4DV5I

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g, bound with streptomycin
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 23
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dv5I00
4DV0I 1A6FA 4GKJE 4LF9E 1BKNA 4LF9I 4LFBE 2A2CA 4DR1E 1I94I 4JI8E 4DR6I 2XEXA 2HHHE 4LFAI 2HK3A 2UXDE 1Z59A 1PIEA 4KHPE 4NXNE 4P7AA 4JI2E 2ZM6E 3V5RA 4FN5A 1IBLE 3PYGA 1HNXE 4WUBA 1H73A 1MG7A 4NXNI 5BR8E 4MYTA 4YY3I 4B3TI 2UXDI 1DARA 4DV2E 3QT7A 4NXME 1XNQE 1B63A 2HHHI 3LNUA 1XNRI 5A2QC 4DR1I 1I94E 2V8PA 3H4LA 3ZM7A 2V2VA 1FJGE 2HKJA 2ZITA 4DV1I 1HNWI 3J81C 5IWAI 3J80Q 2HK2A 2UXCI 5LL6R 1XNRE 4DR5E 4JYAI 2X36A 3K1JA 2UUBI 4JV5E 4B3TE 4LF5E 1N32I 3K17A 1S16A 4JI5I 4JV5I 4JI2I 4LF8I 3LTOA 1XMQE 4LFAE 4DV1E 5GMDA 2UUAI 2AJ4A 4P52A 4JI0E 2E5LI 1MU5A 4PU9A 4DV0E 1H7UA 4NXMI 5A2QQ 2WW4A 3GONA 3QT8A 1KKHA 4DPWA 4ZVIA 4UT4A 1QZRA 4DPYA 1IBKI 4DR5I 3B78A 1Z0CA 5IWAE 1Z0BA 1Z5CA 1S4EA 1IBMI 2UXBE 1K47A 4XTJA 4GKKE 1NHHA 3B8HA 4LFCE 1PKPA 2UUCI 4DPXA 1B62A 3V2UC 2F4VE 1Z0GA 4JI6E 4DUZI 4B3SI 3OTOI 2V2ZA 1HNXI 4DR7E 4DU7A 4ED4A 4DV3E 4JI4E 2BM1A 4JI1I 1KVKA 1N33I 4GKJI 1Z0VA 3JAMQ 4HYMA 4DV4I 1ZXNA 4WUCA 4DPUA 1PVGA 3JAMC 4DV4E 4DR4I 4DPTA 4Z7CA 1N36I 4FWHA 1H72C 4MYUA 3PYEA 4JI4I 3ZZUA 1N34E 1IBLI 4JI3I 4M1KA 1Z5AA 4X66E 1ZM2A 4DR3I 2V2QA 3PYDA 4JG4A 2BM0A 3D4JA 3OTOE 5GMEA 5LMNE 3WU4A 3T1YE 4YHHI 2UU9E 2UUCE 4LF4I 1J5EE 3T1HE 4OX9I 3M6AA 4DV5E 3T1HI 2NPFA 4YHHE 4R1FA 5FLXQ 1H7SA 2A2DA 3CWVA 1ZM9A 2V34A 4I3HA 1KIJA 3WU3A 4DUYE 1IBME 4DR2I 4JI7I 4K0KI 4FW9A 3WU5A 1ELOA 1Z0TA 4B3MI 1N34I 1VISA 4B3SE 2VQEE 3J81Q 4DV7E 1ZM3A 3J80C 4Z7YA 4LF7E 1HR0E 5IT9Q 3QT5A 4WUDA 1J5EI 4DV6I 1RREA 1UEKA 2R3VA 4USMA 1Z0WA 1N33E 1HR0I 2GS8A 2UUAE 4AQYE 1NHJA 1OJ4A 1Z0EA 2HFUA 5LMUI 1FKAE 1KTVA 1NHIA 4X66I 2OI2A 2E1RA 4LF6E 4JI5E 2HFSA 4DUZE 4X65I 4LF5I 1N0UA 1N36E 1D6TA 4RPFA 2UUBE 2VQFI 4B3RI 2DEJA 1EI1A 1WUUA 4URLA 2UXCE 4DV6E 4HY1A 4DV5I 2J7KA 1HNZI 2E5LE 2UU9I 3T1YI 1RR9A 3LPSA 4HACB 4DV3I 4X65E 4DV7I 1NZ0A 4PRXA 4LF6I 4KQVA 4B3ME 4DXLA 1XHKA 1XNQI 4K0KE 5BR8I 4JI6I 3ZKDA 2F4VI 4AQYI 3B82A 1ZXMA 3QT6A 1FWKA 3ZKBA 1HNZE 1HNWE 4OX9E 2CZ9A 3J7AG 4LF4E 2VQFE 4JI0I 4B3RE 1FJGI 1Z5BA 4LFBI 2UXBI 2BV3A 2VQEI 3WU6A 2ZBKB 4HXZA 1XMQI 5IT9C 1MX0A 1N0VC 1IBKE 4LF8E 4DV2I 1FWLA 3ZZTA 2R42A 5L3JA 4FWGA 1ZM4A 4JI7E 1U2RA 1N32E 5FLXC 5LMUE 4X62I 1EA6A 4DUYI 1XMOE 3HULA 1FNMA 2Q2EB 4JYAE 1FI4A 2LJPA 4HACA 4DR4E 4USKA 2X7IA 4DR6E 3PYFA 4JI8I 4GKKI 4LF7I 2HKEA 5LMNI 2DEIA 3ZZ0A 4JI1E 3F0NA 1H74A 4DR3E 4DR7I 4YY3E 4DR2E 2EFGA 3Q1QA 4PRVA 4JI3E 2VF3A 4X64I 1XMOI 4X64E 4DU8A 4FWDA 4X62E 2ZM6I 3J7AM 4KHPI 4EMDA 4LFCI 4UTGA
chains in the Genus database with same CATH superfamily
4DV0I 2C38B 1A6FA 4GKJE 4LF9E 4IZKB 1BKNA 2Z5BA 4LF9I 4LFBE 4IFDE 2A2CA 4DR1E 1I94I 4IFDD 2C37A 4JI8E 4BA2B 2BA1D 4DR6I 2NN6C 2XEXA 2HHHE 3M7NG 4LFAI 2HK3A 4AM3A 2UXDE 1Z59A 1Y60A 4FW5A 4LCGA 2PO1A 1PIEA 4KHPE 4NXNE 4P7AA 4JI2E 2ZM6E 3V5RA 4FN5A 1IBLE 3PYGA 1HNXE 5C0XA 3DD6A 4WUBA 4LOMA 1H73A 1MG7A 4MU4A 4NXNI 5BR8E 4MYTA 3PS2A 4YY3I 4B3TI 2UXDI 3L7ZB 1DARA 4DV2E 3QT7A 4NXME 1XNQE 1B63A 2HHHI 3LNUA 1XNRI 4LPFA 5A2QC 1Y4UA 3GCMA 4DR1I 1I94E 5K36F 2V8PA 3H4LA 5DRPA 3ZM7A 2V2VA 1FJGE 2BA1G 4FW3A 2HKJA 2ZITA 4DV1I 2VESA 1HNWI 3J81C 5IWAI 2Z5EA 3J80Q 2HK2A 5EKWA 2UXCI 5LL6R 1XNRE 4DR5E 4ISAA 5DROA 2X36A 3K1JA 4JYAI 2UUBI 2WNRB 4JV5E 4B3TE 4LF5E 1N32I 3K17A 1S16A 4JI5I 5K36B 3PS3A 4JV5I 4JI2I 4LF8I 4OKGA 3B4TA 3LTOA 1XMQE 4LFAE 2JEBA 2CG9A 1UDQA 4DV1E 2Z5CA 5GMDA 1Y4SA 2UUAI 2AJ4A 4MU0A 1UDNA 2C39A 4P52A 2GO4A 5C0XF 4JI0E 2E5LI 1MU5A 2CVEA 4PU9A 4DV0E 5K36D 3NZKA 1H7UA 4NXMI 5A2QQ 2WW4A 3GONA 3QT8A 4IZJD 1KKHA 4DPWA 4ZVIA 3M85G 4UT4A 1QZRA 1UDOA 4DPYA 1IBKI 4DR5I 5DNXA 3B78A 1Z0CA 5IWAE 1Z0BA 1Z5CA 1S4EA 1IBMI 2UXBE 1K47A 1YHCA 4XTJA 1P42A 4GKKE 3HKMA 1NHHA 2WP8A 3B8HA 4LFCE 1PKPA 2PNZA 2IESA 2JT2A 2UUCI 2C38A 2O1UA 3P06A 4DPXA 4OO1E 1B62A 4MDTA 3UHMA 3V2UC 2F4VE 1Z0GA 2IERA 5JEAC 4JI6E 4DUZI 4B3SI 3OTOI 2V2ZA 1HNXI 4MU3A 4DR7E 4DU7A 4ED4A 2JE6A 4DV3E 4OO1C 4JI4E 1OYSA 2BM1A 4JI1I 1KVKA 1UDSA 1N33I 4GKJI 1Z0VA 5DNLA 3JAMQ 4HYMA 4DV4I 1ZXNA 4FW7A 4WUCA 4DPUA 1PVGA 3JAMC 4DV4E 4DR4I 4DPTA 2F1DA 3Q6NA 4OO1A 4Z7CA 1N36I 4FWHA 2GQ0A 2BR2A 5JEAE 1H72C 4MYUA 1R6MA 3PYEA 4JI4I 3ZZUA 1N34E 1IBLI 4JI3I 4M1KA 2JEAB 1Z5AA 4X66E 4MQYA 1ZM2A 3HJCA 4DR3I 2JE6B 2V2QA 3PYDA 5C0XC 4IZJB 4JG4A 4LCFA 2BM0A 3D4JA 3OTOE 1R6LA 5GMEA 3L7ZA 3Q6MA 2IOQA 5LMNE 3WU4A 3T1YE 4BA2A 4YHHI 2UU9E 2UUCE 3CDJA 4LF4I 1J5EE 3T1HE 4OX9I 3M6AA 4DV5E 4GQUA 2PO0B 3T1HI 4OO1B 2NPFA 4YHHE 5C0XB 4R1FA 4OZEA 1H7SA 5FLXQ 2A2DA 3CWVA 2WP8B 1ZM9A 2NN6F 2V34A 1KIJA 4I3HA 3WU3A 4DUYE 1IBME 1OYRA 4IFDC 4IS9A 3GMEA 4DR2I 4JI7I 4K0KI 4FW9A 3WU5A 1ELOA 1Z0TA 4B3MI 3P3CA 1N34I 1VISA 4QNJA 4B3SE 2VQEE 3J81Q 4DV7E 4OO1F 1ZM3A 3J80C 4Z7YA 2BA0D 4LF7E 2O1VA 4IZKA 1HK7A 1HR0E 5IT9Q 3QT5A 3U1YA 4WUDA 2J65A 1J5EI 4DV6I 1RREA 1UEKA 2R3VA 4USMA 1Z0WA 4J3DA 4OO1D 4MU1A 1N33E 2BA0G 1HR0I 2GS8A 2UUAE 3K85A 4AQYE 1NHJA 1OJ4A 1Z0EA 2HFUA 4FW6A 5LMUI 1FKAE 1KTVA 1NHIA 2PNZB 2JEBB 4X66I 1YH8A 2OI2A 2E1RA 2AE8A 4LF6E 4JI5E 2HFSA 4DUZE 1VI7A 1Y5YA 1RHYA 4X65I 4LF5I 1N0UA 1N36E 3PRYA 1D6TA 4RPFA 2NN6A 2UUBE 2VQFI 4B3RI 2DEJA 4IZJA 1EI1A 4BA1B 1WUUA 4URLA 2UXCE 4DV6E 4HY1A 4DV5I 2J7KA 1HNZI 5DRQA 2E5LE 5JEAD 2UU9I 3T1YI 1RR9A 3LPSA 4HACB 3KRNA 4DV3I 4X65E 4DV7I 2O1WA 1NZ0A 2C39B 4PRXA 4LF6I 4KQVA 4B3ME 4DXLA 2NN6E 1XHKA 1XNQI 4FW4A 4K0KE 4U3DA 5BR8I 4JI6I 3ZKDA 2F4VI 3P76A 2O3ZA 3PS1A 2PO2B 3B82A 4AQYI 1ZXMA 3QT6A 3U1KA 1FWKA 2CGEA 1OYPA 2NN6D 3ZKBA 5EL9A 1HNZE 1USVA 2PO0A 3M85D 2IOPA 4AIMA 4IFDF 1HNWE 5C0XE 4OX9E 2CZ9A 3J7AG 4LF4E 2VQFE 4JI0I 4B3RE 1FJGI 1Z5BA 5DRRA 4LFBI 2UXBI 2BV3A 2PO1B 1E3PA 3CDIA 2VQEI 3WU6A 1E3HA 5JEAF 2ZBKB 4HXZA 1XMQI 5IT9C 1MX0A 1N0VC 1IBKE 4LF8E 5K36E 4DV2I 1FWLA 3ZZTA 2R42A 5L3JA 4FWGA 1ZM4A 4JI7E 1U2RA 2PO2A 5FLXC 5LMUE 1N32E 4X62I 1EA6A 4DUYI 1XMOE 3HULA 4NBQA 3P3EA 1FNMA 2Q2EB 4JYAE 1FI4A 2LJPA 4HACA 4DR4E 4USKA 2X7IA 5JEAB 4DR6E 2PNMA 3PYFA 4JI8I 4GKKI 4LF7I 2HKEA 4N3OA 5LMNI 2Z5CB 2DEIA 2GO3A 3ZZ0A 4BA1A 4JI1E 2JEAA 2WNRA 2Z5BB 3F0NA 1Y6ZA 1USUA 3H1CA 2PNLA 4AIDA 1H74A 4DR3E 4DR7I 4LCHA 5K36A 4YY3E 4DR2E 2EFGA 5FWKA 3Q1QA 4IFDA 4PRVA 4JI3E 2VF3A 4U3BA 2BR2B 4X64I 1XMOI 3GLLA 4QNKA 4X64E 1XXEA 2NN6B 4FWDA 4DU8A 4X62E 2ZM6I 3J7AM 4KHPI 3P3GA 5ELWA 4IFDB 5JEAA 5K36C 4EMDA 5C0XD 2C37B 2O1TA 4LFCI 3M7ND 4UTGA
chains in the Genus database with same CATH topology
4DV0I 1A6FA 4GKJE 4LF9E 4IZKB 1BKNA 2Z5BA 4LF9I 4LFBE 2A2CA 4DR1E 1I94I 4JI8E 4DR6I 2XEXA 2HHHE 4LFAI 2HK3A 2UXDE 1Z59A 1PIEA 4KHPE 4NXNE 4P7AA 4JI2E 2ZM6E 3V5RA 4FN5A 1IBLE 3PYGA 1HNXE 4WUBA 1H73A 1MG7A 4NXNI 5BR8E 4MYTA 4YY3I 4B3TI 2UXDI 1DARA 4DV2E 3QT7A 4NXME 1XNQE 1B63A 2HHHI 3LNUA 1XNRI 5A2QC 1Y4UA 4DR1I 1I94E 2V8PA 3H4LA 3ZM7A 2V2VA 1FJGE 2HKJA 2ZITA 4DV1I 1HNWI 3J81C 5IWAI 2Z5EA 3J80Q 2HK2A 2UXCI 5LL6R 1XNRE 4DR5E 4JYAI 2X36A 3K1JA 2UUBI 4JV5E 4B3TE 4LF5E 1N32I 3K17A 1S16A 4JI5I 4JV5I 4JI2I 4LF8I 3LTOA 1XMQE 4LFAE 2CG9A 4DV1E 2Z5CA 5GMDA 1Y4SA 2UUAI 2AJ4A 4P52A 4JI0E 2E5LI 1MU5A 4PU9A 4DV0E 1H7UA 4NXMI 5A2QQ 2WW4A 3GONA 3QT8A 4IZJD 1KKHA 4DPWA 4ZVIA 4UT4A 1QZRA 4DPYA 1IBKI 4DR5I 3B78A 1Z0CA 5IWAE 1Z0BA 1Z5CA 1S4EA 1IBMI 2UXBE 1K47A 4XTJA 4GKKE 1NHHA 3B8HA 4LFCE 1PKPA 2UUCI 2O1UA 3P06A 4DPXA 1B62A 3V2UC 2F4VE 1Z0GA 4JI6E 4DUZI 4B3SI 3OTOI 2V2ZA 1HNXI 4DR7E 4DU7A 4ED4A 4DV3E 4JI4E 2BM1A 4JI1I 1KVKA 1N33I 4GKJI 1Z0VA 3JAMQ 4HYMA 4DV4I 1ZXNA 4WUCA 4DPUA 1PVGA 3JAMC 4DV4E 4DR4I 4DPTA 3Q6NA 4Z7CA 1N36I 4FWHA 2GQ0A 1H72C 4MYUA 3PYEA 4JI4I 3ZZUA 1N34E 1IBLI 4JI3I 4M1KA 1Z5AA 4X66E 1ZM2A 3HJCA 4DR3I 2V2QA 3PYDA 4IZJB 4JG4A 2BM0A 3D4JA 3OTOE 5GMEA 3Q6MA 2IOQA 5LMNE 3WU4A 3T1YE 4YHHI 2UU9E 2UUCE 4LF4I 1J5EE 3T1HE 4OX9I 3M6AA 4DV5E 3T1HI 2NPFA 4YHHE 4R1FA 5FLXQ 1H7SA 2A2DA 3CWVA 1ZM9A 2V34A 4I3HA 1KIJA 3WU3A 4DUYE 1IBME 4DR2I 4JI7I 4K0KI 4FW9A 3WU5A 1ELOA 1Z0TA 4B3MI 1N34I 1VISA 4B3SE 2VQEE 3J81Q 4DV7E 1ZM3A 3J80C 4Z7YA 4LF7E 2O1VA 4IZKA 1HK7A 1HR0E 5IT9Q 3QT5A 4WUDA 1J5EI 4DV6I 1RREA 1UEKA 2R3VA 4USMA 1Z0WA 1N33E 1HR0I 2UUAE 2GS8A 3K85A 4AQYE 1NHJA 1OJ4A 1Z0EA 2HFUA 5LMUI 1FKAE 1KTVA 1NHIA 4X66I 2OI2A 2E1RA 4LF6E 4JI5E 2HFSA 4DUZE 4X65I 4LF5I 1N0UA 1N36E 3PRYA 1D6TA 4RPFA 2UUBE 2VQFI 4B3RI 2DEJA 4IZJA 1EI1A 1WUUA 4URLA 2UXCE 4DV6E 4HY1A 4DV5I 2J7KA 1HNZI 2E5LE 2UU9I 3T1YI 1RR9A 3LPSA 4HACB 4DV3I 4X65E 4DV7I 2O1WA 1NZ0A 4PRXA 4LF6I 4KQVA 4B3ME 4DXLA 1XHKA 1XNQI 4K0KE 5BR8I 4JI6I 3ZKDA 2F4VI 4AQYI 3B82A 1ZXMA 3QT6A 1FWKA 2CGEA 3ZKBA 1HNZE 1USVA 2IOPA 1HNWE 4OX9E 2CZ9A 3J7AG 4LF4E 2VQFE 4JI0I 4B3RE 1FJGI 1Z5BA 4LFBI 2UXBI 2BV3A 2VQEI 3WU6A 2ZBKB 4HXZA 1XMQI 5IT9C 1MX0A 1N0VC 1IBKE 4LF8E 4DV2I 1FWLA 3ZZTA 2R42A 5L3JA 4FWGA 1ZM4A 4JI7E 1U2RA 1N32E 5FLXC 5LMUE 4X62I 1EA6A 4DUYI 1XMOE 3HULA 1FNMA 2Q2EB 4JYAE 1FI4A 2LJPA 4HACA 4DR4E 4USKA 2X7IA 4DR6E 2PNMA 3PYFA 4JI8I 4GKKI 4LF7I 2HKEA 4N3OA 5LMNI 2Z5CB 2DEIA 3ZZ0A 4JI1E 2Z5BB 3F0NA 1Y6ZA 1USUA 2PNLA 1H74A 4DR3E 4DR7I 4YY3E 4DR2E 2EFGA 5FWKA 3Q1QA 4PRVA 4JI3E 2VF3A 4X64I 1XMOI 4X64E 4DU8A 4FWDA 4X62E 2ZM6I 3J7AM 4KHPI 4EMDA 2O1TA 4LFCI 4UTGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV0 I;  1A6F A;  4GKJ E;  4LF9 E;  1BKN A;  4LF9 I;  4LFB E;  2A2C A;  4DR1 E;  1I94 I;  4JI8 E;  4DR6 I;  2XEX A;  2HHH E;  4LFA I;  2HK3 A;  2UXD E;  1Z59 A;  1PIE A;  4KHP E;  4NXN E;  4P7A A;  4JI2 E;  2ZM6 E;  3V5R A;  4FN5 A;  1IBL E;  3PYG A;  1HNX E;  4WUB A;  1H73 A;  1MG7 A;  4NXN I;  5BR8 E;  4MYT A;  4YY3 I;  4B3T I;  2UXD I;  1DAR A;  4DV2 E;  3QT7 A;  4NXM E;  1XNQ E;  1B63 A;  2HHH I;  3LNU A;  1XNR I;  5A2Q C;  4DR1 I;  1I94 E;  2V8P A;  3H4L A;  3ZM7 A;  2V2V A;  1FJG E;  2HKJ A;  2ZIT A;  4DV1 I;  1HNW I;  3J81 C;  5IWA I;  3J80 Q;  2HK2 A;  2UXC I;  5LL6 R;  1XNR E;  4DR5 E;  4JYA I;  2X36 A;  3K1J A;  2UUB I;  4JV5 E;  4B3T E;  4LF5 E;  1N32 I;  3K17 A;  1S16 A;  4JI5 I;  4JV5 I;  4JI2 I;  4LF8 I;  3LTO A;  1XMQ E;  4LFA E;  4DV1 E;  5GMD A;  2UUA I;  2AJ4 A;  4P52 A;  4JI0 E;  2E5L I;  1MU5 A;  4PU9 A;  4DV0 E;  1H7U A;  4NXM I;  5A2Q Q;  2WW4 A;  3GON A;  3QT8 A;  1KKH A;  4DPW A;  4ZVI A;  4UT4 A;  1QZR A;  4DPY A;  1IBK I;  4DR5 I;  3B78 A;  1Z0C A;  5IWA E;  1Z0B A;  1Z5C A;  1S4E A;  1IBM I;  2UXB E;  1K47 A;  4XTJ A;  4GKK E;  1NHH A;  3B8H A;  4LFC E;  1PKP A;  2UUC I;  4DPX A;  1B62 A;  3V2U C;  2F4V E;  1Z0G A;  4JI6 E;  4DUZ I;  4B3S I;  3OTO I;  2V2Z A;  1HNX I;  4DR7 E;  4DU7 A;  4ED4 A;  4DV3 E;  4JI4 E;  2BM1 A;  4JI1 I;  1KVK A;  1N33 I;  4GKJ I;  1Z0V A;  3JAM Q;  4HYM A;  4DV4 I;  1ZXN A;  4WUC A;  4DPU A;  1PVG A;  3JAM C;  4DV4 E;  4DR4 I;  4DPT A;  4Z7C A;  1N36 I;  4FWH A;  1H72 C;  4MYU A;  3PYE A;  4JI4 I;  3ZZU A;  1N34 E;  1IBL I;  4JI3 I;  4M1K A;  1Z5A A;  4X66 E;  1ZM2 A;  4DR3 I;  2V2Q A;  3PYD A;  4JG4 A;  2BM0 A;  3D4J A;  3OTO E;  5GME A;  5LMN E;  3WU4 A;  3T1Y E;  4YHH I;  2UU9 E;  2UUC E;  4LF4 I;  1J5E E;  3T1H E;  4OX9 I;  3M6A A;  4DV5 E;  3T1H I;  2NPF A;  4YHH E;  4R1F A;  5FLX Q;  1H7S A;  2A2D A;  3CWV A;  1ZM9 A;  2V34 A;  4I3H A;  1KIJ A;  3WU3 A;  4DUY E;  1IBM E;  4DR2 I;  4JI7 I;  4K0K I;  4FW9 A;  3WU5 A;  1ELO A;  1Z0T A;  4B3M I;  1N34 I;  1VIS A;  4B3S E;  2VQE E;  3J81 Q;  4DV7 E;  1ZM3 A;  3J80 C;  4Z7Y A;  4LF7 E;  1HR0 E;  5IT9 Q;  3QT5 A;  4WUD A;  1J5E I;  4DV6 I;  1RRE A;  1UEK A;  2R3V A;  4USM A;  1Z0W A;  1N33 E;  1HR0 I;  2GS8 A;  2UUA E;  4AQY E;  1NHJ A;  1OJ4 A;  1Z0E A;  2HFU A;  5LMU I;  1FKA E;  1KTV A;  1NHI A;  4X66 I;  2OI2 A;  2E1R A;  4LF6 E;  4JI5 E;  2HFS A;  4DUZ E;  4X65 I;  4LF5 I;  1N0U A;  1N36 E;  1D6T A;  4RPF A;  2UUB E;  2VQF I;  4B3R I;  2DEJ A;  1EI1 A;  1WUU A;  4URL A;  2UXC E;  4DV6 E;  4HY1 A;  4DV5 I;  2J7K A;  1HNZ I;  2E5L E;  2UU9 I;  3T1Y I;  1RR9 A;  3LPS A;  4HAC B;  4DV3 I;  4X65 E;  4DV7 I;  1NZ0 A;  4PRX A;  4LF6 I;  4KQV A;  4B3M E;  4DXL A;  1XHK A;  1XNQ I;  4K0K E;  5BR8 I;  4JI6 I;  3ZKD A;  2F4V I;  4AQY I;  3B82 A;  1ZXM A;  3QT6 A;  1FWK A;  3ZKB A;  1HNZ E;  1HNW E;  4OX9 E;  2CZ9 A;  3J7A G;  4LF4 E;  2VQF E;  4JI0 I;  4B3R E;  1FJG I;  1Z5B A;  4LFB I;  2UXB I;  2BV3 A;  2VQE I;  3WU6 A;  2ZBK B;  4HXZ A;  1XMQ I;  5IT9 C;  1MX0 A;  1N0V C;  1IBK E;  4LF8 E;  4DV2 I;  1FWL A;  3ZZT A;  2R42 A;  5L3J A;  4FWG A;  1ZM4 A;  4JI7 E;  1U2R A;  1N32 E;  5FLX C;  5LMU E;  4X62 I;  1EA6 A;  4DUY I;  1XMO E;  3HUL A;  1FNM A;  2Q2E B;  4JYA E;  1FI4 A;  2LJP A;  4HAC A;  4DR4 E;  4USK A;  2X7I A;  4DR6 E;  3PYF A;  4JI8 I;  4GKK I;  4LF7 I;  2HKE A;  5LMN I;  2DEI A;  3ZZ0 A;  4JI1 E;  3F0N A;  1H74 A;  4DR3 E;  4DR7 I;  4YY3 E;  4DR2 E;  2EFG A;  3Q1Q A;  4PRV A;  4JI3 E;  2VF3 A;  4X64 I;  1XMO I;  4X64 E;  4DU8 A;  4FWD A;  4X62 E;  2ZM6 I;  3J7A M;  4KHP I;  4EMD A;  4LFC I;  4UTG A; 
#chains in the Genus database with same CATH topology
 4DV0 I;  2C38 B;  1A6F A;  4GKJ E;  4LF9 E;  4IZK B;  1BKN A;  2Z5B A;  4LF9 I;  4LFB E;  4IFD E;  2A2C A;  4DR1 E;  1I94 I;  4IFD D;  2C37 A;  4JI8 E;  4BA2 B;  2BA1 D;  4DR6 I;  2NN6 C;  2XEX A;  2HHH E;  3M7N G;  4LFA I;  2HK3 A;  4AM3 A;  2UXD E;  1Z59 A;  1Y60 A;  4FW5 A;  4LCG A;  2PO1 A;  1PIE A;  4KHP E;  4NXN E;  4P7A A;  4JI2 E;  2ZM6 E;  3V5R A;  4FN5 A;  1IBL E;  3PYG A;  1HNX E;  5C0X A;  3DD6 A;  4WUB A;  4LOM A;  1H73 A;  1MG7 A;  4MU4 A;  4NXN I;  5BR8 E;  4MYT A;  3PS2 A;  4YY3 I;  4B3T I;  2UXD I;  3L7Z B;  1DAR A;  4DV2 E;  3QT7 A;  4NXM E;  1XNQ E;  1B63 A;  2HHH I;  3LNU A;  1XNR I;  4LPF A;  5A2Q C;  1Y4U A;  3GCM A;  4DR1 I;  1I94 E;  5K36 F;  2V8P A;  3H4L A;  5DRP A;  3ZM7 A;  2V2V A;  1FJG E;  2BA1 G;  4FW3 A;  2HKJ A;  2ZIT A;  4DV1 I;  2VES A;  1HNW I;  3J81 C;  5IWA I;  2Z5E A;  3J80 Q;  2HK2 A;  5EKW A;  2UXC I;  5LL6 R;  1XNR E;  4DR5 E;  4ISA A;  5DRO A;  2X36 A;  3K1J A;  4JYA I;  2UUB I;  2WNR B;  4JV5 E;  4B3T E;  4LF5 E;  1N32 I;  3K17 A;  1S16 A;  4JI5 I;  5K36 B;  3PS3 A;  4JV5 I;  4JI2 I;  4LF8 I;  4OKG A;  3B4T A;  3LTO A;  1XMQ E;  4LFA E;  2JEB A;  2CG9 A;  1UDQ A;  4DV1 E;  2Z5C A;  5GMD A;  1Y4S A;  2UUA I;  2AJ4 A;  4MU0 A;  1UDN A;  2C39 A;  4P52 A;  2GO4 A;  5C0X F;  4JI0 E;  2E5L I;  1MU5 A;  2CVE A;  4PU9 A;  4DV0 E;  5K36 D;  3NZK A;  1H7U A;  4NXM I;  5A2Q Q;  2WW4 A;  3GON A;  3QT8 A;  4IZJ D;  1KKH A;  4DPW A;  4ZVI A;  3M85 G;  4UT4 A;  1QZR A;  1UDO A;  4DPY A;  1IBK I;  4DR5 I;  5DNX A;  3B78 A;  1Z0C A;  5IWA E;  1Z0B A;  1Z5C A;  1S4E A;  1IBM I;  2UXB E;  1K47 A;  1YHC A;  4XTJ A;  1P42 A;  4GKK E;  3HKM A;  1NHH A;  2WP8 A;  3B8H A;  4LFC E;  1PKP A;  2PNZ A;  2IES A;  2JT2 A;  2UUC I;  2C38 A;  2O1U A;  3P06 A;  4DPX A;  4OO1 E;  1B62 A;  4MDT A;  3UHM A;  3V2U C;  2F4V E;  1Z0G A;  2IER A;  5JEA C;  4JI6 E;  4DUZ I;  4B3S I;  3OTO I;  2V2Z A;  1HNX I;  4MU3 A;  4DR7 E;  4DU7 A;  4ED4 A;  2JE6 A;  4DV3 E;  4OO1 C;  4JI4 E;  1OYS A;  2BM1 A;  4JI1 I;  1KVK A;  1UDS A;  1N33 I;  4GKJ I;  1Z0V A;  5DNL A;  3JAM Q;  4HYM A;  4DV4 I;  1ZXN A;  4FW7 A;  4WUC A;  4DPU A;  1PVG A;  3JAM C;  4DV4 E;  4DR4 I;  4DPT A;  2F1D A;  3Q6N A;  4OO1 A;  4Z7C A;  1N36 I;  4FWH A;  2GQ0 A;  2BR2 A;  5JEA E;  1H72 C;  4MYU A;  1R6M A;  3PYE A;  4JI4 I;  3ZZU A;  1N34 E;  1IBL I;  4JI3 I;  4M1K A;  2JEA B;  1Z5A A;  4X66 E;  4MQY A;  1ZM2 A;  3HJC A;  4DR3 I;  2JE6 B;  2V2Q A;  3PYD A;  5C0X C;  4IZJ B;  4JG4 A;  4LCF A;  2BM0 A;  3D4J A;  3OTO E;  1R6L A;  5GME A;  3L7Z A;  3Q6M A;  2IOQ A;  5LMN E;  3WU4 A;  3T1Y E;  4BA2 A;  4YHH I;  2UU9 E;  2UUC E;  3CDJ A;  4LF4 I;  1J5E E;  3T1H E;  4OX9 I;  3M6A A;  4DV5 E;  4GQU A;  2PO0 B;  3T1H I;  4OO1 B;  2NPF A;  4YHH E;  5C0X B;  4R1F A;  4OZE A;  1H7S A;  5FLX Q;  2A2D A;  3CWV A;  2WP8 B;  1ZM9 A;  2NN6 F;  2V34 A;  1KIJ A;  4I3H A;  3WU3 A;  4DUY E;  1IBM E;  1OYR A;  4IFD C;  4IS9 A;  3GME A;  4DR2 I;  4JI7 I;  4K0K I;  4FW9 A;  3WU5 A;  1ELO A;  1Z0T A;  4B3M I;  3P3C A;  1N34 I;  1VIS A;  4QNJ A;  4B3S E;  2VQE E;  3J81 Q;  4DV7 E;  4OO1 F;  1ZM3 A;  3J80 C;  4Z7Y A;  2BA0 D;  4LF7 E;  2O1V A;  4IZK A;  1HK7 A;  1HR0 E;  5IT9 Q;  3QT5 A;  3U1Y A;  4WUD A;  2J65 A;  1J5E I;  4DV6 I;  1RRE A;  1UEK A;  2R3V A;  4USM A;  1Z0W A;  4J3D A;  4OO1 D;  4MU1 A;  1N33 E;  2BA0 G;  1HR0 I;  2GS8 A;  2UUA E;  3K85 A;  4AQY E;  1NHJ A;  1OJ4 A;  1Z0E A;  2HFU A;  4FW6 A;  5LMU I;  1FKA E;  1KTV A;  1NHI A;  2PNZ B;  2JEB B;  4X66 I;  1YH8 A;  2OI2 A;  2E1R A;  2AE8 A;  4LF6 E;  4JI5 E;  2HFS A;  4DUZ E;  1VI7 A;  1Y5Y A;  1RHY A;  4X65 I;  4LF5 I;  1N0U A;  1N36 E;  3PRY A;  1D6T A;  4RPF A;  2NN6 A;  2UUB E;  2VQF I;  4B3R I;  2DEJ A;  4IZJ A;  1EI1 A;  4BA1 B;  1WUU A;  4URL A;  2UXC E;  4DV6 E;  4HY1 A;  4DV5 I;  2J7K A;  1HNZ I;  5DRQ A;  2E5L E;  5JEA D;  2UU9 I;  3T1Y I;  1RR9 A;  3LPS A;  4HAC B;  3KRN A;  4DV3 I;  4X65 E;  4DV7 I;  2O1W A;  1NZ0 A;  2C39 B;  4PRX A;  4LF6 I;  4KQV A;  4B3M E;  4DXL A;  2NN6 E;  1XHK A;  1XNQ I;  4FW4 A;  4K0K E;  4U3D A;  5BR8 I;  4JI6 I;  3ZKD A;  2F4V I;  3P76 A;  2O3Z A;  3PS1 A;  2PO2 B;  3B82 A;  4AQY I;  1ZXM A;  3QT6 A;  3U1K A;  1FWK A;  2CGE A;  1OYP A;  2NN6 D;  3ZKB A;  5EL9 A;  1HNZ E;  1USV A;  2PO0 A;  3M85 D;  2IOP A;  4AIM A;  4IFD F;  1HNW E;  5C0X E;  4OX9 E;  2CZ9 A;  3J7A G;  4LF4 E;  2VQF E;  4JI0 I;  4B3R E;  1FJG I;  1Z5B A;  5DRR A;  4LFB I;  2UXB I;  2BV3 A;  2PO1 B;  1E3P A;  3CDI A;  2VQE I;  3WU6 A;  1E3H A;  5JEA F;  2ZBK B;  4HXZ A;  1XMQ I;  5IT9 C;  1MX0 A;  1N0V C;  1IBK E;  4LF8 E;  5K36 E;  4DV2 I;  1FWL A;  3ZZT A;  2R42 A;  5L3J A;  4FWG A;  1ZM4 A;  4JI7 E;  1U2R A;  2PO2 A;  5FLX C;  5LMU E;  1N32 E;  4X62 I;  1EA6 A;  4DUY I;  1XMO E;  3HUL A;  4NBQ A;  3P3E A;  1FNM A;  2Q2E B;  4JYA E;  1FI4 A;  2LJP A;  4HAC A;  4DR4 E;  4USK A;  2X7I A;  5JEA B;  4DR6 E;  2PNM A;  3PYF A;  4JI8 I;  4GKK I;  4LF7 I;  2HKE A;  4N3O A;  5LMN I;  2Z5C B;  2DEI A;  2GO3 A;  3ZZ0 A;  4BA1 A;  4JI1 E;  2JEA A;  2WNR A;  2Z5B B;  3F0N A;  1Y6Z A;  1USU A;  3H1C A;  2PNL A;  4AID A;  1H74 A;  4DR3 E;  4DR7 I;  4LCH A;  5K36 A;  4YY3 E;  4DR2 E;  2EFG A;  5FWK A;  3Q1Q A;  4IFD A;  4PRV A;  4JI3 E;  2VF3 A;  4U3B A;  2BR2 B;  4X64 I;  1XMO I;  3GLL A;  4QNK A;  4X64 E;  1XXE A;  2NN6 B;  4FWD A;  4DU8 A;  4X62 E;  2ZM6 I;  3J7A M;  4KHP I;  3P3G A;  5ELW A;  4IFD B;  5JEA A;  5K36 C;  4EMD A;  5C0X D;  2C37 B;  2O1T A;  4LFC I;  3M7N D;  4UTG A; 
#chains in the Genus database with same CATH homology
 4DV0 I;  1A6F A;  4GKJ E;  4LF9 E;  4IZK B;  1BKN A;  2Z5B A;  4LF9 I;  4LFB E;  2A2C A;  4DR1 E;  1I94 I;  4JI8 E;  4DR6 I;  2XEX A;  2HHH E;  4LFA I;  2HK3 A;  2UXD E;  1Z59 A;  1PIE A;  4KHP E;  4NXN E;  4P7A A;  4JI2 E;  2ZM6 E;  3V5R A;  4FN5 A;  1IBL E;  3PYG A;  1HNX E;  4WUB A;  1H73 A;  1MG7 A;  4NXN I;  5BR8 E;  4MYT A;  4YY3 I;  4B3T I;  2UXD I;  1DAR A;  4DV2 E;  3QT7 A;  4NXM E;  1XNQ E;  1B63 A;  2HHH I;  3LNU A;  1XNR I;  5A2Q C;  1Y4U A;  4DR1 I;  1I94 E;  2V8P A;  3H4L A;  3ZM7 A;  2V2V A;  1FJG E;  2HKJ A;  2ZIT A;  4DV1 I;  1HNW I;  3J81 C;  5IWA I;  2Z5E A;  3J80 Q;  2HK2 A;  2UXC I;  5LL6 R;  1XNR E;  4DR5 E;  4JYA I;  2X36 A;  3K1J A;  2UUB I;  4JV5 E;  4B3T E;  4LF5 E;  1N32 I;  3K17 A;  1S16 A;  4JI5 I;  4JV5 I;  4JI2 I;  4LF8 I;  3LTO A;  1XMQ E;  4LFA E;  2CG9 A;  4DV1 E;  2Z5C A;  5GMD A;  1Y4S A;  2UUA I;  2AJ4 A;  4P52 A;  4JI0 E;  2E5L I;  1MU5 A;  4PU9 A;  4DV0 E;  1H7U A;  4NXM I;  5A2Q Q;  2WW4 A;  3GON A;  3QT8 A;  4IZJ D;  1KKH A;  4DPW A;  4ZVI A;  4UT4 A;  1QZR A;  4DPY A;  1IBK I;  4DR5 I;  3B78 A;  1Z0C A;  5IWA E;  1Z0B A;  1Z5C A;  1S4E A;  1IBM I;  2UXB E;  1K47 A;  4XTJ A;  4GKK E;  1NHH A;  3B8H A;  4LFC E;  1PKP A;  2UUC I;  2O1U A;  3P06 A;  4DPX A;  1B62 A;  3V2U C;  2F4V E;  1Z0G A;  4JI6 E;  4DUZ I;  4B3S I;  3OTO I;  2V2Z A;  1HNX I;  4DR7 E;  4DU7 A;  4ED4 A;  4DV3 E;  4JI4 E;  2BM1 A;  4JI1 I;  1KVK A;  1N33 I;  4GKJ I;  1Z0V A;  3JAM Q;  4HYM A;  4DV4 I;  1ZXN A;  4WUC A;  4DPU A;  1PVG A;  3JAM C;  4DV4 E;  4DR4 I;  4DPT A;  3Q6N A;  4Z7C A;  1N36 I;  4FWH A;  2GQ0 A;  1H72 C;  4MYU A;  3PYE A;  4JI4 I;  3ZZU A;  1N34 E;  1IBL I;  4JI3 I;  4M1K A;  1Z5A A;  4X66 E;  1ZM2 A;  3HJC A;  4DR3 I;  2V2Q A;  3PYD A;  4IZJ B;  4JG4 A;  2BM0 A;  3D4J A;  3OTO E;  5GME A;  3Q6M A;  2IOQ A;  5LMN E;  3WU4 A;  3T1Y E;  4YHH I;  2UU9 E;  2UUC E;  4LF4 I;  1J5E E;  3T1H E;  4OX9 I;  3M6A A;  4DV5 E;  3T1H I;  2NPF A;  4YHH E;  4R1F A;  5FLX Q;  1H7S A;  2A2D A;  3CWV A;  1ZM9 A;  2V34 A;  4I3H A;  1KIJ A;  3WU3 A;  4DUY E;  1IBM E;  4DR2 I;  4JI7 I;  4K0K I;  4FW9 A;  3WU5 A;  1ELO A;  1Z0T A;  4B3M I;  1N34 I;  1VIS A;  4B3S E;  2VQE E;  3J81 Q;  4DV7 E;  1ZM3 A;  3J80 C;  4Z7Y A;  4LF7 E;  2O1V A;  4IZK A;  1HK7 A;  1HR0 E;  5IT9 Q;  3QT5 A;  4WUD A;  1J5E I;  4DV6 I;  1RRE A;  1UEK A;  2R3V A;  4USM A;  1Z0W A;  1N33 E;  1HR0 I;  2UUA E;  2GS8 A;  3K85 A;  4AQY E;  1NHJ A;  1OJ4 A;  1Z0E A;  2HFU A;  5LMU I;  1FKA E;  1KTV A;  1NHI A;  4X66 I;  2OI2 A;  2E1R A;  4LF6 E;  4JI5 E;  2HFS A;  4DUZ E;  4X65 I;  4LF5 I;  1N0U A;  1N36 E;  3PRY A;  1D6T A;  4RPF A;  2UUB E;  2VQF I;  4B3R I;  2DEJ A;  4IZJ A;  1EI1 A;  1WUU A;  4URL A;  2UXC E;  4DV6 E;  4HY1 A;  4DV5 I;  2J7K A;  1HNZ I;  2E5L E;  2UU9 I;  3T1Y I;  1RR9 A;  3LPS A;  4HAC B;  4DV3 I;  4X65 E;  4DV7 I;  2O1W A;  1NZ0 A;  4PRX A;  4LF6 I;  4KQV A;  4B3M E;  4DXL A;  1XHK A;  1XNQ I;  4K0K E;  5BR8 I;  4JI6 I;  3ZKD A;  2F4V I;  4AQY I;  3B82 A;  1ZXM A;  3QT6 A;  1FWK A;  2CGE A;  3ZKB A;  1HNZ E;  1USV A;  2IOP A;  1HNW E;  4OX9 E;  2CZ9 A;  3J7A G;  4LF4 E;  2VQF E;  4JI0 I;  4B3R E;  1FJG I;  1Z5B A;  4LFB I;  2UXB I;  2BV3 A;  2VQE I;  3WU6 A;  2ZBK B;  4HXZ A;  1XMQ I;  5IT9 C;  1MX0 A;  1N0V C;  1IBK E;  4LF8 E;  4DV2 I;  1FWL A;  3ZZT A;  2R42 A;  5L3J A;  4FWG A;  1ZM4 A;  4JI7 E;  1U2R A;  1N32 E;  5FLX C;  5LMU E;  4X62 I;  1EA6 A;  4DUY I;  1XMO E;  3HUL A;  1FNM A;  2Q2E B;  4JYA E;  1FI4 A;  2LJP A;  4HAC A;  4DR4 E;  4USK A;  2X7I A;  4DR6 E;  2PNM A;  3PYF A;  4JI8 I;  4GKK I;  4LF7 I;  2HKE A;  4N3O A;  5LMN I;  2Z5C B;  2DEI A;  3ZZ0 A;  4JI1 E;  2Z5B B;  3F0N A;  1Y6Z A;  1USU A;  2PNL A;  1H74 A;  4DR3 E;  4DR7 I;  4YY3 E;  4DR2 E;  2EFG A;  5FWK A;  3Q1Q A;  4PRV A;  4JI3 E;  2VF3 A;  4X64 I;  1XMO I;  4X64 E;  4DU8 A;  4FWD A;  4X62 E;  2ZM6 I;  3J7A M;  4KHP I;  4EMD A;  2O1T A;  4LFC I;  4UTG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...