4DV5I

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g, bound with streptomycin
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome/antibiotic
publication title A structural basis for streptomycin resistance
rcsb
total genus 23
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dv5I00
4JI1E 1Z59A 5IWAI 1PVGA 4URLA 2VQFI 3WU5A 2ZBKB 4DXLA 4DV6I 3J81Q 3LPSA 1HNXI 1U2RA 4P52A 1HNZI 1IBLE 1FI4A 2LJPA 3PYFA 5GMDA 3JAMQ 1Z5BA 2UUAE 4LFAI 3QT5A 1HR0E 4LF6E 2WW4A 3H4LA 5BR8E 4JI4E 4UT4A 2VQEI 4HACB 4GKKI 1ZXNA 2UUCE 3ZKBA 1HNXE 4JI6I 4DV3I 4JI3E 1XNQI 2CZ9A 4GKJI 5A2QQ 4LF9E 1NHIA 3PYGA 2E5LE 4DR6E 2R3VA 2UXDE 1XNRE 2AJ4A 4FW9A 1N0UA 4M1KA 1KKHA 1FJGE 4X65I 2Q2EB 3B82A 3WU3A 2V2VA 1Z5CA 3JAMC 5BR8I 1H74A 4DUZI 1PIEA 4LFBE 1N34I 4DUYI 5GMEA 1IBMI 1IBKI 2NPFA 4DV0I 3OTOE 4DR3I 2GS8A 1RR9A 5IT9C 2V34A 2VF3A 1FWKA 2ZITA 2E1RA 1B63A 1N32I 1ELOA 5LMUE 4OX9E 4WUBA 4LF5I 1S16A 1ZM9A 4WUDA 3ZZTA 3B8HA 4B3SI 4X64I 1Z5AA 4WUCA 1BKNA 4LF5E 4JI7I 2UU9I 1OJ4A 3ZM7A 3J7AM 4AQYE 3PYDA 3B78A 3V5RA 3ZKDA 1KTVA 2HK3A 3T1HE 4NXNE 1N33I 4DU7A 1FJGI 2F4VE 1S4EA 3K17A 3QT6A 1WUUA 4DV0E 4KQVA 1MX0A 2F4VI 4FWDA 4LFAE 1B62A 5IT9Q 4LF9I 4DPXA 4DV1E 4DV2E 3T1HI 1ZM3A 1KIJA 4LF7I 2UXBE 4YHHI 1Z0TA 1N34E 1H73A 3QT8A 4JYAI 1Z0VA 1N33E 3QT7A 2ZM6E 1RREA 4LF7E 2V2QA 4HY1A 3D4JA 5LMNE 4DV1I 4DV2I 2OI2A 1N32E 1Z0EA 2J7KA 4DR7I 3WU4A 4DR2I 3GONA 4JV5I 2EFGA 4JI2E 3Q1QA 4B3SE 4ZVIA 4JI1I 1H7SA 4DR5E 2X7IA 4DR4I 2HFSA 4AQYI 1ZM4A 1XNRI 4JI7E 5FLXQ 2DEIA 2X36A 4X65E 3PYEA 2XEXA 1N36I 1XNQE 1I94I 1ZM2A 4ED4A 4DR2E 1Z0GA 1Z0WA 2E5LI 4P7AA 3J7AG 4FN5A 2UXCI 4B3RI 4X66E 2UXDI 4DV4E 5LMNI 4YHHE 2R42A 4DV3E 1XMQI 2DEJA 4DPYA 1J5EE 1VISA 4XTJA 3LNUA 4GKJE 4Z7CA 3J81C 2HHHE 4FWGA 4DR6I 4MYUA 3WU6A 4KHPI 2A2CA 4DPUA 1IBKE 1XMOI 1HR0I 4LF6I 1PKPA 3ZZ0A 4GKKE 4DR4E 2HHHI 2VQFE 4Z7YA 4DR5I 1J5EI 3OTOI 1Z0BA 4DV7E 4USKA 1MG7A 4X64E 1A6FA 1H7UA 4LFCI 1NZ0A 4MYTA 4PRXA 3V2UC 4LF4E 4OX9I 4LFBI 2HFUA 5L3JA 4JI5E 5FLXC 1FNMA 3LTOA 3CWVA 4I3HA 4NXME 2BM1A 4JI0E 5A2QC 2ZM6I 4EMDA 4B3MI 4B3TE 1IBME 1EA6A 4JG4A 1UEKA 4B3ME 4DR3E 4DUYE 1XMOE 1HNWE 4DV6E 4DUZE 4UTGA 4RPFA 1K47A 5IWAE 4JI3I 1D6TA 1QZRA 1IBLI 3J80Q 2UUCI 4JV5E 4PU9A 5LL6R 1H72C 4USMA 4DR1I 4NXNI 4DU8A 1DARA 1XHKA 1XMQE 2V8PA 3J80C 4DV5E 4X62E 2UU9E 4B3TI 4JI5I 4HXZA 3T1YI 2BM0A 4YY3I 4JI6E 1NHJA 2UXBI 1NHHA 1Z0CA 2UUBI 4PRVA 4X62I 4DV4I 4DV5I 4K0KE 2UXCE 4JI4I 4LF8I 4DPTA 2HK2A 2HKJA 5LMUI 3T1YE 4DR1E 4DPWA 1I94E 2VQEE 4JI8E 1HNZE 4DV7I 1KVKA 1MU5A 4FWHA 4K0KI 4JI8I 2V2ZA 3M6AA 2UUAI 4X66I 3F0NA 4JI2I 4KHPE 2UUBE 2BV3A 4HACA 4LF4I 4DR7E 1N36E 1FKAE 1EI1A 4NXMI 1N0VC 3K1JA 1ZXMA 1HNWI 4JI0I 2HKEA 3ZZUA 4YY3E 4LFCE 4B3RE 4HYMA 4JYAE 1FWLA 2A2DA 3HULA 4R1FA 4LF8E
chains in the Genus database with same CATH superfamily
4JI1E 3HJCA 1Z59A 5IWAI 1PVGA 4URLA 2VQFI 3GLLA 3WU5A 2ZBKB 4DXLA 4DV6I 3J81Q 3LPSA 2BR2A 1HNXI 1U2RA 4P52A 4FW4A 1HNZI 1IBLE 1FI4A 2LJPA 5K36E 2O1WA 3PYFA 5C0XD 5GMDA 3JAMQ 1Z5BA 2UUAE 4LFAI 2GQ0A 3QT5A 1HR0E 2PNZA 1R6LA 4LF6E 2WW4A 3H4LA 5BR8E 4JI4E 2JEBA 2BA1G 4UT4A 2VQEI 4HACB 4GKKI 3CDIA 2CG9A 2JEBB 4FW6A 1ZXNA 2UUCE 3ZKBA 3P3EA 1HNXE 4MU0A 4JI6I 4DV3I 4JI3E 1XNQI 2CZ9A 4GKJI 5A2QQ 4LF9E 1NHIA 2PO1A 3L7ZA 3PYGA 2E5LE 4DR6E 2R3VA 2UXDE 4FW5A 1XNRE 4IFDD 2C39A 2AJ4A 5JEAA 4FW9A 1N0UA 2PO0A 4M1KA 1KKHA 1FJGE 3K85A 4X65I 4IZJA 2Q2EB 3B82A 3WU3A 2V2VA 1Z5CA 3JAMC 5BR8I 2C38B 5K36F 1H74A 4DUZI 3U1YA 1PIEA 4LFBE 1N34I 3B4TA 5DRPA 3Q6MA 4DUYI 2PNZB 5GMEA 2JT2A 1IBMI 1IBKI 4IFDB 4BA1A 2NPFA 4AM3A 2BA0D 2WP8A 3OTOE 4DV0I 4DR3I 2GS8A 2JEAA 2BA1D 1RR9A 3P06A 5IT9C 1UDSA 2V34A 1FWKA 1YH8A 2VF3A 2ZITA 4OO1D 2E1RA 1B63A 1N32I 1ELOA 4LCHA 5LMUE 4OX9E 1Y4SA 5EL9A 2NN6D 2PO2B 4MDTA 4WUBA 4LF5I 1ZM9A 1S16A 4WUDA 3ZZTA 5K36D 3B8HA 4B3SI 2Z5BB 2IERA 4X64I 1Z5AA 4WUCA 1BKNA 4LF5E 1VI7A 4JI7I 2PO1B 5K36A 2UU9I 1OJ4A 3ZM7A 3J7AM 4AQYE 2O1VA 1HK7A 4BA2B 3PYDA 3B78A 3V5RA 3M85G 2PNMA 3ZKDA 1KTVA 2HK3A 3T1HE 4NXNE 1N33I 4DU7A 1FJGI 2F4VE 1S4EA 3K17A 5DROA 5JEAC 3QT6A 1WUUA 2O1TA 2WNRA 4GQUA 4OO1E 4DV0E 4KQVA 1MX0A 2F4VI 4FWDA 4LFAE 1B62A 2Z5EA 4OKGA 5IT9Q 4LF9I 4DPXA 4DV1E 2JE6A 4DV2E 1ZM3A 3T1HI 1KIJA 3PS2A 2O1UA 4LF7I 2UXBE 2NN6F 4YHHI 2BR2B 2IOQA 1Z0TA 1N34E 1H73A 2J65A 2JE6B 3QT8A 4JYAI 1Z0VA 1N33E 3P3GA 3QT7A 2ZM6E 4IZJB 1RREA 4LF7E 2V2QA 3M7NG 1Y5YA 4HY1A 3D4JA 4FW7A 5LMNE 3UHMA 4DV1I 4DV2I 2OI2A 2GO3A 2WP8B 5K36B 1N32E 1Z0EA 2J7KA 4DR7I 3WU4A 2IOPA 4DR2I 4QNKA 3GONA 1OYSA 4JV5I 2EFGA 1E3HA 2NN6E 4JI2E 2VESA 3Q1QA 4B3SE 4ZVIA 2Z5BA 4IS9A 2WNRB 4JI1I 1H7SA 4DR5E 2CVEA 2X7IA 4DR4I 2HFSA 5C0XA 4AQYI 3Q6NA 4LOMA 1ZM4A 1XNRI 5DRRA 4JI7E 5FLXQ 4BA2A 1OYRA 2DEIA 2X36A 5JEAB 4X65E 3CDJA 4FW3A 1P42A 3PYEA 4OO1B 2XEXA 1N36I 1XNQE 1I94I 1ZM2A 5C0XE 4ED4A 4DR2E 1Z0GA 1Z0WA 5EKWA 2E5LI 4P7AA 3J7AG 1YHCA 4FN5A 2UXCI 4B3RI 4NBQA 4X66E 2UXDI 4DV4E 5LMNI 4YHHE 5DNLA 4IZJD 2O3ZA 2R42A 4DV3E 1XMQI 5ELWA 1RHYA 2DEJA 4DPYA 1J5EE 3DD6A 1XXEA 1VISA 4XTJA 3LNUA 5JEAD 3PRYA 4GKJE 4Z7CA 1USUA 3J81C 2HHHE 4FWGA 4DR6I 2Z5CA 4MYUA 3WU6A 4IFDA 4KHPI 3M85D 4AIDA 2A2CA 4LPFA 4DPUA 1IBKE 2C39B 1XMOI 1HR0I 4LF6I 2NN6B 2F1DA 4LCGA 4IFDE 1PKPA 4MQYA 3ZZ0A 3GCMA 4GKKE 4DR4E 2HHHI 2VQFE 4AIMA 4Z7YA 3M7ND 4DR5I 1J5EI 3GMEA 2NN6A 3OTOI 1Z0BA 4DV7E 3NZKA 4USKA 1MG7A 4OO1A 4X64E 3PS3A 1A6FA 4MU4A 1H7UA 4LFCI 1NZ0A 4MYTA 4PRXA 3V2UC 4LF4E 4OX9I 4LFBI 2HFUA 4ISAA 5DNXA 5L3JA 4JI5E 5FLXC 5C0XC 4OO1C 1FNMA 3LTOA 3CWVA 4I3HA 4NXME 2BM1A 5DRQA 3P3CA 4JI0E 5A2QC 2ZM6I 4EMDA 4B3MI 4J3DA 4B3TE 1IBME 1EA6A 1R6MA 3PS1A 4JG4A 2PO0B 1UEKA 4B3ME 4DR3E 4DUYE 1XMOE 2PNLA 1HNWE 3H1CA 4DV6E 4DUZE 4UTGA 4RPFA 4OO1F 1K47A 5IWAE 4IFDC 4JI3I 1D6TA 1QZRA 1IBLI 3J80Q 2UUCI 4JV5E 4PU9A 5LL6R 2C37A 1H72C 4USMA 1UDOA 4QNJA 4DR1I 4NXNI 4DU8A 1DARA 1XHKA 1XMQE 2V8PA 4IZKB 2NN6C 3J80C 4DV5E 4X62E 2UU9E 4B3TI 4JI5I 4U3BA 4BA1B 5C0XF 4HXZA 3T1YI 2BM0A 4YY3I 5FWKA 4JI6E 1NHJA 1E3PA 2UXBI 1NHHA 1Z0CA 2UUBI 4PRVA 4X62I 4DV4I 4DV5I 4K0KE 2UXCE 2CGEA 4JI4I 4LF8I 4DPTA 4U3DA 2HK2A 2HKJA 1UDQA 1USVA 5LMUI 3T1YE 5C0XB 4DPWA 4DR1E 1I94E 1OYPA 3HKMA 4MU1A 2VQEE 4JI8E 1Y4UA 1HNZE 3P76A 4DV7I 1KVKA 1MU5A 1Y6ZA 2GO4A 4FWHA 4K0KI 4JI8I 2V2ZA 3M6AA 2UUAI 4X66I 3F0NA 4JI2I 4LCFA 4KHPE 2UUBE 2BV3A 1Y60A 4HACA 4LF4I 4N3OA 3KRNA 4IZKA 2AE8A 3L7ZB 2PO2A 4IFDF 4DR7E 1N36E 1FKAE 1EI1A 4NXMI 1N0VC 3K1JA 1UDNA 1ZXMA 5JEAF 1HNWI 2Z5CB 4JI0I 5JEAE 2JEAB 2HKEA 3U1KA 3ZZUA 4OZEA 4YY3E 2IESA 4LFCE 4B3RE 4HYMA 4JYAE 5K36C 4MU3A 2C38A 1FWLA 2A2DA 2BA0G 3HULA 2C37B 4R1FA 4LF8E
chains in the Genus database with same CATH topology
4JI1E 3HJCA 1Z59A 5IWAI 1PVGA 4URLA 2VQFI 3WU5A 2ZBKB 4DXLA 4DV6I 3J81Q 3LPSA 1HNXI 1U2RA 4P52A 1HNZI 1IBLE 1FI4A 2LJPA 2O1WA 3PYFA 5GMDA 3JAMQ 1Z5BA 2UUAE 4LFAI 2GQ0A 3QT5A 1HR0E 4LF6E 2WW4A 3H4LA 5BR8E 4JI4E 4UT4A 2VQEI 4HACB 4GKKI 2CG9A 1ZXNA 2UUCE 3ZKBA 1HNXE 4JI6I 4DV3I 4JI3E 1XNQI 2CZ9A 4GKJI 5A2QQ 4LF9E 1NHIA 3PYGA 2E5LE 4DR6E 2R3VA 2UXDE 1XNRE 2AJ4A 4FW9A 1N0UA 4M1KA 1KKHA 1FJGE 3K85A 4X65I 4IZJA 2Q2EB 3B82A 3WU3A 2V2VA 1Z5CA 3JAMC 5BR8I 1H74A 4DUZI 1PIEA 4LFBE 1N34I 3Q6MA 4DUYI 5GMEA 1IBMI 1IBKI 2NPFA 4DV0I 3OTOE 4DR3I 2GS8A 1RR9A 3P06A 5IT9C 2V34A 2VF3A 1FWKA 2ZITA 2E1RA 1B63A 1N32I 1ELOA 5LMUE 4OX9E 1Y4SA 4WUBA 4LF5I 1S16A 1ZM9A 4WUDA 3ZZTA 3B8HA 4B3SI 2Z5BB 4X64I 1Z5AA 4WUCA 1BKNA 4LF5E 4JI7I 2UU9I 1OJ4A 3ZM7A 3J7AM 4AQYE 2O1VA 1HK7A 3PYDA 3B78A 3V5RA 2PNMA 3ZKDA 1KTVA 2HK3A 3T1HE 4NXNE 1N33I 4DU7A 1FJGI 2F4VE 1S4EA 3K17A 3QT6A 1WUUA 2O1TA 4DV0E 4KQVA 1MX0A 2F4VI 4FWDA 4LFAE 1B62A 2Z5EA 5IT9Q 4LF9I 4DPXA 4DV1E 4DV2E 3T1HI 1ZM3A 1KIJA 2O1UA 4LF7I 2UXBE 4YHHI 2IOQA 1Z0TA 1N34E 1H73A 3QT8A 4JYAI 1Z0VA 1N33E 3QT7A 2ZM6E 4IZJB 1RREA 4LF7E 2V2QA 4HY1A 3D4JA 5LMNE 4DV1I 4DV2I 2OI2A 1N32E 1Z0EA 2J7KA 4DR7I 3WU4A 2IOPA 4DR2I 3GONA 4JV5I 2EFGA 4JI2E 3Q1QA 4B3SE 4ZVIA 2Z5BA 4JI1I 1H7SA 4DR5E 2X7IA 4DR4I 2HFSA 4AQYI 3Q6NA 1ZM4A 1XNRI 4JI7E 5FLXQ 2DEIA 2X36A 4X65E 3PYEA 2XEXA 1N36I 1XNQE 1I94I 1ZM2A 4ED4A 4DR2E 1Z0GA 1Z0WA 2E5LI 4P7AA 3J7AG 4FN5A 2UXCI 4B3RI 4X66E 2UXDI 4DV4E 5LMNI 4YHHE 4IZJD 2R42A 4DV3E 1XMQI 2DEJA 4DPYA 1J5EE 1VISA 4XTJA 3LNUA 4GKJE 3PRYA 4Z7CA 1USUA 3J81C 2HHHE 4FWGA 4DR6I 2Z5CA 4MYUA 3WU6A 4KHPI 2A2CA 4DPUA 1IBKE 1XMOI 1HR0I 4LF6I 1PKPA 3ZZ0A 4GKKE 4DR4E 2HHHI 2VQFE 4Z7YA 4DR5I 1J5EI 3OTOI 1Z0BA 4DV7E 4USKA 1MG7A 4X64E 1A6FA 1H7UA 4LFCI 1NZ0A 4MYTA 4PRXA 3V2UC 4LF4E 4OX9I 4LFBI 2HFUA 5L3JA 4JI5E 5FLXC 1FNMA 3LTOA 3CWVA 4I3HA 4NXME 2BM1A 4JI0E 5A2QC 2ZM6I 4EMDA 4B3MI 4B3TE 1IBME 1EA6A 4JG4A 1UEKA 4B3ME 4DR3E 4DUYE 1XMOE 2PNLA 1HNWE 4DV6E 4DUZE 4UTGA 4RPFA 1K47A 5IWAE 4JI3I 1D6TA 1QZRA 1IBLI 3J80Q 2UUCI 4JV5E 4PU9A 5LL6R 1H72C 4USMA 4DR1I 4NXNI 4DU8A 1DARA 1XHKA 1XMQE 2V8PA 4IZKB 3J80C 4DV5E 4X62E 2UU9E 4B3TI 4JI5I 4HXZA 3T1YI 2BM0A 4YY3I 5FWKA 4JI6E 1NHJA 2UXBI 1NHHA 1Z0CA 2UUBI 4PRVA 4X62I 4DV4I 4DV5I 4K0KE 2UXCE 2CGEA 4JI4I 4LF8I 4DPTA 2HK2A 2HKJA 1USVA 5LMUI 3T1YE 4DR1E 4DPWA 1I94E 2VQEE 4JI8E 1Y4UA 1HNZE 4DV7I 1KVKA 1MU5A 1Y6ZA 4FWHA 4K0KI 4JI8I 2V2ZA 3M6AA 2UUAI 4X66I 3F0NA 4JI2I 4KHPE 2UUBE 2BV3A 4HACA 4LF4I 4N3OA 4IZKA 4DR7E 1N36E 1FKAE 1EI1A 4NXMI 1N0VC 3K1JA 1ZXMA 1HNWI 2Z5CB 4JI0I 2HKEA 3ZZUA 4YY3E 4LFCE 4B3RE 4HYMA 4JYAE 1FWLA 2A2DA 3HULA 4R1FA 4LF8E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI1 E;  1Z59 A;  5IWA I;  1PVG A;  4URL A;  2VQF I;  3WU5 A;  2ZBK B;  4DXL A;  4DV6 I;  3J81 Q;  3LPS A;  1HNX I;  1U2R A;  4P52 A;  1HNZ I;  1IBL E;  1FI4 A;  2LJP A;  3PYF A;  5GMD A;  3JAM Q;  1Z5B A;  2UUA E;  4LFA I;  3QT5 A;  1HR0 E;  4LF6 E;  2WW4 A;  3H4L A;  5BR8 E;  4JI4 E;  4UT4 A;  2VQE I;  4HAC B;  4GKK I;  1ZXN A;  2UUC E;  3ZKB A;  1HNX E;  4JI6 I;  4DV3 I;  4JI3 E;  1XNQ I;  2CZ9 A;  4GKJ I;  5A2Q Q;  4LF9 E;  1NHI A;  3PYG A;  2E5L E;  4DR6 E;  2R3V A;  2UXD E;  1XNR E;  2AJ4 A;  4FW9 A;  1N0U A;  4M1K A;  1KKH A;  1FJG E;  4X65 I;  2Q2E B;  3B82 A;  3WU3 A;  2V2V A;  1Z5C A;  3JAM C;  5BR8 I;  1H74 A;  4DUZ I;  1PIE A;  4LFB E;  1N34 I;  4DUY I;  5GME A;  1IBM I;  1IBK I;  2NPF A;  4DV0 I;  3OTO E;  4DR3 I;  2GS8 A;  1RR9 A;  5IT9 C;  2V34 A;  2VF3 A;  1FWK A;  2ZIT A;  2E1R A;  1B63 A;  1N32 I;  1ELO A;  5LMU E;  4OX9 E;  4WUB A;  4LF5 I;  1S16 A;  1ZM9 A;  4WUD A;  3ZZT A;  3B8H A;  4B3S I;  4X64 I;  1Z5A A;  4WUC A;  1BKN A;  4LF5 E;  4JI7 I;  2UU9 I;  1OJ4 A;  3ZM7 A;  3J7A M;  4AQY E;  3PYD A;  3B78 A;  3V5R A;  3ZKD A;  1KTV A;  2HK3 A;  3T1H E;  4NXN E;  1N33 I;  4DU7 A;  1FJG I;  2F4V E;  1S4E A;  3K17 A;  3QT6 A;  1WUU A;  4DV0 E;  4KQV A;  1MX0 A;  2F4V I;  4FWD A;  4LFA E;  1B62 A;  5IT9 Q;  4LF9 I;  4DPX A;  4DV1 E;  4DV2 E;  3T1H I;  1ZM3 A;  1KIJ A;  4LF7 I;  2UXB E;  4YHH I;  1Z0T A;  1N34 E;  1H73 A;  3QT8 A;  4JYA I;  1Z0V A;  1N33 E;  3QT7 A;  2ZM6 E;  1RRE A;  4LF7 E;  2V2Q A;  4HY1 A;  3D4J A;  5LMN E;  4DV1 I;  4DV2 I;  2OI2 A;  1N32 E;  1Z0E A;  2J7K A;  4DR7 I;  3WU4 A;  4DR2 I;  3GON A;  4JV5 I;  2EFG A;  4JI2 E;  3Q1Q A;  4B3S E;  4ZVI A;  4JI1 I;  1H7S A;  4DR5 E;  2X7I A;  4DR4 I;  2HFS A;  4AQY I;  1ZM4 A;  1XNR I;  4JI7 E;  5FLX Q;  2DEI A;  2X36 A;  4X65 E;  3PYE A;  2XEX A;  1N36 I;  1XNQ E;  1I94 I;  1ZM2 A;  4ED4 A;  4DR2 E;  1Z0G A;  1Z0W A;  2E5L I;  4P7A A;  3J7A G;  4FN5 A;  2UXC I;  4B3R I;  4X66 E;  2UXD I;  4DV4 E;  5LMN I;  4YHH E;  2R42 A;  4DV3 E;  1XMQ I;  2DEJ A;  4DPY A;  1J5E E;  1VIS A;  4XTJ A;  3LNU A;  4GKJ E;  4Z7C A;  3J81 C;  2HHH E;  4FWG A;  4DR6 I;  4MYU A;  3WU6 A;  4KHP I;  2A2C A;  4DPU A;  1IBK E;  1XMO I;  1HR0 I;  4LF6 I;  1PKP A;  3ZZ0 A;  4GKK E;  4DR4 E;  2HHH I;  2VQF E;  4Z7Y A;  4DR5 I;  1J5E I;  3OTO I;  1Z0B A;  4DV7 E;  4USK A;  1MG7 A;  4X64 E;  1A6F A;  1H7U A;  4LFC I;  1NZ0 A;  4MYT A;  4PRX A;  3V2U C;  4LF4 E;  4OX9 I;  4LFB I;  2HFU A;  5L3J A;  4JI5 E;  5FLX C;  1FNM A;  3LTO A;  3CWV A;  4I3H A;  4NXM E;  2BM1 A;  4JI0 E;  5A2Q C;  2ZM6 I;  4EMD A;  4B3M I;  4B3T E;  1IBM E;  1EA6 A;  4JG4 A;  1UEK A;  4B3M E;  4DR3 E;  4DUY E;  1XMO E;  1HNW E;  4DV6 E;  4DUZ E;  4UTG A;  4RPF A;  1K47 A;  5IWA E;  4JI3 I;  1D6T A;  1QZR A;  1IBL I;  3J80 Q;  2UUC I;  4JV5 E;  4PU9 A;  5LL6 R;  1H72 C;  4USM A;  4DR1 I;  4NXN I;  4DU8 A;  1DAR A;  1XHK A;  1XMQ E;  2V8P A;  3J80 C;  4DV5 E;  4X62 E;  2UU9 E;  4B3T I;  4JI5 I;  4HXZ A;  3T1Y I;  2BM0 A;  4YY3 I;  4JI6 E;  1NHJ A;  2UXB I;  1NHH A;  1Z0C A;  2UUB I;  4PRV A;  4X62 I;  4DV4 I;  4DV5 I;  4K0K E;  2UXC E;  4JI4 I;  4LF8 I;  4DPT A;  2HK2 A;  2HKJ A;  5LMU I;  3T1Y E;  4DR1 E;  4DPW A;  1I94 E;  2VQE E;  4JI8 E;  1HNZ E;  4DV7 I;  1KVK A;  1MU5 A;  4FWH A;  4K0K I;  4JI8 I;  2V2Z A;  3M6A A;  2UUA I;  4X66 I;  3F0N A;  4JI2 I;  4KHP E;  2UUB E;  2BV3 A;  4HAC A;  4LF4 I;  4DR7 E;  1N36 E;  1FKA E;  1EI1 A;  4NXM I;  1N0V C;  3K1J A;  1ZXM A;  1HNW I;  4JI0 I;  2HKE A;  3ZZU A;  4YY3 E;  4LFC E;  4B3R E;  4HYM A;  4JYA E;  1FWL A;  2A2D A;  3HUL A;  4R1F A;  4LF8 E; 
#chains in the Genus database with same CATH topology
 4JI1 E;  3HJC A;  1Z59 A;  5IWA I;  1PVG A;  4URL A;  2VQF I;  3GLL A;  3WU5 A;  2ZBK B;  4DXL A;  4DV6 I;  3J81 Q;  3LPS A;  2BR2 A;  1HNX I;  1U2R A;  4P52 A;  4FW4 A;  1HNZ I;  1IBL E;  1FI4 A;  2LJP A;  5K36 E;  2O1W A;  3PYF A;  5C0X D;  5GMD A;  3JAM Q;  1Z5B A;  2UUA E;  4LFA I;  2GQ0 A;  3QT5 A;  1HR0 E;  2PNZ A;  1R6L A;  4LF6 E;  2WW4 A;  3H4L A;  5BR8 E;  4JI4 E;  2JEB A;  2BA1 G;  4UT4 A;  2VQE I;  4HAC B;  4GKK I;  3CDI A;  2CG9 A;  2JEB B;  4FW6 A;  1ZXN A;  2UUC E;  3ZKB A;  3P3E A;  1HNX E;  4MU0 A;  4JI6 I;  4DV3 I;  4JI3 E;  1XNQ I;  2CZ9 A;  4GKJ I;  5A2Q Q;  4LF9 E;  1NHI A;  2PO1 A;  3L7Z A;  3PYG A;  2E5L E;  4DR6 E;  2R3V A;  2UXD E;  4FW5 A;  1XNR E;  4IFD D;  2C39 A;  2AJ4 A;  5JEA A;  4FW9 A;  1N0U A;  2PO0 A;  4M1K A;  1KKH A;  1FJG E;  3K85 A;  4X65 I;  4IZJ A;  2Q2E B;  3B82 A;  3WU3 A;  2V2V A;  1Z5C A;  3JAM C;  5BR8 I;  2C38 B;  5K36 F;  1H74 A;  4DUZ I;  3U1Y A;  1PIE A;  4LFB E;  1N34 I;  3B4T A;  5DRP A;  3Q6M A;  4DUY I;  2PNZ B;  5GME A;  2JT2 A;  1IBM I;  1IBK I;  4IFD B;  4BA1 A;  2NPF A;  4AM3 A;  2BA0 D;  2WP8 A;  3OTO E;  4DV0 I;  4DR3 I;  2GS8 A;  2JEA A;  2BA1 D;  1RR9 A;  3P06 A;  5IT9 C;  1UDS A;  2V34 A;  1FWK A;  1YH8 A;  2VF3 A;  2ZIT A;  4OO1 D;  2E1R A;  1B63 A;  1N32 I;  1ELO A;  4LCH A;  5LMU E;  4OX9 E;  1Y4S A;  5EL9 A;  2NN6 D;  2PO2 B;  4MDT A;  4WUB A;  4LF5 I;  1ZM9 A;  1S16 A;  4WUD A;  3ZZT A;  5K36 D;  3B8H A;  4B3S I;  2Z5B B;  2IER A;  4X64 I;  1Z5A A;  4WUC A;  1BKN A;  4LF5 E;  1VI7 A;  4JI7 I;  2PO1 B;  5K36 A;  2UU9 I;  1OJ4 A;  3ZM7 A;  3J7A M;  4AQY E;  2O1V A;  1HK7 A;  4BA2 B;  3PYD A;  3B78 A;  3V5R A;  3M85 G;  2PNM A;  3ZKD A;  1KTV A;  2HK3 A;  3T1H E;  4NXN E;  1N33 I;  4DU7 A;  1FJG I;  2F4V E;  1S4E A;  3K17 A;  5DRO A;  5JEA C;  3QT6 A;  1WUU A;  2O1T A;  2WNR A;  4GQU A;  4OO1 E;  4DV0 E;  4KQV A;  1MX0 A;  2F4V I;  4FWD A;  4LFA E;  1B62 A;  2Z5E A;  4OKG A;  5IT9 Q;  4LF9 I;  4DPX A;  4DV1 E;  2JE6 A;  4DV2 E;  1ZM3 A;  3T1H I;  1KIJ A;  3PS2 A;  2O1U A;  4LF7 I;  2UXB E;  2NN6 F;  4YHH I;  2BR2 B;  2IOQ A;  1Z0T A;  1N34 E;  1H73 A;  2J65 A;  2JE6 B;  3QT8 A;  4JYA I;  1Z0V A;  1N33 E;  3P3G A;  3QT7 A;  2ZM6 E;  4IZJ B;  1RRE A;  4LF7 E;  2V2Q A;  3M7N G;  1Y5Y A;  4HY1 A;  3D4J A;  4FW7 A;  5LMN E;  3UHM A;  4DV1 I;  4DV2 I;  2OI2 A;  2GO3 A;  2WP8 B;  5K36 B;  1N32 E;  1Z0E A;  2J7K A;  4DR7 I;  3WU4 A;  2IOP A;  4DR2 I;  4QNK A;  3GON A;  1OYS A;  4JV5 I;  2EFG A;  1E3H A;  2NN6 E;  4JI2 E;  2VES A;  3Q1Q A;  4B3S E;  4ZVI A;  2Z5B A;  4IS9 A;  2WNR B;  4JI1 I;  1H7S A;  4DR5 E;  2CVE A;  2X7I A;  4DR4 I;  2HFS A;  5C0X A;  4AQY I;  3Q6N A;  4LOM A;  1ZM4 A;  1XNR I;  5DRR A;  4JI7 E;  5FLX Q;  4BA2 A;  1OYR A;  2DEI A;  2X36 A;  5JEA B;  4X65 E;  3CDJ A;  4FW3 A;  1P42 A;  3PYE A;  4OO1 B;  2XEX A;  1N36 I;  1XNQ E;  1I94 I;  1ZM2 A;  5C0X E;  4ED4 A;  4DR2 E;  1Z0G A;  1Z0W A;  5EKW A;  2E5L I;  4P7A A;  3J7A G;  1YHC A;  4FN5 A;  2UXC I;  4B3R I;  4NBQ A;  4X66 E;  2UXD I;  4DV4 E;  5LMN I;  4YHH E;  5DNL A;  4IZJ D;  2O3Z A;  2R42 A;  4DV3 E;  1XMQ I;  5ELW A;  1RHY A;  2DEJ A;  4DPY A;  1J5E E;  3DD6 A;  1XXE A;  1VIS A;  4XTJ A;  3LNU A;  5JEA D;  3PRY A;  4GKJ E;  4Z7C A;  1USU A;  3J81 C;  2HHH E;  4FWG A;  4DR6 I;  2Z5C A;  4MYU A;  3WU6 A;  4IFD A;  4KHP I;  3M85 D;  4AID A;  2A2C A;  4LPF A;  4DPU A;  1IBK E;  2C39 B;  1XMO I;  1HR0 I;  4LF6 I;  2NN6 B;  2F1D A;  4LCG A;  4IFD E;  1PKP A;  4MQY A;  3ZZ0 A;  3GCM A;  4GKK E;  4DR4 E;  2HHH I;  2VQF E;  4AIM A;  4Z7Y A;  3M7N D;  4DR5 I;  1J5E I;  3GME A;  2NN6 A;  3OTO I;  1Z0B A;  4DV7 E;  3NZK A;  4USK A;  1MG7 A;  4OO1 A;  4X64 E;  3PS3 A;  1A6F A;  4MU4 A;  1H7U A;  4LFC I;  1NZ0 A;  4MYT A;  4PRX A;  3V2U C;  4LF4 E;  4OX9 I;  4LFB I;  2HFU A;  4ISA A;  5DNX A;  5L3J A;  4JI5 E;  5FLX C;  5C0X C;  4OO1 C;  1FNM A;  3LTO A;  3CWV A;  4I3H A;  4NXM E;  2BM1 A;  5DRQ A;  3P3C A;  4JI0 E;  5A2Q C;  2ZM6 I;  4EMD A;  4B3M I;  4J3D A;  4B3T E;  1IBM E;  1EA6 A;  1R6M A;  3PS1 A;  4JG4 A;  2PO0 B;  1UEK A;  4B3M E;  4DR3 E;  4DUY E;  1XMO E;  2PNL A;  1HNW E;  3H1C A;  4DV6 E;  4DUZ E;  4UTG A;  4RPF A;  4OO1 F;  1K47 A;  5IWA E;  4IFD C;  4JI3 I;  1D6T A;  1QZR A;  1IBL I;  3J80 Q;  2UUC I;  4JV5 E;  4PU9 A;  5LL6 R;  2C37 A;  1H72 C;  4USM A;  1UDO A;  4QNJ A;  4DR1 I;  4NXN I;  4DU8 A;  1DAR A;  1XHK A;  1XMQ E;  2V8P A;  4IZK B;  2NN6 C;  3J80 C;  4DV5 E;  4X62 E;  2UU9 E;  4B3T I;  4JI5 I;  4U3B A;  4BA1 B;  5C0X F;  4HXZ A;  3T1Y I;  2BM0 A;  4YY3 I;  5FWK A;  4JI6 E;  1NHJ A;  1E3P A;  2UXB I;  1NHH A;  1Z0C A;  2UUB I;  4PRV A;  4X62 I;  4DV4 I;  4DV5 I;  4K0K E;  2UXC E;  2CGE A;  4JI4 I;  4LF8 I;  4DPT A;  4U3D A;  2HK2 A;  2HKJ A;  1UDQ A;  1USV A;  5LMU I;  3T1Y E;  5C0X B;  4DPW A;  4DR1 E;  1I94 E;  1OYP A;  3HKM A;  4MU1 A;  2VQE E;  4JI8 E;  1Y4U A;  1HNZ E;  3P76 A;  4DV7 I;  1KVK A;  1MU5 A;  1Y6Z A;  2GO4 A;  4FWH A;  4K0K I;  4JI8 I;  2V2Z A;  3M6A A;  2UUA I;  4X66 I;  3F0N A;  4JI2 I;  4LCF A;  4KHP E;  2UUB E;  2BV3 A;  1Y60 A;  4HAC A;  4LF4 I;  4N3O A;  3KRN A;  4IZK A;  2AE8 A;  3L7Z B;  2PO2 A;  4IFD F;  4DR7 E;  1N36 E;  1FKA E;  1EI1 A;  4NXM I;  1N0V C;  3K1J A;  1UDN A;  1ZXM A;  5JEA F;  1HNW I;  2Z5C B;  4JI0 I;  5JEA E;  2JEA B;  2HKE A;  3U1K A;  3ZZU A;  4OZE A;  4YY3 E;  2IES A;  4LFC E;  4B3R E;  4HYM A;  4JYA E;  5K36 C;  4MU3 A;  2C38 A;  1FWL A;  2A2D A;  2BA0 G;  3HUL A;  2C37 B;  4R1F A;  4LF8 E; 
#chains in the Genus database with same CATH homology
 4JI1 E;  3HJC A;  1Z59 A;  5IWA I;  1PVG A;  4URL A;  2VQF I;  3WU5 A;  2ZBK B;  4DXL A;  4DV6 I;  3J81 Q;  3LPS A;  1HNX I;  1U2R A;  4P52 A;  1HNZ I;  1IBL E;  1FI4 A;  2LJP A;  2O1W A;  3PYF A;  5GMD A;  3JAM Q;  1Z5B A;  2UUA E;  4LFA I;  2GQ0 A;  3QT5 A;  1HR0 E;  4LF6 E;  2WW4 A;  3H4L A;  5BR8 E;  4JI4 E;  4UT4 A;  2VQE I;  4HAC B;  4GKK I;  2CG9 A;  1ZXN A;  2UUC E;  3ZKB A;  1HNX E;  4JI6 I;  4DV3 I;  4JI3 E;  1XNQ I;  2CZ9 A;  4GKJ I;  5A2Q Q;  4LF9 E;  1NHI A;  3PYG A;  2E5L E;  4DR6 E;  2R3V A;  2UXD E;  1XNR E;  2AJ4 A;  4FW9 A;  1N0U A;  4M1K A;  1KKH A;  1FJG E;  3K85 A;  4X65 I;  4IZJ A;  2Q2E B;  3B82 A;  3WU3 A;  2V2V A;  1Z5C A;  3JAM C;  5BR8 I;  1H74 A;  4DUZ I;  1PIE A;  4LFB E;  1N34 I;  3Q6M A;  4DUY I;  5GME A;  1IBM I;  1IBK I;  2NPF A;  4DV0 I;  3OTO E;  4DR3 I;  2GS8 A;  1RR9 A;  3P06 A;  5IT9 C;  2V34 A;  2VF3 A;  1FWK A;  2ZIT A;  2E1R A;  1B63 A;  1N32 I;  1ELO A;  5LMU E;  4OX9 E;  1Y4S A;  4WUB A;  4LF5 I;  1S16 A;  1ZM9 A;  4WUD A;  3ZZT A;  3B8H A;  4B3S I;  2Z5B B;  4X64 I;  1Z5A A;  4WUC A;  1BKN A;  4LF5 E;  4JI7 I;  2UU9 I;  1OJ4 A;  3ZM7 A;  3J7A M;  4AQY E;  2O1V A;  1HK7 A;  3PYD A;  3B78 A;  3V5R A;  2PNM A;  3ZKD A;  1KTV A;  2HK3 A;  3T1H E;  4NXN E;  1N33 I;  4DU7 A;  1FJG I;  2F4V E;  1S4E A;  3K17 A;  3QT6 A;  1WUU A;  2O1T A;  4DV0 E;  4KQV A;  1MX0 A;  2F4V I;  4FWD A;  4LFA E;  1B62 A;  2Z5E A;  5IT9 Q;  4LF9 I;  4DPX A;  4DV1 E;  4DV2 E;  3T1H I;  1ZM3 A;  1KIJ A;  2O1U A;  4LF7 I;  2UXB E;  4YHH I;  2IOQ A;  1Z0T A;  1N34 E;  1H73 A;  3QT8 A;  4JYA I;  1Z0V A;  1N33 E;  3QT7 A;  2ZM6 E;  4IZJ B;  1RRE A;  4LF7 E;  2V2Q A;  4HY1 A;  3D4J A;  5LMN E;  4DV1 I;  4DV2 I;  2OI2 A;  1N32 E;  1Z0E A;  2J7K A;  4DR7 I;  3WU4 A;  2IOP A;  4DR2 I;  3GON A;  4JV5 I;  2EFG A;  4JI2 E;  3Q1Q A;  4B3S E;  4ZVI A;  2Z5B A;  4JI1 I;  1H7S A;  4DR5 E;  2X7I A;  4DR4 I;  2HFS A;  4AQY I;  3Q6N A;  1ZM4 A;  1XNR I;  4JI7 E;  5FLX Q;  2DEI A;  2X36 A;  4X65 E;  3PYE A;  2XEX A;  1N36 I;  1XNQ E;  1I94 I;  1ZM2 A;  4ED4 A;  4DR2 E;  1Z0G A;  1Z0W A;  2E5L I;  4P7A A;  3J7A G;  4FN5 A;  2UXC I;  4B3R I;  4X66 E;  2UXD I;  4DV4 E;  5LMN I;  4YHH E;  4IZJ D;  2R42 A;  4DV3 E;  1XMQ I;  2DEJ A;  4DPY A;  1J5E E;  1VIS A;  4XTJ A;  3LNU A;  4GKJ E;  3PRY A;  4Z7C A;  1USU A;  3J81 C;  2HHH E;  4FWG A;  4DR6 I;  2Z5C A;  4MYU A;  3WU6 A;  4KHP I;  2A2C A;  4DPU A;  1IBK E;  1XMO I;  1HR0 I;  4LF6 I;  1PKP A;  3ZZ0 A;  4GKK E;  4DR4 E;  2HHH I;  2VQF E;  4Z7Y A;  4DR5 I;  1J5E I;  3OTO I;  1Z0B A;  4DV7 E;  4USK A;  1MG7 A;  4X64 E;  1A6F A;  1H7U A;  4LFC I;  1NZ0 A;  4MYT A;  4PRX A;  3V2U C;  4LF4 E;  4OX9 I;  4LFB I;  2HFU A;  5L3J A;  4JI5 E;  5FLX C;  1FNM A;  3LTO A;  3CWV A;  4I3H A;  4NXM E;  2BM1 A;  4JI0 E;  5A2Q C;  2ZM6 I;  4EMD A;  4B3M I;  4B3T E;  1IBM E;  1EA6 A;  4JG4 A;  1UEK A;  4B3M E;  4DR3 E;  4DUY E;  1XMO E;  2PNL A;  1HNW E;  4DV6 E;  4DUZ E;  4UTG A;  4RPF A;  1K47 A;  5IWA E;  4JI3 I;  1D6T A;  1QZR A;  1IBL I;  3J80 Q;  2UUC I;  4JV5 E;  4PU9 A;  5LL6 R;  1H72 C;  4USM A;  4DR1 I;  4NXN I;  4DU8 A;  1DAR A;  1XHK A;  1XMQ E;  2V8P A;  4IZK B;  3J80 C;  4DV5 E;  4X62 E;  2UU9 E;  4B3T I;  4JI5 I;  4HXZ A;  3T1Y I;  2BM0 A;  4YY3 I;  5FWK A;  4JI6 E;  1NHJ A;  2UXB I;  1NHH A;  1Z0C A;  2UUB I;  4PRV A;  4X62 I;  4DV4 I;  4DV5 I;  4K0K E;  2UXC E;  2CGE A;  4JI4 I;  4LF8 I;  4DPT A;  2HK2 A;  2HKJ A;  1USV A;  5LMU I;  3T1Y E;  4DR1 E;  4DPW A;  1I94 E;  2VQE E;  4JI8 E;  1Y4U A;  1HNZ E;  4DV7 I;  1KVK A;  1MU5 A;  1Y6Z A;  4FWH A;  4K0K I;  4JI8 I;  2V2Z A;  3M6A A;  2UUA I;  4X66 I;  3F0N A;  4JI2 I;  4KHP E;  2UUB E;  2BV3 A;  4HAC A;  4LF4 I;  4N3O A;  4IZK A;  4DR7 E;  1N36 E;  1FKA E;  1EI1 A;  4NXM I;  1N0V C;  3K1J A;  1ZXM A;  1HNW I;  2Z5C B;  4JI0 I;  2HKE A;  3ZZU A;  4YY3 E;  4LFC E;  4B3R E;  4HYM A;  4JYA E;  1FWL A;  2A2D A;  3HUL A;  4R1F A;  4LF8 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...