4DV4T

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4dv4T00
4JI3T 4X65T 4LFBT 4JI7T 4LF9T 4JI8T 1XMOT 4JI0T 2UXBT 4OX9T 4DV4T 1HR0T 4NXMT 5LMNT 4JV5T 4LFAT 4LF8T 2UUAT 4YHHT 1XMQT 4GKJT 4LF7T 4JYAT 4LF6T 2F4VT 1N33T 1IBMT 3T1YT 1HNWT 2E5LT 3T1HT 4JI2T 4JI1T 4LF5T 1N36T 2VQET 2UUCT 2UXDT 4DV0T 4KHPT 1IBKT 1N34T 2HHHT 2UXCT 2VQFT 1HNZT 4B3MT 3OTOT 5LMUT 4B3ST 4DV6T 4DV2T 1J5ET 4DR5T 4JI6T 4NXNT 2UU9T 4DR7T 4GKKT 4DUYT 4DV3T 4LFCT 4DV1T 1HNXT 4B3TT 4DR6T 1XNQT 5IWAT 5BR8T 4YY3T 4DR3T 4DUZT 1N32T 2ZM6T 4B3RT 4JI4T 4X64T 4AQYT 4K0KT 4JI5T 4DV5T 1XNRT 4DR2T 4DV7T 4DR1T 4X66T 4LF4T 4DR4T 1I94T 4X62T 2UUBT 1IBLT 1FJGT
chains in the Genus database with same CATH superfamily
4YFSA 4JI3T 1T8BA 4LFBT 4JI7T 2W63A 2CWYA 4UELA 3TLUA 5H6QB 2C5IT 2WDVA 3EVYA 5LB7B 5CA0E 1O3XA 2LHNA 5ABGA 3KFWX 3NZQA 5AQSB 5CA1E 5GONE 5J0ZA 4JI8T 3L8RA 4PJMA 4V1Av 2ODVA 2PBIA 2WY2A 4JI0T 2YU2A 2LRKA 1UK5A 1Z8UA 1W9RA 2LEHA 2VL8A 4EV6A 4YTMA 5C8YE 2X9WA 3OVUA 4Z91A 4AQFA 3E22E 4NPPA 4O4IE 5CB4E 4UR9A 2CA5A 4GKKT 2YN6A 3Q5WA 1X9BA 2LSIA 3N2GE 5HAXA 3UFGA 4CXWA 3PUAA 4ZZBA 4JV5T 4AI6A 4DVDA 1VCSA 1MNEA 2NTXA 3BK9A 3EHZA 3QUJA 2X67A 4QXHB 2DWKA 5ETWA 2ES0A 1FMWA 3RYHE 3P50A 3VU7H 2VKJA 3TKLB 5KMGP 3FBLA 2JQ9A 3NZPA 3ZMSB 4TV9E 3QC9A 3ZYMA 1XMQT 3AECA 5DQWA 3AE4A 5AQRB 5FXZA 5LBQB 2WMNA 4I4TE 3P8CD 2IUBA 2EHOA 3J9X1 3U78A 5LJMA 4IE0A 3I1AA 3LK2B 4L0RA 5FYMA 4DMWA 4I43B 2XY8B 3AE3A 3O1IA 5DQVA 4EOZB 5AQQB 3K3OA 1IBMT 4PK6A 4YJ3E 3KV9A 1WFDA 3KINB 1W09A 3CQCB 3LJCA 3JAFA 3N9NA 4DIDB 4JI1T 1SUMB 3FB2A 2BS3A 2MTQA 4Z90A 2V7MA 5AQFB 5LGNB 3RPUA 4H9QC 4MLKA 2D5UA 2UUCT 1W0AA 3B13A 4NUVA 3BQKA 2V8SV 4MFRA 4O2BE 4AKRB 5L4EA 2BVMA 4YJ2E 2X68A 3FZHB 4ILUA 1VRBA 5HXEA 3ETUA 2XAQB 4PAGA 2BG9E 3ZT6A 2UXXB 5HXRA 3C64A 5BMVE 3KBUA 4U31A 4BJMA 4EEBA 2HHHT 3Q9DA 4EYUA 3RKOA 3VHLA 2H7OA 5HEJA 2X9HA 2WB5A 4ZS3A 2A9UA 2VQFT 2VWAA 3H3AA 3OTOT 1WLXA 3KBTA 4AQGA 2WM9A 2B76A 4DV2T 4O2AE 1BR4A 3JADA 4UV8B 3VRAA 3ZMZB 2JQHA 3ETVA 3I9WA 4P1NA 4DNDA 1J5ET 2DL1A 2FUPA 3O1JA 2M6BA 4UVBB 3M3ZB 2LRLA 2E8IA 2C0SA 2HPLA 2IDOB 3N9LA 4QKNA 1S35A 2LM9A 1YW0A 3L39A 3LFMA 2MOZA 3A8YC 3TLSA 5ABEA 3EDUA 2XQ6A 2AE9A 4HWHA 4JUYA 4UF0B 5FVLA 3CKDA 4HFHA 4A98A 3E08A 4L5GA 3AVRA 1U5PA 4DUYT 3CPZA 4PJJA 1HNXT 2V7IA 3LK3B 2LE8A 2ACXA 1US7B 5EK3A 4PFPA 4E7SA 2X9YA 2W62A 4HFCA 3BQIA 2WU5A 5IUXA 5L47A 4BA9A 1QUUA 1HF8A 2FBWA 3CMLA 5IWAT 5HCMA 3RQWA 3HI2A 2E9XA 3C4XA 4M1PA 4E7ZA 5LNKA 4DR3T 3VKGA 2IAKA 5AQGB 5ABHA 5ADXL 1CUNA 4CI3B 3UU4A 2I0MA 5EK2A 3G06A 2X66A 2JMHA 1Y64B 1ZKEA 2VKDA 3N9PA 2ZM6T 2MAWA 3R6NA 4JI4T 4X64T 2H3RA 4AQYT 5HEGA 5HXHA 4IL4A 5EK4A 3RRWA 5JDQA 3OPCA 3ZJ2A 2W66A 2CXDA 4TV8E 3X1DA 1NAFA 2N2NA 2WU2A 3EI0A 3NVOA 2LSJA 4HFDA 5L3FB 5H6RB 2LSYA 2Z6EA 5HEHA 4DR2T 2BKNA 4AKLA 2SPCA 2LJLA 3FZFB 2XQ3A 2XSAA 4GK5E 1OEDA 4BJNA 5JVDE 4HE8A 5AQVB 3ZJ1A 5C3JA 3NWIA 3UU5A 1OEDB 4ANJA 3OYZA 4JEUB 3ZMUB 1XWMA 3F31A 3RIAA 2WAUA 2WWUA 3PU3A 1XDOA 3C4ZA 4ASKA 2XZEA 3CQXC 2YU1A 1ZP0A 3CWZB 3UULA 4X65T 1IBLT 2CPTA 2EHOB 2Q9QC 4C91A 5LGTB 1YQ4A 4WBOA 4EXTA 4HKAA 5AQPB 2W61A 5AFUL 4FJOA 4U3CA 4A97A 3HKCE 1YKEB 1XMOT 5LHGB 2UXBT 1JNRA 3GN5A 4XBFB 4AXPA 2VVNA 2K24A 1MMDA 2N9DA 3QNUA 4QX7B 2P9BA 5LG3A 2ZM8A 5FP3A 4PJLA 4NXMT 4A56A 2L9QA 3GMIA 4HWIB 5HEUA 4GOUA 5LMNT 2E9XC 3RIFA 2XAHB 4X5TA 3F57A 2WSSV 4X1IE 4YSYA 3AAIA 2HN1A 3UU3A 4HFBA 2C5KT 3A5XA 2OLTA 3PUVF 1YXRA 4PK4A 3V5UA 4LF8T 4P0BA 2V7JA 4YHHT 3PTRB 3SOLA 1BR1A 3CX6B 3RIUA 3RRCA 3FZLB 2NTYA 3AEGA 4ZI3C 3KVBA 4AKGA 1FMVA 3KV6A 3MXZA 3PUGA 3N9OA 4H63V 4CN4A 2F4VT 3KDSE 4JYAT 1KNZA 4P0AA 2LSKA 4TWHA 1SE7A 2KSRA 2X9XA 3HA4A 2LHRA 3VR8A 3ZT7A 3WI3A 1X79A 3AE2A 4YXDA 1YKHB 1ZV4X 3OKQA 4TNWA 1J5WA 4IDPA 1D0YA 2XPKA 4YTPA 2V5DA 3AE1A 3P4QA 1HG5A 2A3DA 4BAYB 4DBRA 5AQTB 5FXVA 2H7VC 3O4XE 2BG9C 4JEHB 4AKHA 3AE9A 1T98A 4WZXA 4DV0T 4IE7A 2HH7A 2KT9A 4QX8B 5A1LA 2XQ4A 3AAEB 3UU8A 5CGMA 4IE4A 3ZLIA 3LBXB 1G8XA 3P4WA 2E5VA 3AE8A 2XSBA 3BQLA 5FY7A 4ZHQE 5LJNA 4IDZA 2W0GA 3GWHA 3MA9A 2VKOA 1HFAA 5AQLB 4WYVA 2MBGA 2I59A 1KF6A 2YDRA 4H9RC 5LMUT 5AQNB 4EEDA 1ZEEA 3ZC0A 3PJAA 3PV0F 1E1HB 5KDMC 3O1HA 4U7YA 3S4UA 4JI6T 2DI4A 2KINB 2YDSA 2KMFA 5LHIB 2FJEA 2OV9A 4IHJE 3OYXA 3TLWA 2EHOC 4G2AA 3JC6D 4KBMB 4DR7T 3DTOA 4UVAB 1WCRA 1WRDA 2CHOA 2XHEB 3QB5A 4U2YA 1D0ZA 4ADZA 3AEEA 2R6GF 3K1SA 3PDYA 3PUQA 3JC6C 3RYIE 5JR9B 4LFCT 1OEDC 1OWAA 2PFVA 3AE6A 4UXNB 5LOVE 3ZPOA 5ABFB 1DU2A 3AE7A 3IA3A 3MKDA 4H9SE 4DR6T 5LXTE 3ZCIA 3RIUC 1HCIA 4CXXA 1KNPA 2A2FX 1FEWA 1LRZA 2PG8A 3HL6A 2VB6A 2VURA 4IDOA 4KMCA 4JBWF 2LT3A 3PUWF 2LM2A 4IIJE 4U74A 4CI2B 4DO0A 4EZ4A 2NW9A 2XM2A 4Z8XA 3B5MA 2IIUA 5FMNA 5HEOA 2CBJA 5FVKA 5JDFA 3TLVA 1I94T 2D0TA 2DWGA 3O9XA 4B3RT 4U72A 5JDGA 2HPJA 3AEDA 4ZOLE 3ZSSA 4CQIA 1T7SA 3MJXA 2GK9A 3C51A 4O4LE 2B1EA 3NKZA 2KZ7B 3RQUA 4CXYA 5KXJA 4DV5T 1WYCA 4TNVA 4EGWA 3ZMVB 4X20E 4DV7T 3I9YA 2BG9A 2J4GA 4ILCA 3I0QA 3CVRA 3M65A 4P09A 3EABA 3ZC1A 4YSXA 2V6YB 1FIOA 2DHRA 1MIYA 3IHRA 2EHOD 5JDMA 1IJ5A 4KP3C 4GYSA 2W00A 3LSVA 5JDNA 3CQGB 2BKPA 4ISTA 4X62T 3P7IA 1VCTA 4PFOA 2VK9A 5L4HA 4DR1T 1FJGT 2JPFA 5JRCA 2NWBA 2XAFB 1WR6A 5AQHB 2ZM0A 2FJDA 3KVAA 2A72A 2IC6A 2XQAA 4CI1B 3Q5XA 3B57A 2K9AA 4EAHA 2VASA 4OX9T 3UTKA 2W2UA 3RX6A 4LMLA 2YDQA 2W67A 2CEAA 2VVSA 3N5LA 4MBQA 4QHOA 3C50A 5L3GB 3HKDE 3PJAJ 2JQKA 3AEBA 2QGSA 4TWDA 5JDLA 5HWYA 2V1DB 5FL1A 2C5JA 3FHNA 4GIWA 2WDQA 1WYBA 4HFVA 5J1GA 1V9DA 4COFA 4LFAT 3PUSA 4X1KE 5DJQC 3AB3B 1YD8G 4TUYE 4OYJA 3PUZF 2D0UA 3RC3A 2BZBA 4EYYR 4N78D 4X1YE 3D0TA 4H63H 4KHZF 3AXJA 3UUXB 3NRYA 2MPKA 2WWVA 3RH3A 3ZN1B 4IREA 2BVLA 4QWNB 5CJ5A 1S94A 2CM0A 2NOXA 2XTLA 2WMOA 1QLBA 3T1YT 1HNWT 2M67A 1KEYA 1YQ3A 1NENA 4ZI2C 2ZM2A 4O4JE 3T1HT 4ISSA 2CE7A 4JI2T 4LMJA 1SA0E 2V5CA 1B7TA 3AA1B 3NRXA 1UCUA 3AA6B 5JH7E 4LF5T 3T8OA 2Y8DA 3EAMA 4IE6A 4WW0A 3RHWA 1W0BA 3P4PA 4A5XA 4ZI2D 1N36T 2LOSA 2XUEA 3KV4A 2Q9QA 2KWIB 3UFEA 3RI5A 5M4YA 2J1DG 3L3PA 4O4HE 5TAOA 4HEAA 2KXPB 4OK0A 1M62A 4ZI7E 5LGUB 2WQYA 2XQ8A 3OBVE 4PW8A 5AQKB 3UUNA 4CZZB 2H89A 1IBKT 3ZYKA 4I55E 2ODUA 5LP6E 3ANWB 2G0UA 4DBQA 2WCAA 2CCQA 2JJ9A 3ZMTB 2X0YA 2AXDS 3RGLA 4EB6E 2LLYA 2UXCT 5AQIB 3SFEA 2Y48B 2NW8A 2V7LA 4FI5A 1HNZT 4B3MT 2IHR1 5CFBA 1SHZC 2BG9B 4B6XA 4TZ4C 4B3ST 3Q5DA 4U33A 3UQ7A 2HN2A 3AVSA 3RYCE 2H88A 3ABVA 1Z0PA 1N32T 2XAGB 4HFIA 3H3MA 4IE5A 1KK7A 4NXNT 2PJQA 2XQ9A 1UX5A 3U3IA 3RYFE 2L3LA 2QA7A 3ESLA 3FXDB 5JQGE 1OXZA 3IF8B 5J2UE 1WR0A 4EZHA 4PNIA 4ZS2A 4ZEYA 4YLHA 3N9QA 5L3DB 4IT4A 4DV1T 5LBMA 4IDQA 3ZN0B 5FY0A 3AAAB 2XM1A 4B3TT 3MZKB 3P4RA 1XNQT 3ZYLA 3HKBE 1AJ3A 1D1BA 5HYAA 1LVFA 1HX8A 1UUSA 3AE5A 2J62A 3QB5K 4L9IA 4PJNA 5E0OA 1MMNA 4EIWA 2WS3A 5KX5E 5BR8T 3AA0B 1HTJF 4YY3T 2QYWA 4YT0A 5HWXA 4DUZT 1M7KA 3SS1A 4IGUA 4UEMA 1R8IA 2YEVC 5HXCA 3PE0A 5LCYA 5LG4A 2WP9A 1U4QA 2XQ5A 4OHFA 4XAXB 1D0XA 5IYZE 5JR9C 3OJAA 2CLYC 2DNXA 2IC9A 3ZKRA 5AQMB 4TX5A 2E2AA 2KWHA 3ZCJA 3N9MA 4K0KT 3JAEA 3SRZA 2N1GA 2QRXA 1E7PA 1L0VA 4F6RC 2WZHA 3E0ZA 3AEAA 3DJBA 1IJ6A 1NWMX 4IL9A 3VRBA 4YTNA 3I0OA 1XNRT 2IMLA 1H7CA 4X66T 1HS7A 2CMRA 2YK0A 4TN7B 1KNRA 2X0LB 4OFZA 3FZKB 2CXFA 3EDVA 4U2ZA 4KHPT 3HKEE 3A7MA 1EZ3A 1UX4A 2Y6XA 3IEEA 5JREA 4CN1A 2VL0A 3LBXA 4QXBB 3ONLC 4LF9T 4ILAA 1J1JA 3HR0A 2CBIA 3ONXA 3ONJA 4I50E 4HN9A 4UIGA 2NP9A 3UUMA 1BR0A 4QH1A 2VKHA 2YOEA 2IW5B 2JQQA 3C4WA 2JMKA 3PURA 2XASB 2V26A 4LMKA 3RKGA 1NEKA 3LK42 4ERRA 4IDNA 2ZMAA 1KFYA 4H9PC 5FY1A 3K3QC 4I0UA 4ZZCA 4DV4T 2ACZA 2CHNA 2RPAA 1HR0T 5IHYA 1IAPA 2JRKA 3FBZA 3QOFA 4KX6A 4NUUA 3NBXX 1G73A 3EUHA 4QH4A 2OA5A 2UXDT 2JIWA 2I6HA 2BDEA 2X51A 1QSDA 2BBJA 1MIVA 2Q9QD 2LOPA 3ZSTA 5FNVE 5JR9A 2UUAT 3PU8A 4MHCA 5FL0A 4C90A 4YHJA 5C2TA 3KV5A 2RA1A 3PUYF 1CHUA 4LF7T 3R84B 2W4XA 4O8SA 3WAKA 4LF6T 4Q25A 5AQUB 1N33T 2QVAA 2MYSA 4QH5A 3H37A 1XDPA 1MMAA 2K3WA 2E5LT 3AA7B 3CK6A 5EZYE 4GKJT 3RF1A 1GQEA 2V6YA 5JTGA 2DCFA 2X0HA 4HWCA 3SWHA 3ZT5A 5L3CB 1UGOA 5F3JA 3J7Yq 3GN5B 4G63A 2FJAA 3MK7C 4GK0E 5HXSA 3TLTA 4HGAA 2VQET 4QXCB 1D1AA 5AQOB 2M6IA 1I6ZA 4F8HA 4MALA 3ANWA 4UF0A 3L09A 4JLEA 4UVCB 3PUXF 3RLFF 1XZYA 2LKHA 4HWFA 3UQ4A 2YKSA 2WDRA 4KI0F 5HCJA 1N34T 2BS4A 1OEDE 2K48A 3VR9A 2UXNB 2Q9QB 1ZOYA 2NW7A 4H9OC 3WAJA 4NIQA 5FKYA 1E2AA 1HX1B 2BS2A 4GYRA 4J2CA 3C98B 1T72A 3DP7A 3IBPA 3GA8A 1MMGA 3CX8B 3LDQB 4WNKA 4XZCA 5LHHB 4DV6T 5ABFA 4TWFA 2YINA 2XJ7A 5DABA 4DR5T 3V5SA 3ZEFB 2CXLA 2V7KA 5JDHA 3JCFA 5J2TE 1ZHCA 4PK5A 4HWDA 4OYKA 5LA6E 2KNDA 3AXJB 3CX7B 4H9NC 4HTEA 1VOMA 4WBNE 2WBLA 2CRBA 2CWOA 5L3EB 4DV3T 2E9XB 2PTFA 4CN6A 4ZI3D 5AQJB 4KUMB 4UV9B 5LYJE 1BR2A 4AIUA 3CIRA 5FXWA 2LSGA 3UU6A 2J47A 2L8KA 3SFDA 3P4SA 3RC8A 2RP4A 2NR4A 4K0UA 5L3BB 3AEFA 2ZLYA 4ILBA 5F8PA 4AKIA 3VKHA 4U7IA 3FXEB 1MIWA 1Y01A 3LG7A 2CLYB 5L2LA 1LKXA 1JNZA 3K3NA 1LVKA 2XQ7A 2V6XA 5FXXA 3UUBA 2D9DA 2DLRA 2XQYA 1UURA 3UT5E 2UU9T 5F5WA 4ZXLA 3N2OA 1IZNB 4DMVA 3K8PC 5JRCB 3F2EA 4JI5T 4AISA 3Q2MA 2KLQA 2D2SA 2FJBA 2LKGA 2K5BB 2WZIA 4HFEA 4LF4T 1HG2A 1MNDA 1D1CA 4AQFC 3QK6A 3Q5EA 3N2KE 3FZMB 2E9XD 4DR4T 3W15B 3MACA 4YSZA 2BKOA 2UUBT 2BBHA 2XAJB
chains in the Genus database with same CATH topology
4JI3T 4X65T 4LFBT 4JI7T 4LF9T 4JI8T 1XMOT 4JI0T 2UXBT 4OX9T 4DV4T 1HR0T 4NXMT 5LMNT 4JV5T 4LFAT 4LF8T 2UUAT 4YHHT 1XMQT 4GKJT 4LF7T 4JYAT 4LF6T 2F4VT 1N33T 1IBMT 3T1YT 1HNWT 2E5LT 3T1HT 4JI2T 4JI1T 4LF5T 1N36T 2VQET 2UUCT 2UXDT 4DV0T 4KHPT 1IBKT 1N34T 2HHHT 2UXCT 2VQFT 1HNZT 4B3MT 3OTOT 5LMUT 4B3ST 4DV6T 4DV2T 1J5ET 4DR5T 4JI6T 4NXNT 2UU9T 4DR7T 4GKKT 4DUYT 4DV3T 4LFCT 4DV1T 1HNXT 4B3TT 4DR6T 1XNQT 5IWAT 5BR8T 4YY3T 4DR3T 4DUZT 1N32T 2ZM6T 4B3RT 4JI4T 4X64T 4AQYT 4K0KT 4JI5T 4DV5T 1XNRT 4DR2T 4DV7T 4DR1T 4X66T 4LF4T 4DR4T 1I94T 4X62T 2UUBT 1IBLT 1FJGT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI3 T;  4X65 T;  4LFB T;  4JI7 T;  4LF9 T;  4JI8 T;  1XMO T;  4JI0 T;  2UXB T;  4OX9 T;  4DV4 T;  1HR0 T;  4NXM T;  5LMN T;  4JV5 T;  4LFA T;  4LF8 T;  2UUA T;  4YHH T;  1XMQ T;  4GKJ T;  4LF7 T;  4JYA T;  4LF6 T;  2F4V T;  1N33 T;  1IBM T;  3T1Y T;  1HNW T;  2E5L T;  3T1H T;  4JI2 T;  4JI1 T;  4LF5 T;  1N36 T;  2VQE T;  2UUC T;  2UXD T;  4DV0 T;  4KHP T;  1IBK T;  1N34 T;  2HHH T;  2UXC T;  2VQF T;  1HNZ T;  4B3M T;  3OTO T;  5LMU T;  4B3S T;  4DV6 T;  4DV2 T;  1J5E T;  4DR5 T;  4JI6 T;  4NXN T;  2UU9 T;  4DR7 T;  4GKK T;  4DUY T;  4DV3 T;  4LFC T;  4DV1 T;  1HNX T;  4B3T T;  4DR6 T;  1XNQ T;  5IWA T;  5BR8 T;  4YY3 T;  4DR3 T;  4DUZ T;  1N32 T;  2ZM6 T;  4B3R T;  4JI4 T;  4X64 T;  4AQY T;  4K0K T;  4JI5 T;  4DV5 T;  1XNR T;  4DR2 T;  4DV7 T;  4DR1 T;  4X66 T;  4LF4 T;  4DR4 T;  1I94 T;  4X62 T;  2UUB T;  1IBL T;  1FJG T; 
#chains in the Genus database with same CATH topology
 4YFS A;  4JI3 T;  1T8B A;  4LFB T;  4JI7 T;  2W63 A;  2CWY A;  4UEL A;  3TLU A;  5H6Q B;  2C5I T;  2WDV A;  3EVY A;  5LB7 B;  5CA0 E;  1O3X A;  2LHN A;  5ABG A;  3KFW X;  3NZQ A;  5AQS B;  5CA1 E;  5GON E;  5J0Z A;  4JI8 T;  3L8R A;  4PJM A;  4V1A v;  2ODV A;  2PBI A;  2WY2 A;  4JI0 T;  2YU2 A;  2LRK A;  1UK5 A;  1Z8U A;  1W9R A;  2LEH A;  2VL8 A;  4EV6 A;  4YTM A;  5C8Y E;  2X9W A;  3OVU A;  4Z91 A;  4AQF A;  3E22 E;  4NPP A;  4O4I E;  5CB4 E;  4UR9 A;  2CA5 A;  4GKK T;  2YN6 A;  3Q5W A;  1X9B A;  2LSI A;  3N2G E;  5HAX A;  3UFG A;  4CXW A;  3PUA A;  4ZZB A;  4JV5 T;  4AI6 A;  4DVD A;  1VCS A;  1MNE A;  2NTX A;  3BK9 A;  3EHZ A;  3QUJ A;  2X67 A;  4QXH B;  2DWK A;  5ETW A;  2ES0 A;  1FMW A;  3RYH E;  3P50 A;  3VU7 H;  2VKJ A;  3TKL B;  5KMG P;  3FBL A;  2JQ9 A;  3NZP A;  3ZMS B;  4TV9 E;  3QC9 A;  3ZYM A;  1XMQ T;  3AEC A;  5DQW A;  3AE4 A;  5AQR B;  5FXZ A;  5LBQ B;  2WMN A;  4I4T E;  3P8C D;  2IUB A;  2EHO A;  3J9X 1;  3U78 A;  5LJM A;  4IE0 A;  3I1A A;  3LK2 B;  4L0R A;  5FYM A;  4DMW A;  4I43 B;  2XY8 B;  3AE3 A;  3O1I A;  5DQV A;  4EOZ B;  5AQQ B;  3K3O A;  1IBM T;  4PK6 A;  4YJ3 E;  3KV9 A;  1WFD A;  3KIN B;  1W09 A;  3CQC B;  3LJC A;  3JAF A;  3N9N A;  4DID B;  4JI1 T;  1SUM B;  3FB2 A;  2BS3 A;  2MTQ A;  4Z90 A;  2V7M A;  5AQF B;  5LGN B;  3RPU A;  4H9Q C;  4MLK A;  2D5U A;  2UUC T;  1W0A A;  3B13 A;  4NUV A;  3BQK A;  2V8S V;  4MFR A;  4O2B E;  4AKR B;  5L4E A;  2BVM A;  4YJ2 E;  2X68 A;  3FZH B;  4ILU A;  1VRB A;  5HXE A;  3ETU A;  2XAQ B;  4PAG A;  2BG9 E;  3ZT6 A;  2UXX B;  5HXR A;  3C64 A;  5BMV E;  3KBU A;  4U31 A;  4BJM A;  4EEB A;  2HHH T;  3Q9D A;  4EYU A;  3RKO A;  3VHL A;  2H7O A;  5HEJ A;  2X9H A;  2WB5 A;  4ZS3 A;  2A9U A;  2VQF T;  2VWA A;  3H3A A;  3OTO T;  1WLX A;  3KBT A;  4AQG A;  2WM9 A;  2B76 A;  4DV2 T;  4O2A E;  1BR4 A;  3JAD A;  4UV8 B;  3VRA A;  3ZMZ B;  2JQH A;  3ETV A;  3I9W A;  4P1N A;  4DND A;  1J5E T;  2DL1 A;  2FUP A;  3O1J A;  2M6B A;  4UVB B;  3M3Z B;  2LRL A;  2E8I A;  2C0S A;  2HPL A;  2IDO B;  3N9L A;  4QKN A;  1S35 A;  2LM9 A;  1YW0 A;  3L39 A;  3LFM A;  2MOZ A;  3A8Y C;  3TLS A;  5ABE A;  3EDU A;  2XQ6 A;  2AE9 A;  4HWH A;  4JUY A;  4UF0 B;  5FVL A;  3CKD A;  4HFH A;  4A98 A;  3E08 A;  4L5G A;  3AVR A;  1U5P A;  4DUY T;  3CPZ A;  4PJJ A;  1HNX T;  2V7I A;  3LK3 B;  2LE8 A;  2ACX A;  1US7 B;  5EK3 A;  4PFP A;  4E7S A;  2X9Y A;  2W62 A;  4HFC A;  3BQI A;  2WU5 A;  5IUX A;  5L47 A;  4BA9 A;  1QUU A;  1HF8 A;  2FBW A;  3CML A;  5IWA T;  5HCM A;  3RQW A;  3HI2 A;  2E9X A;  3C4X A;  4M1P A;  4E7Z A;  5LNK A;  4DR3 T;  3VKG A;  2IAK A;  5AQG B;  5ABH A;  5ADX L;  1CUN A;  4CI3 B;  3UU4 A;  2I0M A;  5EK2 A;  3G06 A;  2X66 A;  2JMH A;  1Y64 B;  1ZKE A;  2VKD A;  3N9P A;  2ZM6 T;  2MAW A;  3R6N A;  4JI4 T;  4X64 T;  2H3R A;  4AQY T;  5HEG A;  5HXH A;  4IL4 A;  5EK4 A;  3RRW A;  5JDQ A;  3OPC A;  3ZJ2 A;  2W66 A;  2CXD A;  4TV8 E;  3X1D A;  1NAF A;  2N2N A;  2WU2 A;  3EI0 A;  3NVO A;  2LSJ A;  4HFD A;  5L3F B;  5H6R B;  2LSY A;  2Z6E A;  5HEH A;  4DR2 T;  2BKN A;  4AKL A;  2SPC A;  2LJL A;  3FZF B;  2XQ3 A;  2XSA A;  4GK5 E;  1OED A;  4BJN A;  5JVD E;  4HE8 A;  5AQV B;  3ZJ1 A;  5C3J A;  3NWI A;  3UU5 A;  1OED B;  4ANJ A;  3OYZ A;  4JEU B;  3ZMU B;  1XWM A;  3F31 A;  3RIA A;  2WAU A;  2WWU A;  3PU3 A;  1XDO A;  3C4Z A;  4ASK A;  2XZE A;  3CQX C;  2YU1 A;  1ZP0 A;  3CWZ B;  3UUL A;  4X65 T;  1IBL T;  2CPT A;  2EHO B;  2Q9Q C;  4C91 A;  5LGT B;  1YQ4 A;  4WBO A;  4EXT A;  4HKA A;  5AQP B;  2W61 A;  5AFU L;  4FJO A;  4U3C A;  4A97 A;  3HKC E;  1YKE B;  1XMO T;  5LHG B;  2UXB T;  1JNR A;  3GN5 A;  4XBF B;  4AXP A;  2VVN A;  2K24 A;  1MMD A;  2N9D A;  3QNU A;  4QX7 B;  2P9B A;  5LG3 A;  2ZM8 A;  5FP3 A;  4PJL A;  4NXM T;  4A56 A;  2L9Q A;  3GMI A;  4HWI B;  5HEU A;  4GOU A;  5LMN T;  2E9X C;  3RIF A;  2XAH B;  4X5T A;  3F57 A;  2WSS V;  4X1I E;  4YSY A;  3AAI A;  2HN1 A;  3UU3 A;  4HFB A;  2C5K T;  3A5X A;  2OLT A;  3PUV F;  1YXR A;  4PK4 A;  3V5U A;  4LF8 T;  4P0B A;  2V7J A;  4YHH T;  3PTR B;  3SOL A;  1BR1 A;  3CX6 B;  3RIU A;  3RRC A;  3FZL B;  2NTY A;  3AEG A;  4ZI3 C;  3KVB A;  4AKG A;  1FMV A;  3KV6 A;  3MXZ A;  3PUG A;  3N9O A;  4H63 V;  4CN4 A;  2F4V T;  3KDS E;  4JYA T;  1KNZ A;  4P0A A;  2LSK A;  4TWH A;  1SE7 A;  2KSR A;  2X9X A;  3HA4 A;  2LHR A;  3VR8 A;  3ZT7 A;  3WI3 A;  1X79 A;  3AE2 A;  4YXD A;  1YKH B;  1ZV4 X;  3OKQ A;  4TNW A;  1J5W A;  4IDP A;  1D0Y A;  2XPK A;  4YTP A;  2V5D A;  3AE1 A;  3P4Q A;  1HG5 A;  2A3D A;  4BAY B;  4DBR A;  5AQT B;  5FXV A;  2H7V C;  3O4X E;  2BG9 C;  4JEH B;  4AKH A;  3AE9 A;  1T98 A;  4WZX A;  4DV0 T;  4IE7 A;  2HH7 A;  2KT9 A;  4QX8 B;  5A1L A;  2XQ4 A;  3AAE B;  3UU8 A;  5CGM A;  4IE4 A;  3ZLI A;  3LBX B;  1G8X A;  3P4W A;  2E5V A;  3AE8 A;  2XSB A;  3BQL A;  5FY7 A;  4ZHQ E;  5LJN A;  4IDZ A;  2W0G A;  3GWH A;  3MA9 A;  2VKO A;  1HFA A;  5AQL B;  4WYV A;  2MBG A;  2I59 A;  1KF6 A;  2YDR A;  4H9R C;  5LMU T;  5AQN B;  4EED A;  1ZEE A;  3ZC0 A;  3PJA A;  3PV0 F;  1E1H B;  5KDM C;  3O1H A;  4U7Y A;  3S4U A;  4JI6 T;  2DI4 A;  2KIN B;  2YDS A;  2KMF A;  5LHI B;  2FJE A;  2OV9 A;  4IHJ E;  3OYX A;  3TLW A;  2EHO C;  4G2A A;  3JC6 D;  4KBM B;  4DR7 T;  3DTO A;  4UVA B;  1WCR A;  1WRD A;  2CHO A;  2XHE B;  3QB5 A;  4U2Y A;  1D0Z A;  4ADZ A;  3AEE A;  2R6G F;  3K1S A;  3PDY A;  3PUQ A;  3JC6 C;  3RYI E;  5JR9 B;  4LFC T;  1OED C;  1OWA A;  2PFV A;  3AE6 A;  4UXN B;  5LOV E;  3ZPO A;  5ABF B;  1DU2 A;  3AE7 A;  3IA3 A;  3MKD A;  4H9S E;  4DR6 T;  5LXT E;  3ZCI A;  3RIU C;  1HCI A;  4CXX A;  1KNP A;  2A2F X;  1FEW A;  1LRZ A;  2PG8 A;  3HL6 A;  2VB6 A;  2VUR A;  4IDO A;  4KMC A;  4JBW F;  2LT3 A;  3PUW F;  2LM2 A;  4IIJ E;  4U74 A;  4CI2 B;  4DO0 A;  4EZ4 A;  2NW9 A;  2XM2 A;  4Z8X A;  3B5M A;  2IIU A;  5FMN A;  5HEO A;  2CBJ A;  5FVK A;  5JDF A;  3TLV A;  1I94 T;  2D0T A;  2DWG A;  3O9X A;  4B3R T;  4U72 A;  5JDG A;  2HPJ A;  3AED A;  4ZOL E;  3ZSS A;  4CQI A;  1T7S A;  3MJX A;  2GK9 A;  3C51 A;  4O4L E;  2B1E A;  3NKZ A;  2KZ7 B;  3RQU A;  4CXY A;  5KXJ A;  4DV5 T;  1WYC A;  4TNV A;  4EGW A;  3ZMV B;  4X20 E;  4DV7 T;  3I9Y A;  2BG9 A;  2J4G A;  4ILC A;  3I0Q A;  3CVR A;  3M65 A;  4P09 A;  3EAB A;  3ZC1 A;  4YSX A;  2V6Y B;  1FIO A;  2DHR A;  1MIY A;  3IHR A;  2EHO D;  5JDM A;  1IJ5 A;  4KP3 C;  4GYS A;  2W00 A;  3LSV A;  5JDN A;  3CQG B;  2BKP A;  4IST A;  4X62 T;  3P7I A;  1VCT A;  4PFO A;  2VK9 A;  5L4H A;  4DR1 T;  1FJG T;  2JPF A;  5JRC A;  2NWB A;  2XAF B;  1WR6 A;  5AQH B;  2ZM0 A;  2FJD A;  3KVA A;  2A72 A;  2IC6 A;  2XQA A;  4CI1 B;  3Q5X A;  3B57 A;  2K9A A;  4EAH A;  2VAS A;  4OX9 T;  3UTK A;  2W2U A;  3RX6 A;  4LML A;  2YDQ A;  2W67 A;  2CEA A;  2VVS A;  3N5L A;  4MBQ A;  4QHO A;  3C50 A;  5L3G B;  3HKD E;  3PJA J;  2JQK A;  3AEB A;  2QGS A;  4TWD A;  5JDL A;  5HWY A;  2V1D B;  5FL1 A;  2C5J A;  3FHN A;  4GIW A;  2WDQ A;  1WYB A;  4HFV A;  5J1G A;  1V9D A;  4COF A;  4LFA T;  3PUS A;  4X1K E;  5DJQ C;  3AB3 B;  1YD8 G;  4TUY E;  4OYJ A;  3PUZ F;  2D0U A;  3RC3 A;  2BZB A;  4EYY R;  4N78 D;  4X1Y E;  3D0T A;  4H63 H;  4KHZ F;  3AXJ A;  3UUX B;  3NRY A;  2MPK A;  2WWV A;  3RH3 A;  3ZN1 B;  4IRE A;  2BVL A;  4QWN B;  5CJ5 A;  1S94 A;  2CM0 A;  2NOX A;  2XTL A;  2WMO A;  1QLB A;  3T1Y T;  1HNW T;  2M67 A;  1KEY A;  1YQ3 A;  1NEN A;  4ZI2 C;  2ZM2 A;  4O4J E;  3T1H T;  4ISS A;  2CE7 A;  4JI2 T;  4LMJ A;  1SA0 E;  2V5C A;  1B7T A;  3AA1 B;  3NRX A;  1UCU A;  3AA6 B;  5JH7 E;  4LF5 T;  3T8O A;  2Y8D A;  3EAM A;  4IE6 A;  4WW0 A;  3RHW A;  1W0B A;  3P4P A;  4A5X A;  4ZI2 D;  1N36 T;  2LOS A;  2XUE A;  3KV4 A;  2Q9Q A;  2KWI B;  3UFE A;  3RI5 A;  5M4Y A;  2J1D G;  3L3P A;  4O4H E;  5TAO A;  4HEA A;  2KXP B;  4OK0 A;  1M62 A;  4ZI7 E;  5LGU B;  2WQY A;  2XQ8 A;  3OBV E;  4PW8 A;  5AQK B;  3UUN A;  4CZZ B;  2H89 A;  1IBK T;  3ZYK A;  4I55 E;  2ODU A;  5LP6 E;  3ANW B;  2G0U A;  4DBQ A;  2WCA A;  2CCQ A;  2JJ9 A;  3ZMT B;  2X0Y A;  2AXD S;  3RGL A;  4EB6 E;  2LLY A;  2UXC T;  5AQI B;  3SFE A;  2Y48 B;  2NW8 A;  2V7L A;  4FI5 A;  1HNZ T;  4B3M T;  2IHR 1;  5CFB A;  1SHZ C;  2BG9 B;  4B6X A;  4TZ4 C;  4B3S T;  3Q5D A;  4U33 A;  3UQ7 A;  2HN2 A;  3AVS A;  3RYC E;  2H88 A;  3ABV A;  1Z0P A;  1N32 T;  2XAG B;  4HFI A;  3H3M A;  4IE5 A;  1KK7 A;  4NXN T;  2PJQ A;  2XQ9 A;  1UX5 A;  3U3I A;  3RYF E;  2L3L A;  2QA7 A;  3ESL A;  3FXD B;  5JQG E;  1OXZ A;  3IF8 B;  5J2U E;  1WR0 A;  4EZH A;  4PNI A;  4ZS2 A;  4ZEY A;  4YLH A;  3N9Q A;  5L3D B;  4IT4 A;  4DV1 T;  5LBM A;  4IDQ A;  3ZN0 B;  5FY0 A;  3AAA B;  2XM1 A;  4B3T T;  3MZK B;  3P4R A;  1XNQ T;  3ZYL A;  3HKB E;  1AJ3 A;  1D1B A;  5HYA A;  1LVF A;  1HX8 A;  1UUS A;  3AE5 A;  2J62 A;  3QB5 K;  4L9I A;  4PJN A;  5E0O A;  1MMN A;  4EIW A;  2WS3 A;  5KX5 E;  5BR8 T;  3AA0 B;  1HTJ F;  4YY3 T;  2QYW A;  4YT0 A;  5HWX A;  4DUZ T;  1M7K A;  3SS1 A;  4IGU A;  4UEM A;  1R8I A;  2YEV C;  5HXC A;  3PE0 A;  5LCY A;  5LG4 A;  2WP9 A;  1U4Q A;  2XQ5 A;  4OHF A;  4XAX B;  1D0X A;  5IYZ E;  5JR9 C;  3OJA A;  2CLY C;  2DNX A;  2IC9 A;  3ZKR A;  5AQM B;  4TX5 A;  2E2A A;  2KWH A;  3ZCJ A;  3N9M A;  4K0K T;  3JAE A;  3SRZ A;  2N1G A;  2QRX A;  1E7P A;  1L0V A;  4F6R C;  2WZH A;  3E0Z A;  3AEA A;  3DJB A;  1IJ6 A;  1NWM X;  4IL9 A;  3VRB A;  4YTN A;  3I0O A;  1XNR T;  2IML A;  1H7C A;  4X66 T;  1HS7 A;  2CMR A;  2YK0 A;  4TN7 B;  1KNR A;  2X0L B;  4OFZ A;  3FZK B;  2CXF A;  3EDV A;  4U2Z A;  4KHP T;  3HKE E;  3A7M A;  1EZ3 A;  1UX4 A;  2Y6X A;  3IEE A;  5JRE A;  4CN1 A;  2VL0 A;  3LBX A;  4QXB B;  3ONL C;  4LF9 T;  4ILA A;  1J1J A;  3HR0 A;  2CBI A;  3ONX A;  3ONJ A;  4I50 E;  4HN9 A;  4UIG A;  2NP9 A;  3UUM A;  1BR0 A;  4QH1 A;  2VKH A;  2YOE A;  2IW5 B;  2JQQ A;  3C4W A;  2JMK A;  3PUR A;  2XAS B;  2V26 A;  4LMK A;  3RKG A;  1NEK A;  3LK4 2;  4ERR A;  4IDN A;  2ZMA A;  1KFY A;  4H9P C;  5FY1 A;  3K3Q C;  4I0U A;  4ZZC A;  4DV4 T;  2ACZ A;  2CHN A;  2RPA A;  1HR0 T;  5IHY A;  1IAP A;  2JRK A;  3FBZ A;  3QOF A;  4KX6 A;  4NUU A;  3NBX X;  1G73 A;  3EUH A;  4QH4 A;  2OA5 A;  2UXD T;  2JIW A;  2I6H A;  2BDE A;  2X51 A;  1QSD A;  2BBJ A;  1MIV A;  2Q9Q D;  2LOP A;  3ZST A;  5FNV E;  5JR9 A;  2UUA T;  3PU8 A;  4MHC A;  5FL0 A;  4C90 A;  4YHJ A;  5C2T A;  3KV5 A;  2RA1 A;  3PUY F;  1CHU A;  4LF7 T;  3R84 B;  2W4X A;  4O8S A;  3WAK A;  4LF6 T;  4Q25 A;  5AQU B;  1N33 T;  2QVA A;  2MYS A;  4QH5 A;  3H37 A;  1XDP A;  1MMA A;  2K3W A;  2E5L T;  3AA7 B;  3CK6 A;  5EZY E;  4GKJ T;  3RF1 A;  1GQE A;  2V6Y A;  5JTG A;  2DCF A;  2X0H A;  4HWC A;  3SWH A;  3ZT5 A;  5L3C B;  1UGO A;  5F3J A;  3J7Y q;  3GN5 B;  4G63 A;  2FJA A;  3MK7 C;  4GK0 E;  5HXS A;  3TLT A;  4HGA A;  2VQE T;  4QXC B;  1D1A A;  5AQO B;  2M6I A;  1I6Z A;  4F8H A;  4MAL A;  3ANW A;  4UF0 A;  3L09 A;  4JLE A;  4UVC B;  3PUX F;  3RLF F;  1XZY A;  2LKH A;  4HWF A;  3UQ4 A;  2YKS A;  2WDR A;  4KI0 F;  5HCJ A;  1N34 T;  2BS4 A;  1OED E;  2K48 A;  3VR9 A;  2UXN B;  2Q9Q B;  1ZOY A;  2NW7 A;  4H9O C;  3WAJ A;  4NIQ A;  5FKY A;  1E2A A;  1HX1 B;  2BS2 A;  4GYR A;  4J2C A;  3C98 B;  1T72 A;  3DP7 A;  3IBP A;  3GA8 A;  1MMG A;  3CX8 B;  3LDQ B;  4WNK A;  4XZC A;  5LHH B;  4DV6 T;  5ABF A;  4TWF A;  2YIN A;  2XJ7 A;  5DAB A;  4DR5 T;  3V5S A;  3ZEF B;  2CXL A;  2V7K A;  5JDH A;  3JCF A;  5J2T E;  1ZHC A;  4PK5 A;  4HWD A;  4OYK A;  5LA6 E;  2KND A;  3AXJ B;  3CX7 B;  4H9N C;  4HTE A;  1VOM A;  4WBN E;  2WBL A;  2CRB A;  2CWO A;  5L3E B;  4DV3 T;  2E9X B;  2PTF A;  4CN6 A;  4ZI3 D;  5AQJ B;  4KUM B;  4UV9 B;  5LYJ E;  1BR2 A;  4AIU A;  3CIR A;  5FXW A;  2LSG A;  3UU6 A;  2J47 A;  2L8K A;  3SFD A;  3P4S A;  3RC8 A;  2RP4 A;  2NR4 A;  4K0U A;  5L3B B;  3AEF A;  2ZLY A;  4ILB A;  5F8P A;  4AKI A;  3VKH A;  4U7I A;  3FXE B;  1MIW A;  1Y01 A;  3LG7 A;  2CLY B;  5L2L A;  1LKX A;  1JNZ A;  3K3N A;  1LVK A;  2XQ7 A;  2V6X A;  5FXX A;  3UUB A;  2D9D A;  2DLR A;  2XQY A;  1UUR A;  3UT5 E;  2UU9 T;  5F5W A;  4ZXL A;  3N2O A;  1IZN B;  4DMV A;  3K8P C;  5JRC B;  3F2E A;  4JI5 T;  4AIS A;  3Q2M A;  2KLQ A;  2D2S A;  2FJB A;  2LKG A;  2K5B B;  2WZI A;  4HFE A;  4LF4 T;  1HG2 A;  1MND A;  1D1C A;  4AQF C;  3QK6 A;  3Q5E A;  3N2K E;  3FZM B;  2E9X D;  4DR4 T;  3W15 B;  3MAC A;  4YSZ A;  2BKO A;  2UUB T;  2BBH A;  2XAJ B; 
#chains in the Genus database with same CATH homology
 4JI3 T;  4X65 T;  4LFB T;  4JI7 T;  4LF9 T;  4JI8 T;  1XMO T;  4JI0 T;  2UXB T;  4OX9 T;  4DV4 T;  1HR0 T;  4NXM T;  5LMN T;  4JV5 T;  4LFA T;  4LF8 T;  2UUA T;  4YHH T;  1XMQ T;  4GKJ T;  4LF7 T;  4JYA T;  4LF6 T;  2F4V T;  1N33 T;  1IBM T;  3T1Y T;  1HNW T;  2E5L T;  3T1H T;  4JI2 T;  4JI1 T;  4LF5 T;  1N36 T;  2VQE T;  2UUC T;  2UXD T;  4DV0 T;  4KHP T;  1IBK T;  1N34 T;  2HHH T;  2UXC T;  2VQF T;  1HNZ T;  4B3M T;  3OTO T;  5LMU T;  4B3S T;  4DV6 T;  4DV2 T;  1J5E T;  4DR5 T;  4JI6 T;  4NXN T;  2UU9 T;  4DR7 T;  4GKK T;  4DUY T;  4DV3 T;  4LFC T;  4DV1 T;  1HNX T;  4B3T T;  4DR6 T;  1XNQ T;  5IWA T;  5BR8 T;  4YY3 T;  4DR3 T;  4DUZ T;  1N32 T;  2ZM6 T;  4B3R T;  4JI4 T;  4X64 T;  4AQY T;  4K0K T;  4JI5 T;  4DV5 T;  1XNR T;  4DR2 T;  4DV7 T;  4DR1 T;  4X66 T;  4LF4 T;  4DR4 T;  1I94 T;  4X62 T;  2UUB T;  1IBL T;  1FJG T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...