5DLQE 1SE8A 2ID0A 4IUVA 4LFCQ 1EYAA 4LAAA 3HOVB 3NP8A 1ASZA 4KKSA 5CV7A 3M9BA 4LF9L 2R92B 3P75A 2DJFC 4DR5L 1SYDA 2EDGA 1KNEA 1D1IA 1O7ZA 4AYBE 4A3IB 1CKNB 3AB9A 4XYQA 1HPCA 3SDZA 1ENFA 3VYTA 4RHRA 2CW0D 3TMEA 2WB1G 2PW5A 1H95A 1X6OA 4YHHL 4R4CA 3VR5A 2I46A 1YJNA 2KHIA 1KQSA 1GHJA 1OXSC 3DM1A 3E5SA 2H1EA 3UE1A 1SJED 1TS4A 3M7NA 2B63H 1SFOB 4G7ZC 4X65L 3PO3G 2L1BA 3OIQA 1GOZA 4QY7A 5F2DA 1MBYA 4FP5D 2K14A 1F9QA 4YIJA 1G51A 1NR4A 2MNAA 3I72A 4KMUC 2XN9C 1EIGA 2F0MA 2B2YA 5JPMC 2F3WA 2YYZA 5C0XH 1WD1A 1K8AC 4IJLA 4GOPC 3KF6B 4DAYA 4DN4M 3K59A 1ET6A 1O78A 2Z8LA 4C3IH 2MGSA 3T53B 2B8FA 5I6YA 5IE8A 4B3RQ 4DV5L 2EYMA 1Y1WB 1PYBA 1HCZA 5G3LF 4FXGC 2CKZB 1M90C 3T4AC 5IYBG 4NDXA 4O2DA 2JA5H 3RUZA 1YNND 1VQOA 2A68C 1PYWD 4IPGA 1VCIA 3EIVA 3T16A 3RLOA 1PH1A 3NUCA 1F2MA 1RTNA 3T56B 4PQXA 1Y8NB 3GTMB 2B2WC 2N8NA 4JI0L 5EGTA 5IGCA 5BR8Q 4MN3A 3I4NG 1NY4A 4HMIA 4HIMA 3Q6SA 1K83B 3SHLA 4ME3A 4DR4Q 5KYLA 1X54A 3R3OA 4G57A 1KRSA 3V96A 3SK6A 1HJPA 2HQLA 2PQAA 3HOXH 3A8JE 4LF6Q 2AQ3B 4DV7L 2WAQG 3F1ZA 3NXWA 4H02A 3E0EA 3K5OA 3NBHA 4CJ2C 4LF7L 2F4VQ 1LO5D 1Y14B 5IGBA 1XPOA 3NTKA 4A4IA 4UDUC 1BUVT 3HKZE 3H6MA 3MC0B 3C1FA 1B53A 4B9XA 4AH6A 1AZQA 5JPNC 4GLXA 3MZ5A 4HJ5A 2UUCL 2R92H 3HOVG 1PFMA 4KJNA 4C3HB 2EVBA 1LV9A 1N8RC 1YNXA 4EQOA 1E1OA 4YCUA 1ESRA 3BYTB 1KC8C 1FYCA 3EN2A 1TWFH 3ZYYX 3OSOA 3A0JA 3BVZA 1TU2B 1BBWA 4A3IG 1B8AA 1JT8A 1VQIA 1LT5D 1SMYC 2HD3A 5IP9H 2KCTA 4DV0L 5HY6A 1RCVD 3ITPA 4N9PA 1HZBA 1I94L 2F0QA 4ZYSA 3CAMA 3HKZB 4P75A 1UWVA 2D0OA 1SMXA 1HZAA 4JCVE 1QJOA 1MJCA 3DUZA 1QUQB 1BF4A 1L0WA 4FXKC 1HTLD 3TS0A 4HIKA 2PQAB 2F0TA 5FOBB 2MUYA 3D4WA 1IBML 1KTKA 3NBHB 2L0CA 1S5DD 2X6LA 5CORA 2BA1A 4RH6A 3VR4A 1C7YA 2F03A 1F77A 3FEWX 2A1AA 3I56A 1QE6A 1FJGQ 5EJWA 1Q12A 1SYEA 4CKEA 5LMNW 4R8NA 3I4MB 1Y1WH 3FP9A 1YBYA 3CC7A 3KLWA 4PMBA 1LT6D 1EY6A 1GUGA 2RDGA 2I07B 1LTGD 1MSGA 1VQBA 2UXBQ 4JI4L 3S24A 1U0LA 3G4SA 2OQ0A 1A3UA 3S1NH 4DR2L 2PCFB 4A3GH 5C44G 1DCZA 5HURA 4NXNQ 1SJHD 1XWEA 2JA7H 3GTMH 2RHQB 1PFBA 3A54A 4J6HA 1TWHB 4KHZA 3QB3A 3LGJA 4IURA 4A93H 1RD9D 4JVZA 1K83H 1PH6A 4DKAC 1WVLA 1K8GA 4BY1G 3OWFA 5M5WH 1P16A 4FF2A 1DD2A 2UXDQ 3GTJH 3HOYB 2VB3X 1AFPA 2JA9A 4B9WA 1HA6A 1GJXA 2A68D 1NMFA 3G48A 4OWWB 1E2ZA 2OQKA 3PIOA 2UUAL 1XXGA 5M3MH 3STBC 1I4QA 1LTRD 2ICIA 2K7VA 1K3BC 4DXGA 4DV4L 5IWAQ 4LUOA 2PZWA 1XTDA 4A3MB 1Q1EA 1ESFA 2KEDA 4A3LH 4RAUC 1XPRA 3GTQH 3KJOA 5E3FA 1D1KA 4C3HG 4GZYC 5H1SE 2Z0SA 2L9HA 1V1PA 2BDOA 2K28A 4A3LG 3KDFA 4NPSA 3NSWA 2RHSB 3U9OA 1HNZQ 2UUBL 1S72A 1KDBA 3S16H 2QF7A 4L6TB 2HDLA 3UDIA 2V1CC 2QEXA 4DF7A 1HRJA 4DV3L 3OWEB 4DXFA 2KCNA 2X69A 4A3EB 3RN2A 4LWCA 2EYOA 5C3EB 4A3CH 3HKZG 5FLXE 1DZ1A 1VQ8A 4GNXC 2D62A 4DV2L 3W5OA 1A62A 2ES2A 4IPCA 1EIYB 4IJHA 2VXWA 1LUZA 3V05A 1O7LA 1UE5A 3CMAA 1SMYD 4HJ8A 4KKTA 1AH9A 3HG9A 4KKUA 3I4MH 1GO3E 1HQMC 1ML0D 2G5DA 4L8JA 2K5WA 1PV4A 3BU2A 1WD0A 4K14A 3MVVA 2R61A 3IFTA 4CKCA 2IJ0A 4J1MA 4JI5Q 4NP5A 3RZDH 4IQZA 4HIDA 1UE7A 1IBLL 5IT9E 3QJYA 3ULJA 4KJOA 3KBXA 4TKOB 1Q81C 1UEBA 3DLLA 3H0GH 5JJLA 3I91A 5EPJA 2MO0A 4ZLTF 3DHQA 2E5LQ 3D8GA 2EXDA 3R2TA 3CC2A 3FRPB 1BO0A 1X56A 2RQXA 5FK9C 3R8BA 1IBKQ 1PTOH 1H9SA 1VMPA 2QILA 1EOVA 1SRUA 2E2HH 1H9JA 1I4XA 1C0AA 2F1MA 2L4NA 2WKDA 2XIWA 4DNRB 5C4ZA 4WJ4A 1QILA 1B3AA 3CW2C 4NKLA 2K5DA 1AE3A 4LF9Q 1KDAA 1GVPA 1XPUA 4QUCA 1ZEQX 5IIFA 3VA5A 2E2JB 4H7BA 1LTLA 3OOCA 3HOYG 2EQSA 3VR6A 1B7YB 1EEFD 1QWYA 1JJCB 1IKLA 4FNFA 3B6YA 2FXQA 5A2QE 3BZCA 4POGA 3OIPA 1K0SA 1YZ6A 1LT3D 4ABNA 3U50C 2KQ3A 2XRSD 3HKSA 3KFUA 1C48A 1W6JA 3KF8A 1V43A 4FO2A 4KLKA 4KY7A 2JA8B 4IPHA 1E7ZA 1WFQA 3JAML 1MD2D 3ND8A 4X66L 4J8QA 1G291 4A3MG 5CGKA 1VQ4A 1U4PA 1Y8PB 3CF5A 2D2CC 1A6XA 2Q2IA 2J7ZA 2I0QA 3PO2G 2FINB 3C46A 1ZKOA 2B2UA 3LWEA 1Z6HA 1HFNA 3GTOB 3F8TA 2F0FA 4YY3L 1IYVA 3JAMc 4LMQD 1H9SB 2ZTCA 3HOWH 3STBD 4X64L 2PQEA 4EGVA 4DV5Q 1YJ9A 1EY0A 4A3EG 1HZCA 2HCCA 2R93B 2BOSA 4MNOA 2HHHL 4BY7H 5C3EG 3VYSA 1SAPA 2K04A 2NUCA 4JOIA 2NWGA 1KD1C 1WTRA 3H94A 3KLRA 4EVOA 3MHBA 1KNAA 1PFNA 5JJZA 3BZKA 1T5EA 1ENCA 3PUZA 1TY0A 2XNAC 4A3JB 2JE6I 2A69C 2FHTA 1VQKA 4LF8L 5JAVA 4JI0Q 5EAYA 1I4RA 2YTYA 4K5WA 1M8AA 2IX0A 1A3TA 4RKLA 4CHTB 2K03A 4EQ5A 4RGOS 1I4PA 3PF4A 3C3LA 3PQIA 1EU4A 1VS0A 2HQEA 5FKAC 5C4JB 1ICFB 3TBIB 1STAA 1TY2A 1STYA 4CGYB 1EWIA 1PRTC 2AQ2B 3WDNA 5IGFA 3DWAA 3QIAA 2M9VA 1L1OB 1GUNA 1VF7A 4QIWE 4DR3L 4LF7Q 2R7FA 2HIVA 4HCEA 2B2VC 3I4LA 2ALYB 3J81L 2F0KA 4JV5L 1B2TA 2IPKD 2PI2A 3A5ZB 4CDDC 2NZHA 4DUZL 1PLFA 4J15A 5JJIA 5C5MA 2DY8A 3CP0A 4GKJL 1DOKA 3F2DA 1J9OA 3PO3B 4LUVA 3F2UA 1UE6A 5J3BA 3J81c 2CFMA 5KIXA 3OPOA 4CKBA 3CRKC 5K36G 4UPAA 4P74A 1XTCD 5FJ8H 3LWUA 4RGNA 4LJZC 5J1ZA 2KUMA 1H9KA 1E24A 3AFQA 2F3IA 1I94Q 1LLRD 3TP5A 3G6JB 1AEXA 3MWYW 1CHQD 4BBSB 2VS1A 4JK1C 4R1JA 3QR8A 4HMJA 1Y1VH 2BH8A 1N33L 2JA8G 2ZTDA 5EPLA 1XMOL 4JI2Q 3GTPB 1SNQA 5EKLA 1CZWA 3TDQA 2N78A 4LFBL 1G2SA 1TWCH 2QGQA 2FFKB 2JK8A 3M4YA 3J81j 3H3VH 2WAQE 5I2XA 4KD4A 2NVYB 2EY1A 4WRDA 3I55A 4DR1L 1CKNA 1LTSD 3PUXA 3VYRA 4ULLA 4G7HC 1XNRQ 2KHJA 2ZJRA 1DOLA 1D2BA 3DMUA 4R4QA 1C8CA 4DR6Q 1OXXK 5ELBA 1S40A 4F7XA 2VUMH 1Z7TA 2JEBI 2MFIA 5E4XA 1VQMA 3FMCA 4KHVA 3I90A 3J7A5 1HR0L 4JI4Q 2R93G 2ZXPA 5C3WA 1O80A 3EBEA 4DR2Q 2JN4A 2NVQH 1X3FA 1KLUD 4X3TA 3D6CA 2IX1A 3WOFA 3OW2A 1B3QA 1BKBA 4A3JG 4JI7L 2LSSA 3FVQA 3KF6A 1DYQA 4C2MB 2QA4A 3RD4A 3TEHB 5D3IB 1U4MA 1JOOA 1AW7A 2PYKA 3M3YB 2QCPX 3S2HB 5C4JH 4LFAL 3M7GA 4KN4C 3U9SA 1QZHA 1Q86C 3HEJA 3K6OA 4A3BB 4V0BA 5HGTA 4FXDA 1N36L 2OCEA 1KHIA 2UUAQ 2RSNA 1U4RA 2UXCL 3TP8A 2A69D 3ERQA 1SEBD 3R93A 3K8AA 2ZM6L 1VQ7A 4DV4Q 2EJFC 3N6RA 2HDMA 1EQTA 3P1HA 3Q24A 2K50A 5ELDA 3PO3H 2Q8IB 3HFZB 3MFGA 2EXZA 1F2ZA 4QJFA 1WOCA 5LMUQ 2MPMA 3S17B 2OTJA 5JVH3 4DR7L 1HNXL 2K4KA 4ILWA 1CM9A 1LYLA 3KLSA 1TWAB 2UUBQ 1PRTD 1VQCA 1VQ9A 3E0JA 3NQIA 4JYAQ 3ER0A 1EOTA 4DAMA 2NVXH 4N8X1 4YWMA 4Y7NB 1JE4A 2LXJA 2FJ2A 4XXEA 1XJVA 1EFID 2LS01 2M00A 2F0IA 1PTOC 3GTGH 3GTPH 1HA5A 2VQEQ 4IFDJ 4BBSG 3U4ZA 4YWLA 1RL2A 5DNFA 3HS0C 5IYBH 2JXMB 2K5NA 4JI1L 3HP3A 4BBRG 4K2KA 4DV2Q 5KNCA 3PGZA 2LY7A 5GQOA 5C44B 4DUYL 5C4XB 1I50H 2ZXRA 1S5FD 3K5MA 2A19A 4I7AA 2M2LA 5M9OA 3I4NH 1J6QA 3P7JA 2ZXOA 3TN2A 5I2YA 2N88A 4ZQ3A 4BY1B 5FLMG 4OO1I 4F8MA 5L37A 1K73C 1A8VA 1QUQA 2A8VA 3PF5A 1B50A 5KNDA 4GS3A 2R3ZA 2SDFA 1M4VA 1MSHA 3QO2A 4AIMA 2NN6G 3DWPA 2VW9A 4BXXG 3A8IE 3S14B 5GROA 3KLSX 2VNUD 2DJGC 1GUWA 3PUVA 2NVTB 4C2MH 3I70A 3A7AB 1QB5D 1BCPC 3W1GA 2MHVA 3M3YH 2D5DA 3HOVH 1IKMA 1KL9A 3CCRA 2A74C 3ERSX 3UDXA 4HN7A 5BN4A 1PH7A 3ONAB 2PZUA 1X9NA 2NB0A 4C1NK 2D0PA 4JBWA 3S9WA 4A3IH 2L11A 3CQZB 3FKIB 4AQYL 1STHA 2K6AA 2R6GA 4A3BG 3T1YL 1IW7C 1O7IA 1X3PA 2AMCB 2F0OA 1GD7A 1PZID 4HTHA 2JA6B 3NWTA 3WWVA 3MXUA 2BDNA 4HSVA 4X66Q 1M1KC 3K0XA 3J80L 1EIFA 4C56C 1SFOH 4I7ZC 4K0KL 3TREA 4K6LA 1EQVA 2DY7A 3CCMA 4Q5VA 2AWNA 1STNA 3NK9A 1I4GA 4R8IA 1JWSD 1EUJA 1VQNA 1LABA 4YY3Q 1DONA 2IY5B 2LXKA 2O5IC 1AZPA 3PSIA 2SNMA 4A3KB 3J80c 4X64Q 3J7AV 3BDOA 3SXHA 3VYUA 2HT1A 2GVAA 3I7FA 2AUJD 3W3AA 3U4VA 4ZK9B 5BN3A 4XTCS 5IP7G 3EQLC 4C3JB 2HHHQ 1ONLA 4POFA 1PRTF 3BDCA 5IYCG 3A8KE 1X65A 2OXPA 1A2TA 1NSNS 3UDFA 3BZDB 1XMQL 4YCVA 5C44H 4OHJA 2OWOA 5I6WA 3I8ZA 1DM0B 4NXMQ 4RHSA 3NWSA 3TP6A 4B3SQ 5M3FB 3BVMA 4UP9A 1RHPA 2B2WA 5C4XG 1ILQA 4RFBA 5JVG3 4L5SA 3RR5A 4PZ6A 1ENAA 4GKKQ 4K6DA 1X3QA 4IUNA 4RKBA 1L2FA 1PTOD 4BY1H 2CWAA 1BVSA 1B1ZA 2WIIB 5LL6S 4LF5L 3OTOL 3RN5A 2PO4A 2IHEA 2JEAI 4GOPB 4DR3Q 2G9DA 3H3VC 1CSQA 4KHPL 3N52A 4X3SA 2CVRA 1SNDA 3FPPA 4HJAA 1EFWA 3KYHC 3PUYA 3NTIA 1RIPA 3E3XA 1QZGA 1FD7D 4V190 1ILPA 4GKJQ 2RKSA 1N34Q 4C3HH 2KENA 5CR3A 2WACA 3G6EA 3PO2B 3CXCA 2EPBA 3S1MB 1YI2A 3I2ZA 5T1GA 5CBEE 5M5XB 1CKMA 4R4OA 2SEBD 3FKIG 1SDFA 5DM73 1X3EA 2F0JA 1R9TB 1GM5A 4S3SA 1PFSA 2HCIA 1BXTA 4P72A 2IWHA 5CC4A 3KUPA 3FPUB 3RMHA 2JA6G 1EL0A 3HOUG 1N33Q 4MTNA 5LHY1 5IYDG 3HRZC 4FF4A 1BCPD 3MXNA 1GUOA 5ELNA 4DK3C 3SGIA 3D6WA 3NENA 1VQ6A 2L5TA 3RLFA 2BE5D 2AHOB 1CQVA 4L5RC 2R7ZB 1I5FA 2K52A 1JWUD 1SYCA 1SSOA 1R4QB 1JE5A 2BH2A 1SE2A 2ZJQA 4JBMA 1K8MA 2Y0SB 2B2UC 4XQQA 2RSOA 1B9NA 2AWOA 1IW7D 3GD7A 3D3RA 5C5LA 1NJIC 1MIUA 2B3GA 4A3KG 3SEBA 4RWSC 3GTLB 2F0DA 3PMFA 2E2IB 1IZ6A 2ENBA 3D4RA 4K8JA 2K01A 2WINB 4IUPA 5C0XI 3H91A 4MHEA 1KLGD 4C3JG 4XQNA 1HR0Q 4YWKA 4O0AA 5ISRA 1AP0A 2LFNA 5LL6X 2O5JC 1FNVA 3AMUA 1N32L 2F0UA 3C2PA 5CYUA 1VMCA 4QUFA 3M4OB 1WTQA 4IFDG 3J7ZC 2K32A 3K7UC 4OXPA 4UP7A 4A75A 1W2BA 2I5MX 3KJPA 1PMRA 5EBCA 5M3FG 1VQPA 1TWHH 3OMCA 1J5EL 4JI7Q 3A56A 1PHJA 1U5KA 5COYA 4ALPA 5I4DA 4FF3A 5CV8A 4XT1B 3MXNB 3IAYA 4JG2A 4MTKA 2YTVA 4LFAQ 1SE4A 4A3FB 3E9HA 5EQ0A 3HOYH 4OIJA 4LF6L 4DR5Q 1HXYD 1E2VA 4TVAB 1KXLA 2KEEA 1STEA 2UXCQ 5I9PA 1ZYRC 1PH9A 1LTID 1PTOF 2L55A 3NE5B 1Q90A 2C9OA 1Y69U 2FMMA 4RGTA 2ZM6Q 2EJMA 2KHSA 3NBIA 4YHHQ 2Z9HA 4BA2I 1TT2A 2IW3A 1K8OA 4A3MH 2K75A 2RCNA 5CV4A 4DR7Q 1HNXQ 2E75C 3EA6A 3PO2H 4DK0A 4X65Q 2PNHA 2PPBC 1STBA 1F2LA 2K5VA 5M5XH 3H15A 3T13A 1FR3A 3EJIA 4LF4L 2RDFA 3IL8A 3NQTA 3GDEA 2Z6KA 5D65A 5D3DA 4HR7B 3JAMi 2O4XA 1EY8A 1L1OA 2TMPA 4Z9CB 2ICEC 1UE1A 1HHVA 1BR9A 4A3EH 4PMCA 3K5LA 1TWGB 4KD3A 4EQPA 5C3EH 3M85A 4JI6L 3E6ZX 1VQFA 1BQQT 5M5YB 3NEMA 1CK1A 2A6EC 4KK7A 1D5ZC 3HZXA 3S2DB 2R7ZG 3HOZB 3K81C 1PDQA 1BCPF 1T9HA 2IHFA 4B3ML 3S1QB 2Y0SG 5FO7B 4I65A 4UHVA 3EVQA 3F2CA 3CD6A 2Q2UA 4DGZA 3I3CA 1SYBA 3GTLH 2LKVA 1F9SA 1V9PA 5JEAG 4OO1G 4RGMA 2BA0A 4QMGA 4U68A 2XSCA 3PIP3 5TSSA 1A0IA 1PVOA 5DEHA 4WORA 2Z6BA 1JJGA 5DAUA 1LTBD 4OELB 3CMEA 3K5NA 1HUNA 4B08A 1QNKA 3M4OH 2ZJPA 1YITA 4DV7Q 3K58A 3MXPA 5JOBA 4NXNL 1Z47A 5IOCA 1UEAB 4B3TL 3AQQA 3CCEA 2CWPA 1WCMB 1GUSA 1QG7A 3BVGA 1TXYA 2B29A 4HEDA 3E9IA 2QKIC 2CHBD 1JR0D 3NELA 1JWMD 4GNXB 2Z4IA 3BDLA 1EEID 2QDBA 1C4QA 2E74C 1B44D 2UUCQ 1KDCA 3CPFA 5AJ3L 1RDPD 1W3SA 1DGSA 3J81i 1WJJA 4DV1L 2NTSA 4A3FG 5K36H 2E2JH 2CCZA 2VQFL 4AQYQ 2XWJB 5K5PA 1J8IA 1JB3A 3KK7A 4APVA 4KI0A 3MEFA 4DV0Q 1LT4D 5ELEA 2MJ8A 4DV6L 2FMCA 1L0XB 1IXRA 2JA8H 3DEPA 1LTAD 4R4IA 5IWAL 3LNNA 2E76C 3UI2A 1BBUA 3VR3A 5I9OA 4K0KQ 2H5XA 1SLJA 2PMZB 4H0LC 4JC0A 5C6AA 2B63B 4BBRB 1QNUA 1NR2A 4QCLA 4CDFC 3QOJA 4X6AH 5LMNL 2JJQA 1VQ5A 2ZTEA 1LTTD 1VQHA 1IBMQ 3GTOH 1ZYRD 2B2YC 1K3RA 1B70B 1I6VC 2EYHA 1PH8A 1HH2P 4ZCKA 3DXJC 2AQ1B 3Q23A 1BOSA 2A6HC 2E8GA 1SYGA 2F4IA 3PUWA 2PNRC 2R93H 1YVCA 4LNQA 3CC4A 2J4XA 3LX0A 1XMQQ 2KBNA 4WJWA 2EY5A 3AU7A 1JJ2A 3HOZG 2WV6D 3BYYB 4A3JH 1HZ9A 4ODGA 4XYOA 3J7AF 3TS2A 4OX9L 1HFGA 2NTTA 4G4KA 4OWXB 3Q8DA 3CU7A 1K0RA 1KAAA 2EYFA 1QOHA 1ICWA 4LF5Q 1VF5C 4RA8A 2A6ED 1S5ED 4HJ7A 1G91A 1YNJC 4G7OC 1FVIA 3QWNA 4QF4A 2E5LL 2TSSA 3NPPA 4KHPQ 4LK1C 3MAQA 4Q0FA 3WOEA 4BWGB 1A15A 5EKIA 4L5QA 1Q82C 1WCMG 1G8ZD 2B2TA 1PH2A 3A7LA 1EWCA 4IN3A 4OEMB 1SNPA 1Q8KA 2IL8A 2K5QA 3GP7A 4GN5A 4A3DG 1B4OA 3UDGA 1KABA 1D7QA 4UP8A 4O42A 1IHZA 3C1EA 1TQOA 2PZTA 3PIO3 1AE2A 1MKHA 1EWHA 5CV9A 1Q7YC 4OONA 1CT1D 2VZAA 1K9MC 4IZ8A 3ULLA 2EZVA 3GO5A 1TVXA 1TWFB 1ZXTA 4XT3B 4PZ8A 2F0SA 3CCUA 2NBFA 1EYCA 1S5CD 2L12A 1U4LA 5ELOA 1VQLA 2OF1A 5IY0A 2HUGA 2F0NA 2RF4A 4DV3Q 3TZUA 5FLXL 2IT1A 4BBSH 2N55A 2XWBB 4TSSA 4JPBW 3K57A 1L0YB 1SE3A 4JI3L 1X3GA 3DEOA 4BBRH 3L9AX 2P5ZX 1U9RA 4JI8L 1EQRA 3JAME 1TS3A 1GUTA 5CV6A 2B63G 1PRTB 4X3KA 1X55A 2EIFA 4AYBB 3D4DA 4OGQC 4HJ9A 1A3VA 2ATWA 1YEZA 2B8GA 5FLXc 3GTKB 2GVBA 2OEOA 4HAEA 1HNWL 5IGDA 5GAGC 1I3QB 2NVYH 3KOJA 4GN3B 2K1BA 5C0XG 1XNQL 1EY7A 1FGBD 1Z9FA 1YHAA 2AKWB 4C3IG 5FLMH 2I5LX 3K0YA 1WTHA 4CJ0B 4N8FA 4OL7A 5IT9L 4F87A 1JC7A 1S3OA 1Y8OB 1N32Q 2F0PA 1R4PB 1IBLQ 3IFDA 2EYLA 3S1NB 2NN6H 3PIPA 4BXXH 4A3GB 1F9RA 3M4QA 4RCOA 2JA5G 1A2UA 1NNXA 3L7ZC 1CFMA 4YCWA 1DOMA 2JA7B 1J5EQ 1PH5A 2Q2TA 5IT9c 1D5MC 5IGGA 1P8LA 1E3PA 1E22A 4A93B 1OTCA 3R2IA 1SYFA 2Z1CA 3SE0A 3F2BA 2C5CA 4IUTA 2A6HD 3ULPA 4HSPA 3S2HH 4M1UB 5M5WB 1QVFA 2BE5C 1D6EC 1FGUA 3X3MA 3GTJB 1GXDC 4P73A 3SK4A 5A2QL 4A3BH 1S4ZA 3HOXG 1EZ8A 2YV5A 1PYSB 4ZUJA 4P71A 4DAYB 1EY9A 2XTIA 5M3MB 1XX8A 3HOUB 3J81E 1NCVA 2VY3A 3CCLA 3TRZA 2A5HA 3GV6A 1NAPA 1JOQA 3BJUA 1G2TA 2G9HD 1RODA 2GN5A 3GTQB 3S17H 2R92G 3K7AB 4KY6A 4MIUA 4QGUA 2K05A 1YNJD 4LF4Q 3S15B 5JEAJ 2XVSA 1TWAH 1II3A 3UE0A 2F0EA 5J39A 3X3NA 1NBWA 1A63A 1EIHA 4Y52H 3J80i 4GOPA 3S16B 2NZOA 5IP9G 3MFYA 4Y7NH 1JMCA 5IP7H 2KCCA 1Q46A 4TQUS 4X62L 2N3SA 3D0FA 2VB2X 5GAEC 4JI2L 5C4HA 4JI6Q 5IYCH 1PZKD 2JQOA 1WTVA 4IOCA 1V8QA 1IYUA 3GV3A 3GQBA 1SBBB 2VL6A 1EQQA 5EKKA 2CH4A 1CKOA 3Q22A 4IALA 1SNOA 2K33A 4CDCC 3GTKH 2E2DC 4AYBG 1I3QH 4M8AA 1Q8IA 5CBAE 5C4XH 1CHPD 4B3MQ 5IODA 5EBDA 3SK5A 1XNRL 2F0LA 1EY5A 3H3VI 4LF8Q 1MGSA 4DR6L 4PZ7A 1FNWA 2YTXA 4JBJA 5E1FA 3T1HL 1PA6A 3EFXD 1Y1WG 3RZDB 2UU9L 1YIJA 2ASBA 2C35B 5ELCA 4ZKBB 2Z4HA 4QB4A 4DK6C 3H0GB 1C9OA 1CQFA 2KJXA 4B3TQ 1DXMA 2DNEA 4A3GG 4GN4B 2CH4W 3S14H 2KECA 2RBMA 1HR0W 2NVTH 2JA7G 1PTOB 4R4TA 1HTPA 4A76A 4FDBA 3CCQA 4RCNA 1BBXC 4JV5Q 2E2HB 4BS9A 4DUZQ 5BN5A 1E1TA 4DNIA 4FYDA 1T5XD 4LFCL 4A93G 1JICA 4IUUA 4ID6A 1SROA 3CCSA 5AJ3Q 1VQDA 4NW2A 3L0OA 4DV1Q 2VQFQ 3MTSA 1ET9A 2DUDA 2QEJC 3RZOB 3CQZH 3FKIH 2A73B 4UY8C 3DM3A 2Y0SE 1K28A 1W6KA 1DJRD 4H13C 1MJEA 4DFAA 3FHWA 4JBKA 4DV6Q 2JA6H 3OYYA 2F0VA 3HOUH 1UAPA 2BCOA 3S1RB 5IYDH 2DN8A 1NTGA 4ZAIA 5M3MG 5CV5A 4EX5A 2Q8TA 2YU9B 1D8LA 1SNMA 2H4OA 1OXTA 4HIOA 1XMOQ 2F0HA 2F3VA 3I4OA 2CQAA 5LMUL 4MZ9A 3K7AH 1SR3A 4LFBQ 2F0WA 3NTHA 5LMNQ 1JCKB 3S15H 5DM63 2DGYA 2IX3A 1E0BA 1VQJA 1F2YA 2EY2A 1WTPA 4QQBX 2K5HA 1H9RA 4JYAL 1G6PA 2MQHA 4HCSA 1TR5A 2Z6KC 4DR1Q 2ZT9C 3H09A 1V1OA 4A3KH 1TIID 1EU3A 4PMWA 1BCPB 4PNYA 2NYZD 1L1OC 4C1NI 1Q3LA 3HOWB 2F52A 4WFN3 5J22A 2RCFA 4IPDA 3CRLC 4ZRZA 2VQEL 4C3JH 4E6IA 4B3RL 5FO8B 4X3UA 3CPWA 4BY7B 4A3CG 1RF2D 1XYIA 1CSPA 5AFWA 2N49A 4JOIC 3IRBA 4IFDH 4RG1A 4XDXA 2QDLA 2OTLA 1AN8A 1BDOA 3TSSA 4F88A 3Q0AA 4R9WA 5M3FH 4OX9Q 3V2TA 3A55A 4GLVB 5E4WC 3I4MG 1CUKA 5BR8L 3AEVA 3MEHA 1OO9B 3SR1A 1RJTA 1UUPA 4DR4L 3TQYA 3SVMA 5IGEA 2OT2A 1MI2A 1V1PB 4DK1A 3KDFB 4ZUIA 2O2LD 2SNSA 4NMZA 1Q1BA 5C3XA 1KAWA 1N36Q 3H0GG 5NUCA 2DNCA 5KGUA 4U673 4FVMA 3P20A 2NN6I 1WTXA 2MO1A 3IKJA 1JOKA 2F4VL 3OMGA 1BNZA 3W1BA 1I6HB 4TRDA 3VA7A 2HIXA 1KRTA 1I4HA 2RDHA 4XIGS 2EJGC 4LUZA 1O7YA 4DAVA 3FDTA 5GADC 4N9TA 4GLAC 5KEEA 1YHQA 1CI3M 1QCBD 3RZOH 1WYDA 2LMCB 3MA2B 5C0XJ 3S1MH 3NHHA 3SK8A 5FO9B 1IYJB 2JP1A 2PW7A 1R9TH 2EE1A 2RVLA 4BA1I 4DA2A 3S1RH 1S5BD 1PH3A 1IL2A 3OHXC 5KNBA 2YU9H 1PH4A 1Y1VB 4K2LA 4CDEC 4JI3Q 4JI8Q 4GNXA 4K5XA 2KVMA 3G71A 3J80E 1TWCB 4JI1Q 2R7ZH 3KBGA 1VQEA 1TKWB 1X32A 1HNWQ 3AFPA 3DWQA 4DUYQ 5D14A 1HUMA 4LW1A 1B9MA 2JSOA 4ZKCB 3D31A 5JEAH 4OO1H 3ND9A 1XNQQ 1PZJD 1FJGL 4WJ3M 1SN8A 2E2IH 5CMDA 3HOWG 4FF1A 2B39A 2VUMB 3BG3A 4OWTB 4DPGA 5KRUA 2EOTA 3EROA 3M4PA 4IUQA 4CBVA 2J0TD 1CA5A 3VR2A 4BY7G 2UXBL 4NB3A 2Q8RE 2L15A 5ELFA 4DU9A 1E2WA 2NVQB 4PV1C 1SXTA 3CCVA 3URYA 3A74A 1YJWA 3L3OC 3BS1A 4NXML 4B3SL 4KTAA 2D9UA 2WB1E 2WKCA 2CW0C 3TP7A 4XQJA 3KF8B 2XGTA 2EYJA 2CQOA 4GKKL
chains in the Genus database with same CATH topology
3CCMA 2AWNA 1AE2A 3CMAA 1MKHA 4HJ8A 1Q7YC 1AH9A 4OONA 1EUJA 2VZAA 3RLNA 1VQNA 1GO3E 1K9MC 4YY3Q 3I4MH 5E7NA 3ULLA 3RNUA 2IY5B 2LXKA 1PV4A 3GO5A 3BU2A 3PSIA 2PMZE 4PZ8A 4A3FH 3J80c 3CCUA 4X64Q 4QL5A 3ICEA 2UXDL 4JI5Q 5ELOA 2HT1A 2GVAA 3I7FA 3U4VA 1VQLA 5IY0A 3RZDH 4XTCS 5IP7G 4HIDA 1UE7A 1IBLL 3ULJA 2HHHQ 2RF4A 4DV3Q 4POFA 3T1YQ 2IT1A 1Q81C 1UEBA 5IYCG 3DLLA 4BBSH 1WI5A 3H0GH 5JJLA 1X65A 2MO0A 2E5LQ 2EXDA 1JB7A 3K80C 4JI3L 1X3GA 3CC2A 3UDFA 4BBRH 1V1QA 1XMQL 1I6HH 4YCVA 1X56A 4JI8L 1EQRA 5C44H 2OWOA 2B63G 1X55A 2EIFA 1IBKQ 4NXMQ 1EOVA 1SRUA 2E2HH 4B3SQ 1N34L 4UP9A 4HJ9A 3AYHB 1C0AA 5C4XG 2ATWA 1YEZA 4L5SA 5FLXc 1HNWL 2GVBA 2WFWA 3RR5A 4WJ4A 5GAGC 3CW2C 2NVYH 4PZ6A 4GKKQ 1AE3A 4LF9Q 4IOAA 1GVPA 1OXVA 1XPUA 3KOJA 4GN3B 1L2FA 4BY1H 5C0XG 1HNZL 1XNQL 3CCJA 2CWAA 5GAHC 1BVSA 2PI2E 1LTLA 1Z9FA 5FJ8G 1YHAA 2AKWB 2EQSA 3HOYG 1B7YB 5FLMH 3ZJYC 1JJCB 2I5LX 4LF5L 1VQGA 3B6YA 2FXQA 3OTOL 3RN5A 2IHEA 3BZCA 4POGA 4X62Q 1QVGA 1YZ6A 3PV0A 2JEAI 1YHBA 1FL0A 1S3OA 3U50C 1TWGH 3KFUA 1QVCA 3HKSA 1N32Q 1VQAA 4GOPB 4L5TA 4DR3Q 1Y1VG 1IBLQ 4KHPL 1CSQA 1V43A 4KLKA 1GKHA 3L2PA 4IPHA 3PIPA 5M5YH 4BXXH 1E7ZA 3M4QA 2JA5G 1WFQA 4HJAA 1EFWA 3L7ZC 4YCWA 4X66L 3S2DH 3KYHC 3PUYA 1J5EQ 1RIPA 1PH5A 1G291 2Q2TA 4A3MG 1VQ4A 5IT9c 1QZGA 3A5UA 3HOZH 3CF5A 1P8LA 4GKJQ 1E3PA 1E22A 2Q2IA 3PCOB 5HGQA 1N34Q 2I0QA 3PO2G 3S1QH 1LM0A 4C3HH 1OTCA 3JC66 2KENA 3F2BA 3VDYA 2Q2HA 3F8TA 3ULPA 3G6EA 4YY3L 3CXCA 1KIXA 3S2HH 3JAMc 1QVFA 4IO9A 1NMGA 3I2ZA 1YI2A 1OXUA 3T1HQ 1FGUA 1CKMA 4R4OA 2ZTCA 3HOWH 3FKIG 3STBD 4X64L 4P73A 2VUMG 1X3EA 4JI5L 1GM5A 2UU9Q 4DV5Q 4A3BH 1YJ9A 2I5HA 3HOXG 1PFSA 2KCMA 4P72A 4A3EG 1HZCA 2YV5A 1PYSB 2R7DA 4P71A 3OTOQ 4MNOA 2HHHL 4BY7H 5C3EG 4DAYB 2JA6G 3HOUG 1N33Q 1NE3A 4JOIA 4MTNA 4RMFA 5IYDG 1KD1C 3U58A 5ELNA 2XTIA 4DK3C 3SGIA 1ASYA 2WP8J 3NENA 5JJKA 1VQ6A 1WCMH 3RLFA 2VY3A 3CCLA 2AHOB 4IFDI 3TRZA 3BZKA 4L5RC 4PG3A 1I5FA 1N9WA 2K52A 4A3DH 1IBKL 1EYGA 3PUZA 1JE5A 2BH2A 3BJUA 2JE6I 5DLQE 1SE8A 2ID0A 4LFCQ 2GN5A 2ZJQA 3S17H 4JBMA 1VQKA 4LF8L 2R92G 4JI0Q 5EAYA 1ASZA 2AWOA 4QGUA 3GD7A 4LF4Q 2YTYA 3M9BA 5JEAJ 1NJIC 4LF9L 1MIUA 1TWAH 2IX0A 3UE0A 1NBWA 2B3GA 4EQ5A 4DR5L 1A63A 4A3KG 3PF4A 4Y52H 4AYBE 3J80i 1VS0A 4GOPA 2NZOA 1IZ6A 5IP9G 1CKNB 4Y7NH 1JMCA 5C0XI 5IP7H 1Q46A 4TQUS 1HR0Q 4X62L 2N3SA 4YWKA 4O0AA 3D0FA 1EWIA 5GAEC 4JI2L 4JI6Q 5IYCH 2WB1G 1H95A 1X6OA 1N32L 4YHHL 1L1OB 2JQOA 4QIWE 4R4CA 4DR3L 4LF7Q 4IOCA 2R7FA 2HIVA 1YJNA 2KHIA 1KQSA 1OXSC 2ALYB 2VL6A 1EQQA 4IFDG 3J7ZC 4JV5L 2PI2A 3A5ZB 3K7UC 4OXPA 2NZHA 1CKOA 4UP7A 3UE1A 4DUZL 3M7NA 4A75A 2B63H 4J15A 3GTKH 1W2BA 5JJIA 4AYBG 2I5MX 1I3QH 3KJPA 4X65L 5M3FG 1VQPA 1TWHH 1J5EL 4JI7Q 3PO3G 4QY7A 1PHJA 5C4XH 4B3MQ 1U5KA 2K14A 4ALPA 3CP0A 4GKJL 1G51A 2MNAA 3F2DA 3MXNB 4LUVA 1XNRL 3H3VI 1UE6A 4LF8Q 5J3BA 4JG2A 2YYZA 4PZ7A 4DR6L 3J81c 2CFMA 2YTVA 2YTXA 4LFAQ 5K36G 1K8AC 4IJLA 4UPAA 3KF6B 4P74A 4GOPC 5FJ8H 4JBJA 3T1HL 3E9HA 1PA6A 3HOYH 4LF6L 4C3IH 1Y1WG 4DR5Q 5IE8A 1E24A 3AFQA 4B3RQ 2F3IA 1I94Q 4TVAB 4DV5L 1YIJA 2UU9L 2ASBA 1KXLA 2C35B 2UXCQ 1PYBA 1PH9A 4DK6C 2VS1A 4R1JA 1Y1VH 2BH8A 2CKZB 1C9OA 1N33L 2JA8G 2ZTDA 1XMOL 4JI2Q 2ZM6Q 1M90C 4B3TQ 5IYBG 4GN4B 3S14H 4A3GG 4O2DA 4YHHQ 2JA5H 1VQOA 4BA2I 2N78A 4LFBL 1HR0W 4IPGA 1VCIA 3EIVA 2NVTH 1TWCH 2JA7G 2QGQA 4R4TA 4A76A 2JK8A 4FDBA 3CCQA 3RLOA 3J81j 4A3MH 2K75A 4JV5Q 4DUZQ 1PH1A 3H3VH 2WAQE 1HNWQ 2RCNA 1E1TA 4DNIA 4DR7Q 1HNXQ 4LFCL 3PO2H 4X65Q 4A93G 2PNHA 2N8NA 3I55A 4DR1L 4JI0L 1SROA 1CKNA 2K5VA 3PUXA 5M5XH 5AJ3Q 3H15A 3CCSA 5BR8Q 4LF4L 1VQDA 3I4NG 1NY4A 3L0OA 4DV1Q 1XNRQ 2KHJA 2Z6KA 3GDEA 2ZJRA 4HIMA 4R4QA 3JAMi 2VQFQ 4ME3A 4DR4Q 2DUDA 4DR6Q 1OXXK 3CQZH 1S40A 3FKIH 1L1OA 1X54A 2VUMH 1KRSA 2JEBI 2MFIA 4UY8C 3DM3A 1HJPA 2HQLA 2Y0SE 1UE1A 2PQAA 3HOXH 1VQMA 1MJEA 4LF6Q 4A3EH 4DV7L 3FHWA 1HR0L 4DV6Q 4JI4Q 4JBKA 3J7A5 2WAQG 2R93G 5C3EH 3OYYA 3F1ZA 2JA6H 3HOUH 3M85A 5IYDH 3EBEA 4H02A 4DR2Q 4JI6L 1NTGA 2NVQH 1VQFA 1X3FA 3E0EA 5M3MG 4EX5A 4LF7L 3NEMA 2F4VQ 1D8LA 1Y14B 1OXTA 1XPOA 4HIOA 4A4IA 1XMOQ 3HKZE 3I4OA 2R7ZG 2IX1A 5LMUL 4AH6A 4MZ9A 3OW2A 3K7AH 1SR3A 4LFBQ 4GLXA 1BKBA 3K81C 4A3JG 4JI7L 4HJ5A 5LMNQ 2LSSA 3S15H 2UUCL 3KF6A 1T9HA 2IHFA 4B3ML 2R92H 2DGYA 2Y0SG 2QA4A 3HOVG 1VQJA 3TEHB 3F2CA 3CD6A 1N8RC 2Q2UA 2K5HA 4QQBX 3GTLH 1YNXA 4JYAL 1E1OA 2MQHA 1G6PA 4YCUA 1V9PA 5JEAG 2Z6KC 1KC8C 4DR1Q 4OO1G 3EN2A 1TWFH 2BA0A 4A3KH 5C4JH 3A0JA 4LFAL 4PMWA 1PVOA 1A0IA 1BBWA 1B8AA 1L1OC 4A3IG 1JT8A 1QZHA 2F52A 1VQIA 1Q86C 5IP9H 4IPDA 2KCTA 4DV0L 5HY6A 1JJGA 2VQEL 4C3JH 3CMEA 1N36L 2OCEA 4B3RL 1HZBA 1I94L 1KHIA 2UUAQ 3CPWA 3CAMA 3M4OH 4A3CG 2UXCL 2ZJPA 4P75A 1UWVA 1YITA 2D0OA 1SMXA 4DV7Q 1CSPA 1HZAA 4JCVE 4NXNL 1Z47A 1MJCA 3K8AA 2N49A 4JOIC 2ZM6L 3AQQA 4B3TL 3IRBA 3CCEA 2CWPA 1QUQB 1VQ7A 4RG1A 1L0WA 4DV4Q 1TXYA 2B29A 3TS0A 4HIKA 3E9IA 2OTLA 2PQAB 2K50A 5M3FH 3PO3H 3HFZB 3NELA 4OX9Q 4QJFA 1WOCA 5LMUQ 2OTJA 4GNXB 4DR7L 1IBML 1HNXL 4GLVB 2K4KA 3NBHB 2UUCQ 1LYLA 3CPFA 3I4MG 5AJ3L 1C7YA 2BA1A 1CUKA 1W3SA 5BR8L 1VQCA 1VQ9A 2UUBQ 3AEVA 2A1AA 1DGSA 3I56A 1FJGQ 3J81i 1WJJA 4DV1L 4A3FG 3ER0A 4JYAQ 4DAMA 1Q12A 2E2JH 2CCZA 5LMNW 2VQFL 4AQYQ 2NVXH 4DR4L 3TQYA 1Y1WH 3FP9A 1YBYA 4YWMA 3CC7A 3KLWA 2LXJA 3KDFB 4APVA 4KI0A 1XJVA 3MEFA 1VQBA 4DV0Q 2UXBQ 1Q1BA 3GTGH 3GTPH 4IFDJ 2VQEQ 4DV6L 4JI4L 4BBSG 1KAWA 1U0LA 3S24A 1N36Q 3U4ZA 3H0GG 1IXRA 4YWLA 1RL2A 3G4SA 2OQ0A 2JA8H 3S1NH 4DR2L 4R4IA 2NN6I 5IWAL 5IYBH 4A3GH 2K5NA 2MO1A 4JI1L 4BBRG 4DV2Q 2F4VL 1BBUA 5C44G 4NXNQ 4K0KQ 2H5XA 1SLJA 4JC0A 2JA7H 3W1BA 3PGZA 3GTMH 2RHQB 5GQOA 4DUYL 4KHZA 2HIXA 1KRTA 4XIGS 4X6AH 4LUZA 3LGJA 5LMNL 4A93H 1I50H 2JJQA 5GADC 4GLAC 1K83H 1YHQA 1PH6A 1VQ5A 2A19A 4DKAC 2ZTEA 1IBMQ 1VQHA 3GTOH 1WYDA 3RZOH 3I4NH 1J6QA 5C0XJ 1K8GA 4BY1G 3S1MH 5M5WH 1K3RA 1P16A 2UXDQ 1IYJB 3GTJH 1B70B 2JA9A 5FLMG 1R9TH 4OO1I 4BA1I 1PH8A 1K73C 1HH2P 3S1RH 1A8VA 1PH3A 1IL2A 1NMFA 1QUQA 3G48A 4OWWB 3PF5A 2E8GA 3PUWA 2A8VA 2OQKA 1YVCA 2YU9H 3CC4A 4LNQA 3PIOA 2UUAL 2R93H 1PH4A 4GS3A 5M3MH 4AIMA 2NN6G 3STBC 4JI3Q 2VW9A 4BXXG 1XMQQ 2KBNA 5GROA 4JI8Q 4GNXA 2VNUD 4DV4L 3G71A 5IWAQ 3PUVA 4JI1Q 2R7ZH 4LUOA 1VQEA 4C2MH 1XTDA 1JJ2A 3HOZG 1Q1EA 4A3JH 4A3LH 1HZ9A 3AFPA 3W1GA 1XPRA 3GTQH 3M3YH 4OX9L 3TS2A 3KJOA 3HOVH 4DUYQ 1KL9A 5H1SE 2Z0SA 3CCRA 3ERSX 3UDXA 4LW1A 4A3LG 3KDFA 4NPSA 1PH7A 4OWXB 2RHSB 3D31A 3Q8DA 1HNZQ 1XNQQ 1X9NA 2UUBL 1K0RA 1S72A 2D0PA 1FJGL 4JBWA 1SN8A 2E2IH 4WJ3M 4A3IH 3S16H 3HOWG 4LF5Q 4AQYL 3UDIA 2V1CC 2QEXA 4OWTB 4DPGA 2R6GA 4DV3L 4A3BG 3T1YL 4HJ7A 1O7IA 3M4PA 2AMCB 1GD7A 3RN2A 4LWCA 1FVIA 2E5LL 4BY7G 2UXBL 4A3CH 4NB3A 4KHPQ 3HKZG 2L15A 3WWVA 3CCVA 1VQ8A 4GNXC 3A74A 2D62A 1YJWA 4NXML 4L5QA 1Q82C 1WCMG 4DV2L 4X66Q 3W5OA 3K0XA 1PH2A 1A62A 1EIFA 1M1KC 4B3SL 2WB1E 2ES2A 4IPCA 1SFOH 4IJHA 1EIYB 4K0KL 1Q8KA 3TREA 4GN5A 4A3DG 3UDGA 3KF8B 1LUZA 2XGTA 1D7QA 4UP8A 2CQOA 4GKKL 1UE5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCM A;  2AWN A;  1AE2 A;  3CMA A;  1MKH A;  4HJ8 A;  1Q7Y C;  1AH9 A;  4OON A;  1EUJ A;  2VZA A;  3RLN A;  1VQN A;  1GO3 E;  1K9M C;  4YY3 Q;  3I4M H;  5E7N A;  3ULL A;  3RNU A;  2IY5 B;  2LXK A;  1PV4 A;  3GO5 A;  3BU2 A;  3PSI A;  2PMZ E;  4PZ8 A;  4A3F H;  3J80 c;  3CCU A;  4X64 Q;  4QL5 A;  3ICE A;  2UXD L;  4JI5 Q;  5ELO A;  2HT1 A;  2GVA A;  3I7F A;  3U4V A;  1VQL A;  5IY0 A;  3RZD H;  4XTC S;  5IP7 G;  4HID A;  1UE7 A;  1IBL L;  3ULJ A;  2HHH Q;  2RF4 A;  4DV3 Q;  4POF A;  3T1Y Q;  2IT1 A;  1Q81 C;  1UEB A;  5IYC G;  3DLL A;  4BBS H;  1WI5 A;  3H0G H;  5JJL A;  1X65 A;  2MO0 A;  2E5L Q;  2EXD A;  1JB7 A;  3K80 C;  4JI3 L;  1X3G A;  3CC2 A;  3UDF A;  4BBR H;  1V1Q A;  1XMQ L;  1I6H H;  4YCV A;  1X56 A;  4JI8 L;  1EQR A;  5C44 H;  2OWO A;  2B63 G;  1X55 A;  2EIF A;  1IBK Q;  4NXM Q;  1EOV A;  1SRU A;  2E2H H;  4B3S Q;  1N34 L;  4UP9 A;  4HJ9 A;  3AYH B;  1C0A A;  5C4X G;  2ATW A;  1YEZ A;  4L5S A;  5FLX c;  1HNW L;  2GVB A;  2WFW A;  3RR5 A;  4WJ4 A;  5GAG C;  3CW2 C;  2NVY H;  4PZ6 A;  4GKK Q;  1AE3 A;  4LF9 Q;  4IOA A;  1GVP A;  1OXV A;  1XPU A;  3KOJ A;  4GN3 B;  1L2F A;  4BY1 H;  5C0X G;  1HNZ L;  1XNQ L;  3CCJ A;  2CWA A;  5GAH C;  1BVS A;  2PI2 E;  1LTL A;  1Z9F A;  5FJ8 G;  1YHA A;  2AKW B;  2EQS A;  3HOY G;  1B7Y B;  5FLM H;  3ZJY C;  1JJC B;  2I5L X;  4LF5 L;  1VQG A;  3B6Y A;  2FXQ A;  3OTO L;  3RN5 A;  2IHE A;  3BZC A;  4POG A;  4X62 Q;  1QVG A;  1YZ6 A;  3PV0 A;  2JEA I;  1YHB A;  1FL0 A;  1S3O A;  3U50 C;  1TWG H;  3KFU A;  1QVC A;  3HKS A;  1N32 Q;  1VQA A;  4GOP B;  4L5T A;  4DR3 Q;  1Y1V G;  1IBL Q;  4KHP L;  1CSQ A;  1V43 A;  4KLK A;  1GKH A;  3L2P A;  4IPH A;  3PIP A;  5M5Y H;  4BXX H;  1E7Z A;  3M4Q A;  2JA5 G;  1WFQ A;  4HJA A;  1EFW A;  3L7Z C;  4YCW A;  4X66 L;  3S2D H;  3KYH C;  3PUY A;  1J5E Q;  1RIP A;  1PH5 A;  1G29 1;  2Q2T A;  4A3M G;  1VQ4 A;  5IT9 c;  1QZG A;  3A5U A;  3HOZ H;  3CF5 A;  1P8L A;  4GKJ Q;  1E3P A;  1E22 A;  2Q2I A;  3PCO B;  5HGQ A;  1N34 Q;  2I0Q A;  3PO2 G;  3S1Q H;  1LM0 A;  4C3H H;  1OTC A;  3JC6 6;  2KEN A;  3F2B A;  3VDY A;  2Q2H A;  3F8T A;  3ULP A;  3G6E A;  4YY3 L;  3CXC A;  1KIX A;  3S2H H;  3JAM c;  1QVF A;  4IO9 A;  1NMG A;  3I2Z A;  1YI2 A;  1OXU A;  3T1H Q;  1FGU A;  1CKM A;  4R4O A;  2ZTC A;  3HOW H;  3FKI G;  3STB D;  4X64 L;  4P73 A;  2VUM G;  1X3E A;  4JI5 L;  1GM5 A;  2UU9 Q;  4DV5 Q;  4A3B H;  1YJ9 A;  2I5H A;  3HOX G;  1PFS A;  2KCM A;  4P72 A;  4A3E G;  1HZC A;  2YV5 A;  1PYS B;  2R7D A;  4P71 A;  3OTO Q;  4MNO A;  2HHH L;  4BY7 H;  5C3E G;  4DAY B;  2JA6 G;  3HOU G;  1N33 Q;  1NE3 A;  4JOI A;  4MTN A;  4RMF A;  5IYD G;  1KD1 C;  3U58 A;  5ELN A;  2XTI A;  4DK3 C;  3SGI A;  1ASY A;  2WP8 J;  3NEN A;  5JJK A;  1VQ6 A;  1WCM H;  3RLF A;  2VY3 A;  3CCL A;  2AHO B;  4IFD I;  3TRZ A;  3BZK A;  4L5R C;  4PG3 A;  1I5F A;  1N9W A;  2K52 A;  4A3D H;  1IBK L;  1EYG A;  3PUZ A;  1JE5 A;  2BH2 A;  3BJU A;  2JE6 I;  5DLQ E;  1SE8 A;  2ID0 A;  4LFC Q;  2GN5 A;  2ZJQ A;  3S17 H;  4JBM A;  1VQK A;  4LF8 L;  2R92 G;  4JI0 Q;  5EAY A;  1ASZ A;  2AWO A;  4QGU A;  3GD7 A;  4LF4 Q;  2YTY A;  3M9B A;  5JEA J;  1NJI C;  4LF9 L;  1MIU A;  1TWA H;  2IX0 A;  3UE0 A;  1NBW A;  2B3G A;  4EQ5 A;  4DR5 L;  1A63 A;  4A3K G;  3PF4 A;  4Y52 H;  4AYB E;  3J80 i;  1VS0 A;  4GOP A;  2NZO A;  1IZ6 A;  5IP9 G;  1CKN B;  4Y7N H;  1JMC A;  5C0X I;  5IP7 H;  1Q46 A;  4TQU S;  1HR0 Q;  4X62 L;  2N3S A;  4YWK A;  4O0A A;  3D0F A;  1EWI A;  5GAE C;  4JI2 L;  4JI6 Q;  5IYC H;  2WB1 G;  1H95 A;  1X6O A;  1N32 L;  4YHH L;  1L1O B;  2JQO A;  4QIW E;  4R4C A;  4DR3 L;  4LF7 Q;  4IOC A;  2R7F A;  2HIV A;  1YJN A;  2KHI A;  1KQS A;  1OXS C;  2ALY B;  2VL6 A;  1EQQ A;  4IFD G;  3J7Z C;  4JV5 L;  2PI2 A;  3A5Z B;  3K7U C;  4OXP A;  2NZH A;  1CKO A;  4UP7 A;  3UE1 A;  4DUZ L;  3M7N A;  4A75 A;  2B63 H;  4J15 A;  3GTK H;  1W2B A;  5JJI A;  4AYB G;  2I5M X;  1I3Q H;  3KJP A;  4X65 L;  5M3F G;  1VQP A;  1TWH H;  1J5E L;  4JI7 Q;  3PO3 G;  4QY7 A;  1PHJ A;  5C4X H;  4B3M Q;  1U5K A;  2K14 A;  4ALP A;  3CP0 A;  4GKJ L;  1G51 A;  2MNA A;  3F2D A;  3MXN B;  4LUV A;  1XNR L;  3H3V I;  1UE6 A;  4LF8 Q;  5J3B A;  4JG2 A;  2YYZ A;  4PZ7 A;  4DR6 L;  3J81 c;  2CFM A;  2YTV A;  2YTX A;  4LFA Q;  5K36 G;  1K8A C;  4IJL A;  4UPA A;  3KF6 B;  4P74 A;  4GOP C;  5FJ8 H;  4JBJ A;  3T1H L;  3E9H A;  1PA6 A;  3HOY H;  4LF6 L;  4C3I H;  1Y1W G;  4DR5 Q;  5IE8 A;  1E24 A;  3AFQ A;  4B3R Q;  2F3I A;  1I94 Q;  4TVA B;  4DV5 L;  1YIJ A;  2UU9 L;  2ASB A;  1KXL A;  2C35 B;  2UXC Q;  1PYB A;  1PH9 A;  4DK6 C;  2VS1 A;  4R1J A;  1Y1V H;  2BH8 A;  2CKZ B;  1C9O A;  1N33 L;  2JA8 G;  2ZTD A;  1XMO L;  4JI2 Q;  2ZM6 Q;  1M90 C;  4B3T Q;  5IYB G;  4GN4 B;  3S14 H;  4A3G G;  4O2D A;  4YHH Q;  2JA5 H;  1VQO A;  4BA2 I;  2N78 A;  4LFB L;  1HR0 W;  4IPG A;  1VCI A;  3EIV A;  2NVT H;  1TWC H;  2JA7 G;  2QGQ A;  4R4T A;  4A76 A;  2JK8 A;  4FDB A;  3CCQ A;  3RLO A;  3J81 j;  4A3M H;  2K75 A;  4JV5 Q;  4DUZ Q;  1PH1 A;  3H3V H;  2WAQ E;  1HNW Q;  2RCN A;  1E1T A;  4DNI A;  4DR7 Q;  1HNX Q;  4LFC L;  3PO2 H;  4X65 Q;  4A93 G;  2PNH A;  2N8N A;  3I55 A;  4DR1 L;  4JI0 L;  1SRO A;  1CKN A;  2K5V A;  3PUX A;  5M5X H;  5AJ3 Q;  3H15 A;  3CCS A;  5BR8 Q;  4LF4 L;  1VQD A;  3I4N G;  1NY4 A;  3L0O A;  4DV1 Q;  1XNR Q;  2KHJ A;  2Z6K A;  3GDE A;  2ZJR A;  4HIM A;  4R4Q A;  3JAM i;  2VQF Q;  4ME3 A;  4DR4 Q;  2DUD A;  4DR6 Q;  1OXX K;  3CQZ H;  1S40 A;  3FKI H;  1L1O A;  1X54 A;  2VUM H;  1KRS A;  2JEB I;  2MFI A;  4UY8 C;  3DM3 A;  1HJP A;  2HQL A;  2Y0S E;  1UE1 A;  2PQA A;  3HOX H;  1VQM A;  1MJE A;  4LF6 Q;  4A3E H;  4DV7 L;  3FHW A;  1HR0 L;  4DV6 Q;  4JI4 Q;  4JBK A;  3J7A 5;  2WAQ G;  2R93 G;  5C3E H;  3OYY A;  3F1Z A;  2JA6 H;  3HOU H;  3M85 A;  5IYD H;  3EBE A;  4H02 A;  4DR2 Q;  4JI6 L;  1NTG A;  2NVQ H;  1VQF A;  1X3F A;  3E0E A;  5M3M G;  4EX5 A;  4LF7 L;  3NEM A;  2F4V Q;  1D8L A;  1Y14 B;  1OXT A;  1XPO A;  4HIO A;  4A4I A;  1XMO Q;  3HKZ E;  3I4O A;  2R7Z G;  2IX1 A;  5LMU L;  4AH6 A;  4MZ9 A;  3OW2 A;  3K7A H;  1SR3 A;  4LFB Q;  4GLX A;  1BKB A;  3K81 C;  4A3J G;  4JI7 L;  4HJ5 A;  5LMN Q;  2LSS A;  3S15 H;  2UUC L;  3KF6 A;  1T9H A;  2IHF A;  4B3M L;  2R92 H;  2DGY A;  2Y0S G;  2QA4 A;  3HOV G;  1VQJ A;  3TEH B;  3F2C A;  3CD6 A;  1N8R C;  2Q2U A;  2K5H A;  4QQB X;  3GTL H;  1YNX A;  4JYA L;  1E1O A;  2MQH A;  1G6P A;  4YCU A;  1V9P A;  5JEA G;  2Z6K C;  1KC8 C;  4DR1 Q;  4OO1 G;  3EN2 A;  1TWF H;  2BA0 A;  4A3K H;  5C4J H;  3A0J A;  4LFA L;  4PMW A;  1PVO A;  1A0I A;  1BBW A;  1B8A A;  1L1O C;  4A3I G;  1JT8 A;  1QZH A;  2F52 A;  1VQI A;  1Q86 C;  5IP9 H;  4IPD A;  2KCT A;  4DV0 L;  5HY6 A;  1JJG A;  2VQE L;  4C3J H;  3CME A;  1N36 L;  2OCE A;  4B3R L;  1HZB A;  1I94 L;  1KHI A;  2UUA Q;  3CPW A;  3CAM A;  3M4O H;  4A3C G;  2UXC L;  2ZJP A;  4P75 A;  1UWV A;  1YIT A;  2D0O A;  1SMX A;  4DV7 Q;  1CSP A;  1HZA A;  4JCV E;  4NXN L;  1Z47 A;  1MJC A;  3K8A A;  2N49 A;  4JOI C;  2ZM6 L;  3AQQ A;  4B3T L;  3IRB A;  3CCE A;  2CWP A;  1QUQ B;  1VQ7 A;  4RG1 A;  1L0W A;  4DV4 Q;  1TXY A;  2B29 A;  3TS0 A;  4HIK A;  3E9I A;  2OTL A;  2PQA B;  2K50 A;  5M3F H;  3PO3 H;  3HFZ B;  3NEL A;  4OX9 Q;  4QJF A;  1WOC A;  5LMU Q;  2OTJ A;  4GNX B;  4DR7 L;  1IBM L;  1HNX L;  4GLV B;  2K4K A;  3NBH B;  2UUC Q;  1LYL A;  3CPF A;  3I4M G;  5AJ3 L;  1C7Y A;  2BA1 A;  1CUK A;  1W3S A;  5BR8 L;  1VQC A;  1VQ9 A;  2UUB Q;  3AEV A;  2A1A A;  1DGS A;  3I56 A;  1FJG Q;  3J81 i;  1WJJ A;  4DV1 L;  4A3F G;  3ER0 A;  4JYA Q;  4DAM A;  1Q12 A;  2E2J H;  2CCZ A;  5LMN W;  2VQF L;  4AQY Q;  2NVX H;  4DR4 L;  3TQY A;  1Y1W H;  3FP9 A;  1YBY A;  4YWM A;  3CC7 A;  3KLW A;  2LXJ A;  3KDF B;  4APV A;  4KI0 A;  1XJV A;  3MEF A;  1VQB A;  4DV0 Q;  2UXB Q;  1Q1B A;  3GTG H;  3GTP H;  4IFD J;  2VQE Q;  4DV6 L;  4JI4 L;  4BBS G;  1KAW A;  1U0L A;  3S24 A;  1N36 Q;  3U4Z A;  3H0G G;  1IXR A;  4YWL A;  1RL2 A;  3G4S A;  2OQ0 A;  2JA8 H;  3S1N H;  4DR2 L;  4R4I A;  2NN6 I;  5IWA L;  5IYB H;  4A3G H;  2K5N A;  2MO1 A;  4JI1 L;  4BBR G;  4DV2 Q;  2F4V L;  1BBU A;  5C44 G;  4NXN Q;  4K0K Q;  2H5X A;  1SLJ A;  4JC0 A;  2JA7 H;  3W1B A;  3PGZ A;  3GTM H;  2RHQ B;  5GQO A;  4DUY L;  4KHZ A;  2HIX A;  1KRT A;  4XIG S;  4X6A H;  4LUZ A;  3LGJ A;  5LMN L;  4A93 H;  1I50 H;  2JJQ A;  5GAD C;  4GLA C;  1K83 H;  1YHQ A;  1PH6 A;  1VQ5 A;  2A19 A;  4DKA C;  2ZTE A;  1IBM Q;  1VQH A;  3GTO H;  1WYD A;  3RZO H;  3I4N H;  1J6Q A;  5C0X J;  1K8G A;  4BY1 G;  3S1M H;  5M5W H;  1K3R A;  1P16 A;  2UXD Q;  1IYJ B;  3GTJ H;  1B70 B;  2JA9 A;  5FLM G;  1R9T H;  4OO1 I;  4BA1 I;  1PH8 A;  1K73 C;  1HH2 P;  3S1R H;  1A8V A;  1PH3 A;  1IL2 A;  1NMF A;  1QUQ A;  3G48 A;  4OWW B;  3PF5 A;  2E8G A;  3PUW A;  2A8V A;  2OQK A;  1YVC A;  2YU9 H;  3CC4 A;  4LNQ A;  3PIO A;  2UUA L;  2R93 H;  1PH4 A;  4GS3 A;  5M3M H;  4AIM A;  2NN6 G;  3STB C;  4JI3 Q;  2VW9 A;  4BXX G;  1XMQ Q;  2KBN A;  5GRO A;  4JI8 Q;  4GNX A;  2VNU D;  4DV4 L;  3G71 A;  5IWA Q;  3PUV A;  4JI1 Q;  2R7Z H;  4LUO A;  1VQE A;  4C2M H;  1XTD A;  1JJ2 A;  3HOZ G;  1Q1E A;  4A3J H;  4A3L H;  1HZ9 A;  3AFP A;  3W1G A;  1XPR A;  3GTQ H;  3M3Y H;  4OX9 L;  3TS2 A;  3KJO A;  3HOV H;  4DUY Q;  1KL9 A;  5H1S E;  2Z0S A;  3CCR A;  3ERS X;  3UDX A;  4LW1 A;  4A3L G;  3KDF A;  4NPS A;  1PH7 A;  4OWX B;  2RHS B;  3D31 A;  3Q8D A;  1HNZ Q;  1XNQ Q;  1X9N A;  2UUB L;  1K0R A;  1S72 A;  2D0P A;  1FJG L;  4JBW A;  1SN8 A;  2E2I H;  4WJ3 M;  4A3I H;  3S16 H;  3HOW G;  4LF5 Q;  4AQY L;  3UDI A;  2V1C C;  2QEX A;  4OWT B;  4DPG A;  2R6G A;  4DV3 L;  4A3B G;  3T1Y L;  4HJ7 A;  1O7I A;  3M4P A;  2AMC B;  1GD7 A;  3RN2 A;  4LWC A;  1FVI A;  2E5L L;  4BY7 G;  2UXB L;  4A3C H;  4NB3 A;  4KHP Q;  3HKZ G;  2L15 A;  3WWV A;  3CCV A;  1VQ8 A;  4GNX C;  3A74 A;  2D62 A;  1YJW A;  4NXM L;  4L5Q A;  1Q82 C;  1WCM G;  4DV2 L;  4X66 Q;  3W5O A;  3K0X A;  1PH2 A;  1A62 A;  1EIF A;  1M1K C;  4B3S L;  2WB1 E;  2ES2 A;  4IPC A;  1SFO H;  4IJH A;  1EIY B;  4K0K L;  1Q8K A;  3TRE A;  4GN5 A;  4A3D G;  3UDG A;  3KF8 B;  1LUZ A;  2XGT A;  1D7Q A;  4UP8 A;  2CQO A;  4GKK L;  1UE5 A; 
#chains in the Genus database with same CATH topology
 4CJ1 B;  4A3D B;  1WTO A;  2F0G A;  2QW7 A;  3I73 A;  5A35 A;  3RLN A;  5E7N A;  3RNU A;  4K8I A;  4DNT B;  2PMZ E;  1RTO A;  1H9M A;  4A3F H;  4L63 B;  4QL5 A;  2SOB A;  3ICE A;  2XRQ D;  2UXD L;  3W2D A;  2X6G A;  1IL8 A;  1JQY D;  3T1Y Q;  2RA4 A;  2WB1 B;  1WI5 A;  1UNS A;  1CTM A;  2KA7 A;  1JB7 A;  3K80 C;  2JYO A;  2B2T C;  1V1Q A;  1I6H H;  3HGB A;  1G6Z A;  2EY6 A;  1RKN A;  3T51 B;  1N34 L;  3AYH B;  4JW0 A;  2WFW A;  1VDZ A;  1YNN C;  4IOA A;  1OXV A;  3O13 A;  3TZD A;  4QIW B;  5G3L D;  4EQN A;  1HNZ L;  4K5V A;  1SNC A;  3CCJ A;  1FNU A;  5GAH C;  5FJ8 G;  2PI2 E;  2NVX B;  4O1N A;  3ZJY C;  1VQG A;  5EPK A;  1CA6 A;  4X62 Q;  1QVG A;  4KV6 A;  3PV0 A;  1YHB A;  4C3I B;  1FL0 A;  3GTG B;  1TWG H;  1QVC A;  1VQA A;  4L5T A;  1Y1V G;  1GKH A;  3L2P A;  5M5Y H;  3QG1 A;  2AUK A;  3MXG A;  3S2D H;  3CHB D;  2JA5 B;  3HOZ H;  3A5U A;  1EYD A;  5HGQ A;  3PCO B;  5T1I A;  3S1Q H;  1GHK A;  2KOL A;  1I50 B;  1LM0 A;  2GA4 B;  2NZ1 D;  3JC6 6;  4ME5 A;  3CKI B;  2MP1 A;  1LAC A;  1STG A;  3VDY A;  2Q2H A;  1F9P A;  3I4N B;  1KIX A;  4IO9 A;  1NMG A;  1OXU A;  3T1H Q;  1D5X C;  1HQR D;  4P2C B;  1WTW A;  3G7L A;  2VUM G;  4H44 C;  4DAP A;  3OW7 A;  1CZG A;  4JI5 L;  2UU9 Q;  1EY4 A;  1TS2 A;  4KN7 C;  2I5H A;  4OIK A;  3QOL A;  2KCM A;  4KY5 A;  2EYP A;  1MHW C;  2R7D A;  3OTO Q;  2WAQ B;  3J7Y W;  1NE3 A;  4RMF A;  3HOX B;  2V4D A;  4UAI A;  3U58 A;  1JOR A;  1TS5 A;  2B2V A;  1ASY A;  2WP8 J;  1NUC A;  5JJK A;  1PXU A;  1WCM H;  5KYI A;  4IFD I;  1EZ6 A;  4PG3 A;  1N9W A;  4A3D H;  1IBK L;  1EYG A;  5DLQ E;  1SE8 A;  2ID0 A;  4IUV A;  4LFC Q;  1EYA A;  4LAA A;  3HOV B;  3NP8 A;  1ASZ A;  4KKS A;  5CV7 A;  3M9B A;  4LF9 L;  2R92 B;  3P75 A;  2DJF C;  4DR5 L;  1SYD A;  2EDG A;  1KNE A;  1D1I A;  1O7Z A;  4AYB E;  4A3I B;  1CKN B;  3AB9 A;  4XYQ A;  1HPC A;  3SDZ A;  1ENF A;  3VYT A;  4RHR A;  2CW0 D;  3TME A;  2WB1 G;  2PW5 A;  1H95 A;  1X6O A;  4YHH L;  4R4C A;  3VR5 A;  2I46 A;  1YJN A;  2KHI A;  1KQS A;  1GHJ A;  1OXS C;  3DM1 A;  3E5S A;  2H1E A;  3UE1 A;  1SJE D;  1TS4 A;  3M7N A;  2B63 H;  1SFO B;  4G7Z C;  4X65 L;  3PO3 G;  2L1B A;  3OIQ A;  1GOZ A;  4QY7 A;  5F2D A;  1MBY A;  4FP5 D;  2K14 A;  1F9Q A;  4YIJ A;  1G51 A;  1NR4 A;  2MNA A;  3I72 A;  4KMU C;  2XN9 C;  1EIG A;  2F0M A;  2B2Y A;  5JPM C;  2F3W A;  2YYZ A;  5C0X H;  1WD1 A;  1K8A C;  4IJL A;  4GOP C;  3KF6 B;  4DAY A;  4DN4 M;  3K59 A;  1ET6 A;  1O78 A;  2Z8L A;  4C3I H;  2MGS A;  3T53 B;  2B8F A;  5I6Y A;  5IE8 A;  4B3R Q;  4DV5 L;  2EYM A;  1Y1W B;  1PYB A;  1HCZ A;  5G3L F;  4FXG C;  2CKZ B;  1M90 C;  3T4A C;  5IYB G;  4NDX A;  4O2D A;  2JA5 H;  3RUZ A;  1YNN D;  1VQO A;  2A68 C;  1PYW D;  4IPG A;  1VCI A;  3EIV A;  3T16 A;  3RLO A;  1PH1 A;  3NUC A;  1F2M A;  1RTN A;  3T56 B;  4PQX A;  1Y8N B;  3GTM B;  2B2W C;  2N8N A;  4JI0 L;  5EGT A;  5IGC A;  5BR8 Q;  4MN3 A;  3I4N G;  1NY4 A;  4HMI A;  4HIM A;  3Q6S A;  1K83 B;  3SHL A;  4ME3 A;  4DR4 Q;  5KYL A;  1X54 A;  3R3O A;  4G57 A;  1KRS A;  3V96 A;  3SK6 A;  1HJP A;  2HQL A;  2PQA A;  3HOX H;  3A8J E;  4LF6 Q;  2AQ3 B;  4DV7 L;  2WAQ G;  3F1Z A;  3NXW A;  4H02 A;  3E0E A;  3K5O A;  3NBH A;  4CJ2 C;  4LF7 L;  2F4V Q;  1LO5 D;  1Y14 B;  5IGB A;  1XPO A;  3NTK A;  4A4I A;  4UDU C;  1BUV T;  3HKZ E;  3H6M A;  3MC0 B;  3C1F A;  1B53 A;  4B9X A;  4AH6 A;  1AZQ A;  5JPN C;  4GLX A;  3MZ5 A;  4HJ5 A;  2UUC L;  2R92 H;  3HOV G;  1PFM A;  4KJN A;  4C3H B;  2EVB A;  1LV9 A;  1N8R C;  1YNX A;  4EQO A;  1E1O A;  4YCU A;  1ESR A;  3BYT B;  1KC8 C;  1FYC A;  3EN2 A;  1TWF H;  3ZYY X;  3OSO A;  3A0J A;  3BVZ A;  1TU2 B;  1BBW A;  4A3I G;  1B8A A;  1JT8 A;  1VQI A;  1LT5 D;  1SMY C;  2HD3 A;  5IP9 H;  2KCT A;  4DV0 L;  5HY6 A;  1RCV D;  3ITP A;  4N9P A;  1HZB A;  1I94 L;  2F0Q A;  4ZYS A;  3CAM A;  3HKZ B;  4P75 A;  1UWV A;  2D0O A;  1SMX A;  1HZA A;  4JCV E;  1QJO A;  1MJC A;  3DUZ A;  1QUQ B;  1BF4 A;  1L0W A;  4FXK C;  1HTL D;  3TS0 A;  4HIK A;  2PQA B;  2F0T A;  5FOB B;  2MUY A;  3D4W A;  1IBM L;  1KTK A;  3NBH B;  2L0C A;  1S5D D;  2X6L A;  5COR A;  2BA1 A;  4RH6 A;  3VR4 A;  1C7Y A;  2F03 A;  1F77 A;  3FEW X;  2A1A A;  3I56 A;  1QE6 A;  1FJG Q;  5EJW A;  1Q12 A;  1SYE A;  4CKE A;  5LMN W;  4R8N A;  3I4M B;  1Y1W H;  3FP9 A;  1YBY A;  3CC7 A;  3KLW A;  4PMB A;  1LT6 D;  1EY6 A;  1GUG A;  2RDG A;  2I07 B;  1LTG D;  1MSG A;  1VQB A;  2UXB Q;  4JI4 L;  3S24 A;  1U0L A;  3G4S A;  2OQ0 A;  1A3U A;  3S1N H;  4DR2 L;  2PCF B;  4A3G H;  5C44 G;  1DCZ A;  5HUR A;  4NXN Q;  1SJH D;  1XWE A;  2JA7 H;  3GTM H;  2RHQ B;  1PFB A;  3A54 A;  4J6H A;  1TWH B;  4KHZ A;  3QB3 A;  3LGJ A;  4IUR A;  4A93 H;  1RD9 D;  4JVZ A;  1K83 H;  1PH6 A;  4DKA C;  1WVL A;  1K8G A;  4BY1 G;  3OWF A;  5M5W H;  1P16 A;  4FF2 A;  1DD2 A;  2UXD Q;  3GTJ H;  3HOY B;  2VB3 X;  1AFP A;  2JA9 A;  4B9W A;  1HA6 A;  1GJX A;  2A68 D;  1NMF A;  3G48 A;  4OWW B;  1E2Z A;  2OQK A;  3PIO A;  2UUA L;  1XXG A;  5M3M H;  3STB C;  1I4Q A;  1LTR D;  2ICI A;  2K7V A;  1K3B C;  4DXG A;  4DV4 L;  5IWA Q;  4LUO A;  2PZW A;  1XTD A;  4A3M B;  1Q1E A;  1ESF A;  2KED A;  4A3L H;  4RAU C;  1XPR A;  3GTQ H;  3KJO A;  5E3F A;  1D1K A;  4C3H G;  4GZY C;  5H1S E;  2Z0S A;  2L9H A;  1V1P A;  2BDO A;  2K28 A;  4A3L G;  3KDF A;  4NPS A;  3NSW A;  2RHS B;  3U9O A;  1HNZ Q;  2UUB L;  1S72 A;  1KDB A;  3S16 H;  2QF7 A;  4L6T B;  2HDL A;  3UDI A;  2V1C C;  2QEX A;  4DF7 A;  1HRJ A;  4DV3 L;  3OWE B;  4DXF A;  2KCN A;  2X69 A;  4A3E B;  3RN2 A;  4LWC A;  2EYO A;  5C3E B;  4A3C H;  3HKZ G;  5FLX E;  1DZ1 A;  1VQ8 A;  4GNX C;  2D62 A;  4DV2 L;  3W5O A;  1A62 A;  2ES2 A;  4IPC A;  1EIY B;  4IJH A;  2VXW A;  1LUZ A;  3V05 A;  1O7L A;  1UE5 A;  3CMA A;  1SMY D;  4HJ8 A;  4KKT A;  1AH9 A;  3HG9 A;  4KKU A;  3I4M H;  1GO3 E;  1HQM C;  1ML0 D;  2G5D A;  4L8J A;  2K5W A;  1PV4 A;  3BU2 A;  1WD0 A;  4K14 A;  3MVV A;  2R61 A;  3IFT A;  4CKC A;  2IJ0 A;  4J1M A;  4JI5 Q;  4NP5 A;  3RZD H;  4IQZ A;  4HID A;  1UE7 A;  1IBL L;  5IT9 E;  3QJY A;  3ULJ A;  4KJO A;  3KBX A;  4TKO B;  1Q81 C;  1UEB A;  3DLL A;  3H0G H;  5JJL A;  3I91 A;  5EPJ A;  2MO0 A;  4ZLT F;  3DHQ A;  2E5L Q;  3D8G A;  2EXD A;  3R2T A;  3CC2 A;  3FRP B;  1BO0 A;  1X56 A;  2RQX A;  5FK9 C;  3R8B A;  1IBK Q;  1PTO H;  1H9S A;  1VMP A;  2QIL A;  1EOV A;  1SRU A;  2E2H H;  1H9J A;  1I4X A;  1C0A A;  2F1M A;  2L4N A;  2WKD A;  2XIW A;  4DNR B;  5C4Z A;  4WJ4 A;  1QIL A;  1B3A A;  3CW2 C;  4NKL A;  2K5D A;  1AE3 A;  4LF9 Q;  1KDA A;  1GVP A;  1XPU A;  4QUC A;  1ZEQ X;  5IIF A;  3VA5 A;  2E2J B;  4H7B A;  1LTL A;  3OOC A;  3HOY G;  2EQS A;  3VR6 A;  1B7Y B;  1EEF D;  1QWY A;  1JJC B;  1IKL A;  4FNF A;  3B6Y A;  2FXQ A;  5A2Q E;  3BZC A;  4POG A;  3OIP A;  1K0S A;  1YZ6 A;  1LT3 D;  4ABN A;  3U50 C;  2KQ3 A;  2XRS D;  3HKS A;  3KFU A;  1C48 A;  1W6J A;  3KF8 A;  1V43 A;  4FO2 A;  4KLK A;  4KY7 A;  2JA8 B;  4IPH A;  1E7Z A;  1WFQ A;  3JAM L;  1MD2 D;  3ND8 A;  4X66 L;  4J8Q A;  1G29 1;  4A3M G;  5CGK A;  1VQ4 A;  1U4P A;  1Y8P B;  3CF5 A;  2D2C C;  1A6X A;  2Q2I A;  2J7Z A;  2I0Q A;  3PO2 G;  2FIN B;  3C46 A;  1ZKO A;  2B2U A;  3LWE A;  1Z6H A;  1HFN A;  3GTO B;  3F8T A;  2F0F A;  4YY3 L;  1IYV A;  3JAM c;  4LMQ D;  1H9S B;  2ZTC A;  3HOW H;  3STB D;  4X64 L;  2PQE A;  4EGV A;  4DV5 Q;  1YJ9 A;  1EY0 A;  4A3E G;  1HZC A;  2HCC A;  2R93 B;  2BOS A;  4MNO A;  2HHH L;  4BY7 H;  5C3E G;  3VYS A;  1SAP A;  2K04 A;  2NUC A;  4JOI A;  2NWG A;  1KD1 C;  1WTR A;  3H94 A;  3KLR A;  4EVO A;  3MHB A;  1KNA A;  1PFN A;  5JJZ A;  3BZK A;  1T5E A;  1ENC A;  3PUZ A;  1TY0 A;  2XNA C;  4A3J B;  2JE6 I;  2A69 C;  2FHT A;  1VQK A;  4LF8 L;  5JAV A;  4JI0 Q;  5EAY A;  1I4R A;  2YTY A;  4K5W A;  1M8A A;  2IX0 A;  1A3T A;  4RKL A;  4CHT B;  2K03 A;  4EQ5 A;  4RGO S;  1I4P A;  3PF4 A;  3C3L A;  3PQI A;  1EU4 A;  1VS0 A;  2HQE A;  5FKA C;  5C4J B;  1ICF B;  3TBI B;  1STA A;  1TY2 A;  1STY A;  4CGY B;  1EWI A;  1PRT C;  2AQ2 B;  3WDN A;  5IGF A;  3DWA A;  3QIA A;  2M9V A;  1L1O B;  1GUN A;  1VF7 A;  4QIW E;  4DR3 L;  4LF7 Q;  2R7F A;  2HIV A;  4HCE A;  2B2V C;  3I4L A;  2ALY B;  3J81 L;  2F0K A;  4JV5 L;  1B2T A;  2IPK D;  2PI2 A;  3A5Z B;  4CDD C;  2NZH A;  4DUZ L;  1PLF A;  4J15 A;  5JJI A;  5C5M A;  2DY8 A;  3CP0 A;  4GKJ L;  1DOK A;  3F2D A;  1J9O A;  3PO3 B;  4LUV A;  3F2U A;  1UE6 A;  5J3B A;  3J81 c;  2CFM A;  5KIX A;  3OPO A;  4CKB A;  3CRK C;  5K36 G;  4UPA A;  4P74 A;  1XTC D;  5FJ8 H;  3LWU A;  4RGN A;  4LJZ C;  5J1Z A;  2KUM A;  1H9K A;  1E24 A;  3AFQ A;  2F3I A;  1I94 Q;  1LLR D;  3TP5 A;  3G6J B;  1AEX A;  3MWY W;  1CHQ D;  4BBS B;  2VS1 A;  4JK1 C;  4R1J A;  3QR8 A;  4HMJ A;  1Y1V H;  2BH8 A;  1N33 L;  2JA8 G;  2ZTD A;  5EPL A;  1XMO L;  4JI2 Q;  3GTP B;  1SNQ A;  5EKL A;  1CZW A;  3TDQ A;  2N78 A;  4LFB L;  1G2S A;  1TWC H;  2QGQ A;  2FFK B;  2JK8 A;  3M4Y A;  3J81 j;  3H3V H;  2WAQ E;  5I2X A;  4KD4 A;  2NVY B;  2EY1 A;  4WRD A;  3I55 A;  4DR1 L;  1CKN A;  1LTS D;  3PUX A;  3VYR A;  4ULL A;  4G7H C;  1XNR Q;  2KHJ A;  2ZJR A;  1DOL A;  1D2B A;  3DMU A;  4R4Q A;  1C8C A;  4DR6 Q;  1OXX K;  5ELB A;  1S40 A;  4F7X A;  2VUM H;  1Z7T A;  2JEB I;  2MFI A;  5E4X A;  1VQM A;  3FMC A;  4KHV A;  3I90 A;  3J7A 5;  1HR0 L;  4JI4 Q;  2R93 G;  2ZXP A;  5C3W A;  1O80 A;  3EBE A;  4DR2 Q;  2JN4 A;  2NVQ H;  1X3F A;  1KLU D;  4X3T A;  3D6C A;  2IX1 A;  3WOF A;  3OW2 A;  1B3Q A;  1BKB A;  4A3J G;  4JI7 L;  2LSS A;  3FVQ A;  3KF6 A;  1DYQ A;  4C2M B;  2QA4 A;  3RD4 A;  3TEH B;  5D3I B;  1U4M A;  1JOO A;  1AW7 A;  2PYK A;  3M3Y B;  2QCP X;  3S2H B;  5C4J H;  4LFA L;  3M7G A;  4KN4 C;  3U9S A;  1QZH A;  1Q86 C;  3HEJ A;  3K6O A;  4A3B B;  4V0B A;  5HGT A;  4FXD A;  1N36 L;  2OCE A;  1KHI A;  2UUA Q;  2RSN A;  1U4R A;  2UXC L;  3TP8 A;  2A69 D;  3ERQ A;  1SEB D;  3R93 A;  3K8A A;  2ZM6 L;  1VQ7 A;  4DV4 Q;  2EJF C;  3N6R A;  2HDM A;  1EQT A;  3P1H A;  3Q24 A;  2K50 A;  5ELD A;  3PO3 H;  2Q8I B;  3HFZ B;  3MFG A;  2EXZ A;  1F2Z A;  4QJF A;  1WOC A;  5LMU Q;  2MPM A;  3S17 B;  2OTJ A;  5JVH 3;  4DR7 L;  1HNX L;  2K4K A;  4ILW A;  1CM9 A;  1LYL A;  3KLS A;  1TWA B;  2UUB Q;  1PRT D;  1VQC A;  1VQ9 A;  3E0J A;  3NQI A;  4JYA Q;  3ER0 A;  1EOT A;  4DAM A;  2NVX H;  4N8X 1;  4YWM A;  4Y7N B;  1JE4 A;  2LXJ A;  2FJ2 A;  4XXE A;  1XJV A;  1EFI D;  2LS0 1;  2M00 A;  2F0I A;  1PTO C;  3GTG H;  3GTP H;  1HA5 A;  2VQE Q;  4IFD J;  4BBS G;  3U4Z A;  4YWL A;  1RL2 A;  5DNF A;  3HS0 C;  5IYB H;  2JXM B;  2K5N A;  4JI1 L;  3HP3 A;  4BBR G;  4K2K A;  4DV2 Q;  5KNC A;  3PGZ A;  2LY7 A;  5GQO A;  5C44 B;  4DUY L;  5C4X B;  1I50 H;  2ZXR A;  1S5F D;  3K5M A;  2A19 A;  4I7A A;  2M2L A;  5M9O A;  3I4N H;  1J6Q A;  3P7J A;  2ZXO A;  3TN2 A;  5I2Y A;  2N88 A;  4ZQ3 A;  4BY1 B;  5FLM G;  4OO1 I;  4F8M A;  5L37 A;  1K73 C;  1A8V A;  1QUQ A;  2A8V A;  3PF5 A;  1B50 A;  5KND A;  4GS3 A;  2R3Z A;  2SDF A;  1M4V A;  1MSH A;  3QO2 A;  4AIM A;  2NN6 G;  3DWP A;  2VW9 A;  4BXX G;  3A8I E;  3S14 B;  5GRO A;  3KLS X;  2VNU D;  2DJG C;  1GUW A;  3PUV A;  2NVT B;  4C2M H;  3I70 A;  3A7A B;  1QB5 D;  1BCP C;  3W1G A;  2MHV A;  3M3Y H;  2D5D A;  3HOV H;  1IKM A;  1KL9 A;  3CCR A;  2A74 C;  3ERS X;  3UDX A;  4HN7 A;  5BN4 A;  1PH7 A;  3ONA B;  2PZU A;  1X9N A;  2NB0 A;  4C1N K;  2D0P A;  4JBW A;  3S9W A;  4A3I H;  2L11 A;  3CQZ B;  3FKI B;  4AQY L;  1STH A;  2K6A A;  2R6G A;  4A3B G;  3T1Y L;  1IW7 C;  1O7I A;  1X3P A;  2AMC B;  2F0O A;  1GD7 A;  1PZI D;  4HTH A;  2JA6 B;  3NWT A;  3WWV A;  3MXU A;  2BDN A;  4HSV A;  4X66 Q;  1M1K C;  3K0X A;  3J80 L;  1EIF A;  4C56 C;  1SFO H;  4I7Z C;  4K0K L;  3TRE A;  4K6L A;  1EQV A;  2DY7 A;  3CCM A;  4Q5V A;  2AWN A;  1STN A;  3NK9 A;  1I4G A;  4R8I A;  1JWS D;  1EUJ A;  1VQN A;  1LAB A;  4YY3 Q;  1DON A;  2IY5 B;  2LXK A;  2O5I C;  1AZP A;  3PSI A;  2SNM A;  4A3K B;  3J80 c;  4X64 Q;  3J7A V;  3BDO A;  3SXH A;  3VYU A;  2HT1 A;  2GVA A;  3I7F A;  2AUJ D;  3W3A A;  3U4V A;  4ZK9 B;  5BN3 A;  4XTC S;  5IP7 G;  3EQL C;  4C3J B;  2HHH Q;  1ONL A;  4POF A;  1PRT F;  3BDC A;  5IYC G;  3A8K E;  1X65 A;  2OXP A;  1A2T A;  1NSN S;  3UDF A;  3BZD B;  1XMQ L;  4YCV A;  5C44 H;  4OHJ A;  2OWO A;  5I6W A;  3I8Z A;  1DM0 B;  4NXM Q;  4RHS A;  3NWS A;  3TP6 A;  4B3S Q;  5M3F B;  3BVM A;  4UP9 A;  1RHP A;  2B2W A;  5C4X G;  1ILQ A;  4RFB A;  5JVG 3;  4L5S A;  3RR5 A;  4PZ6 A;  1ENA A;  4GKK Q;  4K6D A;  1X3Q A;  4IUN A;  4RKB A;  1L2F A;  1PTO D;  4BY1 H;  2CWA A;  1BVS A;  1B1Z A;  2WII B;  5LL6 S;  4LF5 L;  3OTO L;  3RN5 A;  2PO4 A;  2IHE A;  2JEA I;  4GOP B;  4DR3 Q;  2G9D A;  3H3V C;  1CSQ A;  4KHP L;  3N52 A;  4X3S A;  2CVR A;  1SND A;  3FPP A;  4HJA A;  1EFW A;  3KYH C;  3PUY A;  3NTI A;  1RIP A;  3E3X A;  1QZG A;  1FD7 D;  4V19 0;  1ILP A;  4GKJ Q;  2RKS A;  1N34 Q;  4C3H H;  2KEN A;  5CR3 A;  2WAC A;  3G6E A;  3PO2 B;  3CXC A;  2EPB A;  3S1M B;  1YI2 A;  3I2Z A;  5T1G A;  5CBE E;  5M5X B;  1CKM A;  4R4O A;  2SEB D;  3FKI G;  1SDF A;  5DM7 3;  1X3E A;  2F0J A;  1R9T B;  1GM5 A;  4S3S A;  1PFS A;  2HCI A;  1BXT A;  4P72 A;  2IWH A;  5CC4 A;  3KUP A;  3FPU B;  3RMH A;  2JA6 G;  1EL0 A;  3HOU G;  1N33 Q;  4MTN A;  5LHY 1;  5IYD G;  3HRZ C;  4FF4 A;  1BCP D;  3MXN A;  1GUO A;  5ELN A;  4DK3 C;  3SGI A;  3D6W A;  3NEN A;  1VQ6 A;  2L5T A;  3RLF A;  2BE5 D;  2AHO B;  1CQV A;  4L5R C;  2R7Z B;  1I5F A;  2K52 A;  1JWU D;  1SYC A;  1SSO A;  1R4Q B;  1JE5 A;  2BH2 A;  1SE2 A;  2ZJQ A;  4JBM A;  1K8M A;  2Y0S B;  2B2U C;  4XQQ A;  2RSO A;  1B9N A;  2AWO A;  1IW7 D;  3GD7 A;  3D3R A;  5C5L A;  1NJI C;  1MIU A;  2B3G A;  4A3K G;  3SEB A;  4RWS C;  3GTL B;  2F0D A;  3PMF A;  2E2I B;  1IZ6 A;  2ENB A;  3D4R A;  4K8J A;  2K01 A;  2WIN B;  4IUP A;  5C0X I;  3H91 A;  4MHE A;  1KLG D;  4C3J G;  4XQN A;  1HR0 Q;  4YWK A;  4O0A A;  5ISR A;  1AP0 A;  2LFN A;  5LL6 X;  2O5J C;  1FNV A;  3AMU A;  1N32 L;  2F0U A;  3C2P A;  5CYU A;  1VMC A;  4QUF A;  3M4O B;  1WTQ A;  4IFD G;  3J7Z C;  2K32 A;  3K7U C;  4OXP A;  4UP7 A;  4A75 A;  1W2B A;  2I5M X;  3KJP A;  1PMR A;  5EBC A;  5M3F G;  1VQP A;  1TWH H;  3OMC A;  1J5E L;  4JI7 Q;  3A56 A;  1PHJ A;  1U5K A;  5COY A;  4ALP A;  5I4D A;  4FF3 A;  5CV8 A;  4XT1 B;  3MXN B;  3IAY A;  4JG2 A;  4MTK A;  2YTV A;  4LFA Q;  1SE4 A;  4A3F B;  3E9H A;  5EQ0 A;  3HOY H;  4OIJ A;  4LF6 L;  4DR5 Q;  1HXY D;  1E2V A;  4TVA B;  1KXL A;  2KEE A;  1STE A;  2UXC Q;  5I9P A;  1ZYR C;  1PH9 A;  1LTI D;  1PTO F;  2L55 A;  3NE5 B;  1Q90 A;  2C9O A;  1Y69 U;  2FMM A;  4RGT A;  2ZM6 Q;  2EJM A;  2KHS A;  3NBI A;  4YHH Q;  2Z9H A;  4BA2 I;  1TT2 A;  2IW3 A;  1K8O A;  4A3M H;  2K75 A;  2RCN A;  5CV4 A;  4DR7 Q;  1HNX Q;  2E75 C;  3EA6 A;  3PO2 H;  4DK0 A;  4X65 Q;  2PNH A;  2PPB C;  1STB A;  1F2L A;  2K5V A;  5M5X H;  3H15 A;  3T13 A;  1FR3 A;  3EJI A;  4LF4 L;  2RDF A;  3IL8 A;  3NQT A;  3GDE A;  2Z6K A;  5D65 A;  5D3D A;  4HR7 B;  3JAM i;  2O4X A;  1EY8 A;  1L1O A;  2TMP A;  4Z9C B;  2ICE C;  1UE1 A;  1HHV A;  1BR9 A;  4A3E H;  4PMC A;  3K5L A;  1TWG B;  4KD3 A;  4EQP A;  5C3E H;  3M85 A;  4JI6 L;  3E6Z X;  1VQF A;  1BQQ T;  5M5Y B;  3NEM A;  1CK1 A;  2A6E C;  4KK7 A;  1D5Z C;  3HZX A;  3S2D B;  2R7Z G;  3HOZ B;  3K81 C;  1PDQ A;  1BCP F;  1T9H A;  2IHF A;  4B3M L;  3S1Q B;  2Y0S G;  5FO7 B;  4I65 A;  4UHV A;  3EVQ A;  3F2C A;  3CD6 A;  2Q2U A;  4DGZ A;  3I3C A;  1SYB A;  3GTL H;  2LKV A;  1F9S A;  1V9P A;  5JEA G;  4OO1 G;  4RGM A;  2BA0 A;  4QMG A;  4U68 A;  2XSC A;  3PIP 3;  5TSS A;  1A0I A;  1PVO A;  5DEH A;  4WOR A;  2Z6B A;  1JJG A;  5DAU A;  1LTB D;  4OEL B;  3CME A;  3K5N A;  1HUN A;  4B08 A;  1QNK A;  3M4O H;  2ZJP A;  1YIT A;  4DV7 Q;  3K58 A;  3MXP A;  5JOB A;  4NXN L;  1Z47 A;  5IOC A;  1UEA B;  4B3T L;  3AQQ A;  3CCE A;  2CWP A;  1WCM B;  1GUS A;  1QG7 A;  3BVG A;  1TXY A;  2B29 A;  4HED A;  3E9I A;  2QKI C;  2CHB D;  1JR0 D;  3NEL A;  1JWM D;  4GNX B;  2Z4I A;  3BDL A;  1EEI D;  2QDB A;  1C4Q A;  2E74 C;  1B44 D;  2UUC Q;  1KDC A;  3CPF A;  5AJ3 L;  1RDP D;  1W3S A;  1DGS A;  3J81 i;  1WJJ A;  4DV1 L;  2NTS A;  4A3F G;  5K36 H;  2E2J H;  2CCZ A;  2VQF L;  4AQY Q;  2XWJ B;  5K5P A;  1J8I A;  1JB3 A;  3KK7 A;  4APV A;  4KI0 A;  3MEF A;  4DV0 Q;  1LT4 D;  5ELE A;  2MJ8 A;  4DV6 L;  2FMC A;  1L0X B;  1IXR A;  2JA8 H;  3DEP A;  1LTA D;  4R4I A;  5IWA L;  3LNN A;  2E76 C;  3UI2 A;  1BBU A;  3VR3 A;  5I9O A;  4K0K Q;  2H5X A;  1SLJ A;  2PMZ B;  4H0L C;  4JC0 A;  5C6A A;  2B63 B;  4BBR B;  1QNU A;  1NR2 A;  4QCL A;  4CDF C;  3QOJ A;  4X6A H;  5LMN L;  2JJQ A;  1VQ5 A;  2ZTE A;  1LTT D;  1VQH A;  1IBM Q;  3GTO H;  1ZYR D;  2B2Y C;  1K3R A;  1B70 B;  1I6V C;  2EYH A;  1PH8 A;  1HH2 P;  4ZCK A;  3DXJ C;  2AQ1 B;  3Q23 A;  1BOS A;  2A6H C;  2E8G A;  1SYG A;  2F4I A;  3PUW A;  2PNR C;  2R93 H;  1YVC A;  4LNQ A;  3CC4 A;  2J4X A;  3LX0 A;  1XMQ Q;  2KBN A;  4WJW A;  2EY5 A;  3AU7 A;  1JJ2 A;  3HOZ G;  2WV6 D;  3BYY B;  4A3J H;  1HZ9 A;  4ODG A;  4XYO A;  3J7A F;  3TS2 A;  4OX9 L;  1HFG A;  2NTT A;  4G4K A;  4OWX B;  3Q8D A;  3CU7 A;  1K0R A;  1KAA A;  2EYF A;  1QOH A;  1ICW A;  4LF5 Q;  1VF5 C;  4RA8 A;  2A6E D;  1S5E D;  4HJ7 A;  1G91 A;  1YNJ C;  4G7O C;  1FVI A;  3QWN A;  4QF4 A;  2E5L L;  2TSS A;  3NPP A;  4KHP Q;  4LK1 C;  3MAQ A;  4Q0F A;  3WOE A;  4BWG B;  1A15 A;  5EKI A;  4L5Q A;  1Q82 C;  1WCM G;  1G8Z D;  2B2T A;  1PH2 A;  3A7L A;  1EWC A;  4IN3 A;  4OEM B;  1SNP A;  1Q8K A;  2IL8 A;  2K5Q A;  3GP7 A;  4GN5 A;  4A3D G;  1B4O A;  3UDG A;  1KAB A;  1D7Q A;  4UP8 A;  4O42 A;  1IHZ A;  3C1E A;  1TQO A;  2PZT A;  3PIO 3;  1AE2 A;  1MKH A;  1EWH A;  5CV9 A;  1Q7Y C;  4OON A;  1CT1 D;  2VZA A;  1K9M C;  4IZ8 A;  3ULL A;  2EZV A;  3GO5 A;  1TVX A;  1TWF B;  1ZXT A;  4XT3 B;  4PZ8 A;  2F0S A;  3CCU A;  2NBF A;  1EYC A;  1S5C D;  2L12 A;  1U4L A;  5ELO A;  1VQL A;  2OF1 A;  5IY0 A;  2HUG A;  2F0N A;  2RF4 A;  4DV3 Q;  3TZU A;  5FLX L;  2IT1 A;  4BBS H;  2N55 A;  2XWB B;  4TSS A;  4JPB W;  3K57 A;  1L0Y B;  1SE3 A;  4JI3 L;  1X3G A;  3DEO A;  4BBR H;  3L9A X;  2P5Z X;  1U9R A;  4JI8 L;  1EQR A;  3JAM E;  1TS3 A;  1GUT A;  5CV6 A;  2B63 G;  1PRT B;  4X3K A;  1X55 A;  2EIF A;  4AYB B;  3D4D A;  4OGQ C;  4HJ9 A;  1A3V A;  2ATW A;  1YEZ A;  2B8G A;  5FLX c;  3GTK B;  2GVB A;  2OEO A;  4HAE A;  1HNW L;  5IGD A;  5GAG C;  1I3Q B;  2NVY H;  3KOJ A;  4GN3 B;  2K1B A;  5C0X G;  1XNQ L;  1EY7 A;  1FGB D;  1Z9F A;  1YHA A;  2AKW B;  4C3I G;  5FLM H;  2I5L X;  3K0Y A;  1WTH A;  4CJ0 B;  4N8F A;  4OL7 A;  5IT9 L;  4F87 A;  1JC7 A;  1S3O A;  1Y8O B;  1N32 Q;  2F0P A;  1R4P B;  1IBL Q;  3IFD A;  2EYL A;  3S1N B;  2NN6 H;  3PIP A;  4BXX H;  4A3G B;  1F9R A;  3M4Q A;  4RCO A;  2JA5 G;  1A2U A;  1NNX A;  3L7Z C;  1CFM A;  4YCW A;  1DOM A;  2JA7 B;  1J5E Q;  1PH5 A;  2Q2T A;  5IT9 c;  1D5M C;  5IGG A;  1P8L A;  1E3P A;  1E22 A;  4A93 B;  1OTC A;  3R2I A;  1SYF A;  2Z1C A;  3SE0 A;  3F2B A;  2C5C A;  4IUT A;  2A6H D;  3ULP A;  4HSP A;  3S2H H;  4M1U B;  5M5W B;  1QVF A;  2BE5 C;  1D6E C;  1FGU A;  3X3M A;  3GTJ B;  1GXD C;  4P73 A;  3SK4 A;  5A2Q L;  4A3B H;  1S4Z A;  3HOX G;  1EZ8 A;  2YV5 A;  1PYS B;  4ZUJ A;  4P71 A;  4DAY B;  1EY9 A;  2XTI A;  5M3M B;  1XX8 A;  3HOU B;  3J81 E;  1NCV A;  2VY3 A;  3CCL A;  3TRZ A;  2A5H A;  3GV6 A;  1NAP A;  1JOQ A;  3BJU A;  1G2T A;  2G9H D;  1ROD A;  2GN5 A;  3GTQ B;  3S17 H;  2R92 G;  3K7A B;  4KY6 A;  4MIU A;  4QGU A;  2K05 A;  1YNJ D;  4LF4 Q;  3S15 B;  5JEA J;  2XVS A;  1TWA H;  1II3 A;  3UE0 A;  2F0E A;  5J39 A;  3X3N A;  1NBW A;  1A63 A;  1EIH A;  4Y52 H;  3J80 i;  4GOP A;  3S16 B;  2NZO A;  5IP9 G;  3MFY A;  4Y7N H;  1JMC A;  5IP7 H;  2KCC A;  1Q46 A;  4TQU S;  4X62 L;  2N3S A;  3D0F A;  2VB2 X;  5GAE C;  4JI2 L;  5C4H A;  4JI6 Q;  5IYC H;  1PZK D;  2JQO A;  1WTV A;  4IOC A;  1V8Q A;  1IYU A;  3GV3 A;  3GQB A;  1SBB B;  2VL6 A;  1EQQ A;  5EKK A;  2CH4 A;  1CKO A;  3Q22 A;  4IAL A;  1SNO A;  2K33 A;  4CDC C;  3GTK H;  2E2D C;  4AYB G;  1I3Q H;  4M8A A;  1Q8I A;  5CBA E;  5C4X H;  1CHP D;  4B3M Q;  5IOD A;  5EBD A;  3SK5 A;  1XNR L;  2F0L A;  1EY5 A;  3H3V I;  4LF8 Q;  1MGS A;  4DR6 L;  4PZ7 A;  1FNW A;  2YTX A;  4JBJ A;  5E1F A;  3T1H L;  1PA6 A;  3EFX D;  1Y1W G;  3RZD B;  2UU9 L;  1YIJ A;  2ASB A;  2C35 B;  5ELC A;  4ZKB B;  2Z4H A;  4QB4 A;  4DK6 C;  3H0G B;  1C9O A;  1CQF A;  2KJX A;  4B3T Q;  1DXM A;  2DNE A;  4A3G G;  4GN4 B;  2CH4 W;  3S14 H;  2KEC A;  2RBM A;  1HR0 W;  2NVT H;  2JA7 G;  1PTO B;  4R4T A;  1HTP A;  4A76 A;  4FDB A;  3CCQ A;  4RCN A;  1BBX C;  4JV5 Q;  2E2H B;  4BS9 A;  4DUZ Q;  5BN5 A;  1E1T A;  4DNI A;  4FYD A;  1T5X D;  4LFC L;  4A93 G;  1JIC A;  4IUU A;  4ID6 A;  1SRO A;  3CCS A;  5AJ3 Q;  1VQD A;  4NW2 A;  3L0O A;  4DV1 Q;  2VQF Q;  3MTS A;  1ET9 A;  2DUD A;  2QEJ C;  3RZO B;  3CQZ H;  3FKI H;  2A73 B;  4UY8 C;  3DM3 A;  2Y0S E;  1K28 A;  1W6K A;  1DJR D;  4H13 C;  1MJE A;  4DFA A;  3FHW A;  4JBK A;  4DV6 Q;  2JA6 H;  3OYY A;  2F0V A;  3HOU H;  1UAP A;  2BCO A;  3S1R B;  5IYD H;  2DN8 A;  1NTG A;  4ZAI A;  5M3M G;  5CV5 A;  4EX5 A;  2Q8T A;  2YU9 B;  1D8L A;  1SNM A;  2H4O A;  1OXT A;  4HIO A;  1XMO Q;  2F0H A;  2F3V A;  3I4O A;  2CQA A;  5LMU L;  4MZ9 A;  3K7A H;  1SR3 A;  4LFB Q;  2F0W A;  3NTH A;  5LMN Q;  1JCK B;  3S15 H;  5DM6 3;  2DGY A;  2IX3 A;  1E0B A;  1VQJ A;  1F2Y A;  2EY2 A;  1WTP A;  4QQB X;  2K5H A;  1H9R A;  4JYA L;  1G6P A;  2MQH A;  4HCS A;  1TR5 A;  2Z6K C;  4DR1 Q;  2ZT9 C;  3H09 A;  1V1O A;  4A3K H;  1TII D;  1EU3 A;  4PMW A;  1BCP B;  4PNY A;  2NYZ D;  1L1O C;  4C1N I;  1Q3L A;  3HOW B;  2F52 A;  4WFN 3;  5J22 A;  2RCF A;  4IPD A;  3CRL C;  4ZRZ A;  2VQE L;  4C3J H;  4E6I A;  4B3R L;  5FO8 B;  4X3U A;  3CPW A;  4BY7 B;  4A3C G;  1RF2 D;  1XYI A;  1CSP A;  5AFW A;  2N49 A;  4JOI C;  3IRB A;  4IFD H;  4RG1 A;  4XDX A;  2QDL A;  2OTL A;  1AN8 A;  1BDO A;  3TSS A;  4F88 A;  3Q0A A;  4R9W A;  5M3F H;  4OX9 Q;  3V2T A;  3A55 A;  4GLV B;  5E4W C;  3I4M G;  1CUK A;  5BR8 L;  3AEV A;  3MEH A;  1OO9 B;  3SR1 A;  1RJT A;  1UUP A;  4DR4 L;  3TQY A;  3SVM A;  5IGE A;  2OT2 A;  1MI2 A;  1V1P B;  4DK1 A;  3KDF B;  4ZUI A;  2O2L D;  2SNS A;  4NMZ A;  1Q1B A;  5C3X A;  1KAW A;  1N36 Q;  3H0G G;  5NUC A;  2DNC A;  5KGU A;  4U67 3;  4FVM A;  3P20 A;  2NN6 I;  1WTX A;  2MO1 A;  3IKJ A;  1JOK A;  2F4V L;  3OMG A;  1BNZ A;  3W1B A;  1I6H B;  4TRD A;  3VA7 A;  2HIX A;  1KRT A;  1I4H A;  2RDH A;  4XIG S;  2EJG C;  4LUZ A;  1O7Y A;  4DAV A;  3FDT A;  5GAD C;  4N9T A;  4GLA C;  5KEE A;  1YHQ A;  1CI3 M;  1QCB D;  3RZO H;  1WYD A;  2LMC B;  3MA2 B;  5C0X J;  3S1M H;  3NHH A;  3SK8 A;  5FO9 B;  1IYJ B;  2JP1 A;  2PW7 A;  1R9T H;  2EE1 A;  2RVL A;  4BA1 I;  4DA2 A;  3S1R H;  1S5B D;  1PH3 A;  1IL2 A;  3OHX C;  5KNB A;  2YU9 H;  1PH4 A;  1Y1V B;  4K2L A;  4CDE C;  4JI3 Q;  4JI8 Q;  4GNX A;  4K5X A;  2KVM A;  3G71 A;  3J80 E;  1TWC B;  4JI1 Q;  2R7Z H;  3KBG A;  1VQE A;  1TKW B;  1X32 A;  1HNW Q;  3AFP A;  3DWQ A;  4DUY Q;  5D14 A;  1HUM A;  4LW1 A;  1B9M A;  2JSO A;  4ZKC B;  3D31 A;  5JEA H;  4OO1 H;  3ND9 A;  1XNQ Q;  1PZJ D;  1FJG L;  4WJ3 M;  1SN8 A;  2E2I H;  5CMD A;  3HOW G;  4FF1 A;  2B39 A;  2VUM B;  3BG3 A;  4OWT B;  4DPG A;  5KRU A;  2EOT A;  3ERO A;  3M4P A;  4IUQ A;  4CBV A;  2J0T D;  1CA5 A;  3VR2 A;  4BY7 G;  2UXB L;  4NB3 A;  2Q8R E;  2L15 A;  5ELF A;  4DU9 A;  1E2W A;  2NVQ B;  4PV1 C;  1SXT A;  3CCV A;  3URY A;  3A74 A;  1YJW A;  3L3O C;  3BS1 A;  4NXM L;  4B3S L;  4KTA A;  2D9U A;  2WB1 E;  2WKC A;  2CW0 C;  3TP7 A;  4XQJ A;  3KF8 B;  2XGT A;  2EYJ A;  2CQO A;  4GKK L; 
#chains in the Genus database with same CATH homology
 3CCM A;  2AWN A;  1AE2 A;  3CMA A;  1MKH A;  4HJ8 A;  1Q7Y C;  1AH9 A;  4OON A;  1EUJ A;  2VZA A;  3RLN A;  1VQN A;  1GO3 E;  1K9M C;  4YY3 Q;  3I4M H;  5E7N A;  3ULL A;  3RNU A;  2IY5 B;  2LXK A;  1PV4 A;  3GO5 A;  3BU2 A;  3PSI A;  2PMZ E;  4PZ8 A;  4A3F H;  3J80 c;  3CCU A;  4X64 Q;  4QL5 A;  3ICE A;  2UXD L;  4JI5 Q;  5ELO A;  2HT1 A;  2GVA A;  3I7F A;  3U4V A;  1VQL A;  5IY0 A;  3RZD H;  4XTC S;  5IP7 G;  4HID A;  1UE7 A;  1IBL L;  3ULJ A;  2HHH Q;  2RF4 A;  4DV3 Q;  4POF A;  3T1Y Q;  2IT1 A;  1Q81 C;  1UEB A;  5IYC G;  3DLL A;  4BBS H;  1WI5 A;  3H0G H;  5JJL A;  1X65 A;  2MO0 A;  2E5L Q;  2EXD A;  1JB7 A;  3K80 C;  4JI3 L;  1X3G A;  3CC2 A;  3UDF A;  4BBR H;  1V1Q A;  1XMQ L;  1I6H H;  4YCV A;  1X56 A;  4JI8 L;  1EQR A;  5C44 H;  2OWO A;  2B63 G;  1X55 A;  2EIF A;  1IBK Q;  4NXM Q;  1EOV A;  1SRU A;  2E2H H;  4B3S Q;  1N34 L;  4UP9 A;  4HJ9 A;  3AYH B;  1C0A A;  5C4X G;  2ATW A;  1YEZ A;  4L5S A;  5FLX c;  1HNW L;  2GVB A;  2WFW A;  3RR5 A;  4WJ4 A;  5GAG C;  3CW2 C;  2NVY H;  4PZ6 A;  4GKK Q;  1AE3 A;  4LF9 Q;  4IOA A;  1GVP A;  1OXV A;  1XPU A;  3KOJ A;  4GN3 B;  1L2F A;  4BY1 H;  5C0X G;  1HNZ L;  1XNQ L;  3CCJ A;  2CWA A;  5GAH C;  1BVS A;  2PI2 E;  1LTL A;  1Z9F A;  5FJ8 G;  1YHA A;  2AKW B;  2EQS A;  3HOY G;  1B7Y B;  5FLM H;  3ZJY C;  1JJC B;  2I5L X;  4LF5 L;  1VQG A;  3B6Y A;  2FXQ A;  3OTO L;  3RN5 A;  2IHE A;  3BZC A;  4POG A;  4X62 Q;  1QVG A;  1YZ6 A;  3PV0 A;  2JEA I;  1YHB A;  1FL0 A;  1S3O A;  3U50 C;  1TWG H;  3KFU A;  1QVC A;  3HKS A;  1N32 Q;  1VQA A;  4GOP B;  4L5T A;  4DR3 Q;  1Y1V G;  1IBL Q;  4KHP L;  1CSQ A;  1V43 A;  4KLK A;  1GKH A;  3L2P A;  4IPH A;  3PIP A;  5M5Y H;  4BXX H;  1E7Z A;  3M4Q A;  2JA5 G;  1WFQ A;  4HJA A;  1EFW A;  3L7Z C;  4YCW A;  4X66 L;  3S2D H;  3KYH C;  3PUY A;  1J5E Q;  1RIP A;  1PH5 A;  1G29 1;  2Q2T A;  4A3M G;  1VQ4 A;  5IT9 c;  1QZG A;  3A5U A;  3HOZ H;  3CF5 A;  1P8L A;  4GKJ Q;  1E3P A;  1E22 A;  2Q2I A;  3PCO B;  5HGQ A;  1N34 Q;  2I0Q A;  3PO2 G;  3S1Q H;  1LM0 A;  4C3H H;  1OTC A;  3JC6 6;  2KEN A;  3F2B A;  3VDY A;  2Q2H A;  3F8T A;  3ULP A;  3G6E A;  4YY3 L;  3CXC A;  1KIX A;  3S2H H;  3JAM c;  1QVF A;  4IO9 A;  1NMG A;  3I2Z A;  1YI2 A;  1OXU A;  3T1H Q;  1FGU A;  1CKM A;  4R4O A;  2ZTC A;  3HOW H;  3FKI G;  3STB D;  4X64 L;  4P73 A;  2VUM G;  1X3E A;  4JI5 L;  1GM5 A;  2UU9 Q;  4DV5 Q;  4A3B H;  1YJ9 A;  2I5H A;  3HOX G;  1PFS A;  2KCM A;  4P72 A;  4A3E G;  1HZC A;  2YV5 A;  1PYS B;  2R7D A;  4P71 A;  3OTO Q;  4MNO A;  2HHH L;  4BY7 H;  5C3E G;  4DAY B;  2JA6 G;  3HOU G;  1N33 Q;  1NE3 A;  4JOI A;  4MTN A;  4RMF A;  5IYD G;  1KD1 C;  3U58 A;  5ELN A;  2XTI A;  4DK3 C;  3SGI A;  1ASY A;  2WP8 J;  3NEN A;  5JJK A;  1VQ6 A;  1WCM H;  3RLF A;  2VY3 A;  3CCL A;  2AHO B;  4IFD I;  3TRZ A;  3BZK A;  4L5R C;  4PG3 A;  1I5F A;  1N9W A;  2K52 A;  4A3D H;  1IBK L;  1EYG A;  3PUZ A;  1JE5 A;  2BH2 A;  3BJU A;  2JE6 I;  5DLQ E;  1SE8 A;  2ID0 A;  4LFC Q;  2GN5 A;  2ZJQ A;  3S17 H;  4JBM A;  1VQK A;  4LF8 L;  2R92 G;  4JI0 Q;  5EAY A;  1ASZ A;  2AWO A;  4QGU A;  3GD7 A;  4LF4 Q;  2YTY A;  3M9B A;  5JEA J;  1NJI C;  4LF9 L;  1MIU A;  1TWA H;  2IX0 A;  3UE0 A;  1NBW A;  2B3G A;  4EQ5 A;  4DR5 L;  1A63 A;  4A3K G;  3PF4 A;  4Y52 H;  4AYB E;  3J80 i;  1VS0 A;  4GOP A;  2NZO A;  1IZ6 A;  5IP9 G;  1CKN B;  4Y7N H;  1JMC A;  5C0X I;  5IP7 H;  1Q46 A;  4TQU S;  1HR0 Q;  4X62 L;  2N3S A;  4YWK A;  4O0A A;  3D0F A;  1EWI A;  5GAE C;  4JI2 L;  4JI6 Q;  5IYC H;  2WB1 G;  1H95 A;  1X6O A;  1N32 L;  4YHH L;  1L1O B;  2JQO A;  4QIW E;  4R4C A;  4DR3 L;  4LF7 Q;  4IOC A;  2R7F A;  2HIV A;  1YJN A;  2KHI A;  1KQS A;  1OXS C;  2ALY B;  2VL6 A;  1EQQ A;  4IFD G;  3J7Z C;  4JV5 L;  2PI2 A;  3A5Z B;  3K7U C;  4OXP A;  2NZH A;  1CKO A;  4UP7 A;  3UE1 A;  4DUZ L;  3M7N A;  4A75 A;  2B63 H;  4J15 A;  3GTK H;  1W2B A;  5JJI A;  4AYB G;  2I5M X;  1I3Q H;  3KJP A;  4X65 L;  5M3F G;  1VQP A;  1TWH H;  1J5E L;  4JI7 Q;  3PO3 G;  4QY7 A;  1PHJ A;  5C4X H;  4B3M Q;  1U5K A;  2K14 A;  4ALP A;  3CP0 A;  4GKJ L;  1G51 A;  2MNA A;  3F2D A;  3MXN B;  4LUV A;  1XNR L;  3H3V I;  1UE6 A;  4LF8 Q;  5J3B A;  4JG2 A;  2YYZ A;  4PZ7 A;  4DR6 L;  3J81 c;  2CFM A;  2YTV A;  2YTX A;  4LFA Q;  5K36 G;  1K8A C;  4IJL A;  4UPA A;  3KF6 B;  4P74 A;  4GOP C;  5FJ8 H;  4JBJ A;  3T1H L;  3E9H A;  1PA6 A;  3HOY H;  4LF6 L;  4C3I H;  1Y1W G;  4DR5 Q;  5IE8 A;  1E24 A;  3AFQ A;  4B3R Q;  2F3I A;  1I94 Q;  4TVA B;  4DV5 L;  1YIJ A;  2UU9 L;  2ASB A;  1KXL A;  2C35 B;  2UXC Q;  1PYB A;  1PH9 A;  4DK6 C;  2VS1 A;  4R1J A;  1Y1V H;  2BH8 A;  2CKZ B;  1C9O A;  1N33 L;  2JA8 G;  2ZTD A;  1XMO L;  4JI2 Q;  2ZM6 Q;  1M90 C;  4B3T Q;  5IYB G;  4GN4 B;  3S14 H;  4A3G G;  4O2D A;  4YHH Q;  2JA5 H;  1VQO A;  4BA2 I;  2N78 A;  4LFB L;  1HR0 W;  4IPG A;  1VCI A;  3EIV A;  2NVT H;  1TWC H;  2JA7 G;  2QGQ A;  4R4T A;  4A76 A;  2JK8 A;  4FDB A;  3CCQ A;  3RLO A;  3J81 j;  4A3M H;  2K75 A;  4JV5 Q;  4DUZ Q;  1PH1 A;  3H3V H;  2WAQ E;  1HNW Q;  2RCN A;  1E1T A;  4DNI A;  4DR7 Q;  1HNX Q;  4LFC L;  3PO2 H;  4X65 Q;  4A93 G;  2PNH A;  2N8N A;  3I55 A;  4DR1 L;  4JI0 L;  1SRO A;  1CKN A;  2K5V A;  3PUX A;  5M5X H;  5AJ3 Q;  3H15 A;  3CCS A;  5BR8 Q;  4LF4 L;  1VQD A;  3I4N G;  1NY4 A;  3L0O A;  4DV1 Q;  1XNR Q;  2KHJ A;  2Z6K A;  3GDE A;  2ZJR A;  4HIM A;  4R4Q A;  3JAM i;  2VQF Q;  4ME3 A;  4DR4 Q;  2DUD A;  4DR6 Q;  1OXX K;  3CQZ H;  1S40 A;  3FKI H;  1L1O A;  1X54 A;  2VUM H;  1KRS A;  2JEB I;  2MFI A;  4UY8 C;  3DM3 A;  1HJP A;  2HQL A;  2Y0S E;  1UE1 A;  2PQA A;  3HOX H;  1VQM A;  1MJE A;  4LF6 Q;  4A3E H;  4DV7 L;  3FHW A;  1HR0 L;  4DV6 Q;  4JI4 Q;  4JBK A;  3J7A 5;  2WAQ G;  2R93 G;  5C3E H;  3OYY A;  3F1Z A;  2JA6 H;  3HOU H;  3M85 A;  5IYD H;  3EBE A;  4H02 A;  4DR2 Q;  4JI6 L;  1NTG A;  2NVQ H;  1VQF A;  1X3F A;  3E0E A;  5M3M G;  4EX5 A;  4LF7 L;  3NEM A;  2F4V Q;  1D8L A;  1Y14 B;  1OXT A;  1XPO A;  4HIO A;  4A4I A;  1XMO Q;  3HKZ E;  3I4O A;  2R7Z G;  2IX1 A;  5LMU L;  4AH6 A;  4MZ9 A;  3OW2 A;  3K7A H;  1SR3 A;  4LFB Q;  4GLX A;  1BKB A;  3K81 C;  4A3J G;  4JI7 L;  4HJ5 A;  5LMN Q;  2LSS A;  3S15 H;  2UUC L;  3KF6 A;  1T9H A;  2IHF A;  4B3M L;  2R92 H;  2DGY A;  2Y0S G;  2QA4 A;  3HOV G;  1VQJ A;  3TEH B;  3F2C A;  3CD6 A;  1N8R C;  2Q2U A;  2K5H A;  4QQB X;  3GTL H;  1YNX A;  4JYA L;  1E1O A;  2MQH A;  1G6P A;  4YCU A;  1V9P A;  5JEA G;  2Z6K C;  1KC8 C;  4DR1 Q;  4OO1 G;  3EN2 A;  1TWF H;  2BA0 A;  4A3K H;  5C4J H;  3A0J A;  4LFA L;  4PMW A;  1PVO A;  1A0I A;  1BBW A;  1B8A A;  1L1O C;  4A3I G;  1JT8 A;  1QZH A;  2F52 A;  1VQI A;  1Q86 C;  5IP9 H;  4IPD A;  2KCT A;  4DV0 L;  5HY6 A;  1JJG A;  2VQE L;  4C3J H;  3CME A;  1N36 L;  2OCE A;  4B3R L;  1HZB A;  1I94 L;  1KHI A;  2UUA Q;  3CPW A;  3CAM A;  3M4O H;  4A3C G;  2UXC L;  2ZJP A;  4P75 A;  1UWV A;  1YIT A;  2D0O A;  1SMX A;  4DV7 Q;  1CSP A;  1HZA A;  4JCV E;  4NXN L;  1Z47 A;  1MJC A;  3K8A A;  2N49 A;  4JOI C;  2ZM6 L;  3AQQ A;  4B3T L;  3IRB A;  3CCE A;  2CWP A;  1QUQ B;  1VQ7 A;  4RG1 A;  1L0W A;  4DV4 Q;  1TXY A;  2B29 A;  3TS0 A;  4HIK A;  3E9I A;  2OTL A;  2PQA B;  2K50 A;  5M3F H;  3PO3 H;  3HFZ B;  3NEL A;  4OX9 Q;  4QJF A;  1WOC A;  5LMU Q;  2OTJ A;  4GNX B;  4DR7 L;  1IBM L;  1HNX L;  4GLV B;  2K4K A;  3NBH B;  2UUC Q;  1LYL A;  3CPF A;  3I4M G;  5AJ3 L;  1C7Y A;  2BA1 A;  1CUK A;  1W3S A;  5BR8 L;  1VQC A;  1VQ9 A;  2UUB Q;  3AEV A;  2A1A A;  1DGS A;  3I56 A;  1FJG Q;  3J81 i;  1WJJ A;  4DV1 L;  4A3F G;  3ER0 A;  4JYA Q;  4DAM A;  1Q12 A;  2E2J H;  2CCZ A;  5LMN W;  2VQF L;  4AQY Q;  2NVX H;  4DR4 L;  3TQY A;  1Y1W H;  3FP9 A;  1YBY A;  4YWM A;  3CC7 A;  3KLW A;  2LXJ A;  3KDF B;  4APV A;  4KI0 A;  1XJV A;  3MEF A;  1VQB A;  4DV0 Q;  2UXB Q;  1Q1B A;  3GTG H;  3GTP H;  4IFD J;  2VQE Q;  4DV6 L;  4JI4 L;  4BBS G;  1KAW A;  1U0L A;  3S24 A;  1N36 Q;  3U4Z A;  3H0G G;  1IXR A;  4YWL A;  1RL2 A;  3G4S A;  2OQ0 A;  2JA8 H;  3S1N H;  4DR2 L;  4R4I A;  2NN6 I;  5IWA L;  5IYB H;  4A3G H;  2K5N A;  2MO1 A;  4JI1 L;  4BBR G;  4DV2 Q;  2F4V L;  1BBU A;  5C44 G;  4NXN Q;  4K0K Q;  2H5X A;  1SLJ A;  4JC0 A;  2JA7 H;  3W1B A;  3PGZ A;  3GTM H;  2RHQ B;  5GQO A;  4DUY L;  4KHZ A;  2HIX A;  1KRT A;  4XIG S;  4X6A H;  4LUZ A;  3LGJ A;  5LMN L;  4A93 H;  1I50 H;  2JJQ A;  5GAD C;  4GLA C;  1K83 H;  1YHQ A;  1PH6 A;  1VQ5 A;  2A19 A;  4DKA C;  2ZTE A;  1IBM Q;  1VQH A;  3GTO H;  1WYD A;  3RZO H;  3I4N H;  1J6Q A;  5C0X J;  1K8G A;  4BY1 G;  3S1M H;  5M5W H;  1K3R A;  1P16 A;  2UXD Q;  1IYJ B;  3GTJ H;  1B70 B;  2JA9 A;  5FLM G;  1R9T H;  4OO1 I;  4BA1 I;  1PH8 A;  1K73 C;  1HH2 P;  3S1R H;  1A8V A;  1PH3 A;  1IL2 A;  1NMF A;  1QUQ A;  3G48 A;  4OWW B;  3PF5 A;  2E8G A;  3PUW A;  2A8V A;  2OQK A;  1YVC A;  2YU9 H;  3CC4 A;  4LNQ A;  3PIO A;  2UUA L;  2R93 H;  1PH4 A;  4GS3 A;  5M3M H;  4AIM A;  2NN6 G;  3STB C;  4JI3 Q;  2VW9 A;  4BXX G;  1XMQ Q;  2KBN A;  5GRO A;  4JI8 Q;  4GNX A;  2VNU D;  4DV4 L;  3G71 A;  5IWA Q;  3PUV A;  4JI1 Q;  2R7Z H;  4LUO A;  1VQE A;  4C2M H;  1XTD A;  1JJ2 A;  3HOZ G;  1Q1E A;  4A3J H;  4A3L H;  1HZ9 A;  3AFP A;  3W1G A;  1XPR A;  3GTQ H;  3M3Y H;  4OX9 L;  3TS2 A;  3KJO A;  3HOV H;  4DUY Q;  1KL9 A;  5H1S E;  2Z0S A;  3CCR A;  3ERS X;  3UDX A;  4LW1 A;  4A3L G;  3KDF A;  4NPS A;  1PH7 A;  4OWX B;  2RHS B;  3D31 A;  3Q8D A;  1HNZ Q;  1XNQ Q;  1X9N A;  2UUB L;  1K0R A;  1S72 A;  2D0P A;  1FJG L;  4JBW A;  1SN8 A;  2E2I H;  4WJ3 M;  4A3I H;  3S16 H;  3HOW G;  4LF5 Q;  4AQY L;  3UDI A;  2V1C C;  2QEX A;  4OWT B;  4DPG A;  2R6G A;  4DV3 L;  4A3B G;  3T1Y L;  4HJ7 A;  1O7I A;  3M4P A;  2AMC B;  1GD7 A;  3RN2 A;  4LWC A;  1FVI A;  2E5L L;  4BY7 G;  2UXB L;  4A3C H;  4NB3 A;  4KHP Q;  3HKZ G;  2L15 A;  3WWV A;  3CCV A;  1VQ8 A;  4GNX C;  3A74 A;  2D62 A;  1YJW A;  4NXM L;  4L5Q A;  1Q82 C;  1WCM G;  4DV2 L;  4X66 Q;  3W5O A;  3K0X A;  1PH2 A;  1A62 A;  1EIF A;  1M1K C;  4B3S L;  2WB1 E;  2ES2 A;  4IPC A;  1SFO H;  4IJH A;  1EIY B;  4K0K L;  1Q8K A;  3TRE A;  4GN5 A;  4A3D G;  3UDG A;  3KF8 B;  1LUZ A;  2XGT A;  1D7Q A;  4UP8 A;  2CQO A;  4GKK L;  1UE5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...