4DV4M

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 28
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4dv4M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4dv4M02
1HR0M 5FLXS 4LFAM 2VQEM 3J7AS 1XMOM 4PCZA 5ITQA 3GPXA 4LF4M 1XNQM 4JI8M 4JI6M 4DR6M 1N33M 2E5LM 4DV2M 3A46A 1L1TA 4NXNM 3TWLA 3GO8A 3GP1A 2HHHM 5A2QS 4JYAM 1MX0A 4DR2M 3GQ5A 4DV3M 4B3TM 4JI1M 3GPPA 3U6QA 2UU9M 4LF5M 1KFVA 3VK7A 3VK8A 2F5SA 1Z5BA 1PM5A 4G4RA 3J80S 3T1HM 1HNWM 5LMNM 3SBJA 3A45A 2UUAM 3C58A 2UXCM 4JV5M 2UXDM 2F5NA 1MU5A 1XMQM 3SARA 5ITUA 4JI2M 4JI7M 1XNRM 1L2CA 4G4OA 1TDHA 3JR5A 1EE8A 4LF6M 4DV5M 4G4NA 4X66M 3GPYA 2OPFA 3SAVA 4NXMM 3GQ4A 3SAUA 1K82A 1TDZA 4YY3M 3GQ3A 4YHHM 3A42A 1L1ZA 1N32M 4LF8M 4G4QA 3TWMA 1L2DA 3U6MA 4B3MM 4DR3M 1IBLM 3OTOM 3TWKA 1IBKM 4DV4M 3U6OA 1HNXM 1Z59A 4PDIA 5ITXA 2EA0A 1N34M 5LMUM 2F4VM 3SASA 2F5QA 1Z5AA 4LF9M 3DOAA 1Q39A 4CISA 1Z5CA 4X62M 1PJIA 5IWAM 4DR7M 1I94M 4NRVA 1HNZM 2F5OA 1IBMM 4DV0M 1PJJA 3J81S 3U6SA 4JI5M 4DR1M 4B3SM 1FJGM 1XC8A 3T1YM 3W0FA 4B3RM 2XZFA 3JAMS 2Q2EB 4LFCM 2F5PA 4JI4M 3SATA 4JI3M 4DV1M 5ITYA 2XZUA 1N36M 2HKJA 1K3WA 3U6LA 4X65M 1R2YA 5IT9S 2ZBKB 4OX9M 5ITTA 3U6CA 3U6EA 3U6DA 4DV6M 4DV7M 4DR4M 4X64M 2VQFM 5ITRA 3GPUA 1NNJA 4K0KM 4MB7A 1Q3BA 4PDGA 1J5EM 2ZM6M 2UXBM 1L2BA 3U6PA 1Q3CA 5BR8M 4LF7M 4PD2A 3SAWA 1R2ZA 2UUBM 4KHPM 4DUYM 4GKJM 4JI0M 5ITXE 4DUZM 4AQYM 3JR4A 2OQ4A 2UUCM 4GKKM 4DR5M 4NRWA 1K3XA 4LFBM 4ITQA
chains in the Genus database with same CATH superfamily
2J5YA 1ZV1A 3GLHE 4LFAM 2VQEM 1QDRA 2Y20A 3FKEA 1N77A 3QYBA 5ITQA 2R44A 2WSFF 2CHQA 4B08A 3GPXA 3I01M 4OW0A 2R4EA 1J7KA 1DGHB 1LTMA 3FUTA 4LJ6A 4S12A 3HX3A 3VDUA 3GLIE 2XFSA 3A98B 3EIEA 4NXNM 3L2AA 1MJGM 2MJ5B 5A2QS 1ORYB 1DGGA 1OJLA 1MX0A 3GQ5A 4B3TM 3GPPA 2FS1A 4LF5M 3B7ZA 4LJ7A 2KRKA 2V1CA 3HGIA 3UZUA 2CE7A 1PM5A 3HHWA 1JR3D 4RNAA 4GC9A 3J80S 1CUKA 2KXEA 4JXJA 1BVSA 4Z8XA 2UUAM 2FOIC 3IG8A 4FWHA 3C58A 1IN7A 1W5SA 2HWJA 3M6AA 2F5NA 3SARA 4JI2M 2EKFA 2JP7A 2KHHA 2Z4RA 1XHBA 4MGKE 5KPZA 1L2CA 4BLCA 1SG9A 4WP2A 2J7NA 1TH3A 3IHPA 3TL4X 3SAVA 4AKHA 1L8QA 1K82A 3GLGA 2YFQA 2XGNA 3GQ3A 4YHHM 3RFWA 2Z4SA 1V92A 4DR3M 3LCVB 2CV1A 3FUWA 3FD9A 1WGLA 1HNXM 3FUUA 1NSFA 4LRTA 4L16A 1VG5A 1NV8A 3KOXE 2O5RA 4CGYB 3SASA 1QZMA 3FTDA 1DGHA 5GKNA 4LF9M 3DOAA 1HT1E 4B7FA 1QAMA 3MK6A 4MM3B 2BJVA 1NNUC 1PJQA 3GRYA 3NBIA 3NWLA 4B7HA 1N78A 5FTMA 5KPRA 4IBJA 3FUVA 4NRVA 4REZA 2JUJA 2QSFX 1V33A 5FTLA 1IBMM 1KSFX 1UM8A 2ZTDA 3BBZA 7CATA 3E21A 3DFZA 1TH2A 4DV0M 1PJJA 3GLIA 2P5TA 3KSXA 1YUBA 3PNYA 1QQWA 2CHVA 2NQ8C 3T1YM 3GLFE 2BNKA 2KDLA 2G8LA 2Q2EB 3QWLA 4MGZE 2F5PA 2DHRA 1N36M 3HJQA 3U61B 2LWXA 5C1BA 4HL4A 4DBGB 2KNZA 3LCUA 4WURA 4QOZC 2KNAA 2MROB 1VEJA 3K2LA 3HU3A 1T6OA 5JI3E 1R5LA 2D7EA 4K0KM 2LVAA 1J5EM 2RGOA 3KFUG 2R18A 3HKPA 1OTRA 1R6BX 2Y0TA 1DGBA 2EUCA 4QNRA 3ZCBB 4L15A 5BR8M 2C96A 2ERCA 4CJ6A 2V6ZM 4PD2A 2M60A 4GKJM 1ZQ9A 3MHVC 3E46A 1GJSA 2MR9A 3ZC7B 5EXTA 2JZ1A 3VKHA 4DR5M 3LW5F 3K9PA 4ITQA 2QZ4A 1OIZA 2DVWB 3E4RA 3J7AS 2YNMD 1GVNA 1R7RA 4LG2A 3GRUA 2XF3A 1WIVA 2LHGA 1GJTA 4JI8M 3HHYA 5C18A 1VQ1A 3GLGE 3FTFA 4DV2M 1NHWC 2Y0QA 2LVOC 2DAGA 3QAUA 2D7GA 2HHHM 4KO8A 4QNMA 4NC6A 2QNJA 4DR2M 1IN5A 4DV3M 4D80A 1NY5A 4QHTA 2DENA 2UU9M 4JI1M 4FD2A 1KFVA 3VK7A 2F5SA 3AFHA 1IQPA 2K9DA 4EIWA 3U61A 1XWIA 3J2PB 1HNWM 2DZLA 5LMNM 2APLA 4LZJA 2UXCM 4JV5M 4TUWA 2VIIA 2Y21A 2UXDM 1MU5A 5IREB 4F2LA 1R4GA 5H37D 1OFHA 4JI7M 2Z3XA 4GHLA 1XNRM 3K1JA 2I7NA 1IY0A 4P16A 3RGSA 2WZJA 3VLFB 1TF0B 1YLAA 2MH8A 2QENA 2QPAA 1G3IA 3RGPA 3SAUA 3R8FA 2C9OA 3FRHA 1HQYE 4YY3M 1XB2B 3A42A 5EXSA 2JY5A 1IY1A 1DO2A 2KZSA 1C1KA 1IBLM 3OTOM 3L27A 1TGUA 2JZ0A 2CV0A 1GL6A 1D2NA 1JQJC 4GITA 1VEGA 4PDIA 3M7GA 2F4VM 1HT2E 4R71A 2GQFA 2I7PA 3B74A 3FUXA 5E26A 2RGHA 4L4UA 3U5ZB 1N75A 2CV2A 3FTEA 3CTWB 4IJFA 2BWEA 2VDBB 3HJSA 3T6PA 1OAIA 1OFIA 1TTEA 3THGA 3BXWA 3Q8XA 4LJ9A 2LVNC 3SHGB 2F5OA 2C5RA 1EFUB 3WHLA 2X49A 1QVRA 3K8ZA 4IBBA 4RF1A 1PJSA 3KP0E 4Q7JA 1NO1A 5EXXA 4DR1M 4B3SM 4RF0A 5E6JA 3W0FA 1FJGM 4B3RM 4LJ4A 3JAMS 2DKLA 4DV1M 5KO3A 2HKJA 4X65M 3HHXA 4KT0F 2R62A 1OQYA 3SC3A 5ITTA 4BB9A 3HWSA 1IY2A 2WSCF 1SXJB 4DV7M 4UN2B 1WR1B 2OOBA 3RE8A 1NJFA 1QUTA 1NNJA 1PRBA 1IFYA 4PDGA 2L09A 1QZEA 1D0MA 2QHOB 4FVMA 1TH4A 3U6PA 4AKGA 2LNHC 4LF7M 4XGIA 5EJCA 3SAWA 1PJTA 1IN6A 4KHPM 4QOSA 1E94E 3UJNA 1VEKA 3KOYE 2JA2A 3L25A 2DAKA 2LVPC 2XLJA 2CP8A 5DYGA 2XFTA 4ZPXA 3I04M 4G6ZA 3LQQA 4IJEA 1W5TA 3U5ZA 3U60B 1G59A 3VKGA 1OIPA 3PFIA 2O25A 3B7QA 4WW0A 5FLXS 4GHAA 5EP4A 3FYDA 3KP1E 2QBYB 4PCZA 3IG5A 1QAOA 1JB0F 1XNQM 1OKSA 4ANRA 2OOAA 3KOZE 4DR6M 1KYIA 2DAMA 2QP9X 1A5TA 4AG5A 1NY6A 2G5GX 3B9PA 2G3QA 4BBAA 1DV0A 3GO8A 4NOOB 5KPTA 2M5ZA 3D8BA 2KA6B 3SYLA 4F1IA 2UUBM 4XBOA 2ZTCA 4B7GA 3IECA 3T15A 4Z6YA 4JYAM 2W82A 1DGFA 1E9RA 3UMMA 3U6QA 3PVSA 3LVVA 5EXPA 4M0WA 4G4RA 3T1HM 2YR0A 2DWNA 1GLNA 2Z8YM 2R46A 1WXQA 3A45A 3KOWE 4LGMA 1T3TA 2ZAMA 1SXJA 4II7A 3AOEA 1HJPA 3ZH9B 4LRSA 3F92A 4MGIE 1F4IA 1TDHA 3JR5A 1EE8A 3B7NA 3W68A 4DV5M 4OVZB 4L8RC 1QANA 1QDTA 3FYCA 3GPYA 1LV7A 3FRIA 1ZMWA 2R65A 4NXMM 3SFZA 1TDZA 3HHZA 1ZMUA 4AKIA 2HAKA 4JI5M 3HU2A 1QUSA 4G4QA 1RU3A 4I5SA 3U6MA 1L2DA 2DWLA 4B3MM 4L6V6 5FSWA 1GO5A 4FWGA 3U60A 3TWKA 1QYRA 1IBKM 1VDDA 4DV4M 3C9PA 3U6OA 4AG6A 4CHTB 5KQ8A 5JI2E 2QBYA 4NL4H 2EA0A 3H4MA 2OO9A 1JR3A 1N34M 3M0EA 3K9OA 5EP1A 2F5QA 4FCVA 2GNOA 4JN6A 5FTKA 1NVMA 3FE3A 4FWDA 2WSEF 2DWZB 3TQSA 4CISA 2HL7A 2V1UA 4NSRA 2ZANA 5DFLA 4AZFA 2R4JA 5IWAM 2A5YB 2JWSA 2X8AA 3NBXX 8CATA 1I94M 1HNZM 2C99A 2MGWA 4IBGA 1VDLA 2LXEA 5DYIA 3CF2A 1WHCA 3UK6A 3PXGA 3GRVA 4GIPA 3SMSA 3WHKA 3DA1A 3MJ5A 2DAEA 2RRUA 1SXJC 1MN3A 1NHGC 3AOEC 1SXJD 5IZ7D 3SHFA 2BWBA 4LFCM 4JI4M 2DZOB 2X4AA 3HY5A 4JI3M 2C9CA 3AKZA 3SATA 1Q02A 2HCBA 2LBCA 2KW0A 5L8RF 2Z7JA 2VF8A 3AL0C 3U6CA 3L28A 2O01F 3I4VA 4DV6M 2FE8A 2JNHA 4OVZA 4G3OA 3Q8GA 3HZJA 2K47A 2LH0A 4IBKA 3GPUA 1Q3BA 1XXHE 2DI0A 2JY8A 3GLHB 5KQDA 4I8OA 4I4LA 4A3VB 4GH9A 1HQCA 1IXSB 1ZMVA 2CRUA 1L2BA 1Q3CA 2CHGA 1G71A 1QAQA 4MH0E 1DO0A 2QCUA 3QYEA 4W5WA 5BPVA 4DUYM 5ITXE 2LVQD 3BOSA 3FTCA 3ILKA 4DUZM 4AQYM 3GLIB 4QHSA 2OQ4A 1XXHB 2UUCM 1SXJE 4NRWA 4LFBM 3PNVA 5FTJA 1HR0M 4LGYA 2H5XA 4D81A 1XMOM 2YQZA 1IXZA 3GRRA 1ZAEA 3HU1A 4I81A 1D0KA 2DHYA 4HEOA 4KLNA 4LF4M 1AIPC 3ZQJA 4CIZA 4JI6M 2DZNB 1N33M 2E5LM 2R45A 4GC5A 2RKOA 3A46A 1L1TA 1GABA 1IN8A 5DNYA 2XSZA 2CUZA 3TWLA 3W0LB 4IBIA 3H4JA 4KODA 5EQTA 3GP1A 3VDPA 3KSJA 1EIJA 1WGNA 1WJ7A 3C3DA 3KS8A 4LJ5A 1E9SA 3VK8A 1E32A 2DNAA 1JR3E 1Z5BA 3LQRA 2EO2A 1G8PA 3T38A 4RKUF 3SBJA 1FNNA 1UFZA 3CF0A 1GKIA 1XMQM 5ITUA 2B3TA 3J7BA 1PGYA 3EIHA 4FCWA 1YE9A 3GLHA 4M9XA 4FCTA 4G4OA 3AOGA 3SYKA 4LF6M 4L78A 1IXSA 1D0LA 4G4NA 4X66M 4GEWA 3TE6A 4HLQA 4MGYE 2OPFA 3E9SA 3GQ4A 4LJ8A 4XK8F 2C98A 2D7HA 2L7IA 4GRIA 1L1ZA 1N32M 2KZUA 1XXHA 3TWMA 2L2DA 3D8LA 4LF8M 1IN4A 1G4AE 3SMPA 2DWMA 2K6BA 3L26A 1AUAA 3UGJA 2R6FA 1Z59A 2EKKA 2XH9A 2L4FA 4IBEA 4IBFA 1TR8A 1P3QQ 5ITXA 2LTUA 3KVWA 2FH0A 5LMUM 2BJWA 2LHCA 2L6OA 1Z5AA 3DZDA 5F3WA 2EJSA 2FFJA 2DXIA 1H6UA 1Q39A 3GLFB 1Z5CA 2KRUA 4X62M 1YSYA 2XSZD 1Z6TA 4LY6A 3KS4A 4FW9A 1PJIA 1C7YA 2DAIA 3MMPA 4D82A 3J27B 2JXNA 3L29A 4DR7M 2N35A 4LZZA 4R3DA 4Y28F 3KW6A 2L4EA 3C3EA 3B89A 1V34A 4AI6A 1NJGA 3KDSE 3J81S 3U6SA 4M0DA 3I51A 2XEPA 4IBDA 1XC8A 4IIWA 3HJ8A 1G41A 1I4WA 2J7OA 2XZFA 4OU7A 2XZUA 1OAOC 5ITYA 2KNVA 1K3WA 4R7GA 3U6LA 1R2YA 1GL7A 4GMQA 1IM2A 2FNAA 3K92A 4M9SA 5IT9S 2ZBKB 4M9ZA 4OX9M 1IXRC 3U6EA 3U6DA 3VFDA 1Y8GA 2JY6B 2K0BX 1J09A 2ZAOA 4DR4M 4X64M 2KEBA 2VQFM 5ITRA 3AV0A 3V76A 4LJAA 1T43A 4MGHA 2R0IA 4MB7A 3KXEC 2ZM6M 3LVWA 1NV9A 4PT5A 2UXBM 2VF7A 3LMMA 5EP2A 3R9XB 2CFOA 3CF6E 2JY7A 2CEAA 2CWBA 3W67A 3I4YA 1R2ZA 3AJIB 4JI0M 3GLGB 2L7HA 5EP3A 2AHMA 3JR4A 2QQ8A 4IBCA 4P17A 2H1RA 4LCBA 1X37A 5FTNA 4GKKM 3TPZA 1S3SA 3CGWA 1K3XA 4NSOB 4AW4A 3GLFA
chains in the Genus database with same CATH topology
4LFAM 2VQEM 2Y20A 3FKEA 1N77A 5ITQA 2CHQA 4B08A 3GPXA 4OW0A 2R4EA 1J7KA 1DGHB 3FUTA 4LJ6A 4S12A 3VDUA 2XFSA 3A98B 3EIEA 4NXNM 3L2AA 5A2QS 1ORYB 1DGGA 1OJLA 1MX0A 3GQ5A 4B3TM 3GPPA 4LF5M 4LJ7A 2KRKA 2V1CA 3HGIA 3UZUA 2CE7A 1PM5A 3HHWA 1JR3D 4RNAA 4GC9A 3J80S 2KXEA 4JXJA 4Z8XA 2UUAM 2FOIC 3IG8A 4FWHA 3C58A 1IN7A 1W5SA 2F5NA 3M6AA 3SARA 4JI2M 2Z4RA 1XHBA 4MGKE 5KPZA 1L2CA 4BLCA 2J7NA 1TH3A 3TL4X 3SAVA 4AKHA 1L8QA 1K82A 3GLGA 2YFQA 2XGNA 3GQ3A 4YHHM 3RFWA 2Z4SA 4DR3M 2CV1A 3FUWA 3FD9A 1HNXM 3FUUA 1NSFA 4LRTA 4L16A 3KOXE 2O5RA 4CGYB 3SASA 1QZMA 3FTDA 1DGHA 5GKNA 4LF9M 3DOAA 1HT1E 4B7FA 1QAMA 3MK6A 4MM3B 2BJVA 1NNUC 3GRYA 3NBIA 3NWLA 4B7HA 1N78A 5FTMA 5KPRA 4IBJA 3FUVA 4NRVA 4REZA 5FTLA 1IBMM 1KSFX 1UM8A 7CATA 4DV0M 3DFZA 1TH2A 1PJJA 3GLIA 2P5TA 3KSXA 1YUBA 3PNYA 1QQWA 2CHVA 2NQ8C 3T1YM 2BNKA 2G8LA 2Q2EB 3QWLA 4MGZE 2F5PA 2DHRA 1N36M 3HJQA 3U61B 2LWXA 5C1BA 4HL4A 4WURA 4QOZC 3K2LA 3HU3A 5JI3E 2D7EA 4K0KM 1J5EM 2RGOA 3KFUG 2R18A 3HKPA 1R6BX 2Y0TA 1DGBA 2EUCA 4QNRA 3ZCBB 4L15A 5BR8M 2C96A 2ERCA 4PD2A 2V6ZM 2M60A 4GKJM 1ZQ9A 3MHVC 3ZC7B 5EXTA 3VKHA 4DR5M 4ITQA 2QZ4A 2DVWB 3E4RA 3J7AS 2YNMD 1GVNA 1R7RA 4LG2A 3GRUA 2XF3A 4JI8M 3HHYA 5C18A 3FTFA 4DV2M 1NHWC 2Y0QA 3QAUA 2D7GA 2HHHM 4KO8A 4QNMA 4DR2M 1IN5A 4DV3M 4D80A 1NY5A 4QHTA 2UU9M 4JI1M 4FD2A 1KFVA 3VK7A 2F5SA 3AFHA 1IQPA 4EIWA 3U61A 1XWIA 3J2PB 1HNWM 5LMNM 4LZJA 2UXCM 4JV5M 4TUWA 2VIIA 2Y21A 2UXDM 1MU5A 5IREB 5H37D 1OFHA 4JI7M 2Z3XA 4GHLA 1XNRM 3K1JA 2I7NA 1IY0A 4P16A 3RGSA 3VLFB 2QENA 3SAUA 3RGPA 2QPAA 3R8FA 1G3IA 2C9OA 4YY3M 1HQYE 3A42A 5EXSA 1IY1A 1DO2A 2KZSA 1C1KA 1IBLM 3OTOM 3L27A 1TGUA 2CV0A 1GL6A 1D2NA 1JQJC 4GITA 4PDIA 3M7GA 2F4VM 1HT2E 2I7PA 5E26A 3FUXA 3U5ZB 2RGHA 4L4UA 1N75A 2CV2A 3FTEA 3CTWB 4IJFA 3HJSA 1OFIA 3THGA 3Q8XA 4LJ9A 3SHGB 2F5OA 2C5RA 3WHLA 2X49A 1QVRA 3K8ZA 4IBBA 4RF1A 3KP0E 5EXXA 4JI5M 4DR1M 4B3SM 1FJGM 4RF0A 5E6JA 3W0FA 4B3RM 4LJ4A 3JAMS 4DV1M 5KO3A 2HKJA 4X65M 3HHXA 2R62A 3SC3A 5ITTA 4BB9A 3HWSA 1IY2A 1SXJB 4DV7M 3RE8A 1NJFA 1NNJA 4PDGA 2L09A 4FVMA 1TH4A 3U6PA 4AKGA 2LNHC 4LF7M 4XGIA 5EJCA 3SAWA 4KHPM 1IN6A 4QOSA 1E94E 3UJNA 3KOYE 2JA2A 3L25A 2XLJA 5DYGA 2XFTA 4ZPXA 4G6ZA 3LQQA 4IJEA 1W5TA 3U5ZA 3U60B 1G59A 3VKGA 4GHAA 3PFIA 4WW0A 5FLXS 5EP4A 3FYDA 3KP1E 2QBYB 4PCZA 3IG5A 1QAOA 1XNQM 4DR6M 3KOZE 1KYIA 2QP9X 4AG5A 1NY6A 2G5GX 3B9PA 4BBAA 3GO8A 4NOOB 5KPTA 2M5ZA 3D8BA 2KA6B 3SYLA 2UUBM 4XBOA 4B7GA 4JYAM 3T15A 4Z6YA 2W82A 1DGFA 1E9RA 3UMMA 3U6QA 3PVSA 3LVVA 5EXPA 4M0WA 4G4RA 3T1HM 2YR0A 2DWNA 1GLNA 2R46A 1WXQA 3A45A 3KOWE 4LGMA 1T3TA 2ZAMA 1SXJA 4II7A 3AOEA 3ZH9B 4LRSA 4MGIE 1TDHA 3JR5A 1EE8A 4DV5M 4OVZB 4L8RC 1QANA 3FYCA 3GPYA 1LV7A 4NXMM 2R65A 3SFZA 1TDZA 3HHZA 4AKIA 3HU2A 4G4QA 1L2DA 4I5SA 3U6MA 2DWLA 4B3MM 5FSWA 4FWGA 3U60A 3TWKA 1QYRA 1IBKM 1VDDA 4DV4M 3U6OA 4AG6A 4CHTB 5KQ8A 5JI2E 2QBYA 4NL4H 2EA0A 3H4MA 1JR3A 1N34M 3M0EA 5EP1A 2F5QA 4FCVA 4JN6A 5FTKA 1NVMA 4FWDA 4CISA 2DWZB 3TQSA 2HL7A 2V1UA 4NSRA 2ZANA 4AZFA 2R4JA 5IWAM 2A5YB 2X8AA 8CATA 1I94M 1HNZM 2C99A 4IBGA 2LXEA 5DYIA 3CF2A 3UK6A 3PXGA 3GRVA 4GIPA 3SMSA 3WHKA 3DA1A 3MJ5A 1SXJC 1NHGC 3AOEC 1SXJD 5IZ7D 3SHFA 4LFCM 4JI4M 2DZOB 2X4AA 3SATA 4JI3M 2C9CA 3AKZA 2HCBA 2KW0A 2Z7JA 3AL0C 3U6CA 3L28A 3I4VA 4DV6M 2FE8A 4OVZA 2K47A 2LH0A 4IBKA 3GPUA 1Q3BA 3GLHB 5KQDA 4I8OA 4I4LA 4A3VB 4GH9A 1HQCA 1IXSB 1L2BA 1Q3CA 2CHGA 1QAQA 4MH0E 1DO0A 2QCUA 5BPVA 4W5WA 4DUYM 4DUZM 5ITXE 3FTCA 3BOSA 3ILKA 4AQYM 3GLIB 4QHSA 2OQ4A 1XXHB 2UUCM 1SXJE 4NRWA 4LFBM 3PNVA 5FTJA 1HR0M 4LGYA 4D81A 1XMOM 2YQZA 1IXZA 3GRRA 1ZAEA 3HU1A 4I81A 4KLNA 4LF4M 4JI6M 2DZNB 1N33M 2E5LM 2R45A 4GC5A 2RKOA 3A46A 1L1TA 1IN8A 5DNYA 2XSZA 2CUZA 3TWLA 3W0LB 4IBIA 4KODA 5EQTA 3GP1A 3VDPA 3KSJA 3KS8A 4LJ5A 1E9SA 3VK8A 1E32A 1Z5BA 3LQRA 2EO2A 1G8PA 3T38A 3SBJA 1FNNA 3CF0A 1GKIA 1XMQM 5ITUA 3J7BA 3EIHA 4FCWA 1YE9A 3GLHA 4M9XA 4FCTA 4G4OA 3AOGA 3SYKA 4LF6M 4L78A 4G4NA 4X66M 3TE6A 4HLQA 4MGYE 2OPFA 3E9SA 3GQ4A 4LJ8A 2C98A 2D7HA 2L7IA 4GRIA 1L1ZA 1N32M 2KZUA 1XXHA 3TWMA 4LF8M 3D8LA 1IN4A 1G4AE 3SMPA 2DWMA 3L26A 3UGJA 4IBFA 1Z59A 2XH9A 4IBEA 5ITXA 3KVWA 5LMUM 2BJWA 2L6OA 1Z5AA 5F3WA 3DZDA 2DXIA 2FFJA 1H6UA 1Q39A 3GLFB 1Z5CA 2KRUA 4X62M 1YSYA 2XSZD 1Z6TA 4LY6A 3KS4A 4FW9A 1PJIA 4D82A 3J27B 3L29A 4DR7M 4LZZA 4R3DA 4AI6A 3KW6A 1NJGA 3KDSE 3J81S 3U6SA 4M0DA 3I51A 2XEPA 4IBDA 1XC8A 4IIWA 3HJ8A 1G41A 1I4WA 2J7OA 2XZFA 4OU7A 2XZUA 5ITYA 1K3WA 4R7GA 3U6LA 1R2YA 1GL7A 4GMQA 1IM2A 2FNAA 3K92A 4M9SA 5IT9S 2ZBKB 4M9ZA 4OX9M 1IXRC 3U6EA 3U6DA 3VFDA 2ZAOA 1J09A 4DR4M 4X64M 2KEBA 2VQFM 5ITRA 3AV0A 4LJAA 4MGHA 4MB7A 3KXEC 2ZM6M 3LVWA 2UXBM 4PT5A 3LMMA 5EP2A 3R9XB 2CFOA 3CF6E 2CEAA 3I4YA 1R2ZA 3AJIB 4JI0M 3GLGB 2L7HA 5EP3A 2AHMA 3JR4A 4IBCA 2H1RA 4LCBA 1X37A 5FTNA 4GKKM 3TPZA 1S3SA 1K3XA 4NSOB 4AW4A 3GLFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HR0 M;  5FLX S;  4LFA M;  2VQE M;  3J7A S;  1XMO M;  4PCZ A;  5ITQ A;  3GPX A;  4LF4 M;  1XNQ M;  4JI8 M;  4JI6 M;  4DR6 M;  1N33 M;  2E5L M;  4DV2 M;  3A46 A;  1L1T A;  4NXN M;  3TWL A;  3GO8 A;  3GP1 A;  2HHH M;  5A2Q S;  4JYA M;  1MX0 A;  4DR2 M;  3GQ5 A;  4DV3 M;  4B3T M;  4JI1 M;  3GPP A;  3U6Q A;  2UU9 M;  4LF5 M;  1KFV A;  3VK7 A;  3VK8 A;  2F5S A;  1Z5B A;  1PM5 A;  4G4R A;  3J80 S;  3T1H M;  1HNW M;  5LMN M;  3SBJ A;  3A45 A;  2UUA M;  3C58 A;  2UXC M;  4JV5 M;  2UXD M;  2F5N A;  1MU5 A;  1XMQ M;  3SAR A;  5ITU A;  4JI2 M;  4JI7 M;  1XNR M;  1L2C A;  4G4O A;  1TDH A;  3JR5 A;  1EE8 A;  4LF6 M;  4DV5 M;  4G4N A;  4X66 M;  3GPY A;  2OPF A;  3SAV A;  4NXM M;  3GQ4 A;  3SAU A;  1K82 A;  1TDZ A;  4YY3 M;  3GQ3 A;  4YHH M;  3A42 A;  1L1Z A;  1N32 M;  4LF8 M;  4G4Q A;  3TWM A;  1L2D A;  3U6M A;  4B3M M;  4DR3 M;  1IBL M;  3OTO M;  3TWK A;  1IBK M;  4DV4 M;  3U6O A;  1HNX M;  1Z59 A;  4PDI A;  5ITX A;  2EA0 A;  1N34 M;  5LMU M;  2F4V M;  3SAS A;  2F5Q A;  1Z5A A;  4LF9 M;  3DOA A;  1Q39 A;  4CIS A;  1Z5C A;  4X62 M;  1PJI A;  5IWA M;  4DR7 M;  1I94 M;  4NRV A;  1HNZ M;  2F5O A;  1IBM M;  4DV0 M;  1PJJ A;  3J81 S;  3U6S A;  4JI5 M;  4DR1 M;  4B3S M;  1FJG M;  1XC8 A;  3T1Y M;  3W0F A;  4B3R M;  2XZF A;  3JAM S;  2Q2E B;  4LFC M;  2F5P A;  4JI4 M;  3SAT A;  4JI3 M;  4DV1 M;  5ITY A;  2XZU A;  1N36 M;  2HKJ A;  1K3W A;  3U6L A;  4X65 M;  1R2Y A;  5IT9 S;  2ZBK B;  4OX9 M;  5ITT A;  3U6C A;  3U6E A;  3U6D A;  4DV6 M;  4DV7 M;  4DR4 M;  4X64 M;  2VQF M;  5ITR A;  3GPU A;  1NNJ A;  4K0K M;  4MB7 A;  1Q3B A;  4PDG A;  1J5E M;  2ZM6 M;  2UXB M;  1L2B A;  3U6P A;  1Q3C A;  5BR8 M;  4LF7 M;  4PD2 A;  3SAW A;  1R2Z A;  2UUB M;  4KHP M;  4DUY M;  4GKJ M;  4JI0 M;  5ITX E;  4DUZ M;  4AQY M;  3JR4 A;  2OQ4 A;  2UUC M;  4GKK M;  4DR5 M;  4NRW A;  1K3X A;  4LFB M;  4ITQ A; 
#chains in the Genus database with same CATH topology
 2J5Y A;  1ZV1 A;  3GLH E;  4LFA M;  2VQE M;  1QDR A;  2Y20 A;  3FKE A;  1N77 A;  3QYB A;  5ITQ A;  2R44 A;  2WSF F;  2CHQ A;  4B08 A;  3GPX A;  3I01 M;  4OW0 A;  2R4E A;  1J7K A;  1DGH B;  1LTM A;  3FUT A;  4LJ6 A;  4S12 A;  3HX3 A;  3VDU A;  3GLI E;  2XFS A;  3A98 B;  3EIE A;  4NXN M;  3L2A A;  1MJG M;  2MJ5 B;  5A2Q S;  1ORY B;  1DGG A;  1OJL A;  1MX0 A;  3GQ5 A;  4B3T M;  3GPP A;  2FS1 A;  4LF5 M;  3B7Z A;  4LJ7 A;  2KRK A;  2V1C A;  3HGI A;  3UZU A;  2CE7 A;  1PM5 A;  3HHW A;  1JR3 D;  4RNA A;  4GC9 A;  3J80 S;  1CUK A;  2KXE A;  4JXJ A;  1BVS A;  4Z8X A;  2UUA M;  2FOI C;  3IG8 A;  4FWH A;  3C58 A;  1IN7 A;  1W5S A;  2HWJ A;  3M6A A;  2F5N A;  3SAR A;  4JI2 M;  2EKF A;  2JP7 A;  2KHH A;  2Z4R A;  1XHB A;  4MGK E;  5KPZ A;  1L2C A;  4BLC A;  1SG9 A;  4WP2 A;  2J7N A;  1TH3 A;  3IHP A;  3TL4 X;  3SAV A;  4AKH A;  1L8Q A;  1K82 A;  3GLG A;  2YFQ A;  2XGN A;  3GQ3 A;  4YHH M;  3RFW A;  2Z4S A;  1V92 A;  4DR3 M;  3LCV B;  2CV1 A;  3FUW A;  3FD9 A;  1WGL A;  1HNX M;  3FUU A;  1NSF A;  4LRT A;  4L16 A;  1VG5 A;  1NV8 A;  3KOX E;  2O5R A;  4CGY B;  3SAS A;  1QZM A;  3FTD A;  1DGH A;  5GKN A;  4LF9 M;  3DOA A;  1HT1 E;  4B7F A;  1QAM A;  3MK6 A;  4MM3 B;  2BJV A;  1NNU C;  1PJQ A;  3GRY A;  3NBI A;  3NWL A;  4B7H A;  1N78 A;  5FTM A;  5KPR A;  4IBJ A;  3FUV A;  4NRV A;  4REZ A;  2JUJ A;  2QSF X;  1V33 A;  5FTL A;  1IBM M;  1KSF X;  1UM8 A;  2ZTD A;  3BBZ A;  7CAT A;  3E21 A;  3DFZ A;  1TH2 A;  4DV0 M;  1PJJ A;  3GLI A;  2P5T A;  3KSX A;  1YUB A;  3PNY A;  1QQW A;  2CHV A;  2NQ8 C;  3T1Y M;  3GLF E;  2BNK A;  2KDL A;  2G8L A;  2Q2E B;  3QWL A;  4MGZ E;  2F5P A;  2DHR A;  1N36 M;  3HJQ A;  3U61 B;  2LWX A;  5C1B A;  4HL4 A;  4DBG B;  2KNZ A;  3LCU A;  4WUR A;  4QOZ C;  2KNA A;  2MRO B;  1VEJ A;  3K2L A;  3HU3 A;  1T6O A;  5JI3 E;  1R5L A;  2D7E A;  4K0K M;  2LVA A;  1J5E M;  2RGO A;  3KFU G;  2R18 A;  3HKP A;  1OTR A;  1R6B X;  2Y0T A;  1DGB A;  2EUC A;  4QNR A;  3ZCB B;  4L15 A;  5BR8 M;  2C96 A;  2ERC A;  4CJ6 A;  2V6Z M;  4PD2 A;  2M60 A;  4GKJ M;  1ZQ9 A;  3MHV C;  3E46 A;  1GJS A;  2MR9 A;  3ZC7 B;  5EXT A;  2JZ1 A;  3VKH A;  4DR5 M;  3LW5 F;  3K9P A;  4ITQ A;  2QZ4 A;  1OIZ A;  2DVW B;  3E4R A;  3J7A S;  2YNM D;  1GVN A;  1R7R A;  4LG2 A;  3GRU A;  2XF3 A;  1WIV A;  2LHG A;  1GJT A;  4JI8 M;  3HHY A;  5C18 A;  1VQ1 A;  3GLG E;  3FTF A;  4DV2 M;  1NHW C;  2Y0Q A;  2LVO C;  2DAG A;  3QAU A;  2D7G A;  2HHH M;  4KO8 A;  4QNM A;  4NC6 A;  2QNJ A;  4DR2 M;  1IN5 A;  4DV3 M;  4D80 A;  1NY5 A;  4QHT A;  2DEN A;  2UU9 M;  4JI1 M;  4FD2 A;  1KFV A;  3VK7 A;  2F5S A;  3AFH A;  1IQP A;  2K9D A;  4EIW A;  3U61 A;  1XWI A;  3J2P B;  1HNW M;  2DZL A;  5LMN M;  2APL A;  4LZJ A;  2UXC M;  4JV5 M;  4TUW A;  2VII A;  2Y21 A;  2UXD M;  1MU5 A;  5IRE B;  4F2L A;  1R4G A;  5H37 D;  1OFH A;  4JI7 M;  2Z3X A;  4GHL A;  1XNR M;  3K1J A;  2I7N A;  1IY0 A;  4P16 A;  3RGS A;  2WZJ A;  3VLF B;  1TF0 B;  1YLA A;  2MH8 A;  2QEN A;  2QPA A;  1G3I A;  3RGP A;  3SAU A;  3R8F A;  2C9O A;  3FRH A;  1HQY E;  4YY3 M;  1XB2 B;  3A42 A;  5EXS A;  2JY5 A;  1IY1 A;  1DO2 A;  2KZS A;  1C1K A;  1IBL M;  3OTO M;  3L27 A;  1TGU A;  2JZ0 A;  2CV0 A;  1GL6 A;  1D2N A;  1JQJ C;  4GIT A;  1VEG A;  4PDI A;  3M7G A;  2F4V M;  1HT2 E;  4R71 A;  2GQF A;  2I7P A;  3B74 A;  3FUX A;  5E26 A;  2RGH A;  4L4U A;  3U5Z B;  1N75 A;  2CV2 A;  3FTE A;  3CTW B;  4IJF A;  2BWE A;  2VDB B;  3HJS A;  3T6P A;  1OAI A;  1OFI A;  1TTE A;  3THG A;  3BXW A;  3Q8X A;  4LJ9 A;  2LVN C;  3SHG B;  2F5O A;  2C5R A;  1EFU B;  3WHL A;  2X49 A;  1QVR A;  3K8Z A;  4IBB A;  4RF1 A;  1PJS A;  3KP0 E;  4Q7J A;  1NO1 A;  5EXX A;  4DR1 M;  4B3S M;  4RF0 A;  5E6J A;  3W0F A;  1FJG M;  4B3R M;  4LJ4 A;  3JAM S;  2DKL A;  4DV1 M;  5KO3 A;  2HKJ A;  4X65 M;  3HHX A;  4KT0 F;  2R62 A;  1OQY A;  3SC3 A;  5ITT A;  4BB9 A;  3HWS A;  1IY2 A;  2WSC F;  1SXJ B;  4DV7 M;  4UN2 B;  1WR1 B;  2OOB A;  3RE8 A;  1NJF A;  1QUT A;  1NNJ A;  1PRB A;  1IFY A;  4PDG A;  2L09 A;  1QZE A;  1D0M A;  2QHO B;  4FVM A;  1TH4 A;  3U6P A;  4AKG A;  2LNH C;  4LF7 M;  4XGI A;  5EJC A;  3SAW A;  1PJT A;  1IN6 A;  4KHP M;  4QOS A;  1E94 E;  3UJN A;  1VEK A;  3KOY E;  2JA2 A;  3L25 A;  2DAK A;  2LVP C;  2XLJ A;  2CP8 A;  5DYG A;  2XFT A;  4ZPX A;  3I04 M;  4G6Z A;  3LQQ A;  4IJE A;  1W5T A;  3U5Z A;  3U60 B;  1G59 A;  3VKG A;  1OIP A;  3PFI A;  2O25 A;  3B7Q A;  4WW0 A;  5FLX S;  4GHA A;  5EP4 A;  3FYD A;  3KP1 E;  2QBY B;  4PCZ A;  3IG5 A;  1QAO A;  1JB0 F;  1XNQ M;  1OKS A;  4ANR A;  2OOA A;  3KOZ E;  4DR6 M;  1KYI A;  2DAM A;  2QP9 X;  1A5T A;  4AG5 A;  1NY6 A;  2G5G X;  3B9P A;  2G3Q A;  4BBA A;  1DV0 A;  3GO8 A;  4NOO B;  5KPT A;  2M5Z A;  3D8B A;  2KA6 B;  3SYL A;  4F1I A;  2UUB M;  4XBO A;  2ZTC A;  4B7G A;  3IEC A;  3T15 A;  4Z6Y A;  4JYA M;  2W82 A;  1DGF A;  1E9R A;  3UMM A;  3U6Q A;  3PVS A;  3LVV A;  5EXP A;  4M0W A;  4G4R A;  3T1H M;  2YR0 A;  2DWN A;  1GLN A;  2Z8Y M;  2R46 A;  1WXQ A;  3A45 A;  3KOW E;  4LGM A;  1T3T A;  2ZAM A;  1SXJ A;  4II7 A;  3AOE A;  1HJP A;  3ZH9 B;  4LRS A;  3F92 A;  4MGI E;  1F4I A;  1TDH A;  3JR5 A;  1EE8 A;  3B7N A;  3W68 A;  4DV5 M;  4OVZ B;  4L8R C;  1QAN A;  1QDT A;  3FYC A;  3GPY A;  1LV7 A;  3FRI A;  1ZMW A;  2R65 A;  4NXM M;  3SFZ A;  1TDZ A;  3HHZ A;  1ZMU A;  4AKI A;  2HAK A;  4JI5 M;  3HU2 A;  1QUS A;  4G4Q A;  1RU3 A;  4I5S A;  3U6M A;  1L2D A;  2DWL A;  4B3M M;  4L6V 6;  5FSW A;  1GO5 A;  4FWG A;  3U60 A;  3TWK A;  1QYR A;  1IBK M;  1VDD A;  4DV4 M;  3C9P A;  3U6O A;  4AG6 A;  4CHT B;  5KQ8 A;  5JI2 E;  2QBY A;  4NL4 H;  2EA0 A;  3H4M A;  2OO9 A;  1JR3 A;  1N34 M;  3M0E A;  3K9O A;  5EP1 A;  2F5Q A;  4FCV A;  2GNO A;  4JN6 A;  5FTK A;  1NVM A;  3FE3 A;  4FWD A;  2WSE F;  2DWZ B;  3TQS A;  4CIS A;  2HL7 A;  2V1U A;  4NSR A;  2ZAN A;  5DFL A;  4AZF A;  2R4J A;  5IWA M;  2A5Y B;  2JWS A;  2X8A A;  3NBX X;  8CAT A;  1I94 M;  1HNZ M;  2C99 A;  2MGW A;  4IBG A;  1VDL A;  2LXE A;  5DYI A;  3CF2 A;  1WHC A;  3UK6 A;  3PXG A;  3GRV A;  4GIP A;  3SMS A;  3WHK A;  3DA1 A;  3MJ5 A;  2DAE A;  2RRU A;  1SXJ C;  1MN3 A;  1NHG C;  3AOE C;  1SXJ D;  5IZ7 D;  3SHF A;  2BWB A;  4LFC M;  4JI4 M;  2DZO B;  2X4A A;  3HY5 A;  4JI3 M;  2C9C A;  3AKZ A;  3SAT A;  1Q02 A;  2HCB A;  2LBC A;  2KW0 A;  5L8R F;  2Z7J A;  2VF8 A;  3AL0 C;  3U6C A;  3L28 A;  2O01 F;  3I4V A;  4DV6 M;  2FE8 A;  2JNH A;  4OVZ A;  4G3O A;  3Q8G A;  3HZJ A;  2K47 A;  2LH0 A;  4IBK A;  3GPU A;  1Q3B A;  1XXH E;  2DI0 A;  2JY8 A;  3GLH B;  5KQD A;  4I8O A;  4I4L A;  4A3V B;  4GH9 A;  1HQC A;  1IXS B;  1ZMV A;  2CRU A;  1L2B A;  1Q3C A;  2CHG A;  1G71 A;  1QAQ A;  4MH0 E;  1DO0 A;  2QCU A;  3QYE A;  4W5W A;  5BPV A;  4DUY M;  5ITX E;  2LVQ D;  3BOS A;  3FTC A;  3ILK A;  4DUZ M;  4AQY M;  3GLI B;  4QHS A;  2OQ4 A;  1XXH B;  2UUC M;  1SXJ E;  4NRW A;  4LFB M;  3PNV A;  5FTJ A;  1HR0 M;  4LGY A;  2H5X A;  4D81 A;  1XMO M;  2YQZ A;  1IXZ A;  3GRR A;  1ZAE A;  3HU1 A;  4I81 A;  1D0K A;  2DHY A;  4HEO A;  4KLN A;  4LF4 M;  1AIP C;  3ZQJ A;  4CIZ A;  4JI6 M;  2DZN B;  1N33 M;  2E5L M;  2R45 A;  4GC5 A;  2RKO A;  3A46 A;  1L1T A;  1GAB A;  1IN8 A;  5DNY A;  2XSZ A;  2CUZ A;  3TWL A;  3W0L B;  4IBI A;  3H4J A;  4KOD A;  5EQT A;  3GP1 A;  3VDP A;  3KSJ A;  1EIJ A;  1WGN A;  1WJ7 A;  3C3D A;  3KS8 A;  4LJ5 A;  1E9S A;  3VK8 A;  1E32 A;  2DNA A;  1JR3 E;  1Z5B A;  3LQR A;  2EO2 A;  1G8P A;  3T38 A;  4RKU F;  3SBJ A;  1FNN A;  1UFZ A;  3CF0 A;  1GKI A;  1XMQ M;  5ITU A;  2B3T A;  3J7B A;  1PGY A;  3EIH A;  4FCW A;  1YE9 A;  3GLH A;  4M9X A;  4FCT A;  4G4O A;  3AOG A;  3SYK A;  4LF6 M;  4L78 A;  1IXS A;  1D0L A;  4G4N A;  4X66 M;  4GEW A;  3TE6 A;  4HLQ A;  4MGY E;  2OPF A;  3E9S A;  3GQ4 A;  4LJ8 A;  4XK8 F;  2C98 A;  2D7H A;  2L7I A;  4GRI A;  1L1Z A;  1N32 M;  2KZU A;  1XXH A;  3TWM A;  2L2D A;  3D8L A;  4LF8 M;  1IN4 A;  1G4A E;  3SMP A;  2DWM A;  2K6B A;  3L26 A;  1AUA A;  3UGJ A;  2R6F A;  1Z59 A;  2EKK A;  2XH9 A;  2L4F A;  4IBE A;  4IBF A;  1TR8 A;  1P3Q Q;  5ITX A;  2LTU A;  3KVW A;  2FH0 A;  5LMU M;  2BJW A;  2LHC A;  2L6O A;  1Z5A A;  3DZD A;  5F3W A;  2EJS A;  2FFJ A;  2DXI A;  1H6U A;  1Q39 A;  3GLF B;  1Z5C A;  2KRU A;  4X62 M;  1YSY A;  2XSZ D;  1Z6T A;  4LY6 A;  3KS4 A;  4FW9 A;  1PJI A;  1C7Y A;  2DAI A;  3MMP A;  4D82 A;  3J27 B;  2JXN A;  3L29 A;  4DR7 M;  2N35 A;  4LZZ A;  4R3D A;  4Y28 F;  3KW6 A;  2L4E A;  3C3E A;  3B89 A;  1V34 A;  4AI6 A;  1NJG A;  3KDS E;  3J81 S;  3U6S A;  4M0D A;  3I51 A;  2XEP A;  4IBD A;  1XC8 A;  4IIW A;  3HJ8 A;  1G41 A;  1I4W A;  2J7O A;  2XZF A;  4OU7 A;  2XZU A;  1OAO C;  5ITY A;  2KNV A;  1K3W A;  4R7G A;  3U6L A;  1R2Y A;  1GL7 A;  4GMQ A;  1IM2 A;  2FNA A;  3K92 A;  4M9S A;  5IT9 S;  2ZBK B;  4M9Z A;  4OX9 M;  1IXR C;  3U6E A;  3U6D A;  3VFD A;  1Y8G A;  2JY6 B;  2K0B X;  1J09 A;  2ZAO A;  4DR4 M;  4X64 M;  2KEB A;  2VQF M;  5ITR A;  3AV0 A;  3V76 A;  4LJA A;  1T43 A;  4MGH A;  2R0I A;  4MB7 A;  3KXE C;  2ZM6 M;  3LVW A;  1NV9 A;  4PT5 A;  2UXB M;  2VF7 A;  3LMM A;  5EP2 A;  3R9X B;  2CFO A;  3CF6 E;  2JY7 A;  2CEA A;  2CWB A;  3W67 A;  3I4Y A;  1R2Z A;  3AJI B;  4JI0 M;  3GLG B;  2L7H A;  5EP3 A;  2AHM A;  3JR4 A;  2QQ8 A;  4IBC A;  4P17 A;  2H1R A;  4LCB A;  1X37 A;  5FTN A;  4GKK M;  3TPZ A;  1S3S A;  3CGW A;  1K3X A;  4NSO B;  4AW4 A;  3GLF A; 
#chains in the Genus database with same CATH homology
 4LFA M;  2VQE M;  2Y20 A;  3FKE A;  1N77 A;  5ITQ A;  2CHQ A;  4B08 A;  3GPX A;  4OW0 A;  2R4E A;  1J7K A;  1DGH B;  3FUT A;  4LJ6 A;  4S12 A;  3VDU A;  2XFS A;  3A98 B;  3EIE A;  4NXN M;  3L2A A;  5A2Q S;  1ORY B;  1DGG A;  1OJL A;  1MX0 A;  3GQ5 A;  4B3T M;  3GPP A;  4LF5 M;  4LJ7 A;  2KRK A;  2V1C A;  3HGI A;  3UZU A;  2CE7 A;  1PM5 A;  3HHW A;  1JR3 D;  4RNA A;  4GC9 A;  3J80 S;  2KXE A;  4JXJ A;  4Z8X A;  2UUA M;  2FOI C;  3IG8 A;  4FWH A;  3C58 A;  1IN7 A;  1W5S A;  2F5N A;  3M6A A;  3SAR A;  4JI2 M;  2Z4R A;  1XHB A;  4MGK E;  5KPZ A;  1L2C A;  4BLC A;  2J7N A;  1TH3 A;  3TL4 X;  3SAV A;  4AKH A;  1L8Q A;  1K82 A;  3GLG A;  2YFQ A;  2XGN A;  3GQ3 A;  4YHH M;  3RFW A;  2Z4S A;  4DR3 M;  2CV1 A;  3FUW A;  3FD9 A;  1HNX M;  3FUU A;  1NSF A;  4LRT A;  4L16 A;  3KOX E;  2O5R A;  4CGY B;  3SAS A;  1QZM A;  3FTD A;  1DGH A;  5GKN A;  4LF9 M;  3DOA A;  1HT1 E;  4B7F A;  1QAM A;  3MK6 A;  4MM3 B;  2BJV A;  1NNU C;  3GRY A;  3NBI A;  3NWL A;  4B7H A;  1N78 A;  5FTM A;  5KPR A;  4IBJ A;  3FUV A;  4NRV A;  4REZ A;  5FTL A;  1IBM M;  1KSF X;  1UM8 A;  7CAT A;  4DV0 M;  3DFZ A;  1TH2 A;  1PJJ A;  3GLI A;  2P5T A;  3KSX A;  1YUB A;  3PNY A;  1QQW A;  2CHV A;  2NQ8 C;  3T1Y M;  2BNK A;  2G8L A;  2Q2E B;  3QWL A;  4MGZ E;  2F5P A;  2DHR A;  1N36 M;  3HJQ A;  3U61 B;  2LWX A;  5C1B A;  4HL4 A;  4WUR A;  4QOZ C;  3K2L A;  3HU3 A;  5JI3 E;  2D7E A;  4K0K M;  1J5E M;  2RGO A;  3KFU G;  2R18 A;  3HKP A;  1R6B X;  2Y0T A;  1DGB A;  2EUC A;  4QNR A;  3ZCB B;  4L15 A;  5BR8 M;  2C96 A;  2ERC A;  4PD2 A;  2V6Z M;  2M60 A;  4GKJ M;  1ZQ9 A;  3MHV C;  3ZC7 B;  5EXT A;  3VKH A;  4DR5 M;  4ITQ A;  2QZ4 A;  2DVW B;  3E4R A;  3J7A S;  2YNM D;  1GVN A;  1R7R A;  4LG2 A;  3GRU A;  2XF3 A;  4JI8 M;  3HHY A;  5C18 A;  3FTF A;  4DV2 M;  1NHW C;  2Y0Q A;  3QAU A;  2D7G A;  2HHH M;  4KO8 A;  4QNM A;  4DR2 M;  1IN5 A;  4DV3 M;  4D80 A;  1NY5 A;  4QHT A;  2UU9 M;  4JI1 M;  4FD2 A;  1KFV A;  3VK7 A;  2F5S A;  3AFH A;  1IQP A;  4EIW A;  3U61 A;  1XWI A;  3J2P B;  1HNW M;  5LMN M;  4LZJ A;  2UXC M;  4JV5 M;  4TUW A;  2VII A;  2Y21 A;  2UXD M;  1MU5 A;  5IRE B;  5H37 D;  1OFH A;  4JI7 M;  2Z3X A;  4GHL A;  1XNR M;  3K1J A;  2I7N A;  1IY0 A;  4P16 A;  3RGS A;  3VLF B;  2QEN A;  3SAU A;  3RGP A;  2QPA A;  3R8F A;  1G3I A;  2C9O A;  4YY3 M;  1HQY E;  3A42 A;  5EXS A;  1IY1 A;  1DO2 A;  2KZS A;  1C1K A;  1IBL M;  3OTO M;  3L27 A;  1TGU A;  2CV0 A;  1GL6 A;  1D2N A;  1JQJ C;  4GIT A;  4PDI A;  3M7G A;  2F4V M;  1HT2 E;  2I7P A;  5E26 A;  3FUX A;  3U5Z B;  2RGH A;  4L4U A;  1N75 A;  2CV2 A;  3FTE A;  3CTW B;  4IJF A;  3HJS A;  1OFI A;  3THG A;  3Q8X A;  4LJ9 A;  3SHG B;  2F5O A;  2C5R A;  3WHL A;  2X49 A;  1QVR A;  3K8Z A;  4IBB A;  4RF1 A;  3KP0 E;  5EXX A;  4JI5 M;  4DR1 M;  4B3S M;  1FJG M;  4RF0 A;  5E6J A;  3W0F A;  4B3R M;  4LJ4 A;  3JAM S;  4DV1 M;  5KO3 A;  2HKJ A;  4X65 M;  3HHX A;  2R62 A;  3SC3 A;  5ITT A;  4BB9 A;  3HWS A;  1IY2 A;  1SXJ B;  4DV7 M;  3RE8 A;  1NJF A;  1NNJ A;  4PDG A;  2L09 A;  4FVM A;  1TH4 A;  3U6P A;  4AKG A;  2LNH C;  4LF7 M;  4XGI A;  5EJC A;  3SAW A;  4KHP M;  1IN6 A;  4QOS A;  1E94 E;  3UJN A;  3KOY E;  2JA2 A;  3L25 A;  2XLJ A;  5DYG A;  2XFT A;  4ZPX A;  4G6Z A;  3LQQ A;  4IJE A;  1W5T A;  3U5Z A;  3U60 B;  1G59 A;  3VKG A;  4GHA A;  3PFI A;  4WW0 A;  5FLX S;  5EP4 A;  3FYD A;  3KP1 E;  2QBY B;  4PCZ A;  3IG5 A;  1QAO A;  1XNQ M;  4DR6 M;  3KOZ E;  1KYI A;  2QP9 X;  4AG5 A;  1NY6 A;  2G5G X;  3B9P A;  4BBA A;  3GO8 A;  4NOO B;  5KPT A;  2M5Z A;  3D8B A;  2KA6 B;  3SYL A;  2UUB M;  4XBO A;  4B7G A;  4JYA M;  3T15 A;  4Z6Y A;  2W82 A;  1DGF A;  1E9R A;  3UMM A;  3U6Q A;  3PVS A;  3LVV A;  5EXP A;  4M0W A;  4G4R A;  3T1H M;  2YR0 A;  2DWN A;  1GLN A;  2R46 A;  1WXQ A;  3A45 A;  3KOW E;  4LGM A;  1T3T A;  2ZAM A;  1SXJ A;  4II7 A;  3AOE A;  3ZH9 B;  4LRS A;  4MGI E;  1TDH A;  3JR5 A;  1EE8 A;  4DV5 M;  4OVZ B;  4L8R C;  1QAN A;  3FYC A;  3GPY A;  1LV7 A;  4NXM M;  2R65 A;  3SFZ A;  1TDZ A;  3HHZ A;  4AKI A;  3HU2 A;  4G4Q A;  1L2D A;  4I5S A;  3U6M A;  2DWL A;  4B3M M;  5FSW A;  4FWG A;  3U60 A;  3TWK A;  1QYR A;  1IBK M;  1VDD A;  4DV4 M;  3U6O A;  4AG6 A;  4CHT B;  5KQ8 A;  5JI2 E;  2QBY A;  4NL4 H;  2EA0 A;  3H4M A;  1JR3 A;  1N34 M;  3M0E A;  5EP1 A;  2F5Q A;  4FCV A;  4JN6 A;  5FTK A;  1NVM A;  4FWD A;  4CIS A;  2DWZ B;  3TQS A;  2HL7 A;  2V1U A;  4NSR A;  2ZAN A;  4AZF A;  2R4J A;  5IWA M;  2A5Y B;  2X8A A;  8CAT A;  1I94 M;  1HNZ M;  2C99 A;  4IBG A;  2LXE A;  5DYI A;  3CF2 A;  3UK6 A;  3PXG A;  3GRV A;  4GIP A;  3SMS A;  3WHK A;  3DA1 A;  3MJ5 A;  1SXJ C;  1NHG C;  3AOE C;  1SXJ D;  5IZ7 D;  3SHF A;  4LFC M;  4JI4 M;  2DZO B;  2X4A A;  3SAT A;  4JI3 M;  2C9C A;  3AKZ A;  2HCB A;  2KW0 A;  2Z7J A;  3AL0 C;  3U6C A;  3L28 A;  3I4V A;  4DV6 M;  2FE8 A;  4OVZ A;  2K47 A;  2LH0 A;  4IBK A;  3GPU A;  1Q3B A;  3GLH B;  5KQD A;  4I8O A;  4I4L A;  4A3V B;  4GH9 A;  1HQC A;  1IXS B;  1L2B A;  1Q3C A;  2CHG A;  1QAQ A;  4MH0 E;  1DO0 A;  2QCU A;  5BPV A;  4W5W A;  4DUY M;  4DUZ M;  5ITX E;  3FTC A;  3BOS A;  3ILK A;  4AQY M;  3GLI B;  4QHS A;  2OQ4 A;  1XXH B;  2UUC M;  1SXJ E;  4NRW A;  4LFB M;  3PNV A;  5FTJ A;  1HR0 M;  4LGY A;  4D81 A;  1XMO M;  2YQZ A;  1IXZ A;  3GRR A;  1ZAE A;  3HU1 A;  4I81 A;  4KLN A;  4LF4 M;  4JI6 M;  2DZN B;  1N33 M;  2E5L M;  2R45 A;  4GC5 A;  2RKO A;  3A46 A;  1L1T A;  1IN8 A;  5DNY A;  2XSZ A;  2CUZ A;  3TWL A;  3W0L B;  4IBI A;  4KOD A;  5EQT A;  3GP1 A;  3VDP A;  3KSJ A;  3KS8 A;  4LJ5 A;  1E9S A;  3VK8 A;  1E32 A;  1Z5B A;  3LQR A;  2EO2 A;  1G8P A;  3T38 A;  3SBJ A;  1FNN A;  3CF0 A;  1GKI A;  1XMQ M;  5ITU A;  3J7B A;  3EIH A;  4FCW A;  1YE9 A;  3GLH A;  4M9X A;  4FCT A;  4G4O A;  3AOG A;  3SYK A;  4LF6 M;  4L78 A;  4G4N A;  4X66 M;  3TE6 A;  4HLQ A;  4MGY E;  2OPF A;  3E9S A;  3GQ4 A;  4LJ8 A;  2C98 A;  2D7H A;  2L7I A;  4GRI A;  1L1Z A;  1N32 M;  2KZU A;  1XXH A;  3TWM A;  4LF8 M;  3D8L A;  1IN4 A;  1G4A E;  3SMP A;  2DWM A;  3L26 A;  3UGJ A;  4IBF A;  1Z59 A;  2XH9 A;  4IBE A;  5ITX A;  3KVW A;  5LMU M;  2BJW A;  2L6O A;  1Z5A A;  5F3W A;  3DZD A;  2DXI A;  2FFJ A;  1H6U A;  1Q39 A;  3GLF B;  1Z5C A;  2KRU A;  4X62 M;  1YSY A;  2XSZ D;  1Z6T A;  4LY6 A;  3KS4 A;  4FW9 A;  1PJI A;  4D82 A;  3J27 B;  3L29 A;  4DR7 M;  4LZZ A;  4R3D A;  4AI6 A;  3KW6 A;  1NJG A;  3KDS E;  3J81 S;  3U6S A;  4M0D A;  3I51 A;  2XEP A;  4IBD A;  1XC8 A;  4IIW A;  3HJ8 A;  1G41 A;  1I4W A;  2J7O A;  2XZF A;  4OU7 A;  2XZU A;  5ITY A;  1K3W A;  4R7G A;  3U6L A;  1R2Y A;  1GL7 A;  4GMQ A;  1IM2 A;  2FNA A;  3K92 A;  4M9S A;  5IT9 S;  2ZBK B;  4M9Z A;  4OX9 M;  1IXR C;  3U6E A;  3U6D A;  3VFD A;  2ZAO A;  1J09 A;  4DR4 M;  4X64 M;  2KEB A;  2VQF M;  5ITR A;  3AV0 A;  4LJA A;  4MGH A;  4MB7 A;  3KXE C;  2ZM6 M;  3LVW A;  2UXB M;  4PT5 A;  3LMM A;  5EP2 A;  3R9X B;  2CFO A;  3CF6 E;  2CEA A;  3I4Y A;  1R2Z A;  3AJI B;  4JI0 M;  3GLG B;  2L7H A;  5EP3 A;  2AHM A;  3JR4 A;  4IBC A;  2H1R A;  4LCB A;  1X37 A;  5FTN A;  4GKK M;  3TPZ A;  1S3S A;  1K3X A;  4NSO B;  4AW4 A;  3GLF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...