4DV5I

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g, bound with streptomycin
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 23
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dv5I00
3ZZTA 4LF8I 4NXNE 4DR7E 4LFAI 1FKAE 3T1HE 2OI2A 5LMNE 1ZM4A 4GKKI 1XNQE 3T1YE 1N34I 4HACB 1I94E 1IBMI 3PYGA 3PYFA 2HFSA 4XTJA 1XMOI 1DARA 3ZKDA 4JI3E 1NHHA 2ZM6E 4JI7I 4LF4I 4JI5E 4DV3E 4OX9I 1IBKE 4USKA 2XEXA 1XMQI 4M1KA 1QZRA 4JV5I 2UXBI 4YHHE 1PIEA 2Q2EB 4DV1E 4X62I 2UUBI 2DEIA 4NXME 4X62E 2UUBE 3LPSA 3PYEA 4GKJE 4DV0I 5A2QC 1PKPA 2UU9E 3ZZUA 5LMUI 1B63A 1HNXE 2ZITA 4Z7CA 4DV6I 4AQYI 1EI1A 2UXCE 3JAMC 1ELOA 3D4JA 4LFAE 1KKHA 2HKEA 1D6TA 1N36E 4MYTA 1N36I 4DV7E 2BM0A 4DV7I 4USMA 4LF6I 4DR6E 2E1RA 3WU6A 1IBLI 3J80Q 4Z7YA 5IWAI 3HULA 4DV5E 4B3ME 1N33E 5FLXC 2VQEE 2UXBE 2UXCI 4X65I 1RREA 4NXMI 4JI7E 1Z5CA 4DPWA 1WUUA 4HY1A 2V2QA 4DV2E 1FI4A 1Z0CA 1HNZI 2HFUA 2V34A 1N34E 5GMEA 4DU7A 4DR1I 4LFBE 4LFBI 3Q1QA 4LF4E 2V2ZA 4ED4A 4JI3I 4RPFA 2A2CA 4DV4E 1Z0BA 4B3RI 1FWKA 1N32E 1HNZE 3V2UC 3ZZ0A 2F4VE 4JI8I 4GKKE 2BV3A 1ZXNA 4X65E 4R1FA 3J81Q 4FWHA 4DR5I 1ZM9A 2CZ9A 4JI0I 3K1JA 1EA6A 4DR6I 4WUDA 1IBLE 3QT5A 5BR8I 3B78A 1Z59A 4JI8E 1Z0WA 3WU3A 4DV2I 4P7AA 4HACA 2VQFI 4DPYA 1HNWI 1MX0A 2ZM6I 1N0VC 3F0NA 2R3VA 3J7AG 1N32I 5L3JA 2VQEI 5IT9C 3H4LA 2VQFE 1A6FA 2J7KA 3CWVA 2V8PA 4DR4I 4DR1E 4DR7I 4DUZI 1UEKA 1MG7A 4DV3I 4OX9E 1N33I 4UT4A 2LJPA 3QT8A 4K0KI 1Z0GA 1XMOE 1I94I 1IBME 5LL6R 1Z0EA 3T1HI 4NXNI 1NHJA 4YY3I 4LF7I 3J7AM 5A2QQ 4JI1I 3OTOE 4WUBA 5LMNI 4FWGA 3OTOI 4B3SI 5LMUE 1HR0E 1ZM3A 2F4VI 5IT9Q 1HNXI 4KHPE 3GONA 2VF3A 3QT7A 4DR4E 3JAMQ 4DV6E 1NHIA 4DV1I 1FNMA 1KIJA 2ZBKB 4AQYE 1U2RA 4JI1E 4DR5E 4B3RE 3ZM7A 4KHPI 1Z5AA 4DPUA 1Z0VA 2WW4A 4UTGA 4JI6E 4LF9I 3K17A 3PYDA 2A2DA 4EMDA 1ZXMA 1XNRI 1KVKA 1PVGA 4YY3E 4LF7E 3ZKBA 4FN5A 4X64E 1RR9A 4DV0E 4DXLA 1XMQE 5GMDA 2NPFA 1K47A 4PU9A 4URLA 4YHHI 4JI6I 4LF9E 1B62A 4I3HA 3B82A 2HK3A 4MYUA 1Z5BA 1OJ4A 1S4EA 2DEJA 4DV5I 4B3MI 4DUYE 4DR2I 2UUCI 4JI4E 2UUAI 4JYAE 1XNQI 2V2VA 3T1YI 4LFCI 4LF8E 2UXDE 1J5EE 4B3TI 1FJGI 4X66E 4DR3I 4FW9A 1S16A 2EFGA 4JYAI 1FWLA 4B3TE 1N0UA 1FJGE 2X7IA 4LFCE 4GKJI 4DUZE 2UU9I 4ZVIA 2HHHE 4P52A 5FLXQ 4B3SE 1H74A 4JI2E 2X36A 3B8HA 1VISA 1ZM2A 4JV5E 2HK2A 4JG4A 3WU4A 3LTOA 1H72C 3WU5A 1XNRE 4DV4I 4LF5E 2E5LE 1IBKI 4JI2I 3M6AA 2E5LI 4JI4I 3J80C 2HHHI 3QT6A 4FWDA 4PRVA 1KTVA 4KQVA 2R42A 1XHKA 4LF5I 4PRXA 4JI5I 3LNUA 1HNWE 3J81C 5BR8E 4DU8A 1Z0TA 2GS8A 1H73A 4DPXA 1NZ0A 1BKNA 4X64I 4DPTA 5IWAE 3V5RA 1H7SA 4JI0E 2AJ4A 4LF6E 1MU5A 4WUCA 4HXZA 2UXDI 4X66I 4DR3E 1J5EI 4HYMA 1HR0I 4DUYI 4DR2E 2UUCE 2UUAE 4K0KE 2BM1A 1H7UA 2HKJA
chains in the Genus database with same CATH superfamily
3ZZTA 4IZKA 4LF8I 4NXNE 4DR7E 4LFAI 1OYPA 1FKAE 2WNRB 3T1HE 2IERA 2NN6C 4MDTA 2OI2A 5ELWA 5DNXA 5LMNE 1ZM4A 4GKKI 1XNQE 2O1TA 2BR2A 3T1YE 1N34I 4HACB 1I94E 1IBMI 3PYGA 3PYFA 2HFSA 4XTJA 4IZJD 1XMOI 4FW6A 1DARA 2PNMA 2WP8A 3ZKDA 4JI3E 1NHHA 2ZM6E 2BA1G 4JI7I 4LF4I 4JI5E 4LCFA 4NBQA 4DV3E 4OX9I 2JEBB 1IBKE 4USKA 2XEXA 5FWKA 1XMQI 4M1KA 1QZRA 2PO2B 5K36A 4JV5I 1RHYA 2UXBI 4YHHE 1PIEA 4IFDE 1YH8A 2Q2EB 4DV1E 4X62I 2UUBI 2DEIA 4NXME 4X62E 2UUBE 3LPSA 4LCGA 3PYEA 4GKJE 4DV0I 5A2QC 1PKPA 2UU9E 2CG9A 3ZZUA 5LMUI 3HKMA 1B63A 1HNXE 2IESA 2ZITA 4Z7CA 4IFDC 4DV6I 4AQYI 1EI1A 2UXCE 3JAMC 1ELOA 3P76A 3D4JA 4LFAE 1KKHA 2HKEA 5DROA 1D6TA 4U3DA 1N36E 1UDSA 4MYTA 1N36I 4DV7E 2GQ0A 2BM0A 4DV7I 4USMA 4J3DA 4LF6I 4DR6E 1OYSA 2E1RA 3WU6A 1IBLI 5C0XE 3J80Q 1YHCA 4Z7YA 4LPFA 2PNLA 3HULA 5IWAI 5DRQA 4LOMA 4DV5E 4B3ME 1N33E 5FLXC 2VQEE 2UXBE 2UXCI 4X65I 2Z5EA 1RREA 4NXMI 4JI7E 1Z5CA 4MU0A 2PO1A 4DPWA 2PNZA 1WUUA 3B4TA 3PRYA 4HY1A 4N3OA 2V2QA 4DV2E 2O1WA 2NN6B 1FI4A 1Z0CA 2JE6B 1HNZI 2HFUA 2V34A 1N34E 5GMEA 4DU7A 2NN6F 4DR1I 2NN6A 4LFBE 5K36D 4LFBI 4OO1D 3Q1QA 1Y4UA 1R6MA 4LF4E 2VESA 2V2ZA 3HJCA 4ED4A 4JI3I 4RPFA 2A2CA 4DV4E 4AIMA 1Z0BA 4B3RI 1FWKA 1N32E 2Z5CA 2BA1D 1HNZE 3V2UC 3ZZ0A 2F4VE 4JI8I 3M85G 4GKKE 2BV3A 1ZXNA 4X65E 4R1FA 3J81Q 4FWHA 1E3PA 1E3HA 4DR5I 4BA1B 1ZM9A 5JEAD 2CZ9A 4JI0I 3K1JA 2PO0B 2JE6A 1EA6A 4DR6I 4OKGA 2C39A 4WUDA 1IBLE 1UDNA 3QT5A 4FW4A 2PO1B 2JT2A 3KRNA 5BR8I 3B78A 1Z59A 1Y4SA 4MQYA 4BA1A 4JI8E 1Z0WA 3WU3A 4DV2I 2CVEA 4FW3A 4P7AA 3GCMA 5EKWA 4HACA 2VQFI 4OO1F 4DPYA 5DRPA 5K36F 4OZEA 1HNWI 2PO2A 1MX0A 2ZM6I 1N0VC 3F0NA 4GQUA 4OO1A 3CDIA 2R3VA 3J7AG 3M7NG 1N32I 5L3JA 5JEAE 2VQEI 5IT9C 2WNRA 3H4LA 4IFDA 1USVA 2F1DA 2VQFE 1A6FA 2J7KA 3CWVA 4ISAA 2V8PA 4DR4I 4DR1E 2NN6D 5EL9A 4LCHA 5DRRA 4DR7I 1VI7A 4DUZI 1UDQA 5K36E 4OO1B 1UEKA 1MG7A 1OYRA 4DV3I 4OX9E 5K36B 1N33I 4UT4A 2BR2B 2LJPA 3QT8A 4K0KI 4U3BA 1P42A 4IZKB 3Q6NA 1Z0GA 1Y6ZA 3L7ZA 1XMOE 5JEAA 1I94I 1IBME 5LL6R 1Z0EA 3T1HI 1USUA 4MU1A 4NXNI 1NHJA 4YY3I 4LF7I 4OO1C 3J7AM 4QNKA 3K85A 5A2QQ 5K36C 4JI1I 3OTOE 4WUBA 5LMNI 4FWGA 3OTOI 4B3SI 5LMUE 1HR0E 1ZM3A 2F4VI 5IT9Q 1HNXI 2JEAA 4KHPE 3GONA 5C0XA 2VF3A 3NZKA 3QT7A 4DR4E 3JAMQ 4DV6E 1NHIA 4DV1I 1FNMA 1KIJA 2ZBKB 4AQYE 1U2RA 4JI1E 4DR5E 2WP8B 4B3RE 3H1CA 2PO0A 3ZM7A 2JEBA 3U1YA 1Z5AA 4KHPI 4DPUA 1Z0VA 2CGEA 2WW4A 4UTGA 2C38A 4JI6E 4LF9I 3K17A 3M7ND 3PYDA 2A2DA 2BA0D 4EMDA 1ZXMA 4IFDD 4IS9A 1KVKA 1XNRI 1PVGA 4YY3E 4LF7E 3ZKBA 4FN5A 4AIDA 3GMEA 3P06A 4X64E 1RR9A 4DV0E 3U1KA 4DXLA 1XMQE 2NN6E 5GMDA 2NPFA 1K47A 4PU9A 4URLA 4QNJA 4YHHI 4JI6I 5JEAB 4LF9E 4MU4A 2Z5CB 2O1VA 1B62A 4I3HA 3B82A 2HK3A 4MYUA 1Z5BA 1OJ4A 1S4EA 2IOPA 2DEJA 2C37B 3P3EA 4DV5I 4B3MI 4DUYE 4DR2I 2UUCI 4JI4E 5DNLA 5JEAC 4IZJB 2UUAI 1XXEA 4JYAE 1XNQI 4MU3A 2V2VA 3T1YI 4LFCI 4LF8E 2AE8A 2UXDE 1J5EE 4B3TI 1FJGI 5C0XF 4X66E 4DR3I 4BA2A 4FW9A 4AM3A 1S16A 2EFGA 1R6LA 4JYAI 3DD6A 1FWLA 4B3TE 1N0UA 1FJGE 2X7IA 2IOQA 4LFCE 3UHMA 3PS3A 1Y60A 4GKJI 4DUZE 3M85D 3GLLA 2UU9I 4ZVIA 2HHHE 4P52A 5FLXQ 4B3SE 1H74A 4JI2E 2X36A 3P3CA 3B8HA 2Z5BA 1VISA 1ZM2A 4JV5E 2HK2A 4JG4A 3WU4A 3LTOA 1H72C 3WU5A 1XNRE 2JEAB 4DV4I 5JEAF 4LF5E 4IFDF 2E5LE 1IBKI 4FW5A 3M6AA 2E5LI 4JI2I 3L7ZB 4JI4I 3J80C 4IZJA 2HHHI 4IFDB 2GO3A 3QT6A 4FWDA 4PRVA 1HK7A 2C39B 1KTVA 2O1UA 4OO1E 4KQVA 3PS1A 1Y5YA 2J65A 1UDOA 2R42A 1XHKA 4LF5I 4PRXA 2O3ZA 3LNUA 4JI5I 1HNWE 3J81C 5BR8E 4DU8A 1Z0TA 3Q6MA 4DPXA 2GS8A 1H73A 1NZ0A 1BKNA 4X64I 5C0XB 4DPTA 5IWAE 3CDJA 3V5RA 2PNZB 2BA0G 1H7SA 4JI0E 2AJ4A 3PS2A 4LF6E 1MU5A 4WUCA 4HXZA 3P3GA 2UXDI 2C37A 4X66I 4DR3E 1J5EI 5C0XC 4HYMA 2C38B 2GO4A 4BA2B 1HR0I 4FW7A 4DUYI 4DR2E 2UUCE 2UUAE 4K0KE 2Z5BB 5C0XD 2BM1A 1H7UA 2HKJA
chains in the Genus database with same CATH topology
3ZZTA 4IZKA 4LF8I 4NXNE 4DR7E 4LFAI 1FKAE 3T1HE 2OI2A 5LMNE 1ZM4A 4GKKI 1XNQE 2O1TA 3T1YE 1N34I 4HACB 1I94E 1IBMI 3PYGA 3PYFA 2HFSA 4XTJA 4IZJD 1XMOI 1DARA 2PNMA 3ZKDA 4JI3E 1NHHA 2ZM6E 4JI7I 4LF4I 4JI5E 4DV3E 4OX9I 1IBKE 4USKA 2XEXA 5FWKA 1XMQI 4M1KA 1QZRA 4JV5I 2UXBI 4YHHE 1PIEA 2Q2EB 4DV1E 4X62I 2UUBI 2DEIA 4NXME 4X62E 2UUBE 3LPSA 3PYEA 4GKJE 4DV0I 5A2QC 1PKPA 2UU9E 2CG9A 3ZZUA 5LMUI 1B63A 1HNXE 2ZITA 4Z7CA 4DV6I 4AQYI 1EI1A 2UXCE 3JAMC 1ELOA 3D4JA 4LFAE 1KKHA 2HKEA 1D6TA 1N36E 4MYTA 1N36I 4DV7E 2GQ0A 2BM0A 4DV7I 4USMA 4LF6I 4DR6E 2E1RA 3WU6A 1IBLI 3J80Q 4Z7YA 2PNLA 3HULA 5IWAI 4DV5E 4B3ME 1N33E 5FLXC 2VQEE 2UXBE 2UXCI 4X65I 2Z5EA 1RREA 4NXMI 4JI7E 1Z5CA 4DPWA 1WUUA 3PRYA 4HY1A 4N3OA 2V2QA 4DV2E 2O1WA 1FI4A 1Z0CA 1HNZI 2HFUA 2V34A 1N34E 5GMEA 4DU7A 4DR1I 4LFBE 4LFBI 3Q1QA 1Y4UA 4LF4E 2V2ZA 3HJCA 4ED4A 4JI3I 4RPFA 2A2CA 4DV4E 1Z0BA 4B3RI 1FWKA 1N32E 2Z5CA 1HNZE 3V2UC 3ZZ0A 2F4VE 4JI8I 4GKKE 2BV3A 1ZXNA 4X65E 4R1FA 3J81Q 4FWHA 4DR5I 1ZM9A 2CZ9A 4JI0I 3K1JA 1EA6A 4DR6I 4WUDA 1IBLE 3QT5A 5BR8I 3B78A 1Z59A 1Y4SA 4JI8E 1Z0WA 3WU3A 4DV2I 4P7AA 4HACA 2VQFI 4DPYA 1HNWI 1MX0A 2ZM6I 1N0VC 3F0NA 2R3VA 3J7AG 1N32I 5L3JA 2VQEI 5IT9C 3H4LA 1USVA 2VQFE 1A6FA 2J7KA 3CWVA 2V8PA 4DR4I 4DR1E 4DR7I 4DUZI 1UEKA 1MG7A 4DV3I 4OX9E 1N33I 4UT4A 2LJPA 3QT8A 4K0KI 4IZKB 3Q6NA 1Z0GA 1Y6ZA 1XMOE 1I94I 1IBME 5LL6R 1Z0EA 3T1HI 1USUA 4NXNI 1NHJA 4YY3I 4LF7I 3J7AM 3K85A 5A2QQ 4JI1I 3OTOE 4WUBA 5LMNI 4FWGA 3OTOI 4B3SI 5LMUE 1HR0E 1ZM3A 2F4VI 5IT9Q 1HNXI 4KHPE 3GONA 2VF3A 3QT7A 4DR4E 3JAMQ 4DV6E 1NHIA 4DV1I 1FNMA 1KIJA 2ZBKB 4AQYE 1U2RA 4JI1E 4DR5E 4B3RE 3ZM7A 4KHPI 1Z5AA 4DPUA 1Z0VA 2CGEA 2WW4A 4UTGA 4JI6E 4LF9I 3K17A 3PYDA 2A2DA 4EMDA 1ZXMA 1XNRI 1KVKA 1PVGA 4YY3E 4LF7E 3ZKBA 4FN5A 4X64E 3P06A 1RR9A 4DV0E 4DXLA 1XMQE 5GMDA 2NPFA 1K47A 4PU9A 4URLA 4YHHI 4JI6I 4LF9E 2Z5CB 2O1VA 1B62A 4I3HA 3B82A 2HK3A 4MYUA 1Z5BA 1OJ4A 1S4EA 2IOPA 2DEJA 4DV5I 4B3MI 4DUYE 4DR2I 2UUCI 4JI4E 4IZJB 2UUAI 4JYAE 1XNQI 2V2VA 3T1YI 4LFCI 4LF8E 2UXDE 1J5EE 4B3TI 1FJGI 4X66E 4DR3I 4FW9A 1S16A 2EFGA 4JYAI 1FWLA 4B3TE 1N0UA 1FJGE 2X7IA 2IOQA 4LFCE 4GKJI 4DUZE 2UU9I 4ZVIA 2HHHE 4P52A 5FLXQ 4B3SE 1H74A 4JI2E 2X36A 3B8HA 2Z5BA 1VISA 1ZM2A 4JV5E 2HK2A 4JG4A 3WU4A 3LTOA 1H72C 3WU5A 1XNRE 4DV4I 4LF5E 2E5LE 1IBKI 4JI2I 3M6AA 2E5LI 4JI4I 3J80C 4IZJA 2HHHI 3QT6A 4FWDA 4PRVA 1HK7A 1KTVA 2O1UA 4KQVA 2R42A 1XHKA 4LF5I 4PRXA 4JI5I 3LNUA 1HNWE 3J81C 5BR8E 4DU8A 1Z0TA 3Q6MA 2GS8A 1H73A 4DPXA 1NZ0A 1BKNA 4X64I 4DPTA 5IWAE 3V5RA 1H7SA 4JI0E 2AJ4A 4LF6E 1MU5A 4WUCA 4HXZA 2UXDI 4X66I 4DR3E 1J5EI 4HYMA 1HR0I 4DUYI 4DR2E 2UUCE 2UUAE 4K0KE 2Z5BB 2BM1A 1H7UA 2HKJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZZT A;  4LF8 I;  4NXN E;  4DR7 E;  4LFA I;  1FKA E;  3T1H E;  2OI2 A;  5LMN E;  1ZM4 A;  4GKK I;  1XNQ E;  3T1Y E;  1N34 I;  4HAC B;  1I94 E;  1IBM I;  3PYG A;  3PYF A;  2HFS A;  4XTJ A;  1XMO I;  1DAR A;  3ZKD A;  4JI3 E;  1NHH A;  2ZM6 E;  4JI7 I;  4LF4 I;  4JI5 E;  4DV3 E;  4OX9 I;  1IBK E;  4USK A;  2XEX A;  1XMQ I;  4M1K A;  1QZR A;  4JV5 I;  2UXB I;  4YHH E;  1PIE A;  2Q2E B;  4DV1 E;  4X62 I;  2UUB I;  2DEI A;  4NXM E;  4X62 E;  2UUB E;  3LPS A;  3PYE A;  4GKJ E;  4DV0 I;  5A2Q C;  1PKP A;  2UU9 E;  3ZZU A;  5LMU I;  1B63 A;  1HNX E;  2ZIT A;  4Z7C A;  4DV6 I;  4AQY I;  1EI1 A;  2UXC E;  3JAM C;  1ELO A;  3D4J A;  4LFA E;  1KKH A;  2HKE A;  1D6T A;  1N36 E;  4MYT A;  1N36 I;  4DV7 E;  2BM0 A;  4DV7 I;  4USM A;  4LF6 I;  4DR6 E;  2E1R A;  3WU6 A;  1IBL I;  3J80 Q;  4Z7Y A;  5IWA I;  3HUL A;  4DV5 E;  4B3M E;  1N33 E;  5FLX C;  2VQE E;  2UXB E;  2UXC I;  4X65 I;  1RRE A;  4NXM I;  4JI7 E;  1Z5C A;  4DPW A;  1WUU A;  4HY1 A;  2V2Q A;  4DV2 E;  1FI4 A;  1Z0C A;  1HNZ I;  2HFU A;  2V34 A;  1N34 E;  5GME A;  4DU7 A;  4DR1 I;  4LFB E;  4LFB I;  3Q1Q A;  4LF4 E;  2V2Z A;  4ED4 A;  4JI3 I;  4RPF A;  2A2C A;  4DV4 E;  1Z0B A;  4B3R I;  1FWK A;  1N32 E;  1HNZ E;  3V2U C;  3ZZ0 A;  2F4V E;  4JI8 I;  4GKK E;  2BV3 A;  1ZXN A;  4X65 E;  4R1F A;  3J81 Q;  4FWH A;  4DR5 I;  1ZM9 A;  2CZ9 A;  4JI0 I;  3K1J A;  1EA6 A;  4DR6 I;  4WUD A;  1IBL E;  3QT5 A;  5BR8 I;  3B78 A;  1Z59 A;  4JI8 E;  1Z0W A;  3WU3 A;  4DV2 I;  4P7A A;  4HAC A;  2VQF I;  4DPY A;  1HNW I;  1MX0 A;  2ZM6 I;  1N0V C;  3F0N A;  2R3V A;  3J7A G;  1N32 I;  5L3J A;  2VQE I;  5IT9 C;  3H4L A;  2VQF E;  1A6F A;  2J7K A;  3CWV A;  2V8P A;  4DR4 I;  4DR1 E;  4DR7 I;  4DUZ I;  1UEK A;  1MG7 A;  4DV3 I;  4OX9 E;  1N33 I;  4UT4 A;  2LJP A;  3QT8 A;  4K0K I;  1Z0G A;  1XMO E;  1I94 I;  1IBM E;  5LL6 R;  1Z0E A;  3T1H I;  4NXN I;  1NHJ A;  4YY3 I;  4LF7 I;  3J7A M;  5A2Q Q;  4JI1 I;  3OTO E;  4WUB A;  5LMN I;  4FWG A;  3OTO I;  4B3S I;  5LMU E;  1HR0 E;  1ZM3 A;  2F4V I;  5IT9 Q;  1HNX I;  4KHP E;  3GON A;  2VF3 A;  3QT7 A;  4DR4 E;  3JAM Q;  4DV6 E;  1NHI A;  4DV1 I;  1FNM A;  1KIJ A;  2ZBK B;  4AQY E;  1U2R A;  4JI1 E;  4DR5 E;  4B3R E;  3ZM7 A;  4KHP I;  1Z5A A;  4DPU A;  1Z0V A;  2WW4 A;  4UTG A;  4JI6 E;  4LF9 I;  3K17 A;  3PYD A;  2A2D A;  4EMD A;  1ZXM A;  1XNR I;  1KVK A;  1PVG A;  4YY3 E;  4LF7 E;  3ZKB A;  4FN5 A;  4X64 E;  1RR9 A;  4DV0 E;  4DXL A;  1XMQ E;  5GMD A;  2NPF A;  1K47 A;  4PU9 A;  4URL A;  4YHH I;  4JI6 I;  4LF9 E;  1B62 A;  4I3H A;  3B82 A;  2HK3 A;  4MYU A;  1Z5B A;  1OJ4 A;  1S4E A;  2DEJ A;  4DV5 I;  4B3M I;  4DUY E;  4DR2 I;  2UUC I;  4JI4 E;  2UUA I;  4JYA E;  1XNQ I;  2V2V A;  3T1Y I;  4LFC I;  4LF8 E;  2UXD E;  1J5E E;  4B3T I;  1FJG I;  4X66 E;  4DR3 I;  4FW9 A;  1S16 A;  2EFG A;  4JYA I;  1FWL A;  4B3T E;  1N0U A;  1FJG E;  2X7I A;  4LFC E;  4GKJ I;  4DUZ E;  2UU9 I;  4ZVI A;  2HHH E;  4P52 A;  5FLX Q;  4B3S E;  1H74 A;  4JI2 E;  2X36 A;  3B8H A;  1VIS A;  1ZM2 A;  4JV5 E;  2HK2 A;  4JG4 A;  3WU4 A;  3LTO A;  1H72 C;  3WU5 A;  1XNR E;  4DV4 I;  4LF5 E;  2E5L E;  1IBK I;  4JI2 I;  3M6A A;  2E5L I;  4JI4 I;  3J80 C;  2HHH I;  3QT6 A;  4FWD A;  4PRV A;  1KTV A;  4KQV A;  2R42 A;  1XHK A;  4LF5 I;  4PRX A;  4JI5 I;  3LNU A;  1HNW E;  3J81 C;  5BR8 E;  4DU8 A;  1Z0T A;  2GS8 A;  1H73 A;  4DPX A;  1NZ0 A;  1BKN A;  4X64 I;  4DPT A;  5IWA E;  3V5R A;  1H7S A;  4JI0 E;  2AJ4 A;  4LF6 E;  1MU5 A;  4WUC A;  4HXZ A;  2UXD I;  4X66 I;  4DR3 E;  1J5E I;  4HYM A;  1HR0 I;  4DUY I;  4DR2 E;  2UUC E;  2UUA E;  4K0K E;  2BM1 A;  1H7U A;  2HKJ A; 
#chains in the Genus database with same CATH topology
 3ZZT A;  4IZK A;  4LF8 I;  4NXN E;  4DR7 E;  4LFA I;  1OYP A;  1FKA E;  2WNR B;  3T1H E;  2IER A;  2NN6 C;  4MDT A;  2OI2 A;  5ELW A;  5DNX A;  5LMN E;  1ZM4 A;  4GKK I;  1XNQ E;  2O1T A;  2BR2 A;  3T1Y E;  1N34 I;  4HAC B;  1I94 E;  1IBM I;  3PYG A;  3PYF A;  2HFS A;  4XTJ A;  4IZJ D;  1XMO I;  4FW6 A;  1DAR A;  2PNM A;  2WP8 A;  3ZKD A;  4JI3 E;  1NHH A;  2ZM6 E;  2BA1 G;  4JI7 I;  4LF4 I;  4JI5 E;  4LCF A;  4NBQ A;  4DV3 E;  4OX9 I;  2JEB B;  1IBK E;  4USK A;  2XEX A;  5FWK A;  1XMQ I;  4M1K A;  1QZR A;  2PO2 B;  5K36 A;  4JV5 I;  1RHY A;  2UXB I;  4YHH E;  1PIE A;  4IFD E;  1YH8 A;  2Q2E B;  4DV1 E;  4X62 I;  2UUB I;  2DEI A;  4NXM E;  4X62 E;  2UUB E;  3LPS A;  4LCG A;  3PYE A;  4GKJ E;  4DV0 I;  5A2Q C;  1PKP A;  2UU9 E;  2CG9 A;  3ZZU A;  5LMU I;  3HKM A;  1B63 A;  1HNX E;  2IES A;  2ZIT A;  4Z7C A;  4IFD C;  4DV6 I;  4AQY I;  1EI1 A;  2UXC E;  3JAM C;  1ELO A;  3P76 A;  3D4J A;  4LFA E;  1KKH A;  2HKE A;  5DRO A;  1D6T A;  4U3D A;  1N36 E;  1UDS A;  4MYT A;  1N36 I;  4DV7 E;  2GQ0 A;  2BM0 A;  4DV7 I;  4USM A;  4J3D A;  4LF6 I;  4DR6 E;  1OYS A;  2E1R A;  3WU6 A;  1IBL I;  5C0X E;  3J80 Q;  1YHC A;  4Z7Y A;  4LPF A;  2PNL A;  3HUL A;  5IWA I;  5DRQ A;  4LOM A;  4DV5 E;  4B3M E;  1N33 E;  5FLX C;  2VQE E;  2UXB E;  2UXC I;  4X65 I;  2Z5E A;  1RRE A;  4NXM I;  4JI7 E;  1Z5C A;  4MU0 A;  2PO1 A;  4DPW A;  2PNZ A;  1WUU A;  3B4T A;  3PRY A;  4HY1 A;  4N3O A;  2V2Q A;  4DV2 E;  2O1W A;  2NN6 B;  1FI4 A;  1Z0C A;  2JE6 B;  1HNZ I;  2HFU A;  2V34 A;  1N34 E;  5GME A;  4DU7 A;  2NN6 F;  4DR1 I;  2NN6 A;  4LFB E;  5K36 D;  4LFB I;  4OO1 D;  3Q1Q A;  1Y4U A;  1R6M A;  4LF4 E;  2VES A;  2V2Z A;  3HJC A;  4ED4 A;  4JI3 I;  4RPF A;  2A2C A;  4DV4 E;  4AIM A;  1Z0B A;  4B3R I;  1FWK A;  1N32 E;  2Z5C A;  2BA1 D;  1HNZ E;  3V2U C;  3ZZ0 A;  2F4V E;  4JI8 I;  3M85 G;  4GKK E;  2BV3 A;  1ZXN A;  4X65 E;  4R1F A;  3J81 Q;  4FWH A;  1E3P A;  1E3H A;  4DR5 I;  4BA1 B;  1ZM9 A;  5JEA D;  2CZ9 A;  4JI0 I;  3K1J A;  2PO0 B;  2JE6 A;  1EA6 A;  4DR6 I;  4OKG A;  2C39 A;  4WUD A;  1IBL E;  1UDN A;  3QT5 A;  4FW4 A;  2PO1 B;  2JT2 A;  3KRN A;  5BR8 I;  3B78 A;  1Z59 A;  1Y4S A;  4MQY A;  4BA1 A;  4JI8 E;  1Z0W A;  3WU3 A;  4DV2 I;  2CVE A;  4FW3 A;  4P7A A;  3GCM A;  5EKW A;  4HAC A;  2VQF I;  4OO1 F;  4DPY A;  5DRP A;  5K36 F;  4OZE A;  1HNW I;  2PO2 A;  1MX0 A;  2ZM6 I;  1N0V C;  3F0N A;  4GQU A;  4OO1 A;  3CDI A;  2R3V A;  3J7A G;  3M7N G;  1N32 I;  5L3J A;  5JEA E;  2VQE I;  5IT9 C;  2WNR A;  3H4L A;  4IFD A;  1USV A;  2F1D A;  2VQF E;  1A6F A;  2J7K A;  3CWV A;  4ISA A;  2V8P A;  4DR4 I;  4DR1 E;  2NN6 D;  5EL9 A;  4LCH A;  5DRR A;  4DR7 I;  1VI7 A;  4DUZ I;  1UDQ A;  5K36 E;  4OO1 B;  1UEK A;  1MG7 A;  1OYR A;  4DV3 I;  4OX9 E;  5K36 B;  1N33 I;  4UT4 A;  2BR2 B;  2LJP A;  3QT8 A;  4K0K I;  4U3B A;  1P42 A;  4IZK B;  3Q6N A;  1Z0G A;  1Y6Z A;  3L7Z A;  1XMO E;  5JEA A;  1I94 I;  1IBM E;  5LL6 R;  1Z0E A;  3T1H I;  1USU A;  4MU1 A;  4NXN I;  1NHJ A;  4YY3 I;  4LF7 I;  4OO1 C;  3J7A M;  4QNK A;  3K85 A;  5A2Q Q;  5K36 C;  4JI1 I;  3OTO E;  4WUB A;  5LMN I;  4FWG A;  3OTO I;  4B3S I;  5LMU E;  1HR0 E;  1ZM3 A;  2F4V I;  5IT9 Q;  1HNX I;  2JEA A;  4KHP E;  3GON A;  5C0X A;  2VF3 A;  3NZK A;  3QT7 A;  4DR4 E;  3JAM Q;  4DV6 E;  1NHI A;  4DV1 I;  1FNM A;  1KIJ A;  2ZBK B;  4AQY E;  1U2R A;  4JI1 E;  4DR5 E;  2WP8 B;  4B3R E;  3H1C A;  2PO0 A;  3ZM7 A;  2JEB A;  3U1Y A;  1Z5A A;  4KHP I;  4DPU A;  1Z0V A;  2CGE A;  2WW4 A;  4UTG A;  2C38 A;  4JI6 E;  4LF9 I;  3K17 A;  3M7N D;  3PYD A;  2A2D A;  2BA0 D;  4EMD A;  1ZXM A;  4IFD D;  4IS9 A;  1KVK A;  1XNR I;  1PVG A;  4YY3 E;  4LF7 E;  3ZKB A;  4FN5 A;  4AID A;  3GME A;  3P06 A;  4X64 E;  1RR9 A;  4DV0 E;  3U1K A;  4DXL A;  1XMQ E;  2NN6 E;  5GMD A;  2NPF A;  1K47 A;  4PU9 A;  4URL A;  4QNJ A;  4YHH I;  4JI6 I;  5JEA B;  4LF9 E;  4MU4 A;  2Z5C B;  2O1V A;  1B62 A;  4I3H A;  3B82 A;  2HK3 A;  4MYU A;  1Z5B A;  1OJ4 A;  1S4E A;  2IOP A;  2DEJ A;  2C37 B;  3P3E A;  4DV5 I;  4B3M I;  4DUY E;  4DR2 I;  2UUC I;  4JI4 E;  5DNL A;  5JEA C;  4IZJ B;  2UUA I;  1XXE A;  4JYA E;  1XNQ I;  4MU3 A;  2V2V A;  3T1Y I;  4LFC I;  4LF8 E;  2AE8 A;  2UXD E;  1J5E E;  4B3T I;  1FJG I;  5C0X F;  4X66 E;  4DR3 I;  4BA2 A;  4FW9 A;  4AM3 A;  1S16 A;  2EFG A;  1R6L A;  4JYA I;  3DD6 A;  1FWL A;  4B3T E;  1N0U A;  1FJG E;  2X7I A;  2IOQ A;  4LFC E;  3UHM A;  3PS3 A;  1Y60 A;  4GKJ I;  4DUZ E;  3M85 D;  3GLL A;  2UU9 I;  4ZVI A;  2HHH E;  4P52 A;  5FLX Q;  4B3S E;  1H74 A;  4JI2 E;  2X36 A;  3P3C A;  3B8H A;  2Z5B A;  1VIS A;  1ZM2 A;  4JV5 E;  2HK2 A;  4JG4 A;  3WU4 A;  3LTO A;  1H72 C;  3WU5 A;  1XNR E;  2JEA B;  4DV4 I;  5JEA F;  4LF5 E;  4IFD F;  2E5L E;  1IBK I;  4FW5 A;  3M6A A;  2E5L I;  4JI2 I;  3L7Z B;  4JI4 I;  3J80 C;  4IZJ A;  2HHH I;  4IFD B;  2GO3 A;  3QT6 A;  4FWD A;  4PRV A;  1HK7 A;  2C39 B;  1KTV A;  2O1U A;  4OO1 E;  4KQV A;  3PS1 A;  1Y5Y A;  2J65 A;  1UDO A;  2R42 A;  1XHK A;  4LF5 I;  4PRX A;  2O3Z A;  3LNU A;  4JI5 I;  1HNW E;  3J81 C;  5BR8 E;  4DU8 A;  1Z0T A;  3Q6M A;  4DPX A;  2GS8 A;  1H73 A;  1NZ0 A;  1BKN A;  4X64 I;  5C0X B;  4DPT A;  5IWA E;  3CDJ A;  3V5R A;  2PNZ B;  2BA0 G;  1H7S A;  4JI0 E;  2AJ4 A;  3PS2 A;  4LF6 E;  1MU5 A;  4WUC A;  4HXZ A;  3P3G A;  2UXD I;  2C37 A;  4X66 I;  4DR3 E;  1J5E I;  5C0X C;  4HYM A;  2C38 B;  2GO4 A;  4BA2 B;  1HR0 I;  4FW7 A;  4DUY I;  4DR2 E;  2UUC E;  2UUA E;  4K0K E;  2Z5B B;  5C0X D;  2BM1 A;  1H7U A;  2HKJ A; 
#chains in the Genus database with same CATH homology
 3ZZT A;  4IZK A;  4LF8 I;  4NXN E;  4DR7 E;  4LFA I;  1FKA E;  3T1H E;  2OI2 A;  5LMN E;  1ZM4 A;  4GKK I;  1XNQ E;  2O1T A;  3T1Y E;  1N34 I;  4HAC B;  1I94 E;  1IBM I;  3PYG A;  3PYF A;  2HFS A;  4XTJ A;  4IZJ D;  1XMO I;  1DAR A;  2PNM A;  3ZKD A;  4JI3 E;  1NHH A;  2ZM6 E;  4JI7 I;  4LF4 I;  4JI5 E;  4DV3 E;  4OX9 I;  1IBK E;  4USK A;  2XEX A;  5FWK A;  1XMQ I;  4M1K A;  1QZR A;  4JV5 I;  2UXB I;  4YHH E;  1PIE A;  2Q2E B;  4DV1 E;  4X62 I;  2UUB I;  2DEI A;  4NXM E;  4X62 E;  2UUB E;  3LPS A;  3PYE A;  4GKJ E;  4DV0 I;  5A2Q C;  1PKP A;  2UU9 E;  2CG9 A;  3ZZU A;  5LMU I;  1B63 A;  1HNX E;  2ZIT A;  4Z7C A;  4DV6 I;  4AQY I;  1EI1 A;  2UXC E;  3JAM C;  1ELO A;  3D4J A;  4LFA E;  1KKH A;  2HKE A;  1D6T A;  1N36 E;  4MYT A;  1N36 I;  4DV7 E;  2GQ0 A;  2BM0 A;  4DV7 I;  4USM A;  4LF6 I;  4DR6 E;  2E1R A;  3WU6 A;  1IBL I;  3J80 Q;  4Z7Y A;  2PNL A;  3HUL A;  5IWA I;  4DV5 E;  4B3M E;  1N33 E;  5FLX C;  2VQE E;  2UXB E;  2UXC I;  4X65 I;  2Z5E A;  1RRE A;  4NXM I;  4JI7 E;  1Z5C A;  4DPW A;  1WUU A;  3PRY A;  4HY1 A;  4N3O A;  2V2Q A;  4DV2 E;  2O1W A;  1FI4 A;  1Z0C A;  1HNZ I;  2HFU A;  2V34 A;  1N34 E;  5GME A;  4DU7 A;  4DR1 I;  4LFB E;  4LFB I;  3Q1Q A;  1Y4U A;  4LF4 E;  2V2Z A;  3HJC A;  4ED4 A;  4JI3 I;  4RPF A;  2A2C A;  4DV4 E;  1Z0B A;  4B3R I;  1FWK A;  1N32 E;  2Z5C A;  1HNZ E;  3V2U C;  3ZZ0 A;  2F4V E;  4JI8 I;  4GKK E;  2BV3 A;  1ZXN A;  4X65 E;  4R1F A;  3J81 Q;  4FWH A;  4DR5 I;  1ZM9 A;  2CZ9 A;  4JI0 I;  3K1J A;  1EA6 A;  4DR6 I;  4WUD A;  1IBL E;  3QT5 A;  5BR8 I;  3B78 A;  1Z59 A;  1Y4S A;  4JI8 E;  1Z0W A;  3WU3 A;  4DV2 I;  4P7A A;  4HAC A;  2VQF I;  4DPY A;  1HNW I;  1MX0 A;  2ZM6 I;  1N0V C;  3F0N A;  2R3V A;  3J7A G;  1N32 I;  5L3J A;  2VQE I;  5IT9 C;  3H4L A;  1USV A;  2VQF E;  1A6F A;  2J7K A;  3CWV A;  2V8P A;  4DR4 I;  4DR1 E;  4DR7 I;  4DUZ I;  1UEK A;  1MG7 A;  4DV3 I;  4OX9 E;  1N33 I;  4UT4 A;  2LJP A;  3QT8 A;  4K0K I;  4IZK B;  3Q6N A;  1Z0G A;  1Y6Z A;  1XMO E;  1I94 I;  1IBM E;  5LL6 R;  1Z0E A;  3T1H I;  1USU A;  4NXN I;  1NHJ A;  4YY3 I;  4LF7 I;  3J7A M;  3K85 A;  5A2Q Q;  4JI1 I;  3OTO E;  4WUB A;  5LMN I;  4FWG A;  3OTO I;  4B3S I;  5LMU E;  1HR0 E;  1ZM3 A;  2F4V I;  5IT9 Q;  1HNX I;  4KHP E;  3GON A;  2VF3 A;  3QT7 A;  4DR4 E;  3JAM Q;  4DV6 E;  1NHI A;  4DV1 I;  1FNM A;  1KIJ A;  2ZBK B;  4AQY E;  1U2R A;  4JI1 E;  4DR5 E;  4B3R E;  3ZM7 A;  4KHP I;  1Z5A A;  4DPU A;  1Z0V A;  2CGE A;  2WW4 A;  4UTG A;  4JI6 E;  4LF9 I;  3K17 A;  3PYD A;  2A2D A;  4EMD A;  1ZXM A;  1XNR I;  1KVK A;  1PVG A;  4YY3 E;  4LF7 E;  3ZKB A;  4FN5 A;  4X64 E;  3P06 A;  1RR9 A;  4DV0 E;  4DXL A;  1XMQ E;  5GMD A;  2NPF A;  1K47 A;  4PU9 A;  4URL A;  4YHH I;  4JI6 I;  4LF9 E;  2Z5C B;  2O1V A;  1B62 A;  4I3H A;  3B82 A;  2HK3 A;  4MYU A;  1Z5B A;  1OJ4 A;  1S4E A;  2IOP A;  2DEJ A;  4DV5 I;  4B3M I;  4DUY E;  4DR2 I;  2UUC I;  4JI4 E;  4IZJ B;  2UUA I;  4JYA E;  1XNQ I;  2V2V A;  3T1Y I;  4LFC I;  4LF8 E;  2UXD E;  1J5E E;  4B3T I;  1FJG I;  4X66 E;  4DR3 I;  4FW9 A;  1S16 A;  2EFG A;  4JYA I;  1FWL A;  4B3T E;  1N0U A;  1FJG E;  2X7I A;  2IOQ A;  4LFC E;  4GKJ I;  4DUZ E;  2UU9 I;  4ZVI A;  2HHH E;  4P52 A;  5FLX Q;  4B3S E;  1H74 A;  4JI2 E;  2X36 A;  3B8H A;  2Z5B A;  1VIS A;  1ZM2 A;  4JV5 E;  2HK2 A;  4JG4 A;  3WU4 A;  3LTO A;  1H72 C;  3WU5 A;  1XNR E;  4DV4 I;  4LF5 E;  2E5L E;  1IBK I;  4JI2 I;  3M6A A;  2E5L I;  4JI4 I;  3J80 C;  4IZJ A;  2HHH I;  3QT6 A;  4FWD A;  4PRV A;  1HK7 A;  1KTV A;  2O1U A;  4KQV A;  2R42 A;  1XHK A;  4LF5 I;  4PRX A;  4JI5 I;  3LNU A;  1HNW E;  3J81 C;  5BR8 E;  4DU8 A;  1Z0T A;  3Q6M A;  2GS8 A;  1H73 A;  4DPX A;  1NZ0 A;  1BKN A;  4X64 I;  4DPT A;  5IWA E;  3V5R A;  1H7S A;  4JI0 E;  2AJ4 A;  4LF6 E;  1MU5 A;  4WUC A;  4HXZ A;  2UXD I;  4X66 I;  4DR3 E;  1J5E I;  4HYM A;  1HR0 I;  4DUY I;  4DR2 E;  2UUC E;  2UUA E;  4K0K E;  2Z5B B;  2BM1 A;  1H7U A;  2HKJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...