4DV5I

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g, bound with streptomycin
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 23
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dv5I00
2ZM6I 2ZM6E 1KVKA 4WUDA 1H7UA 4DV2I 4DV2E 2ZBKB 2V2QA 4P7AA 1HNZI 1H72C 1DARA 1N0UA 1NHJA 5LMNE 5LMNI 3D4JA 5IWAI 5IWAE 4MYUA 1XHKA 1RREA 4DV5E 4DV5I 2UXBI 2UXBE 1EA6A 4DR6E 4DR6I 5A2QQ 3GONA 4HACB 2E5LI 2E5LE 1ZXMA 2UUBI 2UUBE 3QT8A 4FW9A 5BR8E 5BR8I 4NXME 2CZ9A 4NXMI 4LF4E 4LF4I 3J80Q 1I94E 1I94I 2GS8A 1ZM9A 4JI4E 4DV1I 4DV1E 4JI4I 5FLXC 2Q2EB 4DR2I 4DR2E 1NZ0A 1N34I 1N34E 2VQFE 2VQFI 3QT6A 1NHHA 1H7SA 3HULA 4LF6I 4JI7E 4JI7I 4JI3E 2UUAI 2UUAE 4JI3I 4DR4E 4DR4I 1KTVA 4USKA 3J81C 4B3ME 4B3MI 5IT9C 1Z0BA 3H4LA 2V2VA 4DV7I 4B3SI 1IBMI 1IBME 2HKJA 4UT4A 1Z0WA 4FWHA 1ZM3A 2HKEA 4LFBE 4LFBI 1OJ4A 4PRXA 4USMA 4JI0I 4JI0E 2E1RA 4LF9E 4LF9I 4JG4A 1FWKA 1FI4A 4DV0E 3PYDA 4DV0I 1RR9A 1Z0TA 4FWDA 1Z0EA 4LF8E 3LNUA 2X7IA 1Z0GA 1N0VC 4PU9A 2OI2A 4HY1A 4JI1I 4JI1E 2HK2A 4FN5A 4B3RE 4B3RI 4Z7CA 4DR3E 4DR3I 2UUCE 2UUCI 1MG7A 4WUBA 2BM1A 3PYFA 5LL6R 4AQYE 4AQYI 4JI5I 4JI5E 1HNZE 4P52A 1S4EA 4DUZI 2XEXA 4HACA 4DV3E 4DV3I 4R1FA 1PIEA 3ZKDA 3V5RA 3PYGA 3J81Q 3J7AG 4Z7YA 1N36E 1N36I 1Z5CA 2V2ZA 3QT7A 3LTOA 4XTJA 1VISA 2HFSA 2DEIA 1N33I 1IBLI 4LF6E 4JI8E 4JI8I 2VQEE 2VQEI 2BM0A 4DPUA 2VF3A 3B82A 2ZITA 1Z5BA 4DV7E 4B3SE 4GKKI 4GKKE 2UU9E 2UU9I 1EI1A 3ZZTA 2EFGA 1B62A 2A2DA 1WUUA 2X36A 4DR1E 1UEKA 4DR1I 3ZKBA 3J80C 1XNQE 2HFUA 1XNQI 4GKJI 4GKJE 3ZZUA 3JAMC 1KIJA 4X66I 4X66E 5LMUI 2LJPA 3CWVA 4DR7I 4DR7E 4EMDA 1PVGA 1HNXI 1HNXE 3M6AA 1PKPA 4DPXA 4WUCA 2HK3A 4DV6E 4DV6I 1IBKE 1IBKI 3WU5A 1ZM4A 1MU5A 1KKHA 1Z59A 1ZXNA 3PYEA 1XNRE 1XNRI 4DPYA 4KQVA 1NHIA 4NXNI 4NXNE 4OX9E 4OX9I 5GMDA 2DEJA 4HYMA 5GMEA 4ZVIA 2A2CA 4KHPE 4KHPI 4DUZE 5FLXQ 1Z5AA 1XMQI 1XMQE 4JV5I 4JV5E 4DPWA 1ZM2A 2BV3A 4RPFA 3F0NA 4LF5E 4LF5I 4JI6E 4JI6I 4K0KE 4K0KI 3V2UC 3B78A 1XMOI 1XMOE 2UXDE 2UXDI 4URLA 3WU6A 5IT9Q 2AJ4A 1N32E 1N32I 1ELOA 2R3VA 4DU8A 1J5EE 2V34A 1J5EI 4I3HA 1N33E 5L3JA 4YY3E 4YY3I 1K47A 1B63A 1IBLE 4DPTA 1BKNA 1H73A 1Z0VA 4PRVA 4UTGA 4FWGA 1MX0A 1FWLA 3JAMQ 2F4VI 3J7AM 2F4VE 1A6FA 5A2QC 4X65E 4X65I 1S16A 4LFAI 4LFAE 3ZM7A 4YHHE 4YHHI 2WW4A 1FKAE 1D6TA 3K1JA 4X64I 4X64E 1QZRA 4DUYE 4DUYI 3ZZ0A 2J7KA 2R42A 1FNMA 3B8HA 3WU3A 4ED4A 4MYTA 4LF7E 4LF7I 1HNWI 1HNWE 4DR5E 4DR5I 4JYAE 4JYAI 1FJGE 1FJGI 4DXLA 1U2RA 5LMUE 2HHHI 2HHHE 4B3TE 4B3TI 3Q1QA 4HXZA 1HR0I 1HR0E 3K17A 4M1KA 4DU7A 2UXCE 2UXCI 4LFCI 4LFCE 3T1HE 3T1HI 2NPFA 3LPSA 4LF8I 1Z0CA 4JI2I 4JI2E 2V8PA 1H74A 3OTOE 3OTOI 3QT5A 4DV4E 4DV4I 3T1YI 3T1YE 4X62E 4X62I 3WU4A
chains in the Genus database with same CATH superfamily
2ZM6I 2ZM6E 4OO1D 1KVKA 4IFDB 4WUDA 4QNJA 5C0XB 4LCGA 5DROA 1H7UA 4DV2I 4DV2E 2ZBKB 2PO2B 2V2QA 4P7AA 1HNZI 1H72C 1DARA 1N0UA 4BA2B 1NHJA 3P3GA 5LMNE 5LMNI 3D4JA 3CDIA 5IWAE 5IWAI 4MYUA 1XHKA 1RREA 4LOMA 4DV5E 4DV5I 5JEAC 2UXBI 2UXBE 1EA6A 4DR6E 4DR6I 3P3CA 1VI7A 4N3OA 3GONA 2PO0B 5A2QQ 4HACB 4IZJB 2E5LI 2NN6A 2E5LE 4IFDC 5C0XC 5ELWA 1ZXMA 2UUBI 2UUBE 4J3DA 2BR2B 3QT8A 4FW9A 1P42A 1Y4SA 5BR8E 5BR8I 4NXME 2CZ9A 4NXMI 4LF4E 4LF4I 1Y60A 3J80Q 1USVA 1I94E 1I94I 2GS8A 1ZM9A 4JI4E 4DV1I 4DV1E 2CVEA 4JI4I 5FLXC 5JEAE 2Q2EB 4DR2I 4DR2E 1NZ0A 1N34I 1N34E 4FW7A 4OZEA 2VQFE 2VQFI 3GLLA 3L7ZB 3QT6A 4OO1F 2AE8A 1NHHA 1H7SA 3HULA 4MU3A 4LF6I 4JI7E 4JI7I 4FW6A 4JI3E 2UUAI 2UUAE 4JI3I 4DR4E 4DR4I 1KTVA 2IOQA 4USKA 3J81C 4B3ME 4B3MI 5IT9C 1OYSA 1Z0BA 3H4LA 1Y6ZA 2V2VA 4DV7I 4B3SI 1IBMI 1IBME 4LCHA 2HKJA 4UT4A 1Z0WA 4FWHA 1ZM3A 2HKEA 4BA1A 4LFBE 4LFBI 1OJ4A 4PRXA 4USMA 4JI0I 2Z5CB 4JI0E 2E1RA 2IOPA 4LF9E 4LF9I 2NN6E 4JG4A 1FWKA 1FI4A 3P06A 4DV0I 1RR9A 3PYDA 1UDNA 2JE6B 1Z0TA 4DV0E 2GO4A 5K36B 2C37B 2Z5BA 2NN6D 4FWDA 1Z0EA 4MU4A 4LF8E 2PO1B 3LNUA 1YH8A 2X7IA 4U3DA 1Z0GA 1N0VC 2C39B 2WNRB 5JEAA 3KRNA 3B4TA 5JEAF 4PU9A 2OI2A 4QNKA 1USUA 4HY1A 4JI1I 4JI1E 5DRQA 2HK2A 4FN5A 4B3RE 4B3RI 3HJCA 4Z7CA 4DR3E 4DR3I 4IZKB 5K36C 2PO2A 2UUCE 2UUCI 1MG7A 4WUBA 2BM1A 3PYFA 5LL6R 4AQYE 4AQYI 4JI5I 4JI5E 2WP8B 2VESA 1HNZE 4P52A 1S4EA 4MU1A 4DUZI 4AIMA 2PO0A 2XEXA 4HACA 4DV3E 4DV3I 4R1FA 2PNZB 1PIEA 5K36E 3Q6NA 2NN6F 3PS2A 1YHCA 3ZKDA 3PRYA 3V5RA 5DNLA 3PYGA 3J81Q 3J7AG 4Z7YA 3P3EA 2C38A 1N36E 1N36I 2IERA 1Z5CA 2V2ZA 5DRRA 3GCMA 3QT7A 3LTOA 2JT2A 4XTJA 3U1YA 2O1UA 1VISA 2HFSA 4AIDA 2DEIA 1N33I 5JEAD 2JEAA 4IFDE 5C0XE 1IBLI 4LF6E 2BA0D 4JI8E 4JI8I 2VQEE 2VQEI 2BM0A 4IFDD 5C0XD 4DPUA 2VF3A 3B82A 1E3PA 2ZITA 1Z5BA 1OYRA 4DV7E 4B3SE 4GKKI 4GKKE 5DRPA 2J65A 2UU9E 2UU9I 1EI1A 4OO1B 3ZZTA 2EFGA 1B62A 4IS9A 2A2DA 1WUUA 4U3BA 3M7NG 2X36A 5K36A 5K36F 4IZJD 4DR1E 1UEKA 4DR1I 3Q6MA 5DNXA 3ZKBA 2GO3A 3J80C 1XNQE 2HFUA 1XNQI 2PO1A 4GKJI 4GKJE 1XXEA 2JEBB 3GMEA 3ZZUA 4FW3A 5EL9A 2C39A 4FW5A 3JAMC 1KIJA 4MDTA 4X66I 2O1WA 4X66E 5LMUI 3CDJA 2LJPA 3CWVA 3M7ND 4DR7I 4DR7E 2O1TA 4EMDA 1PVGA 4OO1C 4MU0A 1HNXI 1HNXE 3M6AA 1PKPA 4DPXA 4IZKA 4IFDA 4WUCA 2HK3A 5C0XA 4IFDF 5C0XF 4DV6E 4DV6I 1IBKE 1IBKI 5FWKA 3WU5A 1ZM4A 1MU5A 1KKHA 5EKWA 1Y4UA 1Z59A 1ZXNA 3PYEA 1XNRE 1XNRI 4DPYA 4KQVA 4BA2A 1NHIA 4NXNI 4NXNE 4OX9E 4OX9I 5GMDA 3K85A 1UDSA 2DEJA 2IESA 5JEAB 4HYMA 5GMEA 4ZVIA 2A2CA 4OO1E 4KHPE 4KHPI 1R6MA 4DUZE 5FLXQ 1Z5AA 1XMQI 1XMQE 2PNZA 4JV5I 4JV5E 3DD6A 1UDQA 4DPWA 4IZJA 1ZM2A 2BV3A 4RPFA 3F0NA 4LF5E 4LF5I 4JI6E 4JI6I 2BR2A 4K0KE 4K0KI 3V2UC 2O1VA 3B78A 5K36D 1XMOI 1XMOE 1OYPA 2UXDE 2UXDI 4URLA 4LCFA 3WU6A 2BA0G 3P76A 5IT9Q 2AJ4A 1N32E 1N32I 3L7ZA 1ELOA 1HK7A 2GQ0A 2R3VA 4DU8A 1J5EE 2V34A 1J5EI 4I3HA 1N33E 5L3JA 4YY3E 4YY3I 1K47A 1B63A 2NN6B 3PS3A 1IBLE 4LPFA 4DPTA 1BKNA 1UDOA 1H73A 1Z0VA 4PRVA 4UTGA 4FWGA 1MX0A 1FWLA 2C38B 3UHMA 3JAMQ 2F4VI 3J7AM 2F4VE 4OO1A 1A6FA 5A2QC 4X65E 4X65I 1S16A 2Z5CA 4LFAI 4LFAE 3ZM7A 4YHHE 4YHHI 2WW4A 3HKMA 1FKAE 1D6TA 3K1JA 4X64I 4X64E 1QZRA 3U1KA 2JEAB 3NZKA 2NN6C 2JE6A 4DUYE 4DUYI 2C37A 2JEBA 3ZZ0A 2J7KA 2R42A 1FNMA 3B8HA 3WU3A 4ED4A 1RHYA 4MYTA 4LF7E 4LF7I 4NBQA 2BA1G 2F1DA 1R6LA 2WNRA 1HNWI 1HNWE 4DR5E 4DR5I 4JYAE 4JYAI 1FJGE 1FJGI 4ISAA 4DXLA 1U2RA 5LMUE 1Y5YA 2PNLA 2CG9A 2O3ZA 2HHHI 2HHHE 4GQUA 4B3TE 4B3TI 3M85G 3Q1QA 4HXZA 1HR0I 1HR0E 3K17A 4M1KA 4BA1B 3H1CA 2CGEA 4MQYA 4DU7A 2UXCE 2UXCI 2BA1D 4FW4A 4AM3A 4LFCI 4LFCE 3T1HE 3T1HI 2NPFA 3LPSA 4LF8I 2PNMA 1Z0CA 4JI2I 4JI2E 2V8PA 1H74A 3OTOE 3OTOI 3QT5A 2Z5BB 2WP8A 3PS1A 3M85D 4DV4E 4DV4I 3T1YI 3T1YE 2Z5EA 4X62E 4X62I 4OKGA 1E3HA 3WU4A
chains in the Genus database with same CATH topology
2ZM6I 2ZM6E 1KVKA 4WUDA 1H7UA 4DV2I 4DV2E 2ZBKB 2V2QA 4P7AA 1HNZI 1H72C 1DARA 1N0UA 1NHJA 5LMNI 5LMNE 3D4JA 5IWAI 5IWAE 4MYUA 1XHKA 1RREA 4DV5E 4DV5I 2UXBI 2UXBE 1EA6A 4DR6E 4DR6I 4N3OA 3GONA 5A2QQ 4HACB 4IZJB 2E5LI 2E5LE 1ZXMA 2UUBI 2UUBE 3QT8A 4FW9A 1Y4SA 5BR8E 5BR8I 4NXME 2CZ9A 4NXMI 4LF4E 4LF4I 3J80Q 1USVA 1I94E 1I94I 2GS8A 1ZM9A 4JI4E 4DV1I 4DV1E 4JI4I 5FLXC 2Q2EB 4DR2I 4DR2E 1NZ0A 1N34I 1N34E 2VQFE 2VQFI 3QT6A 1NHHA 1H7SA 3HULA 4LF6I 4JI7E 4JI7I 4JI3E 2UUAI 2UUAE 4JI3I 4DR4E 4DR4I 1KTVA 2IOQA 4USKA 3J81C 4B3ME 4B3MI 5IT9C 1Z0BA 3H4LA 1Y6ZA 2V2VA 4DV7I 4B3SI 1IBMI 1IBME 2HKJA 4UT4A 1Z0WA 4FWHA 1ZM3A 2HKEA 4LFBE 4LFBI 1OJ4A 4PRXA 4USMA 4JI0I 2Z5CB 4JI0E 2E1RA 2IOPA 4LF9E 4LF9I 4JG4A 1FWKA 1FI4A 3P06A 4DV0E 3PYDA 4DV0I 1RR9A 1Z0TA 2Z5BA 4FWDA 1Z0EA 4LF8E 3LNUA 2X7IA 1Z0GA 1N0VC 4PU9A 2OI2A 1USUA 4HY1A 4JI1I 4JI1E 2HK2A 4FN5A 4B3RE 4B3RI 3HJCA 4Z7CA 4DR3E 4DR3I 4IZKB 2UUCE 2UUCI 1MG7A 4WUBA 2BM1A 3PYFA 5LL6R 4AQYE 4AQYI 4JI5I 4JI5E 1HNZE 4P52A 1S4EA 4DUZI 2XEXA 4HACA 4DV3E 4DV3I 4R1FA 1PIEA 3Q6NA 3ZKDA 3PRYA 3V5RA 3PYGA 3J81Q 3J7AG 4Z7YA 1N36E 1N36I 1Z5CA 2V2ZA 3QT7A 3LTOA 4XTJA 2O1UA 1VISA 2HFSA 2DEIA 1N33I 1IBLI 4LF6E 4JI8E 4JI8I 2VQEE 2VQEI 2BM0A 4DPUA 2VF3A 3B82A 2ZITA 1Z5BA 4DV7E 4B3SE 4GKKI 4GKKE 2UU9E 2UU9I 1EI1A 3ZZTA 2EFGA 1B62A 2A2DA 1WUUA 2X36A 4IZJD 4DR1E 1UEKA 4DR1I 3Q6MA 3ZKBA 3J80C 1XNQE 2HFUA 1XNQI 4GKJI 4GKJE 3ZZUA 3JAMC 1KIJA 4X66I 2O1WA 4X66E 5LMUI 2LJPA 3CWVA 4DR7I 4DR7E 2O1TA 4EMDA 1PVGA 1HNXI 1HNXE 3M6AA 1PKPA 4DPXA 4IZKA 4WUCA 2HK3A 4DV6E 4DV6I 1IBKE 1IBKI 5FWKA 3WU5A 1ZM4A 1MU5A 1KKHA 1Y4UA 1Z59A 1ZXNA 3PYEA 1XNRE 1XNRI 4DPYA 4KQVA 1NHIA 4NXNI 4NXNE 4OX9E 4OX9I 5GMDA 3K85A 2DEJA 4HYMA 5GMEA 4ZVIA 2A2CA 4KHPE 4KHPI 4DUZE 5FLXQ 1Z5AA 1XMQI 1XMQE 4JV5I 4JV5E 4DPWA 4IZJA 1ZM2A 2BV3A 4RPFA 3F0NA 4LF5E 4LF5I 4JI6E 4JI6I 4K0KE 4K0KI 3V2UC 2O1VA 3B78A 1XMOI 1XMOE 2UXDE 2UXDI 4URLA 3WU6A 5IT9Q 2AJ4A 1N32E 1N32I 1ELOA 1HK7A 2GQ0A 2R3VA 4DU8A 1J5EE 2V34A 1J5EI 4I3HA 1N33E 5L3JA 4YY3E 4YY3I 1K47A 1B63A 1IBLE 4DPTA 1BKNA 1H73A 1Z0VA 4PRVA 4UTGA 4FWGA 1MX0A 1FWLA 3JAMQ 2F4VI 3J7AM 2F4VE 1A6FA 5A2QC 4X65E 4X65I 1S16A 2Z5CA 4LFAI 4LFAE 3ZM7A 4YHHE 4YHHI 2WW4A 1FKAE 1D6TA 3K1JA 4X64I 4X64E 1QZRA 4DUYE 4DUYI 3ZZ0A 2J7KA 2R42A 1FNMA 3B8HA 3WU3A 4ED4A 4MYTA 4LF7E 4LF7I 1HNWI 1HNWE 4DR5E 4DR5I 4JYAE 4JYAI 1FJGE 1FJGI 4DXLA 1U2RA 5LMUE 2PNLA 2CG9A 2HHHI 2HHHE 4B3TE 4B3TI 3Q1QA 4HXZA 1HR0I 1HR0E 3K17A 4M1KA 2CGEA 4DU7A 2UXCE 2UXCI 4LFCI 4LFCE 3T1HE 3T1HI 2NPFA 3LPSA 4LF8I 2PNMA 1Z0CA 4JI2I 4JI2E 2V8PA 1H74A 3OTOE 3OTOI 3QT5A 2Z5BB 4DV4E 4DV4I 3T1YI 3T1YE 2Z5EA 4X62E 4X62I 3WU4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZM6 I;  2ZM6 E;  1KVK A;  4WUD A;  1H7U A;  4DV2 I;  4DV2 E;  2ZBK B;  2V2Q A;  4P7A A;  1HNZ I;  1H72 C;  1DAR A;  1N0U A;  1NHJ A;  5LMN E;  5LMN I;  3D4J A;  5IWA I;  5IWA E;  4MYU A;  1XHK A;  1RRE A;  4DV5 E;  4DV5 I;  2UXB I;  2UXB E;  1EA6 A;  4DR6 E;  4DR6 I;  5A2Q Q;  3GON A;  4HAC B;  2E5L I;  2E5L E;  1ZXM A;  2UUB I;  2UUB E;  3QT8 A;  4FW9 A;  5BR8 E;  5BR8 I;  4NXM E;  2CZ9 A;  4NXM I;  4LF4 E;  4LF4 I;  3J80 Q;  1I94 E;  1I94 I;  2GS8 A;  1ZM9 A;  4JI4 E;  4DV1 I;  4DV1 E;  4JI4 I;  5FLX C;  2Q2E B;  4DR2 I;  4DR2 E;  1NZ0 A;  1N34 I;  1N34 E;  2VQF E;  2VQF I;  3QT6 A;  1NHH A;  1H7S A;  3HUL A;  4LF6 I;  4JI7 E;  4JI7 I;  4JI3 E;  2UUA I;  2UUA E;  4JI3 I;  4DR4 E;  4DR4 I;  1KTV A;  4USK A;  3J81 C;  4B3M E;  4B3M I;  5IT9 C;  1Z0B A;  3H4L A;  2V2V A;  4DV7 I;  4B3S I;  1IBM I;  1IBM E;  2HKJ A;  4UT4 A;  1Z0W A;  4FWH A;  1ZM3 A;  2HKE A;  4LFB E;  4LFB I;  1OJ4 A;  4PRX A;  4USM A;  4JI0 I;  4JI0 E;  2E1R A;  4LF9 E;  4LF9 I;  4JG4 A;  1FWK A;  1FI4 A;  4DV0 E;  3PYD A;  4DV0 I;  1RR9 A;  1Z0T A;  4FWD A;  1Z0E A;  4LF8 E;  3LNU A;  2X7I A;  1Z0G A;  1N0V C;  4PU9 A;  2OI2 A;  4HY1 A;  4JI1 I;  4JI1 E;  2HK2 A;  4FN5 A;  4B3R E;  4B3R I;  4Z7C A;  4DR3 E;  4DR3 I;  2UUC E;  2UUC I;  1MG7 A;  4WUB A;  2BM1 A;  3PYF A;  5LL6 R;  4AQY E;  4AQY I;  4JI5 I;  4JI5 E;  1HNZ E;  4P52 A;  1S4E A;  4DUZ I;  2XEX A;  4HAC A;  4DV3 E;  4DV3 I;  4R1F A;  1PIE A;  3ZKD A;  3V5R A;  3PYG A;  3J81 Q;  3J7A G;  4Z7Y A;  1N36 E;  1N36 I;  1Z5C A;  2V2Z A;  3QT7 A;  3LTO A;  4XTJ A;  1VIS A;  2HFS A;  2DEI A;  1N33 I;  1IBL I;  4LF6 E;  4JI8 E;  4JI8 I;  2VQE E;  2VQE I;  2BM0 A;  4DPU A;  2VF3 A;  3B82 A;  2ZIT A;  1Z5B A;  4DV7 E;  4B3S E;  4GKK I;  4GKK E;  2UU9 E;  2UU9 I;  1EI1 A;  3ZZT A;  2EFG A;  1B62 A;  2A2D A;  1WUU A;  2X36 A;  4DR1 E;  1UEK A;  4DR1 I;  3ZKB A;  3J80 C;  1XNQ E;  2HFU A;  1XNQ I;  4GKJ I;  4GKJ E;  3ZZU A;  3JAM C;  1KIJ A;  4X66 I;  4X66 E;  5LMU I;  2LJP A;  3CWV A;  4DR7 I;  4DR7 E;  4EMD A;  1PVG A;  1HNX I;  1HNX E;  3M6A A;  1PKP A;  4DPX A;  4WUC A;  2HK3 A;  4DV6 E;  4DV6 I;  1IBK E;  1IBK I;  3WU5 A;  1ZM4 A;  1MU5 A;  1KKH A;  1Z59 A;  1ZXN A;  3PYE A;  1XNR E;  1XNR I;  4DPY A;  4KQV A;  1NHI A;  4NXN I;  4NXN E;  4OX9 E;  4OX9 I;  5GMD A;  2DEJ A;  4HYM A;  5GME A;  4ZVI A;  2A2C A;  4KHP E;  4KHP I;  4DUZ E;  5FLX Q;  1Z5A A;  1XMQ I;  1XMQ E;  4JV5 I;  4JV5 E;  4DPW A;  1ZM2 A;  2BV3 A;  4RPF A;  3F0N A;  4LF5 E;  4LF5 I;  4JI6 E;  4JI6 I;  4K0K E;  4K0K I;  3V2U C;  3B78 A;  1XMO I;  1XMO E;  2UXD E;  2UXD I;  4URL A;  3WU6 A;  5IT9 Q;  2AJ4 A;  1N32 E;  1N32 I;  1ELO A;  2R3V A;  4DU8 A;  1J5E E;  2V34 A;  1J5E I;  4I3H A;  1N33 E;  5L3J A;  4YY3 E;  4YY3 I;  1K47 A;  1B63 A;  1IBL E;  4DPT A;  1BKN A;  1H73 A;  1Z0V A;  4PRV A;  4UTG A;  4FWG A;  1MX0 A;  1FWL A;  3JAM Q;  2F4V I;  3J7A M;  2F4V E;  1A6F A;  5A2Q C;  4X65 E;  4X65 I;  1S16 A;  4LFA I;  4LFA E;  3ZM7 A;  4YHH E;  4YHH I;  2WW4 A;  1FKA E;  1D6T A;  3K1J A;  4X64 I;  4X64 E;  1QZR A;  4DUY E;  4DUY I;  3ZZ0 A;  2J7K A;  2R42 A;  1FNM A;  3B8H A;  3WU3 A;  4ED4 A;  4MYT A;  4LF7 E;  4LF7 I;  1HNW I;  1HNW E;  4DR5 E;  4DR5 I;  4JYA E;  4JYA I;  1FJG E;  1FJG I;  4DXL A;  1U2R A;  5LMU E;  2HHH I;  2HHH E;  4B3T E;  4B3T I;  3Q1Q A;  4HXZ A;  1HR0 I;  1HR0 E;  3K17 A;  4M1K A;  4DU7 A;  2UXC E;  2UXC I;  4LFC I;  4LFC E;  3T1H E;  3T1H I;  2NPF A;  3LPS A;  4LF8 I;  1Z0C A;  4JI2 I;  4JI2 E;  2V8P A;  1H74 A;  3OTO E;  3OTO I;  3QT5 A;  4DV4 E;  4DV4 I;  3T1Y I;  3T1Y E;  4X62 E;  4X62 I;  3WU4 A; 
#chains in the Genus database with same CATH topology
 2ZM6 I;  2ZM6 E;  4OO1 D;  1KVK A;  4IFD B;  4WUD A;  4QNJ A;  5C0X B;  4LCG A;  5DRO A;  1H7U A;  4DV2 I;  4DV2 E;  2ZBK B;  2PO2 B;  2V2Q A;  4P7A A;  1HNZ I;  1H72 C;  1DAR A;  1N0U A;  4BA2 B;  1NHJ A;  3P3G A;  5LMN E;  5LMN I;  3D4J A;  3CDI A;  5IWA E;  5IWA I;  4MYU A;  1XHK A;  1RRE A;  4LOM A;  4DV5 E;  4DV5 I;  5JEA C;  2UXB I;  2UXB E;  1EA6 A;  4DR6 E;  4DR6 I;  3P3C A;  1VI7 A;  4N3O A;  3GON A;  2PO0 B;  5A2Q Q;  4HAC B;  4IZJ B;  2E5L I;  2NN6 A;  2E5L E;  4IFD C;  5C0X C;  5ELW A;  1ZXM A;  2UUB I;  2UUB E;  4J3D A;  2BR2 B;  3QT8 A;  4FW9 A;  1P42 A;  1Y4S A;  5BR8 E;  5BR8 I;  4NXM E;  2CZ9 A;  4NXM I;  4LF4 E;  4LF4 I;  1Y60 A;  3J80 Q;  1USV A;  1I94 E;  1I94 I;  2GS8 A;  1ZM9 A;  4JI4 E;  4DV1 I;  4DV1 E;  2CVE A;  4JI4 I;  5FLX C;  5JEA E;  2Q2E B;  4DR2 I;  4DR2 E;  1NZ0 A;  1N34 I;  1N34 E;  4FW7 A;  4OZE A;  2VQF E;  2VQF I;  3GLL A;  3L7Z B;  3QT6 A;  4OO1 F;  2AE8 A;  1NHH A;  1H7S A;  3HUL A;  4MU3 A;  4LF6 I;  4JI7 E;  4JI7 I;  4FW6 A;  4JI3 E;  2UUA I;  2UUA E;  4JI3 I;  4DR4 E;  4DR4 I;  1KTV A;  2IOQ A;  4USK A;  3J81 C;  4B3M E;  4B3M I;  5IT9 C;  1OYS A;  1Z0B A;  3H4L A;  1Y6Z A;  2V2V A;  4DV7 I;  4B3S I;  1IBM I;  1IBM E;  4LCH A;  2HKJ A;  4UT4 A;  1Z0W A;  4FWH A;  1ZM3 A;  2HKE A;  4BA1 A;  4LFB E;  4LFB I;  1OJ4 A;  4PRX A;  4USM A;  4JI0 I;  2Z5C B;  4JI0 E;  2E1R A;  2IOP A;  4LF9 E;  4LF9 I;  2NN6 E;  4JG4 A;  1FWK A;  1FI4 A;  3P06 A;  4DV0 I;  1RR9 A;  3PYD A;  1UDN A;  2JE6 B;  1Z0T A;  4DV0 E;  2GO4 A;  5K36 B;  2C37 B;  2Z5B A;  2NN6 D;  4FWD A;  1Z0E A;  4MU4 A;  4LF8 E;  2PO1 B;  3LNU A;  1YH8 A;  2X7I A;  4U3D A;  1Z0G A;  1N0V C;  2C39 B;  2WNR B;  5JEA A;  3KRN A;  3B4T A;  5JEA F;  4PU9 A;  2OI2 A;  4QNK A;  1USU A;  4HY1 A;  4JI1 I;  4JI1 E;  5DRQ A;  2HK2 A;  4FN5 A;  4B3R E;  4B3R I;  3HJC A;  4Z7C A;  4DR3 E;  4DR3 I;  4IZK B;  5K36 C;  2PO2 A;  2UUC E;  2UUC I;  1MG7 A;  4WUB A;  2BM1 A;  3PYF A;  5LL6 R;  4AQY E;  4AQY I;  4JI5 I;  4JI5 E;  2WP8 B;  2VES A;  1HNZ E;  4P52 A;  1S4E A;  4MU1 A;  4DUZ I;  4AIM A;  2PO0 A;  2XEX A;  4HAC A;  4DV3 E;  4DV3 I;  4R1F A;  2PNZ B;  1PIE A;  5K36 E;  3Q6N A;  2NN6 F;  3PS2 A;  1YHC A;  3ZKD A;  3PRY A;  3V5R A;  5DNL A;  3PYG A;  3J81 Q;  3J7A G;  4Z7Y A;  3P3E A;  2C38 A;  1N36 E;  1N36 I;  2IER A;  1Z5C A;  2V2Z A;  5DRR A;  3GCM A;  3QT7 A;  3LTO A;  2JT2 A;  4XTJ A;  3U1Y A;  2O1U A;  1VIS A;  2HFS A;  4AID A;  2DEI A;  1N33 I;  5JEA D;  2JEA A;  4IFD E;  5C0X E;  1IBL I;  4LF6 E;  2BA0 D;  4JI8 E;  4JI8 I;  2VQE E;  2VQE I;  2BM0 A;  4IFD D;  5C0X D;  4DPU A;  2VF3 A;  3B82 A;  1E3P A;  2ZIT A;  1Z5B A;  1OYR A;  4DV7 E;  4B3S E;  4GKK I;  4GKK E;  5DRP A;  2J65 A;  2UU9 E;  2UU9 I;  1EI1 A;  4OO1 B;  3ZZT A;  2EFG A;  1B62 A;  4IS9 A;  2A2D A;  1WUU A;  4U3B A;  3M7N G;  2X36 A;  5K36 A;  5K36 F;  4IZJ D;  4DR1 E;  1UEK A;  4DR1 I;  3Q6M A;  5DNX A;  3ZKB A;  2GO3 A;  3J80 C;  1XNQ E;  2HFU A;  1XNQ I;  2PO1 A;  4GKJ I;  4GKJ E;  1XXE A;  2JEB B;  3GME A;  3ZZU A;  4FW3 A;  5EL9 A;  2C39 A;  4FW5 A;  3JAM C;  1KIJ A;  4MDT A;  4X66 I;  2O1W A;  4X66 E;  5LMU I;  3CDJ A;  2LJP A;  3CWV A;  3M7N D;  4DR7 I;  4DR7 E;  2O1T A;  4EMD A;  1PVG A;  4OO1 C;  4MU0 A;  1HNX I;  1HNX E;  3M6A A;  1PKP A;  4DPX A;  4IZK A;  4IFD A;  4WUC A;  2HK3 A;  5C0X A;  4IFD F;  5C0X F;  4DV6 E;  4DV6 I;  1IBK E;  1IBK I;  5FWK A;  3WU5 A;  1ZM4 A;  1MU5 A;  1KKH A;  5EKW A;  1Y4U A;  1Z59 A;  1ZXN A;  3PYE A;  1XNR E;  1XNR I;  4DPY A;  4KQV A;  4BA2 A;  1NHI A;  4NXN I;  4NXN E;  4OX9 E;  4OX9 I;  5GMD A;  3K85 A;  1UDS A;  2DEJ A;  2IES A;  5JEA B;  4HYM A;  5GME A;  4ZVI A;  2A2C A;  4OO1 E;  4KHP E;  4KHP I;  1R6M A;  4DUZ E;  5FLX Q;  1Z5A A;  1XMQ I;  1XMQ E;  2PNZ A;  4JV5 I;  4JV5 E;  3DD6 A;  1UDQ A;  4DPW A;  4IZJ A;  1ZM2 A;  2BV3 A;  4RPF A;  3F0N A;  4LF5 E;  4LF5 I;  4JI6 E;  4JI6 I;  2BR2 A;  4K0K E;  4K0K I;  3V2U C;  2O1V A;  3B78 A;  5K36 D;  1XMO I;  1XMO E;  1OYP A;  2UXD E;  2UXD I;  4URL A;  4LCF A;  3WU6 A;  2BA0 G;  3P76 A;  5IT9 Q;  2AJ4 A;  1N32 E;  1N32 I;  3L7Z A;  1ELO A;  1HK7 A;  2GQ0 A;  2R3V A;  4DU8 A;  1J5E E;  2V34 A;  1J5E I;  4I3H A;  1N33 E;  5L3J A;  4YY3 E;  4YY3 I;  1K47 A;  1B63 A;  2NN6 B;  3PS3 A;  1IBL E;  4LPF A;  4DPT A;  1BKN A;  1UDO A;  1H73 A;  1Z0V A;  4PRV A;  4UTG A;  4FWG A;  1MX0 A;  1FWL A;  2C38 B;  3UHM A;  3JAM Q;  2F4V I;  3J7A M;  2F4V E;  4OO1 A;  1A6F A;  5A2Q C;  4X65 E;  4X65 I;  1S16 A;  2Z5C A;  4LFA I;  4LFA E;  3ZM7 A;  4YHH E;  4YHH I;  2WW4 A;  3HKM A;  1FKA E;  1D6T A;  3K1J A;  4X64 I;  4X64 E;  1QZR A;  3U1K A;  2JEA B;  3NZK A;  2NN6 C;  2JE6 A;  4DUY E;  4DUY I;  2C37 A;  2JEB A;  3ZZ0 A;  2J7K A;  2R42 A;  1FNM A;  3B8H A;  3WU3 A;  4ED4 A;  1RHY A;  4MYT A;  4LF7 E;  4LF7 I;  4NBQ A;  2BA1 G;  2F1D A;  1R6L A;  2WNR A;  1HNW I;  1HNW E;  4DR5 E;  4DR5 I;  4JYA E;  4JYA I;  1FJG E;  1FJG I;  4ISA A;  4DXL A;  1U2R A;  5LMU E;  1Y5Y A;  2PNL A;  2CG9 A;  2O3Z A;  2HHH I;  2HHH E;  4GQU A;  4B3T E;  4B3T I;  3M85 G;  3Q1Q A;  4HXZ A;  1HR0 I;  1HR0 E;  3K17 A;  4M1K A;  4BA1 B;  3H1C A;  2CGE A;  4MQY A;  4DU7 A;  2UXC E;  2UXC I;  2BA1 D;  4FW4 A;  4AM3 A;  4LFC I;  4LFC E;  3T1H E;  3T1H I;  2NPF A;  3LPS A;  4LF8 I;  2PNM A;  1Z0C A;  4JI2 I;  4JI2 E;  2V8P A;  1H74 A;  3OTO E;  3OTO I;  3QT5 A;  2Z5B B;  2WP8 A;  3PS1 A;  3M85 D;  4DV4 E;  4DV4 I;  3T1Y I;  3T1Y E;  2Z5E A;  4X62 E;  4X62 I;  4OKG A;  1E3H A;  3WU4 A; 
#chains in the Genus database with same CATH homology
 2ZM6 I;  2ZM6 E;  1KVK A;  4WUD A;  1H7U A;  4DV2 I;  4DV2 E;  2ZBK B;  2V2Q A;  4P7A A;  1HNZ I;  1H72 C;  1DAR A;  1N0U A;  1NHJ A;  5LMN I;  5LMN E;  3D4J A;  5IWA I;  5IWA E;  4MYU A;  1XHK A;  1RRE A;  4DV5 E;  4DV5 I;  2UXB I;  2UXB E;  1EA6 A;  4DR6 E;  4DR6 I;  4N3O A;  3GON A;  5A2Q Q;  4HAC B;  4IZJ B;  2E5L I;  2E5L E;  1ZXM A;  2UUB I;  2UUB E;  3QT8 A;  4FW9 A;  1Y4S A;  5BR8 E;  5BR8 I;  4NXM E;  2CZ9 A;  4NXM I;  4LF4 E;  4LF4 I;  3J80 Q;  1USV A;  1I94 E;  1I94 I;  2GS8 A;  1ZM9 A;  4JI4 E;  4DV1 I;  4DV1 E;  4JI4 I;  5FLX C;  2Q2E B;  4DR2 I;  4DR2 E;  1NZ0 A;  1N34 I;  1N34 E;  2VQF E;  2VQF I;  3QT6 A;  1NHH A;  1H7S A;  3HUL A;  4LF6 I;  4JI7 E;  4JI7 I;  4JI3 E;  2UUA I;  2UUA E;  4JI3 I;  4DR4 E;  4DR4 I;  1KTV A;  2IOQ A;  4USK A;  3J81 C;  4B3M E;  4B3M I;  5IT9 C;  1Z0B A;  3H4L A;  1Y6Z A;  2V2V A;  4DV7 I;  4B3S I;  1IBM I;  1IBM E;  2HKJ A;  4UT4 A;  1Z0W A;  4FWH A;  1ZM3 A;  2HKE A;  4LFB E;  4LFB I;  1OJ4 A;  4PRX A;  4USM A;  4JI0 I;  2Z5C B;  4JI0 E;  2E1R A;  2IOP A;  4LF9 E;  4LF9 I;  4JG4 A;  1FWK A;  1FI4 A;  3P06 A;  4DV0 E;  3PYD A;  4DV0 I;  1RR9 A;  1Z0T A;  2Z5B A;  4FWD A;  1Z0E A;  4LF8 E;  3LNU A;  2X7I A;  1Z0G A;  1N0V C;  4PU9 A;  2OI2 A;  1USU A;  4HY1 A;  4JI1 I;  4JI1 E;  2HK2 A;  4FN5 A;  4B3R E;  4B3R I;  3HJC A;  4Z7C A;  4DR3 E;  4DR3 I;  4IZK B;  2UUC E;  2UUC I;  1MG7 A;  4WUB A;  2BM1 A;  3PYF A;  5LL6 R;  4AQY E;  4AQY I;  4JI5 I;  4JI5 E;  1HNZ E;  4P52 A;  1S4E A;  4DUZ I;  2XEX A;  4HAC A;  4DV3 E;  4DV3 I;  4R1F A;  1PIE A;  3Q6N A;  3ZKD A;  3PRY A;  3V5R A;  3PYG A;  3J81 Q;  3J7A G;  4Z7Y A;  1N36 E;  1N36 I;  1Z5C A;  2V2Z A;  3QT7 A;  3LTO A;  4XTJ A;  2O1U A;  1VIS A;  2HFS A;  2DEI A;  1N33 I;  1IBL I;  4LF6 E;  4JI8 E;  4JI8 I;  2VQE E;  2VQE I;  2BM0 A;  4DPU A;  2VF3 A;  3B82 A;  2ZIT A;  1Z5B A;  4DV7 E;  4B3S E;  4GKK I;  4GKK E;  2UU9 E;  2UU9 I;  1EI1 A;  3ZZT A;  2EFG A;  1B62 A;  2A2D A;  1WUU A;  2X36 A;  4IZJ D;  4DR1 E;  1UEK A;  4DR1 I;  3Q6M A;  3ZKB A;  3J80 C;  1XNQ E;  2HFU A;  1XNQ I;  4GKJ I;  4GKJ E;  3ZZU A;  3JAM C;  1KIJ A;  4X66 I;  2O1W A;  4X66 E;  5LMU I;  2LJP A;  3CWV A;  4DR7 I;  4DR7 E;  2O1T A;  4EMD A;  1PVG A;  1HNX I;  1HNX E;  3M6A A;  1PKP A;  4DPX A;  4IZK A;  4WUC A;  2HK3 A;  4DV6 E;  4DV6 I;  1IBK E;  1IBK I;  5FWK A;  3WU5 A;  1ZM4 A;  1MU5 A;  1KKH A;  1Y4U A;  1Z59 A;  1ZXN A;  3PYE A;  1XNR E;  1XNR I;  4DPY A;  4KQV A;  1NHI A;  4NXN I;  4NXN E;  4OX9 E;  4OX9 I;  5GMD A;  3K85 A;  2DEJ A;  4HYM A;  5GME A;  4ZVI A;  2A2C A;  4KHP E;  4KHP I;  4DUZ E;  5FLX Q;  1Z5A A;  1XMQ I;  1XMQ E;  4JV5 I;  4JV5 E;  4DPW A;  4IZJ A;  1ZM2 A;  2BV3 A;  4RPF A;  3F0N A;  4LF5 E;  4LF5 I;  4JI6 E;  4JI6 I;  4K0K E;  4K0K I;  3V2U C;  2O1V A;  3B78 A;  1XMO I;  1XMO E;  2UXD E;  2UXD I;  4URL A;  3WU6 A;  5IT9 Q;  2AJ4 A;  1N32 E;  1N32 I;  1ELO A;  1HK7 A;  2GQ0 A;  2R3V A;  4DU8 A;  1J5E E;  2V34 A;  1J5E I;  4I3H A;  1N33 E;  5L3J A;  4YY3 E;  4YY3 I;  1K47 A;  1B63 A;  1IBL E;  4DPT A;  1BKN A;  1H73 A;  1Z0V A;  4PRV A;  4UTG A;  4FWG A;  1MX0 A;  1FWL A;  3JAM Q;  2F4V I;  3J7A M;  2F4V E;  1A6F A;  5A2Q C;  4X65 E;  4X65 I;  1S16 A;  2Z5C A;  4LFA I;  4LFA E;  3ZM7 A;  4YHH E;  4YHH I;  2WW4 A;  1FKA E;  1D6T A;  3K1J A;  4X64 I;  4X64 E;  1QZR A;  4DUY E;  4DUY I;  3ZZ0 A;  2J7K A;  2R42 A;  1FNM A;  3B8H A;  3WU3 A;  4ED4 A;  4MYT A;  4LF7 E;  4LF7 I;  1HNW I;  1HNW E;  4DR5 E;  4DR5 I;  4JYA E;  4JYA I;  1FJG E;  1FJG I;  4DXL A;  1U2R A;  5LMU E;  2PNL A;  2CG9 A;  2HHH I;  2HHH E;  4B3T E;  4B3T I;  3Q1Q A;  4HXZ A;  1HR0 I;  1HR0 E;  3K17 A;  4M1K A;  2CGE A;  4DU7 A;  2UXC E;  2UXC I;  4LFC I;  4LFC E;  3T1H E;  3T1H I;  2NPF A;  3LPS A;  4LF8 I;  2PNM A;  1Z0C A;  4JI2 I;  4JI2 E;  2V8P A;  1H74 A;  3OTO E;  3OTO I;  3QT5 A;  2Z5B B;  4DV4 E;  4DV4 I;  3T1Y I;  3T1Y E;  2Z5E A;  4X62 E;  4X62 I;  3WU4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...