4DV4T

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
b'RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4dv4T00
4K0KT 2ZM6T 4X66T 4JI4T 2UUAT 4DR6T 3OTOT 2VQFT 4DR3T 4B3TT 4LF4T 1HNZT 5LMUT 5BR8T 1XMQT 4DV1T 1FJGT 4AQYT 1HNXT 1XNRT 2UUCT 3T1YT 4DR7T 2UXBT 1N34T 4LFCT 2VQET 4LFBT 4DV4T 4JV5T 2UXCT 1J5ET 4B3RT 1IBMT 4DR4T 4JYAT 4LF8T 5IWAT 4X64T 4LF7T 1I94T 4JI6T 4KHPT 4DV7T 4JI5T 1IBKT 3T1HT 4X65T 1N33T 4NXMT 4DR2T 2UUBT 4DV2T 5LMNT 1N32T 1IBLT 4LFAT 4OX9T 4YHHT 4GKKT 1N36T 2E5LT 4B3ST 4DR5T 4DV5T 4NXNT 4LF5T 4DUZT 1XMOT 4JI8T 2F4VT 4DV3T 2UXDT 4DV6T 4DV0T 4LF6T 1HNWT 2UU9T 4JI3T 4B3MT 1HR0T 2HHHT 4YY3T 4DR1T 4X62T 4DUYT 4JI7T 4JI0T 4GKJT 1XNQT 4LF9T 4JI2T 4JI1T
chains in the Genus database with same CATH superfamily
4A5XA 4HN9A 2E5VA 2CXLA 5L4HA 1ZKEA 3SFEA 4EOZB 3AEBA 3UU4A 3VRAA 5L3DB 4DVDA 3UUXB 2H7OA 3I1AA 2LE8A 2ACZA 5FY7A 4AKHA 5FKYA 4FI5A 3K3NA 5EZYE 4DV4T 5HWXA 3U78A 3Q5XA 2LJLA 3ZT7A 1J5ET 2XASB 4JYAT 1HF8A 2ODVA 4MFRA 2BKPA 4YJ3E 2XQ3A 4HTEA 3QK6A 4H9OC 3MK7C 2LT3A 4ZI2D 4U2ZA 4FJOA 2Y8DA 4B3ST 4CZZB 4PNIA 1OEDA 2ODUA 5FMNA 3RKGA 3QB5A 2ZM0A 2LOSA 3AEFA 1ZP0A 2X9YA 4YY3T 3MKDA 3LG7A 4H9QC 3C4ZA 3VU7H 5E0OA 4O4LE 1UX5A 3CK6A 2YU1A 4EYYR 1ZEEA 2A3DA 4Z8XA 3A5XA 4AQFA 3EABA 3HKBE 4X66T 3PURA 2W2UA 2XZEA 3ZYMA 2BG9A 2ZM8A 4IL9A 4TNWA 5FVKA 4JUYA 2X0LB 3KBUA 2V7LA 4ZHQE 4IGUA 5CFBA 1YKEB 3BK9A 4IE4A 3AE4A 3T1YT 3LBXA 2HH7A 2W0GA 2YDSA 4O4JE 1IBMT 5ABEA 4AI6A 4EV6A 3RIUA 2HN1A 3C50A 5FVLA 2JIWA 2AXDS 3AEGA 3UT5E 5ABFB 4MBQA 5LJNA 3AA1B 1HCIA 4H9NC 4AKLA 4CXWA 3ZJ2A 3D0TA 5AQUB 4L9IA 4JBWF 2L3LA 2K3WA 4DV3T 4X1IE 2WZIA 3VHLA 3RIAA 1VCSA 3UU5A 4YTPA 2MYSA 4ZI7E 4IE0A 4K0UA 4ANJA 4NIQA 1MIVA 2V6XA 3OPCA 2JJ9A 3UU8A 3RI5A 4X1YE 2UUAT 2E2AA 4O4HE 5LG4A 4YFSA 4L0RA 2KLQA 2D5UA 3CX7B 3RC3A 3P4PA 3CMLA 3KV6A 2JMHA 5HEHA 3X1DA 1OEDC 4EB6E 3CQCB 4QXCB 4YT0A 4BJMA 4TWDA 1E2AA 2C5KT 3RYHE 4WNKA 4EXTA 2MBGA 2XSAA 4JV5T 2V1DB 3OYXA 5IWAT 3AVRA 4IE5A 4E7SA 2KINB 4KHPT 2K5BB 3WAKA 2W66A 1MMGA 2VL8A 1T8BA 3AE5A 2XQAA 2BBJA 3R84B 1QLBA 2Y6XA 4H63V 2Q9QB 1MNEA 2UUBT 1NAFA 1IJ5A 2XQ5A 2D2SA 3TLWA 2CM0A 3UU6A 2YKSA 5H6QB 4CQIA 3FXEB 3HL6A 2NWBA 3AE8A 1NENA 4NXNT 3AE6A 3RYFE 5FXZA 3PUSA 4X5TA 4DMVA 3AAIA 3AXJA 4U33A 4G63A 2JMKA 4YLHA 4OYJA 2OLTA 2KXPB 5LCYA 3C51A 4TX5A 3FXDB 2XTLA 4O2BE 2C5JA 2BS2A 1HTJF 2WAUA 4CN1A 2IW5B 4NUVA 3ZCIA 5FL0A 2X9WA 4IHJE 1QUUA 4HFBA 5KMGP 4MHCA 5JDLA 5AQIB 1FJGT 4IL4A 4ILAA 4HFCA 5JQGE 3M3ZB 4JEUB 4PK5A 2H3RA 3F31A 3ANWB 3SRZA 3HKCE 1YW0A 2RPAA 4AIUA 3PUQA 3ZMVB 4CN6A 4X65T 2HN2A 5F8PA 4QKNA 3VKGA 3I9YA 2Q9QD 1UX4A 3O1IA 1XZYA 1CUNA 4AXPA 3ZPOA 3ZYLA 2H89A 3F57A 5JVDE 4XZCA 3PUXF 2CWYA 2K9AA 2B1EA 2UU9T 3NKZA 2M6IA 3ZN0B 2KNDA 1S35A 2WP9A 3F2EA 3EVYA 4PK4A 2BVLA 1YD8G 5AQTB 2VK9A 2DNXA 2QVAA 3ZT6A 1YKHB 5IUXA 3ZLIA 3ABVA 3AVSA 1Y64B 4WZXA 3JADA 3IHRA 5LMUT 4PAGA 4QH1A 3RRCA 1B7TA 4QH4A 4AQYT 1XNRT 5AQHB 3E22E 4LFCT 2D0UA 2WCAA 4U2YA 4PJNA 4GYRA 4QX8B 2BZBA 3N5LA 4JI5T 3R6NA 2X9XA 2KWHA 4A56A 3Q2MA 4UV8B 1HX8A 5HEUA 3KINB 2BDEA 4IDOA 4O8SA 2VKJA 3GN5B 2YK0A 2V5DA 4GKKT 4GK5E 3NRXA 1ZOYA 5HXRA 3C4WA 3ZMZB 2DLRA 4DUZT 2JQQA 5FY1A 2DI4A 2QA7A 2VVNA 2UXDT 2W62A 2CHOA 2NR4A 1J1JA 3KV5A 5ETWA 2WS3A 3RRWA 2VL0A 4JI2T 2CXFA 2D9DA 1BR2A 4HGAA 2A2FX 3P7IA 2XQ4A 1U5PA 2VQFT 2WWVA 4U74A 2X0HA 1MMNA 2ZMAA 1W9RA 2BBHA 5LGTB 3VRBA 1V9DA 5A1LA 5LYJE 3ZMUB 2NW9A 3ZMTB 3RHWA 4HKAA 4ZI3D 5L3GB 5ADXL 1OEDE 4EGWA 4LFBT 2QYWA 2IHR1 3AEEA 5ABGA 5BMVE 2EHOC 4MALA 1FEWA 2WMOA 1T98A 4HWCA 2DCFA 3PUAA 3I0OA 4QHOA 1UCUA 3CPZA 3UFGA 1N33T 4CI2B 3LK2B 3UQ4A 4OX9T 4A97A 3EDUA 4F8HA 3K1SA 2A9UA 4EAHA 3EAMA 3HA4A 3RQWA 3B5MA 2BG9E 5LG3A 2JPFA 3JAFA 3T8OA 1JNZA 2RA1A 5AQKB 1LRZA 3TLUA 5C2TA 5HAXA 4I43B 2KWIB 3FZFB 3B57A 3PUYF 3C4XA 3UFEA 3N9NA 4LMKA 5AQLB 4A98A 5C3JA 2LOPA 2JQKA 3L39A 1W09A 5ABFA 3UU3A 3PDYA 4ASKA 2LSGA 3P4RA 2JQ9A 1VRBA 1KK7A 5FXWA 2XJ7A 1UGOA 3J7Yq 5L3CB 2XSBA 4QXHB 3CX8B 2CLYC 3UQ7A 5AQPB 2DL1A 2QGSA 2VQET 3PE0A 5LBMA 1LKXA 1G8XA 2IIUA 5DQVA 5L47A 4UVBB 5LHHB 4ISSA 2M6BA 2E9XA 2W67A 5JTGA 1IBKT 4GYSA 1R8IA 5CA1E 1W0BA 3JC6C 2BKNA 1N32T 4JLEA 4YTMA 3L3PA 2V7IA 1AJ3A 4ZXLA 3NZPA 4I4TE 2MOZA 5AQRB 3MACA 1VCTA 4C90A 1O3XA 2XM1A 4LF5T 4PK6A 1YQ3A 2SPCA 1HG5A 3N2GE 2XAHB 1D1AA 2ES0A 4HWIB 3N9MA 2HHHT 3P8CD 3LK42 3EUHA 4PJLA 1HG2A 4DO0A 4YSXA 1FIOA 4IIJE 4GKJT 4I0UA 5AQJB 2IUBA 3N9QA 1OEDB 5L4EA 2Q9QA 3AB3B 3ONLC 4CXYA 4DR6T 1VOMA 4TZ4C 3AA0B 3KDSE 3N9PA 1XWMA 5LNKA 4P0AA 3MXZA 3SWHA 2J4GA 4TWFA 5C8YE 2WZHA 5AQVB 2NOXA 1WR0A 3RKOA 5JRCB 3P4SA 2XM2A 1UK5A 2K24A 4H9PC 3CIRA 2BG9B 5AQQB 2XAJB 2WWUA 4LF7T 5JDNA 2R6GF 4G2AA 3HI2A 4DV7T 3PUGA 3T1HT 2V8SV 4H63H 5HEGA 5JH7E 4NXMT 4AKGA 5LMNT 3LBXB 4ILUA 3NWIA 1N36T 1IJ6A 4L5GA 4YXDA 2CE7A 3QOFA 4COFA 1HX1B 3SOLA 3JCFA 3ESLA 2V5CA 4DV6T 4U31A 2N2NA 3PUVF 2WQYA 4ZS2A 5LP6E 5GONE 1HR0T 5FYMA 4AQFC 4TWHA 3I9WA 2PFVA 3ANWA 1WLXA 2NTYA 3O9XA 4JI7T 4OK0A 2BG9C 2XHEB 2J62A 2HPLA 2E9XC 3HR0A 3TLTA 3NBXX 4IDPA 2LRLA 1JNRA 4QWNB 1W0AA 2J1DG 1M7KA 1Z0PA 2MPKA 3QUJA 3BQKA 3DP7A 5CGMA 3ONJA 5F5WA 4AQGA 4KUMB 3LFMA 1SA0E 3RIUC 2X68A 1NWMX 2KZ7B 3PTRB 3N2KE 5CA0E 4ZS3A 2FJEA 3AEAA 2FBWA 5AQOB 3KV9A 4KX6A 3UUNA 2W63A 5FY0A 5KDMC 2BS4A 5FNVE 4XAXB 2WMNA 4DR2T 3E08A 3KFWX 4EZ4A 2IC6A 4I55E 4DV5T 5JDQA 3LK3B 3M65A 3HKDE 5AQGB 1IAPA 2LHRA 2V6YA 5JR9A 4NPPA 2VB6A 2C5IT 3WAJA 1X79A 3AEDA 3RH3A 2NW8A 3NVOA 2VASA 5L2LA 4WBOA 1WRDA 3AA6B 5HWYA 4I50E 4YJ2E 3RYCE 2CWOA 2ZM6T 2ZM2A 2UXXB 2LKGA 4J2CA 3GN5A 3AA7B 3AAAB 4B3TT 1QSDA 3N2OA 2DWGA 2G0UA 1OXZA 2WBLA 5BR8T 4UF0A 5KX5E 2QRXA 4X20E 4BJNA 4DV1T 4B6XA 3LSVA 2CHNA 5FXVA 4DR7T 2JQHA 1UURA 3OJAA 5F3JA 4CXXA 5AFUL 4HFIA 3LDQB 1DU2A 3K8PC 1M62A 2LSKA 3FB2A 4B3RT 1XDOA 4WBNE 4DR4T 3IA3A 4P09A 4M1PA 1J5WA 5AQMB 1SE7A 3WI3A 4KP3C 4GK0E 2DHRA 1U4QA 3FZHB 3PV0F 2MTQA 4WW0A 2V7KA 1E1HB 3P4QA 3FBZA 3ZSSA 4ZZCA 3KVAA 3CQGB 3J9X1 4DBQA 4JI8T 2F4VT 2UXNB 2Z6EA 4DV0T 4YSYA 3V5SA 4YHJA 1XDPA 2VURA 2FJDA 2A72A 3OKQA 5L3FB 3ZC0A 3U3IA 4HWDA 4OHFA 3FZKB 4JI0T 2WY2A 3S4UA 1H7CA 4LF9T 5JDHA 2YN6A 5J2UE 4K0KT 2NP9A 4NUUA 4TUYE 3ETUA 2EHOB 2LHNA 2LKHA 2XQ7A 5LGNB 4DMWA 2VKOA 3AAEB 4ILCA 5JR9C 1CHUA 3CWZB 3PUZF 1WCRA 3B13A 3PUWF 3EI0A 1I94T 4WYVA 1WYBA 3KBTA 3TKLB 4U7YA 3ZCJA 3TLSA 2CA5A 2WDRA 2XQYA 4YSZA 2WB5A 2IAKA 3K3OA 2CCQA 4YHHT 3RIFA 2YOEA 2GK9A 2XY8B 5HXCA 3CX6B 5LA6E 3VR9A 1XMOT 2PBIA 4UVCB 2IMLA 1HNWT 1D1CA 1D1BA 1Y01A 2XAGB 5DABA 2CRBA 4O4IE 4ZI2C 3SS1A 4ERRA 4X1KE 2CLYB 4BA9A 5KXJA 1SHZC 2W00A 4IT4A 4H9RC 1D0XA 4ISTA 4IE7A 2FUPA 3DJBA 1LVKA 5J1GA 4AISA 1KNZA 2EHOD 3MZKB 3OBVE 3IEEA 3EDVA 2D0TA 4Q25A 3G06A 3AECA 2P9BA 3NZQA 4HWHA 4IE6A 3IBPA 1S94A 4IDQA 2NTXA 4HFHA 2UXBT 3Q5DA 1N34T 1WR6A 1T72A 5LGUB 2I0MA 5CJ5A 4X64T 3PU3A 4CN4A 2PTFA 4UELA 4JI6T 3C64A 3RYIE 2MAWA 5M4YA 2W4XA 2XUEA 3ZYKA 3H37A 2WU2A 1SUMB 5HCJA 3GWHA 3FZMB 3VR8A 3ETVA 4DR5T 4UIGA 4AKRB 3ZSTA 2DWKA 2BVMA 2CPTA 3UUMA 5JRCA 1E7PA 2LRKA 1ZV4X 3A8YC 1KEYA 5FXXA 4GOUA 5J0ZA 4O2AE 2E8IA 4P0BA 1D0YA 5L3EB 2C0SA 2V7MA 1KF6A 3ZC1A 2VKHA 2CBJA 2YINA 3RPUA 4ZZBA 1KNPA 4HFVA 5CB4E 4DNDA 2I6HA 3ONXA 2XAFB 1FMVA 3H3MA 5EK2A 1I6ZA 4TN7B 1MIYA 4U72A 2UUCT 3JC6D 2LM2A 1LVFA 2CMRA 2HPJA 2WM9A 2V7JA 5LHGB 3Q5EA 4EIWA 3QC9A 3AE1A 5IHYA 3C98B 2KSRA 4KI0F 1L0VA 5LHIB 3I0QA 4UVAB 1X9BA 4DIDB 2E5LT 2N9DA 3BQLA 2I59A 3SFDA 4MLKA 3UUBA 2X66A 2E9XB 2LLYA 1MMAA 5DQWA 2V26A 3H3AA 4P1NA 2YU2A 1BR1A 4PW8A 3K3QC 3N9LA 1WFDA 2ACXA 4U7IA 3A7MA 3L8RA 2W61A 3RQUA 2BKOA 4JI1T 3NRYA 3VKHA 4H9SE 3HKEE 5AQSB 3QB5K 2X0YA 3FZLB 4DR3T 3ZMSB 2CBIA 1Z8UA 4ILBA 5HXEA 2KT9A 4UXNB 4OYKA 1GQEA 4ZEYA 1KNRA 3DTOA 3GMIA 4QX7B 1WYCA 3AE3A 5LOVE 3ZN1B 4CI1B 4HEAA 3Q9DA 5LXTE 2LEHA 1YQ4A 1YXRA 3P4WA 4UV9B 2X9HA 3FBLA 2YDRA 1EZ3A 4ADZA 2XQ6A 2XAQB 4HFEA 4LFAT 5JDFA 2PJQA 2J47A 3ZKRA 2LSIA 4PJJA 5EK3A 4C91A 4CI3B 4AKIA 2FJBA 2E9XD 2VWAA 4LF6T 4JI3T 4B3MT 2Y48B 4EEDA 1KFYA 2Q9QC 4DR1T 1D0ZA 2H7VC 3OYZA 4PFPA 4EYUA 2XPKA 5ABHA 2NW7A 5HEJA 3AE7A 2B76A 2OA5A 2N1GA 3ZJ1A 3LJCA 4QXBB 3OTOT 2K48A 2L8KA 4OFZA 5FP3A 1NEKA 1XMQT 1MIWA 4F6RC 4E7ZA 4YTNA 3AXJB 3AE2A 1HS7A 3GA8A 2YEVC 3KV4A 5HEOA 5L3BB 2UXCT 4IDZA 1OWAA 4N78D 4QH5A 3KVBA 4KHZF 4UEMA 2PG8A 3RC8A 4U3CA 5LBQB 2EHOA 2LSJA 1IZNB 4DV2T 3UTKA 5IYZE 3RLFF 1IBLT 1UUSA 3EHZA 2X67A 4LMLA 4HFDA 2WDQA 2WU5A 3ZT5A 2KMFA 3JAEA 2AE9A 1HFAA 4PFOA 2ZLYA 2YDQA 4TV9E 4X62T 3W15B 1MNDA 3OVUA 2WSSV 5HXSA 1T7SA 1FMWA 2LSYA 4DUYT 3V5UA 4IREA 3N9OA 5EK4A 5J2TE 4EEBA 1BR0A 1MMDA 2IC9A 2V6YB 5JR9B 3FHNA 4JI4T 5AQNB 5JREA 4EZHA 2CEAA 3ZEFB 3L09A 5FL1A 4LF4T 2VVSA 1HNZT 5LB7B 5HYAA 4IDNA 3CKDA 2LM9A 1ZHCA 5H6RB 3O1JA 4KBMB 1HNXT 4JEHB 2BS3A 1G73A 3RF1A 4TV8E 5TAOA 2IDOB 2XQ9A 3IF8B 3Q5WA 4LF8T 4KMCA 4GIWA 3MA9A 4Z90A 4PJMA 4UF0B 4TNVA 4LMJA 1US7B 2M67A 3AE9A 5HXHA 3O1HA 5DJQC 3RX6A 3CQXC 3MJXA 4ZI3C 4DBRA 4XBFB 4HE8A 3P50A 5JDMA 3O4XE 5AQFB 4BAYB 5HCMA 3PJAJ 2L9QA 4ZOLE 5JDGA 1BR4A 2FJAA 3UULA 2RP4A 3CVRA 2VKDA 4UR9A 3PJAA 2OV9A 2CXDA 4V1Av 4HWFA 4Z91A 5LJMA 3TLVA 2X51A 3BQIA 3QNUA 3E0ZA 2XQ8A 2WDVA 1XNQT 2H88A 2JRKA 3PU8A 3RGLA
chains in the Genus database with same CATH topology
4K0KT 2ZM6T 4X66T 4JI4T 2UUAT 4DR6T 3OTOT 2VQFT 4DR3T 4B3TT 4LF4T 1HNZT 5LMUT 5BR8T 1XMQT 4DV1T 1FJGT 4AQYT 1HNXT 1XNRT 2UUCT 3T1YT 4DR7T 2UXBT 1N34T 4LFCT 2VQET 4LFBT 4DV4T 4JV5T 2UXCT 1J5ET 4B3RT 1IBMT 4DR4T 4JYAT 4LF8T 5IWAT 4X64T 4LF7T 1I94T 4JI6T 4KHPT 4DV7T 4JI5T 1IBKT 3T1HT 4X65T 1N33T 4NXMT 4DR2T 2UUBT 4DV2T 5LMNT 1N32T 1IBLT 4LFAT 4OX9T 4YHHT 4GKKT 1N36T 2E5LT 4B3ST 4DR5T 4DV5T 4NXNT 4LF5T 4DUZT 1XMOT 4JI8T 2F4VT 4DV3T 2UXDT 4DV6T 4DV0T 4LF6T 1HNWT 2UU9T 4JI3T 4B3MT 1HR0T 2HHHT 4YY3T 4DR1T 4X62T 4DUYT 4JI7T 4JI0T 4GKJT 1XNQT 4LF9T 4JI2T 4JI1T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K0K T;  2ZM6 T;  4X66 T;  4JI4 T;  2UUA T;  4DR6 T;  3OTO T;  2VQF T;  4DR3 T;  4B3T T;  4LF4 T;  1HNZ T;  5LMU T;  5BR8 T;  1XMQ T;  4DV1 T;  1FJG T;  4AQY T;  1HNX T;  1XNR T;  2UUC T;  3T1Y T;  4DR7 T;  2UXB T;  1N34 T;  4LFC T;  2VQE T;  4LFB T;  4DV4 T;  4JV5 T;  2UXC T;  1J5E T;  4B3R T;  1IBM T;  4DR4 T;  4JYA T;  4LF8 T;  5IWA T;  4X64 T;  4LF7 T;  1I94 T;  4JI6 T;  4KHP T;  4DV7 T;  4JI5 T;  1IBK T;  3T1H T;  4X65 T;  1N33 T;  4NXM T;  4DR2 T;  2UUB T;  4DV2 T;  5LMN T;  1N32 T;  1IBL T;  4LFA T;  4OX9 T;  4YHH T;  4GKK T;  1N36 T;  2E5L T;  4B3S T;  4DR5 T;  4DV5 T;  4NXN T;  4LF5 T;  4DUZ T;  1XMO T;  4JI8 T;  2F4V T;  4DV3 T;  2UXD T;  4DV6 T;  4DV0 T;  4LF6 T;  1HNW T;  2UU9 T;  4JI3 T;  4B3M T;  1HR0 T;  2HHH T;  4YY3 T;  4DR1 T;  4X62 T;  4DUY T;  4JI7 T;  4JI0 T;  4GKJ T;  1XNQ T;  4LF9 T;  4JI2 T;  4JI1 T; 
#chains in the Genus database with same CATH topology
 4A5X A;  4HN9 A;  2E5V A;  2CXL A;  5L4H A;  1ZKE A;  3SFE A;  4EOZ B;  3AEB A;  3UU4 A;  3VRA A;  5L3D B;  4DVD A;  3UUX B;  2H7O A;  3I1A A;  2LE8 A;  2ACZ A;  5FY7 A;  4AKH A;  5FKY A;  4FI5 A;  3K3N A;  5EZY E;  4DV4 T;  5HWX A;  3U78 A;  3Q5X A;  2LJL A;  3ZT7 A;  1J5E T;  2XAS B;  4JYA T;  1HF8 A;  2ODV A;  4MFR A;  2BKP A;  4YJ3 E;  2XQ3 A;  4HTE A;  3QK6 A;  4H9O C;  3MK7 C;  2LT3 A;  4ZI2 D;  4U2Z A;  4FJO A;  2Y8D A;  4B3S T;  4CZZ B;  4PNI A;  1OED A;  2ODU A;  5FMN A;  3RKG A;  3QB5 A;  2ZM0 A;  2LOS A;  3AEF A;  1ZP0 A;  2X9Y A;  4YY3 T;  3MKD A;  3LG7 A;  4H9Q C;  3C4Z A;  3VU7 H;  5E0O A;  4O4L E;  1UX5 A;  3CK6 A;  2YU1 A;  4EYY R;  1ZEE A;  2A3D A;  4Z8X A;  3A5X A;  4AQF A;  3EAB A;  3HKB E;  4X66 T;  3PUR A;  2W2U A;  2XZE A;  3ZYM A;  2BG9 A;  2ZM8 A;  4IL9 A;  4TNW A;  5FVK A;  4JUY A;  2X0L B;  3KBU A;  2V7L A;  4ZHQ E;  4IGU A;  5CFB A;  1YKE B;  3BK9 A;  4IE4 A;  3AE4 A;  3T1Y T;  3LBX A;  2HH7 A;  2W0G A;  2YDS A;  4O4J E;  1IBM T;  5ABE A;  4AI6 A;  4EV6 A;  3RIU A;  2HN1 A;  3C50 A;  5FVL A;  2JIW A;  2AXD S;  3AEG A;  3UT5 E;  5ABF B;  4MBQ A;  5LJN A;  3AA1 B;  1HCI A;  4H9N C;  4AKL A;  4CXW A;  3ZJ2 A;  3D0T A;  5AQU B;  4L9I A;  4JBW F;  2L3L A;  2K3W A;  4DV3 T;  4X1I E;  2WZI A;  3VHL A;  3RIA A;  1VCS A;  3UU5 A;  4YTP A;  2MYS A;  4ZI7 E;  4IE0 A;  4K0U A;  4ANJ A;  4NIQ A;  1MIV A;  2V6X A;  3OPC A;  2JJ9 A;  3UU8 A;  3RI5 A;  4X1Y E;  2UUA T;  2E2A A;  4O4H E;  5LG4 A;  4YFS A;  4L0R A;  2KLQ A;  2D5U A;  3CX7 B;  3RC3 A;  3P4P A;  3CML A;  3KV6 A;  2JMH A;  5HEH A;  3X1D A;  1OED C;  4EB6 E;  3CQC B;  4QXC B;  4YT0 A;  4BJM A;  4TWD A;  1E2A A;  2C5K T;  3RYH E;  4WNK A;  4EXT A;  2MBG A;  2XSA A;  4JV5 T;  2V1D B;  3OYX A;  5IWA T;  3AVR A;  4IE5 A;  4E7S A;  2KIN B;  4KHP T;  2K5B B;  3WAK A;  2W66 A;  1MMG A;  2VL8 A;  1T8B A;  3AE5 A;  2XQA A;  2BBJ A;  3R84 B;  1QLB A;  2Y6X A;  4H63 V;  2Q9Q B;  1MNE A;  2UUB T;  1NAF A;  1IJ5 A;  2XQ5 A;  2D2S A;  3TLW A;  2CM0 A;  3UU6 A;  2YKS A;  5H6Q B;  4CQI A;  3FXE B;  3HL6 A;  2NWB A;  3AE8 A;  1NEN A;  4NXN T;  3AE6 A;  3RYF E;  5FXZ A;  3PUS A;  4X5T A;  4DMV A;  3AAI A;  3AXJ A;  4U33 A;  4G63 A;  2JMK A;  4YLH A;  4OYJ A;  2OLT A;  2KXP B;  5LCY A;  3C51 A;  4TX5 A;  3FXD B;  2XTL A;  4O2B E;  2C5J A;  2BS2 A;  1HTJ F;  2WAU A;  4CN1 A;  2IW5 B;  4NUV A;  3ZCI A;  5FL0 A;  2X9W A;  4IHJ E;  1QUU A;  4HFB A;  5KMG P;  4MHC A;  5JDL A;  5AQI B;  1FJG T;  4IL4 A;  4ILA A;  4HFC A;  5JQG E;  3M3Z B;  4JEU B;  4PK5 A;  2H3R A;  3F31 A;  3ANW B;  3SRZ A;  3HKC E;  1YW0 A;  2RPA A;  4AIU A;  3PUQ A;  3ZMV B;  4CN6 A;  4X65 T;  2HN2 A;  5F8P A;  4QKN A;  3VKG A;  3I9Y A;  2Q9Q D;  1UX4 A;  3O1I A;  1XZY A;  1CUN A;  4AXP A;  3ZPO A;  3ZYL A;  2H89 A;  3F57 A;  5JVD E;  4XZC A;  3PUX F;  2CWY A;  2K9A A;  2B1E A;  2UU9 T;  3NKZ A;  2M6I A;  3ZN0 B;  2KND A;  1S35 A;  2WP9 A;  3F2E A;  3EVY A;  4PK4 A;  2BVL A;  1YD8 G;  5AQT B;  2VK9 A;  2DNX A;  2QVA A;  3ZT6 A;  1YKH B;  5IUX A;  3ZLI A;  3ABV A;  3AVS A;  1Y64 B;  4WZX A;  3JAD A;  3IHR A;  5LMU T;  4PAG A;  4QH1 A;  3RRC A;  1B7T A;  4QH4 A;  4AQY T;  1XNR T;  5AQH B;  3E22 E;  4LFC T;  2D0U A;  2WCA A;  4U2Y A;  4PJN A;  4GYR A;  4QX8 B;  2BZB A;  3N5L A;  4JI5 T;  3R6N A;  2X9X A;  2KWH A;  4A56 A;  3Q2M A;  4UV8 B;  1HX8 A;  5HEU A;  3KIN B;  2BDE A;  4IDO A;  4O8S A;  2VKJ A;  3GN5 B;  2YK0 A;  2V5D A;  4GKK T;  4GK5 E;  3NRX A;  1ZOY A;  5HXR A;  3C4W A;  3ZMZ B;  2DLR A;  4DUZ T;  2JQQ A;  5FY1 A;  2DI4 A;  2QA7 A;  2VVN A;  2UXD T;  2W62 A;  2CHO A;  2NR4 A;  1J1J A;  3KV5 A;  5ETW A;  2WS3 A;  3RRW A;  2VL0 A;  4JI2 T;  2CXF A;  2D9D A;  1BR2 A;  4HGA A;  2A2F X;  3P7I A;  2XQ4 A;  1U5P A;  2VQF T;  2WWV A;  4U74 A;  2X0H A;  1MMN A;  2ZMA A;  1W9R A;  2BBH A;  5LGT B;  3VRB A;  1V9D A;  5A1L A;  5LYJ E;  3ZMU B;  2NW9 A;  3ZMT B;  3RHW A;  4HKA A;  4ZI3 D;  5L3G B;  5ADX L;  1OED E;  4EGW A;  4LFB T;  2QYW A;  2IHR 1;  3AEE A;  5ABG A;  5BMV E;  2EHO C;  4MAL A;  1FEW A;  2WMO A;  1T98 A;  4HWC A;  2DCF A;  3PUA A;  3I0O A;  4QHO A;  1UCU A;  3CPZ A;  3UFG A;  1N33 T;  4CI2 B;  3LK2 B;  3UQ4 A;  4OX9 T;  4A97 A;  3EDU A;  4F8H A;  3K1S A;  2A9U A;  4EAH A;  3EAM A;  3HA4 A;  3RQW A;  3B5M A;  2BG9 E;  5LG3 A;  2JPF A;  3JAF A;  3T8O A;  1JNZ A;  2RA1 A;  5AQK B;  1LRZ A;  3TLU A;  5C2T A;  5HAX A;  4I43 B;  2KWI B;  3FZF B;  3B57 A;  3PUY F;  3C4X A;  3UFE A;  3N9N A;  4LMK A;  5AQL B;  4A98 A;  5C3J A;  2LOP A;  2JQK A;  3L39 A;  1W09 A;  5ABF A;  3UU3 A;  3PDY A;  4ASK A;  2LSG A;  3P4R A;  2JQ9 A;  1VRB A;  1KK7 A;  5FXW A;  2XJ7 A;  1UGO A;  3J7Y q;  5L3C B;  2XSB A;  4QXH B;  3CX8 B;  2CLY C;  3UQ7 A;  5AQP B;  2DL1 A;  2QGS A;  2VQE T;  3PE0 A;  5LBM A;  1LKX A;  1G8X A;  2IIU A;  5DQV A;  5L47 A;  4UVB B;  5LHH B;  4ISS A;  2M6B A;  2E9X A;  2W67 A;  5JTG A;  1IBK T;  4GYS A;  1R8I A;  5CA1 E;  1W0B A;  3JC6 C;  2BKN A;  1N32 T;  4JLE A;  4YTM A;  3L3P A;  2V7I A;  1AJ3 A;  4ZXL A;  3NZP A;  4I4T E;  2MOZ A;  5AQR B;  3MAC A;  1VCT A;  4C90 A;  1O3X A;  2XM1 A;  4LF5 T;  4PK6 A;  1YQ3 A;  2SPC A;  1HG5 A;  3N2G E;  2XAH B;  1D1A A;  2ES0 A;  4HWI B;  3N9M A;  2HHH T;  3P8C D;  3LK4 2;  3EUH A;  4PJL A;  1HG2 A;  4DO0 A;  4YSX A;  1FIO A;  4IIJ E;  4GKJ T;  4I0U A;  5AQJ B;  2IUB A;  3N9Q A;  1OED B;  5L4E A;  2Q9Q A;  3AB3 B;  3ONL C;  4CXY A;  4DR6 T;  1VOM A;  4TZ4 C;  3AA0 B;  3KDS E;  3N9P A;  1XWM A;  5LNK A;  4P0A A;  3MXZ A;  3SWH A;  2J4G A;  4TWF A;  5C8Y E;  2WZH A;  5AQV B;  2NOX A;  1WR0 A;  3RKO A;  5JRC B;  3P4S A;  2XM2 A;  1UK5 A;  2K24 A;  4H9P C;  3CIR A;  2BG9 B;  5AQQ B;  2XAJ B;  2WWU A;  4LF7 T;  5JDN A;  2R6G F;  4G2A A;  3HI2 A;  4DV7 T;  3PUG A;  3T1H T;  2V8S V;  4H63 H;  5HEG A;  5JH7 E;  4NXM T;  4AKG A;  5LMN T;  3LBX B;  4ILU A;  3NWI A;  1N36 T;  1IJ6 A;  4L5G A;  4YXD A;  2CE7 A;  3QOF A;  4COF A;  1HX1 B;  3SOL A;  3JCF A;  3ESL A;  2V5C A;  4DV6 T;  4U31 A;  2N2N A;  3PUV F;  2WQY A;  4ZS2 A;  5LP6 E;  5GON E;  1HR0 T;  5FYM A;  4AQF C;  4TWH A;  3I9W A;  2PFV A;  3ANW A;  1WLX A;  2NTY A;  3O9X A;  4JI7 T;  4OK0 A;  2BG9 C;  2XHE B;  2J62 A;  2HPL A;  2E9X C;  3HR0 A;  3TLT A;  3NBX X;  4IDP A;  2LRL A;  1JNR A;  4QWN B;  1W0A A;  2J1D G;  1M7K A;  1Z0P A;  2MPK A;  3QUJ A;  3BQK A;  3DP7 A;  5CGM A;  3ONJ A;  5F5W A;  4AQG A;  4KUM B;  3LFM A;  1SA0 E;  3RIU C;  2X68 A;  1NWM X;  2KZ7 B;  3PTR B;  3N2K E;  5CA0 E;  4ZS3 A;  2FJE A;  3AEA A;  2FBW A;  5AQO B;  3KV9 A;  4KX6 A;  3UUN A;  2W63 A;  5FY0 A;  5KDM C;  2BS4 A;  5FNV E;  4XAX B;  2WMN A;  4DR2 T;  3E08 A;  3KFW X;  4EZ4 A;  2IC6 A;  4I55 E;  4DV5 T;  5JDQ A;  3LK3 B;  3M65 A;  3HKD E;  5AQG B;  1IAP A;  2LHR A;  2V6Y A;  5JR9 A;  4NPP A;  2VB6 A;  2C5I T;  3WAJ A;  1X79 A;  3AED A;  3RH3 A;  2NW8 A;  3NVO A;  2VAS A;  5L2L A;  4WBO A;  1WRD A;  3AA6 B;  5HWY A;  4I50 E;  4YJ2 E;  3RYC E;  2CWO A;  2ZM6 T;  2ZM2 A;  2UXX B;  2LKG A;  4J2C A;  3GN5 A;  3AA7 B;  3AAA B;  4B3T T;  1QSD A;  3N2O A;  2DWG A;  2G0U A;  1OXZ A;  2WBL A;  5BR8 T;  4UF0 A;  5KX5 E;  2QRX A;  4X20 E;  4BJN A;  4DV1 T;  4B6X A;  3LSV A;  2CHN A;  5FXV A;  4DR7 T;  2JQH A;  1UUR A;  3OJA A;  5F3J A;  4CXX A;  5AFU L;  4HFI A;  3LDQ B;  1DU2 A;  3K8P C;  1M62 A;  2LSK A;  3FB2 A;  4B3R T;  1XDO A;  4WBN E;  4DR4 T;  3IA3 A;  4P09 A;  4M1P A;  1J5W A;  5AQM B;  1SE7 A;  3WI3 A;  4KP3 C;  4GK0 E;  2DHR A;  1U4Q A;  3FZH B;  3PV0 F;  2MTQ A;  4WW0 A;  2V7K A;  1E1H B;  3P4Q A;  3FBZ A;  3ZSS A;  4ZZC A;  3KVA A;  3CQG B;  3J9X 1;  4DBQ A;  4JI8 T;  2F4V T;  2UXN B;  2Z6E A;  4DV0 T;  4YSY A;  3V5S A;  4YHJ A;  1XDP A;  2VUR A;  2FJD A;  2A72 A;  3OKQ A;  5L3F B;  3ZC0 A;  3U3I A;  4HWD A;  4OHF A;  3FZK B;  4JI0 T;  2WY2 A;  3S4U A;  1H7C A;  4LF9 T;  5JDH A;  2YN6 A;  5J2U E;  4K0K T;  2NP9 A;  4NUU A;  4TUY E;  3ETU A;  2EHO B;  2LHN A;  2LKH A;  2XQ7 A;  5LGN B;  4DMW A;  2VKO A;  3AAE B;  4ILC A;  5JR9 C;  1CHU A;  3CWZ B;  3PUZ F;  1WCR A;  3B13 A;  3PUW F;  3EI0 A;  1I94 T;  4WYV A;  1WYB A;  3KBT A;  3TKL B;  4U7Y A;  3ZCJ A;  3TLS A;  2CA5 A;  2WDR A;  2XQY A;  4YSZ A;  2WB5 A;  2IAK A;  3K3O A;  2CCQ A;  4YHH T;  3RIF A;  2YOE A;  2GK9 A;  2XY8 B;  5HXC A;  3CX6 B;  5LA6 E;  3VR9 A;  1XMO T;  2PBI A;  4UVC B;  2IML A;  1HNW T;  1D1C A;  1D1B A;  1Y01 A;  2XAG B;  5DAB A;  2CRB A;  4O4I E;  4ZI2 C;  3SS1 A;  4ERR A;  4X1K E;  2CLY B;  4BA9 A;  5KXJ A;  1SHZ C;  2W00 A;  4IT4 A;  4H9R C;  1D0X A;  4IST A;  4IE7 A;  2FUP A;  3DJB A;  1LVK A;  5J1G A;  4AIS A;  1KNZ A;  2EHO D;  3MZK B;  3OBV E;  3IEE A;  3EDV A;  2D0T A;  4Q25 A;  3G06 A;  3AEC A;  2P9B A;  3NZQ A;  4HWH A;  4IE6 A;  3IBP A;  1S94 A;  4IDQ A;  2NTX A;  4HFH A;  2UXB T;  3Q5D A;  1N34 T;  1WR6 A;  1T72 A;  5LGU B;  2I0M A;  5CJ5 A;  4X64 T;  3PU3 A;  4CN4 A;  2PTF A;  4UEL A;  4JI6 T;  3C64 A;  3RYI E;  2MAW A;  5M4Y A;  2W4X A;  2XUE A;  3ZYK A;  3H37 A;  2WU2 A;  1SUM B;  5HCJ A;  3GWH A;  3FZM B;  3VR8 A;  3ETV A;  4DR5 T;  4UIG A;  4AKR B;  3ZST A;  2DWK A;  2BVM A;  2CPT A;  3UUM A;  5JRC A;  1E7P A;  2LRK A;  1ZV4 X;  3A8Y C;  1KEY A;  5FXX A;  4GOU A;  5J0Z A;  4O2A E;  2E8I A;  4P0B A;  1D0Y A;  5L3E B;  2C0S A;  2V7M A;  1KF6 A;  3ZC1 A;  2VKH A;  2CBJ A;  2YIN A;  3RPU A;  4ZZB A;  1KNP A;  4HFV A;  5CB4 E;  4DND A;  2I6H A;  3ONX A;  2XAF B;  1FMV A;  3H3M A;  5EK2 A;  1I6Z A;  4TN7 B;  1MIY A;  4U72 A;  2UUC T;  3JC6 D;  2LM2 A;  1LVF A;  2CMR A;  2HPJ A;  2WM9 A;  2V7J A;  5LHG B;  3Q5E A;  4EIW A;  3QC9 A;  3AE1 A;  5IHY A;  3C98 B;  2KSR A;  4KI0 F;  1L0V A;  5LHI B;  3I0Q A;  4UVA B;  1X9B A;  4DID B;  2E5L T;  2N9D A;  3BQL A;  2I59 A;  3SFD A;  4MLK A;  3UUB A;  2X66 A;  2E9X B;  2LLY A;  1MMA A;  5DQW A;  2V26 A;  3H3A A;  4P1N A;  2YU2 A;  1BR1 A;  4PW8 A;  3K3Q C;  3N9L A;  1WFD A;  2ACX A;  4U7I A;  3A7M A;  3L8R A;  2W61 A;  3RQU A;  2BKO A;  4JI1 T;  3NRY A;  3VKH A;  4H9S E;  3HKE E;  5AQS B;  3QB5 K;  2X0Y A;  3FZL B;  4DR3 T;  3ZMS B;  2CBI A;  1Z8U A;  4ILB A;  5HXE A;  2KT9 A;  4UXN B;  4OYK A;  1GQE A;  4ZEY A;  1KNR A;  3DTO A;  3GMI A;  4QX7 B;  1WYC A;  3AE3 A;  5LOV E;  3ZN1 B;  4CI1 B;  4HEA A;  3Q9D A;  5LXT E;  2LEH A;  1YQ4 A;  1YXR A;  3P4W A;  4UV9 B;  2X9H A;  3FBL A;  2YDR A;  1EZ3 A;  4ADZ A;  2XQ6 A;  2XAQ B;  4HFE A;  4LFA T;  5JDF A;  2PJQ A;  2J47 A;  3ZKR A;  2LSI A;  4PJJ A;  5EK3 A;  4C91 A;  4CI3 B;  4AKI A;  2FJB A;  2E9X D;  2VWA A;  4LF6 T;  4JI3 T;  4B3M T;  2Y48 B;  4EED A;  1KFY A;  2Q9Q C;  4DR1 T;  1D0Z A;  2H7V C;  3OYZ A;  4PFP A;  4EYU A;  2XPK A;  5ABH A;  2NW7 A;  5HEJ A;  3AE7 A;  2B76 A;  2OA5 A;  2N1G A;  3ZJ1 A;  3LJC A;  4QXB B;  3OTO T;  2K48 A;  2L8K A;  4OFZ A;  5FP3 A;  1NEK A;  1XMQ T;  1MIW A;  4F6R C;  4E7Z A;  4YTN A;  3AXJ B;  3AE2 A;  1HS7 A;  3GA8 A;  2YEV C;  3KV4 A;  5HEO A;  5L3B B;  2UXC T;  4IDZ A;  1OWA A;  4N78 D;  4QH5 A;  3KVB A;  4KHZ F;  4UEM A;  2PG8 A;  3RC8 A;  4U3C A;  5LBQ B;  2EHO A;  2LSJ A;  1IZN B;  4DV2 T;  3UTK A;  5IYZ E;  3RLF F;  1IBL T;  1UUS A;  3EHZ A;  2X67 A;  4LML A;  4HFD A;  2WDQ A;  2WU5 A;  3ZT5 A;  2KMF A;  3JAE A;  2AE9 A;  1HFA A;  4PFO A;  2ZLY A;  2YDQ A;  4TV9 E;  4X62 T;  3W15 B;  1MND A;  3OVU A;  2WSS V;  5HXS A;  1T7S A;  1FMW A;  2LSY A;  4DUY T;  3V5U A;  4IRE A;  3N9O A;  5EK4 A;  5J2T E;  4EEB A;  1BR0 A;  1MMD A;  2IC9 A;  2V6Y B;  5JR9 B;  3FHN A;  4JI4 T;  5AQN B;  5JRE A;  4EZH A;  2CEA A;  3ZEF B;  3L09 A;  5FL1 A;  4LF4 T;  2VVS A;  1HNZ T;  5LB7 B;  5HYA A;  4IDN A;  3CKD A;  2LM9 A;  1ZHC A;  5H6R B;  3O1J A;  4KBM B;  1HNX T;  4JEH B;  2BS3 A;  1G73 A;  3RF1 A;  4TV8 E;  5TAO A;  2IDO B;  2XQ9 A;  3IF8 B;  3Q5W A;  4LF8 T;  4KMC A;  4GIW A;  3MA9 A;  4Z90 A;  4PJM A;  4UF0 B;  4TNV A;  4LMJ A;  1US7 B;  2M67 A;  3AE9 A;  5HXH A;  3O1H A;  5DJQ C;  3RX6 A;  3CQX C;  3MJX A;  4ZI3 C;  4DBR A;  4XBF B;  4HE8 A;  3P50 A;  5JDM A;  3O4X E;  5AQF B;  4BAY B;  5HCM A;  3PJA J;  2L9Q A;  4ZOL E;  5JDG A;  1BR4 A;  2FJA A;  3UUL A;  2RP4 A;  3CVR A;  2VKD A;  4UR9 A;  3PJA A;  2OV9 A;  2CXD A;  4V1A v;  4HWF A;  4Z91 A;  5LJM A;  3TLV A;  2X51 A;  3BQI A;  3QNU A;  3E0Z A;  2XQ8 A;  2WDV A;  1XNQ T;  2H88 A;  2JRK A;  3PU8 A;  3RGL A; 
#chains in the Genus database with same CATH homology
 4K0K T;  2ZM6 T;  4X66 T;  4JI4 T;  2UUA T;  4DR6 T;  3OTO T;  2VQF T;  4DR3 T;  4B3T T;  4LF4 T;  1HNZ T;  5LMU T;  5BR8 T;  1XMQ T;  4DV1 T;  1FJG T;  4AQY T;  1HNX T;  1XNR T;  2UUC T;  3T1Y T;  4DR7 T;  2UXB T;  1N34 T;  4LFC T;  2VQE T;  4LFB T;  4DV4 T;  4JV5 T;  2UXC T;  1J5E T;  4B3R T;  1IBM T;  4DR4 T;  4JYA T;  4LF8 T;  5IWA T;  4X64 T;  4LF7 T;  1I94 T;  4JI6 T;  4KHP T;  4DV7 T;  4JI5 T;  1IBK T;  3T1H T;  4X65 T;  1N33 T;  4NXM T;  4DR2 T;  2UUB T;  4DV2 T;  5LMN T;  1N32 T;  1IBL T;  4LFA T;  4OX9 T;  4YHH T;  4GKK T;  1N36 T;  2E5L T;  4B3S T;  4DR5 T;  4DV5 T;  4NXN T;  4LF5 T;  4DUZ T;  1XMO T;  4JI8 T;  2F4V T;  4DV3 T;  2UXD T;  4DV6 T;  4DV0 T;  4LF6 T;  1HNW T;  2UU9 T;  4JI3 T;  4B3M T;  1HR0 T;  2HHH T;  4YY3 T;  4DR1 T;  4X62 T;  4DUY T;  4JI7 T;  4JI0 T;  4GKJ T;  1XNQ T;  4LF9 T;  4JI2 T;  4JI1 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...