4DV5D

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g, bound with streptomycin
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
208
structure length
208
Chain Sequence
GRYIGPVCRLCRREGVKLYLKGERCYSPKCAMERRPYPPGQHGQKRARRPSDYAVRLREKQKLRRIYGISERQFRNLFEEASKKKGVTGSVFLGLLESRLDNVVYRLGFAVSRRQARQLVRHGHITVNGRRVDLPSYRVRPGDEIAVAEKSRNLELIRQNLEAMKGRKVGPWLSLDVEGMKGKFLRLPDREDLALPVNEQLVIEFYSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 55
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00163 Ribosomal_S4 Ribosomal protein S4/S9 N-terminal domain
D PF01479 S4 S4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1050.10 Mainly Alpha Orthogonal Bundle Ribosomal Protein S4 Delta 41; Chain A, domain 1 Ribosomal Protein S4 Delta 41; Chain A, domain 1 4dv5D01
3.10.290.10 Alpha Beta Roll Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A RNA-binding S4 domain 4dv5D02
1VIOA 1HR0D 2JANA 4AQYD 1KSLA 2UU9D 1H3EA 1HNWD 4X65D 4DV0D 1FJGD 4JI1D 4LF7D 4LGTA 2ISTA 1XNQD 2UUBD 4DV2D 4DR1D 1N32D 4LF5D 4YHHD 4DR2D 4LFCD 1KSVA 2K6PA 4X64D 1HNXD 4DR3D 1HNZD 4YY3D 4NXMD 4NXND 4DUZD 1IBLD 4B3MD 5LMND 4DV7D 2VQED 2UUAD 2KTLA 4JI7D 1H3FA 3KBGA 4JI6D 5LMUD 4OUDA 2HHHD 4JI8D 2F4VD 1N36D 4DV4D 4JYAD 4JI3D 1I94D 1IBKD 4LF9D 4B3RD 4DV5D 4JI0D 1XMQD 4DR5D 4JI4D 3DH3A 4DR7D 2UXDD 4GKKD 4DUYD 4DV3D 4JV5D 4LFBD 4DV1D 2E5LD 4JI5D 4DV6D 1JH3A 4LFAD 1C06A 5BR8D 3HP7A 2UXCD 1KSKA 4DR4D 3T1HD 4LF4D 4LF8D 1C05A 1IBMD 1N34D 4K0KD 4GKJD 2VQFD 1XNRD 1N33D 4JI2D 4B3TD 1P9KA 1DM9A 4X66D 2UUCD 5IWAD 4KHPD 2UXBD 4DR6D 4X62D 4OX9D 2ZM6D 3T1YD 1FKAD 4B3SD 1XMOD 1J5ED 4LF6D 3OTOD
chains in the Genus database with same CATH superfamily
1VIOA 1HR0D 3KYDB 2JANA 4AQYD 1KSLA 2UU9D 1H3EA 3CMMA 1HNWD 4X65D 4DV0D 1FJGD 2NVUB 4JI1D 4LF7D 4LGTA 2ISTA 1XNQD 1Y8QB 2UUBD 5FLXE 2LQ7A 4DV2D 4DR1D 1N32D 4LF5D 4YHHD 5KNLA 3ONHA 4DR2D 4LFCD 1KSVA 2K6PA 4X64D 1HNXD 4DR3D 1HNZD 4YY3D 4NXMD 4NXND 4DUZD 1Y8XB 3ONGA 1IBLD 5LL6S 4B3MD 5LMND 4DV7D 2VQED 2UUAD 2KTLA 4JI7D 1H3FA 3KBGA 4JI6D 5LMUD 4OUDA 4NNJA 2HHHD 4JI8D 2F4VD 1N36D 3J80E 4DV4D 4JYAD 4JI3D 1I94D 2ZTBA 1IBKD 4LF9D 4B3RD 4DV5D 4JI0D 1XMQD 4DR5D 4JI4D 3DH3A 4DR7D 2L3NA 2UXDD 4GKKD 4DUYD 4DV3D 4JV5D 3J81E 4II2A 4LFBD 4DV1D 2E5LD 4JI5D 4DV6D 1Y8RB 4LFAD 1JH3A 1C06A 5BR8D 5FQ2B 3JAME 2I1SA 3HP7A 5IT9E 2UXCD 4W5VB 1KSKA 4DR4D 3T1HD 4LF4D 4LF8D 1C05A 1IBMD 1N34D 4K0KD 4GKJD 2VQFD 1XNRD 1N33D 4JI2D 3J7AF 4B3TD 1P9KA 1DM9A 4X66D 2UUCD 5IWAD 4II3A 4KHPD 2UXBD 3KYCB 4DR6D 4X62D 3FN1A 4OX9D 2ZM6D 3T1YD 5A2QE 1FKAD 4B3SD 1XMOD 1J5ED 4LF6D 3OTOD
chains in the Genus database with same CATH topology
1VIOA 1HR0D 2JANA 4AQYD 1KSLA 2UU9D 1H3EA 1HNWD 4X65D 4DV0D 1FJGD 4JI1D 4LF7D 4LGTA 2ISTA 1XNQD 2UUBD 4DV2D 4DR1D 1N32D 4LF5D 4YHHD 4DR2D 4LFCD 1KSVA 2K6PA 4X64D 1HNXD 4DR3D 1HNZD 4YY3D 4NXMD 4NXND 4DUZD 1IBLD 4B3MD 5LMND 4DV7D 2VQED 2UUAD 2KTLA 4JI7D 1H3FA 3KBGA 4JI6D 5LMUD 4OUDA 2HHHD 4JI8D 2F4VD 1N36D 4DV4D 4JYAD 4JI3D 1I94D 1IBKD 4LF9D 4B3RD 4DV5D 4JI0D 1XMQD 4DR5D 4JI4D 3DH3A 4DR7D 2L3NA 2UXDD 4GKKD 4DUYD 4DV3D 4JV5D 4LFBD 4DV1D 2E5LD 4JI5D 4DV6D 1JH3A 4LFAD 1C06A 5BR8D 3HP7A 2UXCD 1KSKA 4DR4D 3T1HD 4LF4D 4LF8D 1C05A 1IBMD 1N34D 4K0KD 4GKJD 2VQFD 1XNRD 1N33D 4JI2D 4B3TD 1P9KA 1DM9A 4X66D 2UUCD 5IWAD 4KHPD 2UXBD 4DR6D 4X62D 4OX9D 2ZM6D 3T1YD 1FKAD 4B3SD 1XMOD 1J5ED 4LF6D 3OTOD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VIO A;  1HR0 D;  2JAN A;  4AQY D;  1KSL A;  2UU9 D;  1H3E A;  1HNW D;  4X65 D;  4DV0 D;  1FJG D;  4JI1 D;  4LF7 D;  4LGT A;  2IST A;  1XNQ D;  2UUB D;  4DV2 D;  4DR1 D;  1N32 D;  4LF5 D;  4YHH D;  4DR2 D;  4LFC D;  1KSV A;  2K6P A;  4X64 D;  1HNX D;  4DR3 D;  1HNZ D;  4YY3 D;  4NXM D;  4NXN D;  4DUZ D;  1IBL D;  4B3M D;  5LMN D;  4DV7 D;  2VQE D;  2UUA D;  2KTL A;  4JI7 D;  1H3F A;  3KBG A;  4JI6 D;  5LMU D;  4OUD A;  2HHH D;  4JI8 D;  2F4V D;  1N36 D;  4DV4 D;  4JYA D;  4JI3 D;  1I94 D;  1IBK D;  4LF9 D;  4B3R D;  4DV5 D;  4JI0 D;  1XMQ D;  4DR5 D;  4JI4 D;  3DH3 A;  4DR7 D;  2UXD D;  4GKK D;  4DUY D;  4DV3 D;  4JV5 D;  4LFB D;  4DV1 D;  2E5L D;  4JI5 D;  4DV6 D;  1JH3 A;  4LFA D;  1C06 A;  5BR8 D;  3HP7 A;  2UXC D;  1KSK A;  4DR4 D;  3T1H D;  4LF4 D;  4LF8 D;  1C05 A;  1IBM D;  1N34 D;  4K0K D;  4GKJ D;  2VQF D;  1XNR D;  1N33 D;  4JI2 D;  4B3T D;  1P9K A;  1DM9 A;  4X66 D;  2UUC D;  5IWA D;  4KHP D;  2UXB D;  4DR6 D;  4X62 D;  4OX9 D;  2ZM6 D;  3T1Y D;  1FKA D;  4B3S D;  1XMO D;  1J5E D;  4LF6 D;  3OTO D; 
#chains in the Genus database with same CATH topology
 1VIO A;  1HR0 D;  3KYD B;  2JAN A;  4AQY D;  1KSL A;  2UU9 D;  1H3E A;  3CMM A;  1HNW D;  4X65 D;  4DV0 D;  1FJG D;  2NVU B;  4JI1 D;  4LF7 D;  4LGT A;  2IST A;  1XNQ D;  1Y8Q B;  2UUB D;  5FLX E;  2LQ7 A;  4DV2 D;  4DR1 D;  1N32 D;  4LF5 D;  4YHH D;  5KNL A;  3ONH A;  4DR2 D;  4LFC D;  1KSV A;  2K6P A;  4X64 D;  1HNX D;  4DR3 D;  1HNZ D;  4YY3 D;  4NXM D;  4NXN D;  4DUZ D;  1Y8X B;  3ONG A;  1IBL D;  5LL6 S;  4B3M D;  5LMN D;  4DV7 D;  2VQE D;  2UUA D;  2KTL A;  4JI7 D;  1H3F A;  3KBG A;  4JI6 D;  5LMU D;  4OUD A;  4NNJ A;  2HHH D;  4JI8 D;  2F4V D;  1N36 D;  3J80 E;  4DV4 D;  4JYA D;  4JI3 D;  1I94 D;  2ZTB A;  1IBK D;  4LF9 D;  4B3R D;  4DV5 D;  4JI0 D;  1XMQ D;  4DR5 D;  4JI4 D;  3DH3 A;  4DR7 D;  2L3N A;  2UXD D;  4GKK D;  4DUY D;  4DV3 D;  4JV5 D;  3J81 E;  4II2 A;  4LFB D;  4DV1 D;  2E5L D;  4JI5 D;  4DV6 D;  1Y8R B;  4LFA D;  1JH3 A;  1C06 A;  5BR8 D;  5FQ2 B;  3JAM E;  2I1S A;  3HP7 A;  5IT9 E;  2UXC D;  4W5V B;  1KSK A;  4DR4 D;  3T1H D;  4LF4 D;  4LF8 D;  1C05 A;  1IBM D;  1N34 D;  4K0K D;  4GKJ D;  2VQF D;  1XNR D;  1N33 D;  4JI2 D;  3J7A F;  4B3T D;  1P9K A;  1DM9 A;  4X66 D;  2UUC D;  5IWA D;  4II3 A;  4KHP D;  2UXB D;  3KYC B;  4DR6 D;  4X62 D;  3FN1 A;  4OX9 D;  2ZM6 D;  3T1Y D;  5A2Q E;  1FKA D;  4B3S D;  1XMO D;  1J5E D;  4LF6 D;  3OTO D; 
#chains in the Genus database with same CATH homology
 1VIO A;  1HR0 D;  2JAN A;  4AQY D;  1KSL A;  2UU9 D;  1H3E A;  1HNW D;  4X65 D;  4DV0 D;  1FJG D;  4JI1 D;  4LF7 D;  4LGT A;  2IST A;  1XNQ D;  2UUB D;  4DV2 D;  4DR1 D;  1N32 D;  4LF5 D;  4YHH D;  4DR2 D;  4LFC D;  1KSV A;  2K6P A;  4X64 D;  1HNX D;  4DR3 D;  1HNZ D;  4YY3 D;  4NXM D;  4NXN D;  4DUZ D;  1IBL D;  4B3M D;  5LMN D;  4DV7 D;  2VQE D;  2UUA D;  2KTL A;  4JI7 D;  1H3F A;  3KBG A;  4JI6 D;  5LMU D;  4OUD A;  2HHH D;  4JI8 D;  2F4V D;  1N36 D;  4DV4 D;  4JYA D;  4JI3 D;  1I94 D;  1IBK D;  4LF9 D;  4B3R D;  4DV5 D;  4JI0 D;  1XMQ D;  4DR5 D;  4JI4 D;  3DH3 A;  4DR7 D;  2L3N A;  2UXD D;  4GKK D;  4DUY D;  4DV3 D;  4JV5 D;  4LFB D;  4DV1 D;  2E5L D;  4JI5 D;  4DV6 D;  1JH3 A;  4LFA D;  1C06 A;  5BR8 D;  3HP7 A;  2UXC D;  1KSK A;  4DR4 D;  3T1H D;  4LF4 D;  4LF8 D;  1C05 A;  1IBM D;  1N34 D;  4K0K D;  4GKJ D;  2VQF D;  1XNR D;  1N33 D;  4JI2 D;  4B3T D;  1P9K A;  1DM9 A;  4X66 D;  2UUC D;  5IWA D;  4KHP D;  2UXB D;  4DR6 D;  4X62 D;  4OX9 D;  2ZM6 D;  3T1Y D;  1FKA D;  4B3S D;  1XMO D;  1J5E D;  4LF6 D;  3OTO D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...