4DV4T

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4dv4T00
2VQET 2VQFT 1IBLT 4DR3T 4JV5T 4YHHT 2UU9T 1XMOT 4GKJT 4JI4T 4DV4T 4DV3T 1HNWT 4GKKT 4JI5T 4KHPT 5LMNT 2ZM6T 4LF8T 4DR5T 4LF4T 1HNXT 4JI3T 3T1YT 3T1HT 1HNZT 4DV7T 4JYAT 4JI7T 4X65T 2UXBT 4JI8T 1N33T 4JI0T 4DUYT 4X64T 4OX9T 4NXMT 4DR4T 2UUAT 4DV2T 4YY3T 4DR1T 1XNQT 4LF7T 4K0KT 1XMQT 4LF9T 2F4VT 5BR8T 2UXCT 1FJGT 4LFCT 2E5LT 4DUZT 4NXNT 1N36T 1N32T 4B3MT 4JI2T 4LFAT 1XNRT 2UXDT 1IBKT 1IBMT 4B3RT 2UUCT 4B3ST 4JI1T 4DV5T 1HR0T 4DR6T 1N34T 3OTOT 4LF5T 4X62T 2HHHT 1I94T 4DV6T 4LF6T 4DR7T 4DR2T 2UUBT 1J5ET 4DV0T 4X66T 5LMUT 4B3TT 4DV1T 4JI6T 5IWAT 4AQYT 4LFBT
chains in the Genus database with same CATH superfamily
2CWYA 3UU8A 5JDHA 2WY2A 2D2SA 2E9XA 2H3RA 5LG4A 3PUQA 2N1GA 1WYCA 2W4XA 3RIFA 3LG7A 2E9XD 2PFVA 2YDQA 2E5VA 4CXYA 1IJ5A 5C2TA 2ZM6T 3PUGA 3CQCB 3P4RA 3N2KE 4KI0F 3EI0A 4AI6A 2BS4A 5HEJA 3HI2A 4O4IE 2LRLA 4CI1B 3FB2A 4LF9T 3ZLIA 2WP9A 2F4VT 5CA0E 2VKJA 3OBVE 3EDUA 2B76A 1VCSA 2BG9C 1VRBA 1D0YA 2XASB 2HN2A 3HKCE 5IUXA 4C91A 4AKGA 2XQAA 5FXZA 2G0UA 5HXHA 3PUAA 4JEHB 3RYHE 2RA1A 4IDQA 1IAPA 2VL0A 3AXJA 5EK4A 5FXVA 3W15B 5HXEA 4QH4A 2XZEA 4FJOA 2LSYA 2X0HA 2K9AA 2PTFA 3F31A 2KT9A 3JCFA 3RIUA 3E08A 2BBHA 4B3TT 2WMOA 3C51A 4ILAA 5LA6E 2WQYA 2Q9QA 2V7MA 2X9XA 1US7B 1IBLT 5LYJE 2V7KA 2IAKA 4U33A 2JIWA 2J62A 2Q9QD 3E22E 2L9QA 3UUBA 2MPKA 3KVAA 4PK5A 5HEOA 3VRAA 1KFYA 4KP3C 3PUZF 4AKHA 1HG5A 3L8RA 2NTYA 1Z0PA 4QXCB 2NW9A 4X65T 5JDLA 3TKLB 2K48A 3QB5K 3PUXF 3RIAA 1S35A 1D1BA 4YTNA 2BVLA 1W0AA 4EXTA 2JMHA 2WBLA 1UX5A 5JRCB 2IC9A 3Q5DA 3RQWA 5M4YA 2V7JA 2A72A 2BVMA 3DTOA 1N34T 3RC8A 2CXLA 4COFA 3TLWA 4H9OC 2ES0A 5L3FB 3ZMUB 4IDZA 3AE2A 5FVLA 4WYVA 4F6RC 2V7IA 4MLKA 3JC6D 1OEDE 2PJQA 5LJNA 5BMVE 2JQHA 2C5JA 1MMNA 5AQJB 5JDNA 1HCIA 4AKRB 2LSKA 4PJMA 5AQLB 4Z91A 3ZCJA 3MJXA 2VK9A 1WR6A 2UXXB 1XDOA 1XMOT 2CLYC 2GK9A 3SOLA 5AQFB 3BQLA 4HWIB 2FJBA 3ZT5A 5FMNA 4DV7T 2WSSV 1MNEA 2J4GA 4HE8A 4EYYR 1O3XA 2WB5A 3FBLA 3PE0A 3AE4A 4DBRA 4EB6E 1D0ZA 2UXCT 5HXSA 3ONXA 2LT3A 3LK42 3FZFB 1N36T 4WZXA 3I1AA 3H37A 3KVBA 3KV5A 2UXDT 4B3RT 1Z8UA 3U78A 3J7Yq 3L3PA 4NIQA 4YTPA 1HR0T 4IDOA 1OEDA 3O1JA 2KWIB 2CLYB 3LSVA 3PUVF 3L09A 1MIVA 3AAIA 2Y6XA 3TLVA 3VR9A 4AKIA 2BKNA 3KINB 3C98B 4CXWA 3RQUA 1B7TA 4IE7A 2C5KT 4TWDA 1ZP0A 1MIWA 3FZMB 2DL1A 3EAMA 3AEBA 4HFHA 2YOEA 4O4HE 2ODVA 2XPKA 4AIUA 4DNDA 2V6YB 2LOSA 4K0UA 4ERRA 2XSAA 3RRWA 2NOXA 4WBNE 3OJAA 3LJCA 4UV8B 5ETWA 2X66A 2B1EA 4CN6A 4GKKT 3X1DA 5LMNT 5LCYA 3AA1B 4GYRA 4ZI3C 3AAEB 3BQIA 3ZJ2A 4CI3B 2LSIA 1CUNA 4WBOA 2V1DB 3AEGA 1T8BA 3EABA 3QC9A 3H3MA 3K3QC 3Q5EA 4HWCA 3RRCA 3ANWB 3WAKA 2X9HA 3M3ZB 3MZKB 4YJ2E 2YU1A 1Y64B 5LG3A 2JQQA 4JI1T 1W09A 3IEEA 3CQXC 5LXTE 5HWXA 3ZKRA 4U2YA 5FY0A 1I94T 4DV6T 3UTKA 5AQKB 5F8PA 2ZM2A 3WI3A 1ZOYA 2X68A 2R6GF 5KMGP 1HS7A 2FJDA 5AQQB 4A98A 5ADXL 2DLRA 5IWAT 4IT4A 2A3DA 2Y8DA 3B13A 2VQFT 4G63A 5FP3A 5JR9A 1E2AA 3KV6A 1XZYA 1KF6A 4DR3T 2XJ7A 1LVKA 1QLBA 4PK4A 3G06A 3VKHA 4MHCA 5HXCA 5J1GA 4P0BA 5JQGE 2VVSA 3UUMA 1T7SA 4YHJA 3UT5E 5AQSB 1MNDA 2XQ3A 3ETVA 4JI8T 1N33T 2MOZA 3NRYA 3PJAA 4NXMT 2UUAT 5AQVB 2KNDA 4HWHA 5HXRA 4LF7T 4ASKA 3RLFF 4K0KT 4QH1A 3FHNA 2HH7A 5J0ZA 3ZCIA 2E5LT 4UF0B 4UXNB 2CE7A 4IE0A 1H7CA 4X20E 4ZZCA 1HF8A 4L5GA 2WU2A 5JTGA 3MK7C 2IW5B 4L9IA 3GWHA 4AQGA 5FKYA 5ABGA 3OTOT 1HFAA 3TLSA 4I55E 4ZI7E 4CN4A 3AE6A 4NPPA 4QX8B 2L3LA 5AQMB 2CXDA 1BR4A 5L47A 3PUYF 3AA6B 1JNZA 4AQFA 3DP7A 4H9SE 4U74A 4TUYE 3ZSTA 3ZJ1A 4A5XA 4QXHB 4O4JE 3D0TA 4ZZBA 2W61A 1SE7A 4YHHT 2DWKA 5AQIB 2BBJA 2W63A 4PK6A 2ZLYA 1KK7A 4JYAT 3GN5B 3TLUA 2JQ9A 3Q2MA 5LBMA 1YXRA 4ZOLE 1T72A 3I0QA 1VCTA 1XMQT 1FJGT 4TNVA 3CKDA 1R8IA 3UFGA 4HEAA 3K8PC 1IBKT 2SPCA 4ISSA 4AISA 3QNUA 4YLHA 2LKHA 1EZ3A 2LOPA 4ISTA 5KDMC 3RPUA 1E1HB 2XAGB 2JPFA 2W0GA 2VQET 3FZLB 2CBJA 3CVRA 3ZEFB 4IE4A 2EHOC 4OYJA 1LVFA 5J2UE 3AVSA 1WLXA 1BR0A 2MTQA 4HFVA 3P4WA 1FMVA 3S4UA 4AXPA 4L0RA 4JI5T 3EDVA 4U7IA 4X1IE 5DJQC 5LHHB 4MBQA 4ILUA 4KBMB 2M6IA 2L8KA 2BG9B 3AEAA 4ADZA 2XM1A 2XQ9A 4PJNA 3UFEA 3AEEA 4OX9T 2ACXA 3P4QA 2CEAA 4WNKA 2CWOA 4IIJE 2XM2A 2YDRA 1M62A 5JDFA 2D5UA 1N32T 1YW0A 2BKOA 4B3MT 2EHOB 1I6ZA 4LFAT 4Q25A 2LSJA 3VKGA 5LGTB 4G2AA 3EUHA 1X79A 4DR6T 3R6NA 4UVBB 4CZZB 2XQ4A 4QH5A 4F8HA 2V6XA 5CGMA 4M1PA 4Z90A 4HWDA 2X51A 3LBXA 2Z6EA 4IHJE 4IE6A 3UU3A 4EEBA 5AFUL 2XAFB 4NUVA 5HAXA 4LFBT 4EV6A 2LSGA 3RYIE 4OFZA 3KBUA 1YQ3A 5ABFB 2X0LB 3O1HA 2RPAA 2WAUA 3AEFA 1X9BA 1UUSA 1KEYA 1SA0E 3NBXX 4DV3T 1HNWT 3AE8A 2HPJA 3CQGB 2LRKA 3OYZA 5EK2A 4EGWA 5LGUB 4UVAB 1QUUA 5HWYA 5GONE 2QRXA 1DU2A 2BDEA 1LRZA 5IHYA 3QK6A 2KZ7B 4X64T 2K24A 4I0UA 3V5UA 3ZPOA 3SFEA 4LMLA 4JBWF 2E9XC 2J1DG 4QHOA 3RI5A 2QYWA 1KNRA 2PBIA 2M67A 1T98A 1U4QA 1VOMA 3NZQA 4HFBA 2XQYA 2LE8A 2CCQA 4JI2T 4P09A 3O9XA 1HX1B 3LDQB 2UUCT 3SS1A 1V9DA 4KUMB 4YSYA 5FYMA 4QWNB 4U31A 1UURA 1XWMA 1MMGA 4DR2T 2MBGA 3P8CD 5IYZE 2WCAA 2X9YA 3TLTA 3KDSE 4WW0A 2IMLA 1W0BA 4YSZA 3ETUA 4KHZF 2E9XB 2QA7A 2XQ8A 3N9QA 2LJLA 2IUBA 2H7OA 4PNIA 1U5PA 3EVYA 4N78D 1D0XA 3A8YC 4OK0A 4JV5T 4BA9A 1S94A 4B6XA 3UUNA 1ZV4X 3AAAB 4KX6A 5HCJA 3C4ZA 4OYKA 5LBQB 3HKEE 1NAFA 3RIUC 3RYCE 5AQTB 5LJMA 5F5WA 5LGNB 3C50A 2XSBA 2BG9E 2ZM8A 5LOVE 2Q9QC 2WZIA 4X1YE 2V7LA 4UVCB 3AVRA 5DQWA 4TX5A 5L3CB 2LEHA 4ILCA 3HKBE 4P0AA 4ZI2D 4X1KE 4MALA 2NWBA 3BK9A 3ABVA 2C5IT 2CA5A 4FI5A 1WCRA 4LMJA 2LM9A 4E7ZA 4EEDA 1MMDA 4GK5E 3RHWA 3PURA 4U3CA 5LB7B 2VKDA 3UU4A 5C3JA 2CHNA 3N9LA 4TV8E 3ESLA 2UXNB 5L3BB 2Q9QB 1J5WA 2OLTA 2YU2A 2N2NA 3JADA 1MIYA 1YKHB 2D0UA 2FBWA 4YT0A 2DWGA 3MXZA 2KXPB 2JQKA 1ZEEA 3ZMZB 3I9WA 3ZT7A 1E7PA 3ONLC 4HFDA 3SRZA 4TZ4C 3ZC0A 2KWHA 3GA8A 5HCMA 4UEMA 2BG9A 2W2UA 3JC6C 5H6RB 5KXJA 4DMWA 2HPLA 4YTMA 2CBIA 4DR5T 3IBPA 3KV9A 1D1CA 3LK3B 2KINB 3R84B 3RKOA 3C4XA 4DR1T 2DNXA 4TN7B 2W67A 2XAHB 4BJMA 1WRDA 1M7KA 4NXNT 3I0OA 5HYAA 1HX8A 5FL1A 3CIRA 2W00A 2VKHA 4E7SA 5JRCA 4CN1A 4B3ST 4I50E 3I9YA 1IJ6A 4HTEA 3UULA 3RF1A 3RYFE 4AKLA 3F57A 3N9NA 4DV0T 2P9BA 2I0MA 3O4XE 4JI6T 4P1NA 5JDMA 4IL9A 3A7MA 1IZNB 2MYSA 3E0ZA 1OEDC 1UCUA 2H88A 5L4EA 3ZN1B 4PJJA 3ZMVB 2ACZA 2X67A 2D0TA 5LHGB 3CX7B 3NRXA 4J2CA 3BQKA 3N2OA 4IGUA 1KNZA 2QGSA 5C8YE 4LF8T 3T1YT 3T1HT 1BR1A 5E0OA 2CXFA 2YINA 4IREA 5FXWA 4LMKA 2CMRA 1XNQT 2V26A 2JMKA 3ZMTB 3Q9DA 3VR8A 4BJNA 2WDVA 3UU6A 2VURA 4H9NC 3SFDA 1ZKEA 3RC3A 1YKEB 4DUZT 5JVDE 4X5TA 3GMIA 5L2LA 2E8IA 3HA4A 4UELA 3B57A 1OEDB 2XUEA 3AECA 3ZT6A 2QVAA 4DO0A 4HWFA 3IF8B 3EHZA 4YXDA 3RGLA 2W66A 4IE5A 5AQHB 2HHHT 4LF6T 3A5XA 2YEVC 4EIWA 2XTLA 5AQPB 2DHRA 2VB6A 3NVOA 5FVKA 1KNPA 2VWAA 4DV1T 3ZN0B 1SUMB 4V1Av 5AQRB 1NWMX 1WYBA 4GYSA 3PV0F 3PUWF 5L3EB 4EZHA 2WMNA 4PFOA 1UK5A 2V6YA 3U3IA 5J2TE 3PJAJ 4NUUA 3NZPA 4KHPT 5AQGB 1AJ3A 4I43B 3UQ7A 5DQVA 3OPCA 2X9WA 2PG8A 3AEDA 4JI0T 1WR0A 1L0VA 2WS3A 4U72A 5JR9C 4DV2T 3ZYMA 1G8XA 3RH3A 3K1SA 3UQ4A 3FXEB 5F3JA 1OWAA 2YN6A 2Y48B 3ANWA 3FZKB 5LP6E 3AB3B 3CX8B 4X62T 4U2ZA 4H63V 1XDPA 2XHEB 2WDQA 1QSDA 3N5LA 2XY8B 4X66T 5LNKA 5JR9B 4XBFB 3IA3A 4DIDB 1HTJF 2V8SV 3QB5A 4CI2B 3SWHA 2CPTA 5CA1E 4ZI3D 1HG2A 2DCFA 2OV9A 4H9PC 1BR2A 3PDYA 4DMVA 4JLEA 1SHZC 5HEUA 1Y01A 5AQUB 2ODUA 4JEUB 2M6BA 1UGOA 2BS3A 3PU3A 1HNZT 2WDRA 2DI4A 3AA7B 4AQFC 2UXBT 1WFDA 3HKDE 2I59A 4DUYT 5ABHA 2V5CA 1JNRA 4TWFA 2IIUA 2IDOB 1GQEA 5FL0A 4CXXA 2XQ6A 4ZXLA 3RKGA 3K3OA 5FXXA 4IDNA 2N9DA 3N9MA 4XAXB 1IBMT 2KSRA 4C90A 4KMCA 5A1LA 4UF0A 3LFMA 1UX4A 1FMWA 5CJ5A 3QOFA 2A2FX 3K3NA 3V5SA 4Z8XA 2XAQB 3KFWX 4HFIA 3FXDB 5JREA 4O2AE 3CWZB 2NW7A 3L39A 5TAOA 5LMUT 3ZMSB 4ANJA 2MAWA 4ZS2A 5HEGA 5FNVE 4AQYT 3AA0B 3C4WA 2X0YA 2LKGA 1W9RA 5L4HA 4PAGA 2C0SA 4ZS3A 5JH7E 2LM2A 2VKOA 2UU9T 4HGAA 2V5DA 5L3GB 4DV4T 3PU8A 5FY1A 2WWUA 4DVDA 2NR4A 4EOZB 1HNXT 4MFRA 4I4TE 4H9RC 3OVUA 1D1AA 4ILBA 5ABEA 4XZCA 3CMLA 3N9PA 3ZSSA 4UIGA 3Q5XA 2LLYA 4QKNA 4YY3T 2WZHA 3N9OA 3GN5A 5BR8T 4ZHQE 3AE7A 4O8SA 3M65A 3AE1A 3ZYLA 2CRBA 4GIWA 1J1JA 4YJ3E 1ZHCA 4LF5T 2D9DA 1FEWA 2HN1A 4TWHA 2NP9A 3P7IA 2KLQA 2OA5A 1LKXA 4TNWA 4PFPA 2IC6A 3F2EA 3HR0A 4UR9A 3ONJA 2E2AA 3AXJB 3UUXB 1G73A 2VVNA 4YFSA 5CFBA 4O4LE 4IDPA 2WWVA 3HL6A 3CK6A 3O1IA 2ZMAA 3MA9A 1OXZA 5FY7A 4H63H 1YQ4A 3P4PA 3Q5WA 4A97A 2XQ5A 4LF4T 4OHFA 4GK0E 4JI7T 3AE9A 3B5MA 4H9QC 3C64A 3KV4A 3FBZA 4EYUA 2CM0A 4UV9B 4HKAA 2YK0A 2BS2A 3AE5A 4HFEA 4DBQA 3H3AA 5AQNB 3PUSA 2WM9A 2BKPA 1MMAA 2VASA 2WU5A 3ZYKA 1XNRT 3AE3A 2RP4A 2BZBA 3N2GE 5JDQA 1YD8G 2EHOA 2CHOA 4A56A 4YSXA 2A9UA 3JAFA 4IL4A 4DR7T 2K3WA 3KBTA 3LBXB 5KX5E 2YKSA 2EHOD 5AQOB 3IHRA 3NWIA 2XQ7A 1CHUA 2AXDS 2H89A 4EAHA 2XAJB 2H7VC 4EZ4A 4HN9A 3J9X1 3VRBA 3DJBA 5EK3A 1NENA 5CB4E 4JUYA 3VU7H 4GKJT 4JI4T 2KMFA 4PJLA 5ABFA 3ZC1A 5H6QB 1FIOA 4GOUA 5DABA 3UU5A 3LK2B 4JI3T 3FZHB 2ZM0A 3OKQA 4HFCA 4U7YA 2J47A 2I6HA 2AE9A 3JAEA 4DR4T 3P50A 2JRKA 5HEHA 4QX7B 2IHR1 2VL8A 3MKDA 4CQIA 3QUJA 4LFCT 3CX6B 3RX6A 3OYXA 5LHIB 2FUPA 3P4SA 3WAJA 5L3DB 4PW8A 4QXBB 2FJAA 2W62A 3MACA 3PTRB 4DV5T 2NTXA 4ZEYA 2LHNA 3NKZA 2K5BB 2YDSA 4ZI2C 2UUBT 2JJ9A 2NW8A 1J5ET 4TV9E 3CPZA 4BAYB 2FJEA 2LHRA 1NEKA 4O2BE 3T8OA 5JDGA 5EZYE 3VHLA
chains in the Genus database with same CATH topology
2VQET 2VQFT 1IBLT 4DR3T 4JV5T 4YHHT 2UU9T 1XMOT 4GKJT 4JI4T 4DV4T 4DV3T 1HNWT 4GKKT 4JI5T 4KHPT 5LMNT 2ZM6T 4LF8T 4DR5T 4LF4T 1HNXT 4JI3T 3T1YT 3T1HT 1HNZT 4DV7T 4JYAT 4JI7T 4X65T 2UXBT 4JI8T 1N33T 4JI0T 4DUYT 4X64T 4OX9T 4NXMT 4DR4T 2UUAT 4DV2T 4YY3T 4DR1T 1XNQT 4LF7T 4K0KT 1XMQT 4LF9T 2F4VT 5BR8T 2UXCT 1FJGT 4LFCT 2E5LT 4DUZT 4NXNT 1N36T 1N32T 4B3MT 4JI2T 4LFAT 1XNRT 2UXDT 1IBKT 1IBMT 4B3RT 2UUCT 4B3ST 4JI1T 4DV5T 1HR0T 4DR6T 1N34T 3OTOT 4LF5T 4X62T 2HHHT 1I94T 4DV6T 4LF6T 4DR7T 4DR2T 2UUBT 1J5ET 4DV0T 4X66T 5LMUT 4B3TT 4DV1T 4JI6T 5IWAT 4AQYT 4LFBT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQE T;  2VQF T;  1IBL T;  4DR3 T;  4JV5 T;  4YHH T;  2UU9 T;  1XMO T;  4GKJ T;  4JI4 T;  4DV4 T;  4DV3 T;  1HNW T;  4GKK T;  4JI5 T;  4KHP T;  5LMN T;  2ZM6 T;  4LF8 T;  4DR5 T;  4LF4 T;  1HNX T;  4JI3 T;  3T1Y T;  3T1H T;  1HNZ T;  4DV7 T;  4JYA T;  4JI7 T;  4X65 T;  2UXB T;  4JI8 T;  1N33 T;  4JI0 T;  4DUY T;  4X64 T;  4OX9 T;  4NXM T;  4DR4 T;  2UUA T;  4DV2 T;  4YY3 T;  4DR1 T;  1XNQ T;  4LF7 T;  4K0K T;  1XMQ T;  4LF9 T;  2F4V T;  5BR8 T;  2UXC T;  1FJG T;  4LFC T;  2E5L T;  4DUZ T;  4NXN T;  1N36 T;  1N32 T;  4B3M T;  4JI2 T;  4LFA T;  1XNR T;  2UXD T;  1IBK T;  1IBM T;  4B3R T;  2UUC T;  4B3S T;  4JI1 T;  4DV5 T;  1HR0 T;  4DR6 T;  1N34 T;  3OTO T;  4LF5 T;  4X62 T;  2HHH T;  1I94 T;  4DV6 T;  4LF6 T;  4DR7 T;  4DR2 T;  2UUB T;  1J5E T;  4DV0 T;  4X66 T;  5LMU T;  4B3T T;  4DV1 T;  4JI6 T;  5IWA T;  4AQY T;  4LFB T; 
#chains in the Genus database with same CATH topology
 2CWY A;  3UU8 A;  5JDH A;  2WY2 A;  2D2S A;  2E9X A;  2H3R A;  5LG4 A;  3PUQ A;  2N1G A;  1WYC A;  2W4X A;  3RIF A;  3LG7 A;  2E9X D;  2PFV A;  2YDQ A;  2E5V A;  4CXY A;  1IJ5 A;  5C2T A;  2ZM6 T;  3PUG A;  3CQC B;  3P4R A;  3N2K E;  4KI0 F;  3EI0 A;  4AI6 A;  2BS4 A;  5HEJ A;  3HI2 A;  4O4I E;  2LRL A;  4CI1 B;  3FB2 A;  4LF9 T;  3ZLI A;  2WP9 A;  2F4V T;  5CA0 E;  2VKJ A;  3OBV E;  3EDU A;  2B76 A;  1VCS A;  2BG9 C;  1VRB A;  1D0Y A;  2XAS B;  2HN2 A;  3HKC E;  5IUX A;  4C91 A;  4AKG A;  2XQA A;  5FXZ A;  2G0U A;  5HXH A;  3PUA A;  4JEH B;  3RYH E;  2RA1 A;  4IDQ A;  1IAP A;  2VL0 A;  3AXJ A;  5EK4 A;  5FXV A;  3W15 B;  5HXE A;  4QH4 A;  2XZE A;  4FJO A;  2LSY A;  2X0H A;  2K9A A;  2PTF A;  3F31 A;  2KT9 A;  3JCF A;  3RIU A;  3E08 A;  2BBH A;  4B3T T;  2WMO A;  3C51 A;  4ILA A;  5LA6 E;  2WQY A;  2Q9Q A;  2V7M A;  2X9X A;  1US7 B;  1IBL T;  5LYJ E;  2V7K A;  2IAK A;  4U33 A;  2JIW A;  2J62 A;  2Q9Q D;  3E22 E;  2L9Q A;  3UUB A;  2MPK A;  3KVA A;  4PK5 A;  5HEO A;  3VRA A;  1KFY A;  4KP3 C;  3PUZ F;  4AKH A;  1HG5 A;  3L8R A;  2NTY A;  1Z0P A;  4QXC B;  2NW9 A;  4X65 T;  5JDL A;  3TKL B;  2K48 A;  3QB5 K;  3PUX F;  3RIA A;  1S35 A;  1D1B A;  4YTN A;  2BVL A;  1W0A A;  4EXT A;  2JMH A;  2WBL A;  1UX5 A;  5JRC B;  2IC9 A;  3Q5D A;  3RQW A;  5M4Y A;  2V7J A;  2A72 A;  2BVM A;  3DTO A;  1N34 T;  3RC8 A;  2CXL A;  4COF A;  3TLW A;  4H9O C;  2ES0 A;  5L3F B;  3ZMU B;  4IDZ A;  3AE2 A;  5FVL A;  4WYV A;  4F6R C;  2V7I A;  4MLK A;  3JC6 D;  1OED E;  2PJQ A;  5LJN A;  5BMV E;  2JQH A;  2C5J A;  1MMN A;  5AQJ B;  5JDN A;  1HCI A;  4AKR B;  2LSK A;  4PJM A;  5AQL B;  4Z91 A;  3ZCJ A;  3MJX A;  2VK9 A;  1WR6 A;  2UXX B;  1XDO A;  1XMO T;  2CLY C;  2GK9 A;  3SOL A;  5AQF B;  3BQL A;  4HWI B;  2FJB A;  3ZT5 A;  5FMN A;  4DV7 T;  2WSS V;  1MNE A;  2J4G A;  4HE8 A;  4EYY R;  1O3X A;  2WB5 A;  3FBL A;  3PE0 A;  3AE4 A;  4DBR A;  4EB6 E;  1D0Z A;  2UXC T;  5HXS A;  3ONX A;  2LT3 A;  3LK4 2;  3FZF B;  1N36 T;  4WZX A;  3I1A A;  3H37 A;  3KVB A;  3KV5 A;  2UXD T;  4B3R T;  1Z8U A;  3U78 A;  3J7Y q;  3L3P A;  4NIQ A;  4YTP A;  1HR0 T;  4IDO A;  1OED A;  3O1J A;  2KWI B;  2CLY B;  3LSV A;  3PUV F;  3L09 A;  1MIV A;  3AAI A;  2Y6X A;  3TLV A;  3VR9 A;  4AKI A;  2BKN A;  3KIN B;  3C98 B;  4CXW A;  3RQU A;  1B7T A;  4IE7 A;  2C5K T;  4TWD A;  1ZP0 A;  1MIW A;  3FZM B;  2DL1 A;  3EAM A;  3AEB A;  4HFH A;  2YOE A;  4O4H E;  2ODV A;  2XPK A;  4AIU A;  4DND A;  2V6Y B;  2LOS A;  4K0U A;  4ERR A;  2XSA A;  3RRW A;  2NOX A;  4WBN E;  3OJA A;  3LJC A;  4UV8 B;  5ETW A;  2X66 A;  2B1E A;  4CN6 A;  4GKK T;  3X1D A;  5LMN T;  5LCY A;  3AA1 B;  4GYR A;  4ZI3 C;  3AAE B;  3BQI A;  3ZJ2 A;  4CI3 B;  2LSI A;  1CUN A;  4WBO A;  2V1D B;  3AEG A;  1T8B A;  3EAB A;  3QC9 A;  3H3M A;  3K3Q C;  3Q5E A;  4HWC A;  3RRC A;  3ANW B;  3WAK A;  2X9H A;  3M3Z B;  3MZK B;  4YJ2 E;  2YU1 A;  1Y64 B;  5LG3 A;  2JQQ A;  4JI1 T;  1W09 A;  3IEE A;  3CQX C;  5LXT E;  5HWX A;  3ZKR A;  4U2Y A;  5FY0 A;  1I94 T;  4DV6 T;  3UTK A;  5AQK B;  5F8P A;  2ZM2 A;  3WI3 A;  1ZOY A;  2X68 A;  2R6G F;  5KMG P;  1HS7 A;  2FJD A;  5AQQ B;  4A98 A;  5ADX L;  2DLR A;  5IWA T;  4IT4 A;  2A3D A;  2Y8D A;  3B13 A;  2VQF T;  4G63 A;  5FP3 A;  5JR9 A;  1E2A A;  3KV6 A;  1XZY A;  1KF6 A;  4DR3 T;  2XJ7 A;  1LVK A;  1QLB A;  4PK4 A;  3G06 A;  3VKH A;  4MHC A;  5HXC A;  5J1G A;  4P0B A;  5JQG E;  2VVS A;  3UUM A;  1T7S A;  4YHJ A;  3UT5 E;  5AQS B;  1MND A;  2XQ3 A;  3ETV A;  4JI8 T;  1N33 T;  2MOZ A;  3NRY A;  3PJA A;  4NXM T;  2UUA T;  5AQV B;  2KND A;  4HWH A;  5HXR A;  4LF7 T;  4ASK A;  3RLF F;  4K0K T;  4QH1 A;  3FHN A;  2HH7 A;  5J0Z A;  3ZCI A;  2E5L T;  4UF0 B;  4UXN B;  2CE7 A;  4IE0 A;  1H7C A;  4X20 E;  4ZZC A;  1HF8 A;  4L5G A;  2WU2 A;  5JTG A;  3MK7 C;  2IW5 B;  4L9I A;  3GWH A;  4AQG A;  5FKY A;  5ABG A;  3OTO T;  1HFA A;  3TLS A;  4I55 E;  4ZI7 E;  4CN4 A;  3AE6 A;  4NPP A;  4QX8 B;  2L3L A;  5AQM B;  2CXD A;  1BR4 A;  5L47 A;  3PUY F;  3AA6 B;  1JNZ A;  4AQF A;  3DP7 A;  4H9S E;  4U74 A;  4TUY E;  3ZST A;  3ZJ1 A;  4A5X A;  4QXH B;  4O4J E;  3D0T A;  4ZZB A;  2W61 A;  1SE7 A;  4YHH T;  2DWK A;  5AQI B;  2BBJ A;  2W63 A;  4PK6 A;  2ZLY A;  1KK7 A;  4JYA T;  3GN5 B;  3TLU A;  2JQ9 A;  3Q2M A;  5LBM A;  1YXR A;  4ZOL E;  1T72 A;  3I0Q A;  1VCT A;  1XMQ T;  1FJG T;  4TNV A;  3CKD A;  1R8I A;  3UFG A;  4HEA A;  3K8P C;  1IBK T;  2SPC A;  4ISS A;  4AIS A;  3QNU A;  4YLH A;  2LKH A;  1EZ3 A;  2LOP A;  4IST A;  5KDM C;  3RPU A;  1E1H B;  2XAG B;  2JPF A;  2W0G A;  2VQE T;  3FZL B;  2CBJ A;  3CVR A;  3ZEF B;  4IE4 A;  2EHO C;  4OYJ A;  1LVF A;  5J2U E;  3AVS A;  1WLX A;  1BR0 A;  2MTQ A;  4HFV A;  3P4W A;  1FMV A;  3S4U A;  4AXP A;  4L0R A;  4JI5 T;  3EDV A;  4U7I A;  4X1I E;  5DJQ C;  5LHH B;  4MBQ A;  4ILU A;  4KBM B;  2M6I A;  2L8K A;  2BG9 B;  3AEA A;  4ADZ A;  2XM1 A;  2XQ9 A;  4PJN A;  3UFE A;  3AEE A;  4OX9 T;  2ACX A;  3P4Q A;  2CEA A;  4WNK A;  2CWO A;  4IIJ E;  2XM2 A;  2YDR A;  1M62 A;  5JDF A;  2D5U A;  1N32 T;  1YW0 A;  2BKO A;  4B3M T;  2EHO B;  1I6Z A;  4LFA T;  4Q25 A;  2LSJ A;  3VKG A;  5LGT B;  4G2A A;  3EUH A;  1X79 A;  4DR6 T;  3R6N A;  4UVB B;  4CZZ B;  2XQ4 A;  4QH5 A;  4F8H A;  2V6X A;  5CGM A;  4M1P A;  4Z90 A;  4HWD A;  2X51 A;  3LBX A;  2Z6E A;  4IHJ E;  4IE6 A;  3UU3 A;  4EEB A;  5AFU L;  2XAF B;  4NUV A;  5HAX A;  4LFB T;  4EV6 A;  2LSG A;  3RYI E;  4OFZ A;  3KBU A;  1YQ3 A;  5ABF B;  2X0L B;  3O1H A;  2RPA A;  2WAU A;  3AEF A;  1X9B A;  1UUS A;  1KEY A;  1SA0 E;  3NBX X;  4DV3 T;  1HNW T;  3AE8 A;  2HPJ A;  3CQG B;  2LRK A;  3OYZ A;  5EK2 A;  4EGW A;  5LGU B;  4UVA B;  1QUU A;  5HWY A;  5GON E;  2QRX A;  1DU2 A;  2BDE A;  1LRZ A;  5IHY A;  3QK6 A;  2KZ7 B;  4X64 T;  2K24 A;  4I0U A;  3V5U A;  3ZPO A;  3SFE A;  4LML A;  4JBW F;  2E9X C;  2J1D G;  4QHO A;  3RI5 A;  2QYW A;  1KNR A;  2PBI A;  2M67 A;  1T98 A;  1U4Q A;  1VOM A;  3NZQ A;  4HFB A;  2XQY A;  2LE8 A;  2CCQ A;  4JI2 T;  4P09 A;  3O9X A;  1HX1 B;  3LDQ B;  2UUC T;  3SS1 A;  1V9D A;  4KUM B;  4YSY A;  5FYM A;  4QWN B;  4U31 A;  1UUR A;  1XWM A;  1MMG A;  4DR2 T;  2MBG A;  3P8C D;  5IYZ E;  2WCA A;  2X9Y A;  3TLT A;  3KDS E;  4WW0 A;  2IML A;  1W0B A;  4YSZ A;  3ETU A;  4KHZ F;  2E9X B;  2QA7 A;  2XQ8 A;  3N9Q A;  2LJL A;  2IUB A;  2H7O A;  4PNI A;  1U5P A;  3EVY A;  4N78 D;  1D0X A;  3A8Y C;  4OK0 A;  4JV5 T;  4BA9 A;  1S94 A;  4B6X A;  3UUN A;  1ZV4 X;  3AAA B;  4KX6 A;  5HCJ A;  3C4Z A;  4OYK A;  5LBQ B;  3HKE E;  1NAF A;  3RIU C;  3RYC E;  5AQT B;  5LJM A;  5F5W A;  5LGN B;  3C50 A;  2XSB A;  2BG9 E;  2ZM8 A;  5LOV E;  2Q9Q C;  2WZI A;  4X1Y E;  2V7L A;  4UVC B;  3AVR A;  5DQW A;  4TX5 A;  5L3C B;  2LEH A;  4ILC A;  3HKB E;  4P0A A;  4ZI2 D;  4X1K E;  4MAL A;  2NWB A;  3BK9 A;  3ABV A;  2C5I T;  2CA5 A;  4FI5 A;  1WCR A;  4LMJ A;  2LM9 A;  4E7Z A;  4EED A;  1MMD A;  4GK5 E;  3RHW A;  3PUR A;  4U3C A;  5LB7 B;  2VKD A;  3UU4 A;  5C3J A;  2CHN A;  3N9L A;  4TV8 E;  3ESL A;  2UXN B;  5L3B B;  2Q9Q B;  1J5W A;  2OLT A;  2YU2 A;  2N2N A;  3JAD A;  1MIY A;  1YKH B;  2D0U A;  2FBW A;  4YT0 A;  2DWG A;  3MXZ A;  2KXP B;  2JQK A;  1ZEE A;  3ZMZ B;  3I9W A;  3ZT7 A;  1E7P A;  3ONL C;  4HFD A;  3SRZ A;  4TZ4 C;  3ZC0 A;  2KWH A;  3GA8 A;  5HCM A;  4UEM A;  2BG9 A;  2W2U A;  3JC6 C;  5H6R B;  5KXJ A;  4DMW A;  2HPL A;  4YTM A;  2CBI A;  4DR5 T;  3IBP A;  3KV9 A;  1D1C A;  3LK3 B;  2KIN B;  3R84 B;  3RKO A;  3C4X A;  4DR1 T;  2DNX A;  4TN7 B;  2W67 A;  2XAH B;  4BJM A;  1WRD A;  1M7K A;  4NXN T;  3I0O A;  5HYA A;  1HX8 A;  5FL1 A;  3CIR A;  2W00 A;  2VKH A;  4E7S A;  5JRC A;  4CN1 A;  4B3S T;  4I50 E;  3I9Y A;  1IJ6 A;  4HTE A;  3UUL A;  3RF1 A;  3RYF E;  4AKL A;  3F57 A;  3N9N A;  4DV0 T;  2P9B A;  2I0M A;  3O4X E;  4JI6 T;  4P1N A;  5JDM A;  4IL9 A;  3A7M A;  1IZN B;  2MYS A;  3E0Z A;  1OED C;  1UCU A;  2H88 A;  5L4E A;  3ZN1 B;  4PJJ A;  3ZMV B;  2ACZ A;  2X67 A;  2D0T A;  5LHG B;  3CX7 B;  3NRX A;  4J2C A;  3BQK A;  3N2O A;  4IGU A;  1KNZ A;  2QGS A;  5C8Y E;  4LF8 T;  3T1Y T;  3T1H T;  1BR1 A;  5E0O A;  2CXF A;  2YIN A;  4IRE A;  5FXW A;  4LMK A;  2CMR A;  1XNQ T;  2V26 A;  2JMK A;  3ZMT B;  3Q9D A;  3VR8 A;  4BJN A;  2WDV A;  3UU6 A;  2VUR A;  4H9N C;  3SFD A;  1ZKE A;  3RC3 A;  1YKE B;  4DUZ T;  5JVD E;  4X5T A;  3GMI A;  5L2L A;  2E8I A;  3HA4 A;  4UEL A;  3B57 A;  1OED B;  2XUE A;  3AEC A;  3ZT6 A;  2QVA A;  4DO0 A;  4HWF A;  3IF8 B;  3EHZ A;  4YXD A;  3RGL A;  2W66 A;  4IE5 A;  5AQH B;  2HHH T;  4LF6 T;  3A5X A;  2YEV C;  4EIW A;  2XTL A;  5AQP B;  2DHR A;  2VB6 A;  3NVO A;  5FVK A;  1KNP A;  2VWA A;  4DV1 T;  3ZN0 B;  1SUM B;  4V1A v;  5AQR B;  1NWM X;  1WYB A;  4GYS A;  3PV0 F;  3PUW F;  5L3E B;  4EZH A;  2WMN A;  4PFO A;  1UK5 A;  2V6Y A;  3U3I A;  5J2T E;  3PJA J;  4NUU A;  3NZP A;  4KHP T;  5AQG B;  1AJ3 A;  4I43 B;  3UQ7 A;  5DQV A;  3OPC A;  2X9W A;  2PG8 A;  3AED A;  4JI0 T;  1WR0 A;  1L0V A;  2WS3 A;  4U72 A;  5JR9 C;  4DV2 T;  3ZYM A;  1G8X A;  3RH3 A;  3K1S A;  3UQ4 A;  3FXE B;  5F3J A;  1OWA A;  2YN6 A;  2Y48 B;  3ANW A;  3FZK B;  5LP6 E;  3AB3 B;  3CX8 B;  4X62 T;  4U2Z A;  4H63 V;  1XDP A;  2XHE B;  2WDQ A;  1QSD A;  3N5L A;  2XY8 B;  4X66 T;  5LNK A;  5JR9 B;  4XBF B;  3IA3 A;  4DID B;  1HTJ F;  2V8S V;  3QB5 A;  4CI2 B;  3SWH A;  2CPT A;  5CA1 E;  4ZI3 D;  1HG2 A;  2DCF A;  2OV9 A;  4H9P C;  1BR2 A;  3PDY A;  4DMV A;  4JLE A;  1SHZ C;  5HEU A;  1Y01 A;  5AQU B;  2ODU A;  4JEU B;  2M6B A;  1UGO A;  2BS3 A;  3PU3 A;  1HNZ T;  2WDR A;  2DI4 A;  3AA7 B;  4AQF C;  2UXB T;  1WFD A;  3HKD E;  2I59 A;  4DUY T;  5ABH A;  2V5C A;  1JNR A;  4TWF A;  2IIU A;  2IDO B;  1GQE A;  5FL0 A;  4CXX A;  2XQ6 A;  4ZXL A;  3RKG A;  3K3O A;  5FXX A;  4IDN A;  2N9D A;  3N9M A;  4XAX B;  1IBM T;  2KSR A;  4C90 A;  4KMC A;  5A1L A;  4UF0 A;  3LFM A;  1UX4 A;  1FMW A;  5CJ5 A;  3QOF A;  2A2F X;  3K3N A;  3V5S A;  4Z8X A;  2XAQ B;  3KFW X;  4HFI A;  3FXD B;  5JRE A;  4O2A E;  3CWZ B;  2NW7 A;  3L39 A;  5TAO A;  5LMU T;  3ZMS B;  4ANJ A;  2MAW A;  4ZS2 A;  5HEG A;  5FNV E;  4AQY T;  3AA0 B;  3C4W A;  2X0Y A;  2LKG A;  1W9R A;  5L4H A;  4PAG A;  2C0S A;  4ZS3 A;  5JH7 E;  2LM2 A;  2VKO A;  2UU9 T;  4HGA A;  2V5D A;  5L3G B;  4DV4 T;  3PU8 A;  5FY1 A;  2WWU A;  4DVD A;  2NR4 A;  4EOZ B;  1HNX T;  4MFR A;  4I4T E;  4H9R C;  3OVU A;  1D1A A;  4ILB A;  5ABE A;  4XZC A;  3CML A;  3N9P A;  3ZSS A;  4UIG A;  3Q5X A;  2LLY A;  4QKN A;  4YY3 T;  2WZH A;  3N9O A;  3GN5 A;  5BR8 T;  4ZHQ E;  3AE7 A;  4O8S A;  3M65 A;  3AE1 A;  3ZYL A;  2CRB A;  4GIW A;  1J1J A;  4YJ3 E;  1ZHC A;  4LF5 T;  2D9D A;  1FEW A;  2HN1 A;  4TWH A;  2NP9 A;  3P7I A;  2KLQ A;  2OA5 A;  1LKX A;  4TNW A;  4PFP A;  2IC6 A;  3F2E A;  3HR0 A;  4UR9 A;  3ONJ A;  2E2A A;  3AXJ B;  3UUX B;  1G73 A;  2VVN A;  4YFS A;  5CFB A;  4O4L E;  4IDP A;  2WWV A;  3HL6 A;  3CK6 A;  3O1I A;  2ZMA A;  3MA9 A;  1OXZ A;  5FY7 A;  4H63 H;  1YQ4 A;  3P4P A;  3Q5W A;  4A97 A;  2XQ5 A;  4LF4 T;  4OHF A;  4GK0 E;  4JI7 T;  3AE9 A;  3B5M A;  4H9Q C;  3C64 A;  3KV4 A;  3FBZ A;  4EYU A;  2CM0 A;  4UV9 B;  4HKA A;  2YK0 A;  2BS2 A;  3AE5 A;  4HFE A;  4DBQ A;  3H3A A;  5AQN B;  3PUS A;  2WM9 A;  2BKP A;  1MMA A;  2VAS A;  2WU5 A;  3ZYK A;  1XNR T;  3AE3 A;  2RP4 A;  2BZB A;  3N2G E;  5JDQ A;  1YD8 G;  2EHO A;  2CHO A;  4A56 A;  4YSX A;  2A9U A;  3JAF A;  4IL4 A;  4DR7 T;  2K3W A;  3KBT A;  3LBX B;  5KX5 E;  2YKS A;  2EHO D;  5AQO B;  3IHR A;  3NWI A;  2XQ7 A;  1CHU A;  2AXD S;  2H89 A;  4EAH A;  2XAJ B;  2H7V C;  4EZ4 A;  4HN9 A;  3J9X 1;  3VRB A;  3DJB A;  5EK3 A;  1NEN A;  5CB4 E;  4JUY A;  3VU7 H;  4GKJ T;  4JI4 T;  2KMF A;  4PJL A;  5ABF A;  3ZC1 A;  5H6Q B;  1FIO A;  4GOU A;  5DAB A;  3UU5 A;  3LK2 B;  4JI3 T;  3FZH B;  2ZM0 A;  3OKQ A;  4HFC A;  4U7Y A;  2J47 A;  2I6H A;  2AE9 A;  3JAE A;  4DR4 T;  3P50 A;  2JRK A;  5HEH A;  4QX7 B;  2IHR 1;  2VL8 A;  3MKD A;  4CQI A;  3QUJ A;  4LFC T;  3CX6 B;  3RX6 A;  3OYX A;  5LHI B;  2FUP A;  3P4S A;  3WAJ A;  5L3D B;  4PW8 A;  4QXB B;  2FJA A;  2W62 A;  3MAC A;  3PTR B;  4DV5 T;  2NTX A;  4ZEY A;  2LHN A;  3NKZ A;  2K5B B;  2YDS A;  4ZI2 C;  2UUB T;  2JJ9 A;  2NW8 A;  1J5E T;  4TV9 E;  3CPZ A;  4BAY B;  2FJE A;  2LHR A;  1NEK A;  4O2B E;  3T8O A;  5JDG A;  5EZY E;  3VHL A; 
#chains in the Genus database with same CATH homology
 2VQE T;  2VQF T;  1IBL T;  4DR3 T;  4JV5 T;  4YHH T;  2UU9 T;  1XMO T;  4GKJ T;  4JI4 T;  4DV4 T;  4DV3 T;  1HNW T;  4GKK T;  4JI5 T;  4KHP T;  5LMN T;  2ZM6 T;  4LF8 T;  4DR5 T;  4LF4 T;  1HNX T;  4JI3 T;  3T1Y T;  3T1H T;  1HNZ T;  4DV7 T;  4JYA T;  4JI7 T;  4X65 T;  2UXB T;  4JI8 T;  1N33 T;  4JI0 T;  4DUY T;  4X64 T;  4OX9 T;  4NXM T;  4DR4 T;  2UUA T;  4DV2 T;  4YY3 T;  4DR1 T;  1XNQ T;  4LF7 T;  4K0K T;  1XMQ T;  4LF9 T;  2F4V T;  5BR8 T;  2UXC T;  1FJG T;  4LFC T;  2E5L T;  4DUZ T;  4NXN T;  1N36 T;  1N32 T;  4B3M T;  4JI2 T;  4LFA T;  1XNR T;  2UXD T;  1IBK T;  1IBM T;  4B3R T;  2UUC T;  4B3S T;  4JI1 T;  4DV5 T;  1HR0 T;  4DR6 T;  1N34 T;  3OTO T;  4LF5 T;  4X62 T;  2HHH T;  1I94 T;  4DV6 T;  4LF6 T;  4DR7 T;  4DR2 T;  2UUB T;  1J5E T;  4DV0 T;  4X66 T;  5LMU T;  4B3T T;  4DV1 T;  4JI6 T;  5IWA T;  4AQY T;  4LFB T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...