4DV6J

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a915g
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 14
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4dv6J00
2MEWA 4AQYJ 4X62J 4DUYJ 1IBKJ 4DR7J 4LFAJ 3W1YC 4DUZJ 1N32J 2F4VJ 1HNXJ 3IMQJ 4DR1J 2HHHJ 2MQ8A 1HNZJ 1N33J 3R2CJ 1N34J 1HNWJ 4HHUA 4K0KJ 4X65J 4DV1J 1J5EJ 5LMNJ 2ZM6J 4LF6J 4LF5J 4DR5J 4OX9J 4X64J 4DR6J 4X66J 4DV7J 4LF7J 5IWAJ 4JI8J 5LMUJ 1XMOJ 4NEYA 4DR2J 4YY3J 4JYAJ 4LF9J 2VQFJ 2UUCJ 1HR0J 4JI3J 2UU9J 4JI5J 4KHPJ 1I94J 4JI7J 4B3MJ 4B3TJ 4LF8J 4B3RJ 5FLXU 3J7AN 5BR8J 4LF4J 4DV2J 4V1Ak 1N36J 4DV5J 1IBLJ 4PWWA 4DV6J 4B3SJ 4KYZA 5AJ3J 4DV3J 5IT9U 3T1YJ 2MTLA 4GKKJ 2E5LJ 3D3BJ 1XMQJ 4NXNJ 4JI4J 3D3CJ 5LM7E 4JI0J 3J81U 4DV4J 2UUAJ 2UUBJ 1XNRJ 2UXBJ 4DV0J 2KL8A 4JV5J 1IBMJ 4GKJJ 5A2QU 1FJGJ 4JI1J 4RJVA 2VQEJ 4JI6J 4DR3J 2KVQE 2UXCJ 1XNQJ 4KY3A 3R2DJ 3J80U 3OTOJ 4LFCJ 4LFBJ 4DR4J 4JI2J 3T1HJ 2UXDJ 3JAMU 4YHHJ 4NEZA 4NXMJ
chains in the Genus database with same CATH superfamily
3SYZA 1YZ7A 2VPWB 3GG1A 2OI2A 5BJRA 4M63A 3W9HA 2BJ3A 4ALZA 4R25A 1T11A 3JAMY 3AAWB 3PX0A 2LQ5A 1O8BA 2FC8A 1RAFB 2UUWA 3B82A 4OYXA 4ZJLA 5KOXA 2KJWA 1S97A 4IH5A 1A6LA 2IVMA 3AFGA 1X5TA 5C2CA 2HNYA 2G9OA 2XS7A 2A3JA 1Y7PA 2NXNA 2LQ8A 3K8WA 1RWKB 3DLJA 3CCES 1VC5A 5C24B 1HNZJ 2EFGA 3I5CA 3MPWA 1O5JA 4Y2CA 5K5MA 2NYHA 1ROFA 2BRKA 5F0UA 5BYSA 4W90B 1DZ5A 3GYXB 2M4MA 4L6V3 1VQPS 2J9CA 1PJ6A 1ZS6A 4OYZA 2X1BA 4CM0A 2J7UA 1TK0A 2HQ3A 1RT5B 1GFWB 1NK5A 2Y8YA 3QRPA 4F0MA 1ZPVA 1WNEA 1DTTB 3BGOP 3NBPB 4DR5J 2HFZA 1CS4B 1YQHA 2GGPB 2YKQA 4LBHA 4CNYA 1T9TA 2BE2A 3SMZA 2N7YA 1TK8A 2IRXA 3M2VA 1HPZB 1HBNA 4EI2A 2HZCA 1SH2A 3I31A 3WC2A 3DHWC 1FD2A 1TV6A 4C11A 1HI0P 3SDEA 5KFPA 5KG5A 3T5HA 1XC9A 1MWZA 4I4BA 3LALA 4YR0A 4PWDA 3BS9A 1YSJA 2OPSA 4FP9A 5B0FA 4OL8A 2AJ0A 3CDBA 1JK9B 1RAHB 2UUCJ 1AZSA 4NLTA 4X66F 1DFDA 1QSYA 4XDDA 4ERDA 1GAOA 1U6FA 1V5IB 2OPPB 1HBUB 1DTQB 1NSKL 1SIWB 1JKHA 5EUHA 4CIOA 3MM5A 4K8RA 3VAGA 3CCMS 2FY8A 4OX8A 5F9LA 3H7HB 1LFPA 1XERA 4I2QB 5LOQA 1S4FA 2OPQB 5GAGI 2KFNA 2YNGB 1VBYA 4MT1A 2YX7A 5KFFA 2HGLA 4N7TA 4A8SA 1LWXA 5D77A 5EDWA 2EFPA 4QU7A 3BJYA 2B43A 4LSZB 4L75A 1QVFR 4DG1B 4WXOA 3KUEA 3MFIA 2V4QA 4ELVA 1CJUB 3CJSA 2EPIA 1FFSB 2N3LA 4ECSA 2RS2A 4A8KA 4K4TA 1MROA 1TP7A 4KE5A 3ZZOA 4DFMA 1VRTA 3NGTA 2HFOA 4A8YA 1WG5A 1GEHA 3V6JA 1XWLA 2A0FB 1B0VA 4LT6A 5FDLB 1H7XA 4USTA 1Q5YA 2VL1A 3U1MA 1X31C 2KL8A 3DOMB 3M8PB 3O2IA 2BYCA 1WHWA 3QWPA 4AYBD 4RWWA 2XM3A 3CJ5A 1CLFA 1EQ0A 2VJUA 1EQMA 2C2KB 1MN7A 2C22A 4DR3J 3DU5A 4XDCA 2WSFC 4QWBA 1WEXA 3EJMA 2NR0A 1TVRB 2GNKA 1HYSA 4NCGB 4P7VA 3AXMA 4A46A 2OSQA 5HQMA 3C46A 1UJ6A 1R8AA 2FB0A 3EWGA 2XMWA 2LA4A 1FNXH 4JI1F 4CLLA 2YWKA 3BZQA 3K5LA 1FRIA 4GVBB 1RWPB 2UXDJ 2QLFB 5DJBA 1PG5B 1TL3A 2CRLA 5L1JA 4FF4A 2BJEA 5EWEA 3UVJA 3D6FB 2QRRA 2KYXA 2VBWA 2R7OA 3HKZD 3ILLA 1WKJA 3NCRA 4IO1A 4OQJA 3OSNA 3OL9A 1RWVB 1VLOA 5DG8A 5KFYA 4ZCIA 2BUNA 1DRZA 2C2NA 4X4QA 3OL6A 3MUTP 2DRAA 3DLGB 2XS5A 2MKCA 3DLEA 3DLKA 2GX8A 1H98A 4YDDB 1SL2A 2VOOA 3V5RA 1S76D 3CMQA 2V69A 2WOMA 3W5YA 5HN0A 1OIAA 2PDAA 5CYJA 4WK3A 1U47A 1IXKA 4N41A 4GKKF 5KG2A 1S6QA 3MHYA 5DZ6A 3TAMB 1M5SA 2LCWA 5DDOC 3IM9A 1NXIA 4NA2A 2E9TA 4C98A 1VDHA 5ETLA 3FZ2A 3R3TA 4DXLA 1Y10A 4ZN1A 2XHCA 3DOLB 3K8VA 4HH1A 4OHWA 2AGQA 3LPEA 2C2MB 1N36F 4O3SA 3DNCA 4PXDA 2ZH8A 4DV1J 1C1BA 1BWVA 3FFIA 4ELUA 4U96A 3PYFA 3G6XA 2KT2A 2FLNA 3CIZA 4KHRA 3A4TA 2ZHAA 1T02A 1HNIB 3R97A 3K59A 1HBOB 1VRTB 1D9AA 1MROB 1HW8A 4KRWA 4JI5F 2W4CA 3E3XA 3CMAS 1N5QA 1S1UA 3M8YA 2OHDA 3FMWA 5KG0A 4PQUB 4RZRA 1FDDA 1H6KX 3TEHB 2F8HA 3DRSA 1ZPWX 1WC4A 2MHNA 2J7WA 4HTIA 3H0PA 4Q44A 4F4ZA 4JI5J 3G2XA 1EB0A 1L3KA 1Q8LA 2CQ2A 2JSXA 4P2XA 1JJCB 1NH8A 2RRNA 2YX1A 2ZM6F 1RQ0A 6FD1A 3RB6A 3PACA 2IC3A 4MYTA 2VHGA 4K4UA 4FYWB 2VG7A 3UDCA 4EO6A 4RKUC 3BQ2A 4DV2J 3HDSA 3WX4A 1XNRF 4P72A 5A76A 3EPGA 2G2YA 4K0KF 2HQIA 3JTPA 3N01A 3MEKA 4U6PA 1N6QA 2J6SA 3C6TB 1UVLA 2RNEA 3GJQB 2O1PA 4QBUA 3PZPA 2YNFA 4MJKA 5F9NA 1PC5A 4NX9A 3OL8A 2VA3A 4J37A 3CCVS 1S9EA 2PMZD 2OD6A 5T41A 2W9BB 3D68A 4DMZA 1FO1A 2HEKA 5CXTA 3FRZA 1S0VA 1IJFB 4B9LA 2YPYA 3IAS9 2B51A 1WWHA 1CQNA 3GYGA 1UFWA 3VZIA 2W2PP 3M2VB 4BS2A 3J81U 3UCGA 2VPYB 3KLGA 1RKIA 2BA9A 1OPIA 3H2VE 2FVPA 1EKRA 1B64A 1NPKA 5FIIA 3GMGA 1FEHA 1GH8A 4ZLLA 5I42B 3N6MA 1V3RA 1WOSA 4DV0J 7FD1A 4YEAA 2FJAB 3D6HB 3KLGB 1PBAA 5E3CA 1EJ7L 1IBMJ 2Z4PA 5DLGA 5ETPA 3NMAA 1F2GA 3CCRS 3S8SA 1T9VA 2RB7A 2R8IA 3K0JA 4LF9F 1CG2A 3MECA 4DQRA 2ATLA 1T94A 1MMNA 2OUGA 2VASA 3KWMA 3G82B 1UVMA 4OI4A 1RTHB 3DDIA 3L09A 2VC1A 1IVZA 4YUDA 1WHVA 1NM2A 2DNQA 4WKRA 3HVAA 2DR7A 3D5MA 3TQ1A 2F5GA 2VFVA 3UDEA 1RBLA 1N6QB 1RWOB 3MDFA 2ZOGA 3K5NA 3RRKA 1U2RA 4DN0A 3KUGA 4USUA 2CJKA 4AL5A 3SSRA 2GIRA 5ETSA 1M5VC 4ZIWA 1NK9A 2LA6A 5KFIA 4M94A 1U09A 3KK1A 2QYGA 3KOAA 3MR2A 1YVFA 3LAMA 1BLUA 1UCNA 2NCKL 2YKPA 3R7NB 2YWEA 3BSOA 2CQ0A 4NXMJ 4U8YA 4ED3A 1SH3A 2DH9A 4TQRA 1ZZNA 3LUYA 2M2BA 1HD1A 4YN3B 2AIRB 4KT0C 1CQMA 1REVA 5MLCV 3AODA 2I2YA 1RTJA 3AQOA 2L41A 2ZH7A 3V6HA 5I3UA 3QATA 2JRSA 2HWTA 4LFAF 4DR1J 5C5JA 1VQLS 4ZITA 5D3GA 4ZN3A 2ZZNA 1HBOA 2MQ8A 4DUYF 4TKTA 3EZUA 4DUZF 3OTEA 4Q0BA 2HSEB 3UCZP 5EWFA 1NEEA 1IBKF 1DAXA 1FX4A 4GC6A 2JVRA 2I0XA 5CYQA 2AD9A 1C0TB 1S0MA 1RT6B 3RYLA 3VAFA 4MYUA 5DDQC 4D3GA 3BEGB 2HURA 1SH0A 2DGQA 3PR5B 2WSCC 4F0HA 4JV1A 5IFMA 3DOLA 5LMNJ 4OZ3A 2ERRA 4IOCQ 5LSRA 3M9NB 4ED5A 2K3KA 1K47A 5IQ6A 3E2EA 4OYMA 1TL5A 4CH0S 3EXCX 4H4OB 1S6QB 2MXYA 3PVXA 1B99A 2CPEA 5KFZA 3GFYA 2RQCA 1SKSA 2E44A 3KJQB 3VQTA 4KO0B 3DLKB 4JYAJ 2R8KA 3OJSA 1RE1B 2GVZA 1K1QA 3U02A 3LQVA 5G4DA 4JI8F 1TELA 4YDXA 1HL6A 4AE5A 1GMWA 5BXIA 2CPZA 2UU9J 1DJ0A 3R5DA 3ZTOA 1X7VA 2R8GA 4LF7F 1IKWB 4EEYA 3GSDA 2Y3YA 3FK4A 2LP4A 1PO6A 4OZ1A 3TA0A 3UNYA 4F67A 1CC8A 1X4EA 1HWUA 2D74B 2EWHA 3DMJA 2GJFA 2MKKA 2OJ3A 4C4WA 1WDDA 2M88A 2JLEA 3BBBA 3LP2B 3RG6A 1SJRA 4NCGA 4PWWA 3U1NA 2JEIA 4JI4F 1TK5A 3ITHA 1KKHA 4Z2XA 2ROGA 3GG0A 5HJXA 3E01B 1HBMB 5AJ3J 4WF9Q 4LJMA 2YTCA 2YKMB 1NPPA 1SUQA 3MZIA 5HMXA 5EN1A 4CLSA 3IP0A 5B7WA 3OLAA 1RCXB 2CZVC 3NAHA 1RHJB 2GVDB 3C8YA 4NXNJ 3FDSA 1FWKA 1S1WB 3GU0A 3H5YA 3DOMA 3M8PA 1RBOB 4YOEA 3ISNC 2V4JA 2HKEA 3C6UB 4ENOA 3GIJA 3I56S 2ZBIA 3BSCA 1XR6A 2X1GA 1VR6A 2VOPA 1MSWD 2IPOB 2JFDA 4MAKA 1S4EA 1UL3A 4BWJA 1S77D 2DO0A 3MR7A 4OX6A 3W63A 3ZZTA 3BR8A 5A2QU 3SZ2A 2N4CA 3N6LA 3IAM9 1HQ2A 3OR1A 5C25B 2Z30B 1YKWA 2KRBA 3NXZA 3PYEA 2VKRA 2FJXA 2BKNA 4HDHA 2PO4A 3QIPA 3JQMA 3N9UC 4H4MB 2AYGA 4O3OA 3LA0A 2VKZG 4F50A 1RAJA 2R2RA 2E9ZA 1UAWA 2HVDA 3W65A 1XK8A 1MLAA 3GB0A 3MMCA 4DQPA 1NBEB 3FSXA 1Y9OA 4TY9A 1JMTA 2EXUA 3FEYB 4DPXA 1M1GA 3J7ZT 3DYAB 4AFFA 1N48A 4F4KA 3CJ3A 2GMHA 2HZAA 2YNGA 3W60A 3ZTQA 4FS1A 2M5YA 3FUYA 2QJ3A 3O3LA 4NMLA 3KJVA 2DRBA 4KJIA 2IIHA 1UMJA 4KR0B 4IDKB 4NRUA 4JI0F 3EYZA 1HBUA 1IBCB 2PMHA 4KIAA 1AZSB 3CJ8A 3ADAC 4DUYJ 3R1HA 4Q2LA 1T9XA 4QIVA 4PYDA 1LW2A 1H74A 3C16B 3KFWX 3W2VA 4CO5A 3NNCA 1HW9A 3CD0A 3PFOA 1JLFB 3TYTA 1Q5VA 2XWYA 4MIAA 2CQPA 3H2LA 5HMZA 5J2PB 3GILA 3ETOA 3KMSA 2HNZB 3BO4A 1HNXF 1SKUB 3FVYA 4URGA 5EGYA 4ZLNA 2QZ8A 1IR1A 2KI2A 3AD7C 5E7OB 2BRLA 4USHA 4ZP9A 3C14B 2DR6A 1P1TA 3N0VA 2AEJA 2EK1A 1K9MT 2QN6B 1RT7A 2QFJA 1WKLA 2IDLA 2VG6B 2B9WA 1UVIA 4KBIA 4AXJA 1RAIB 1N34J 5DM7Q 3UI3A 2H65B 2NXJA 1X4AA 3C66A 3KG4A 2F3JA 3F41A 1SXLA 2VFRA 3JSRA 4KPCA 1ZETA 1M5OC 2K1RA 3A3NB 2XGQA 4KGMA 3BREA 4DL3A 4CLZA 1RTDA 3CC2S 3Q24A 1X60A 2EFNA 4ZJOA 4DR4F 4JI8J 2HK2A 1I94F 3CXCR 5IM0A 1FCAA 2IM1A 2K7JA 1FTRA 4DR2J 1FNMA 2V0NA 1NJXA 4TYBA 1S1XB 1U0HA 4RO0A 2FGOA 2H54B 4NYPA 4WYWA 4WE1B 5A8KB 1ZAWA 1B4SA 2G2OA 2EVZA 4N5SA 4KHPJ 1MMDA 3CO0P 4KC5A 1MWQA 2XCPA 4J9SA 5E3PA 3IM8A 1WUUA 1IKYA 5LMNF 2NPIA 2AWZA 4ECZA 1SKRA 1JLCA 3B54A 3B8HA 1YJWS 3O44A 3ET6A 1VQSA 5DQHA 4PRFA 1LNQA 3F56A 5GAHU 5HSPA 5ETKA 2XCAA 4HH0A 4LSLB 4DV1F 4O4GA 2CZ9A 1JXVA 4Y28C 2DR9A 1ZBTA 2K3IA 3HT0A 3MCNA 3GV8B 5HLFB 1WORA 4ZDNA 3FQKA 3RRGA 3HVTB 3E8OA 1A7GE 1Q53A 2G1HA 4RU9A 4PG4A 4UW2A 4ZA1A 4DV6J 2ATCB 3R7BB 4LSNA 3EXYA 2F4VF 1JNZB 3EICA 4LSLA 4CLPA 2ADBA 4OLPA 2DHAA 2B7CB 2FGCA 4HT5A 2AJ2A 3PO4A 1QE1B 1RT2B 1UEKA 2FJEB 2VZ9A 4YB7A 4FBTA 2R7XA 1FRLA 1RJJA 1DLOA 1IWAA 3FEXB 3IR6B 3K7RA 4QR1A 3TUIC 4F3QA 3D3BJ 4QPXA 3T1YF 2YKOA 3JSYA 3CCJS 3EGZA 2VD3A 4WFZA 4NE9C 4A47A 4DEZA 2HHSA 1QD1A 1TR0A 2P8IA 3DOKB 3MPVA 1S72S 2KZZA 2VFTA 1X4HA 2NSBA 3NNAA 3HFZB 4R8UB 1NK6A 1F5CA 2AHOB 2MZTA 3ISZA 3VV2B 1U25A 2CPXA 5J2QA 1NJZA 4BC9A 1VRUA 2GJ2A 1KLNA 4GC7A 4K4WA 3W9IA 3C15A 4O3NA 1NAQA 2RRBA 1LW0B 4CDIA 3IFEA 5HP1B 1KWMA 5KG3A 1R89A 4RNHA 2CPFA 3EVMA 4HYKA 3OHBA 2AV5A 1I5OB 3H59A 4O4RA 2BJDA 4DL4A 5FJ4A 2DNPA 5A6WA 2GAGC 2I8EA 2I1RA 2W7AA 3I0RB 4F2RA 3H2UB 5DRKA 3K5MA 4UQTA 2R2UA 2COLA 5ETRA 2LLZA 2HVIA 3THTA 4DX6A 1L3UA 5J2PA 3TARA 2EFQA 4LREA 2ILZA 1P9YA 2U2FA 4DV0F 2MKYA 2AZ3A 2V94A 3Q2SC 3KHHA 3V6KA 5DS7A 3PW4A 5LSLA 5EWGA 4LR7A 1B3TA 2XZWA 1WF0A 1VLYA 1ITPA 2HQDA 4M5HA 3BGUA 1U6ZA 3GCWP 1FWLA 2C2OB 2GAHC 4IDKA 3BH7B 3G8TA 3Q8YA 1VIXA 2J5AA 3FBBA 4WYLA 5KFOA 2AGPA 2E5LF 3J7A1 1NDCA 3OT9A 4IH6A 1TAUA 3M4XA 1YWXA 3IO1A 1ZM2A 1GK8A 3AT1B 2XSJB 1BD6A 3HFVA 5KG1A 1VIOA 4PXEA 4OV6A 3W2WB 1NLKL 5H1SV 3BO3A 3OFEA 1QUPA 1T05B 4FF1A 4HHJA 1FEEA 1RACB 4C6AA 5LJ5Y 1TTHB 1K44A 2PC6A 3ENWA 4CO4A 3PR4A 4NLWA 3PXGa 5B0AA 4UOHA 4RUHA 1OPZA 1RXOB 1UPMB 2OKQA 3BGFA 2CXEA 4H4MA 4NRTA 3Q8RB 3G96A 4DS4A 5JJBA 3MPUB 4XAKA 2PGCA 3LH2S 4K5RA 1CC7A 4CNZA 1LXJA 1YJ9S 3HULA 1S48A 4J91A 2Z2LA 4DV7J 2D9OA 2DNKA 4KKOA 2ZEJA 4NLXA 5ADZA 1R8PA 2EC2A 1F2HA 4ECRA 1HARA 1R0AB 1FRKA 1OSDA 1MU2A 3VF0B 4JUZA 3RBDA 8RUCA 2UUCF 4KTQA 2UV8A 3ZC4A 1BQNA 3TUPA 4DCPB 3NAIA 1BUXA 1WEZA 3M32B 3OTDA 3PY8A 3PX6A 4WTYA 2JFKA 3PJXA 2CFXA 4OX9F 5KFDA 1IBMF 2RKIB 3IWNC 4ICLA 3KLVA 1TKZA 2B6AA 4OZNA 4ZKAA 3NOGA 2DO4A 3LANA 3E01A 3GV5B 3MMAA 3MEGB 2XMTA 3RB0A 2MZ1A 2MKHA 3GJRB 5CQGA 4DV4F 3HHLA 3LP2A 2JEFA 3TANA 5GADI 3C15B 2F8MA 3H8YA 3D9BA 1UA0A 1N5YB 2HHHF 5B08A 2RQKA 3R7SB 1RYSA 2J76E 3PCOB 4CI0B 5IT9U 3HMJG 2DNYA 1VCTA 2FYXA 2MTLA 1X0FA 4MIBA 2LFVA 3VGUA 1R31A 4R8UA 4W92B 2JH3A 4ZK7M 2LVWA 2V68A 3UD5A 2NS1B 4MFBA 3D7SB 1H2UX 4TNOA 5LM7E 5C7PA 4OHVA 2H9ZA 3AY0A 4M5DB 5KT4A 4KHMA 4DSLA 3US5A 3CCUS 4JI0J 2QV6A 1VRQC 4FXVA 4ETZA 2VA2A 5IS2A 3C3LA 2WVBA 3M05A 3ZZZA 3E51A 3CCTA 5KFLA 4GO5X 2EI5A 2M8DB 2MHEA 1SC4B 2W2MP 3FCWA 5BYRA 1XNRJ 1QE1A 1RDRA 4QWCA 2DNRA 4DLEA 2UVRA 2OTJS 1H73A 2J0SD 4CYUA 3AD9C 4M5DA 2DNOA 2BW7A 1D8YA 1Y0HA 1XN9A 2FZGB 5ETVA 3Q8PB 3M8ZA 4ER8A 2Y1JA 1KTQA 3O6QA 4IR9A 3DI6B 4QZVB 2QG9B 4P10A 3TUJC 2NSCA 2GZOA 1W25A 2V50A 2CQ4A 3MM8A 2E5IA 3H4BA 5HLFA 2DIUA 2EG2A 2QYCA 1VFJA 4PG6A 2R7QA 2YNHB 2ACYA 2C2EA 1YJUA 5CYMA 2C28A 2JOQA 3W8GA 4LVNP 4O0NA 2EBEA 1WD6A 5CYQB 4C7QA 4CO0A 4FS2A 1LEOA 2FJDB 4HACA 2LXFA 1G1XA 4LFCJ 5KFAA 2QMXA 3D2WA 1S12A 1CJVB 1HQEB 4PKDB 1IQZA 2R7WA 1WOPA 1Q8KA 3HLUA 1S49A 1CULA 3OTCA 2PI5A 1TUGB 4ES3A 2PA3A 5K8MA 5L9NA 2O5DA 2KG1A 1DY3A 4ZPWR 1YRTA 4EYHB 4LVOP 4R0JA 1X0PA 4IFVB 3ZZPA 1HA1A 3QSYB 1X5OA 3T6BA 4L72B 2CG4A 5F8IA 1M1KT 2FDNA 1N33F 2MB0B 1VHFA 2BACA 4LFAJ 4HL9A 2R4FA 3W1YC 4C0HA 2GHPA 4X4UA 3R5AA 1ZM9A 4GRSA 1U1NA 1SV5A 1S7IA 1SI9A 2K1RB 3B78A 4Y2MA 3CJKA 1L5UA 1VC0A 2OIHA 3GSIA 4Q8EA 1EP4B 1FKPA 2XZDB 3R5BA 1NKCA 3C19A 4B3SF 1JB0C 3R6GB 4BBYA 1Q82T 1FJ7A 3RRHA 2ZBRA 2QLBB 1HIYA 1N5VA 4WPAA 4AL6A 2J6TA 1UVNA 1TQLA 2R7VA 3RR7A 2PN6A 1RTHA 2RF2A 3AJ1A 4LRBA 4HHUA 3GQCA 4UZBA 4K0KJ 2AF6A 2RH3A 3DRPB 3ZZ0A 4ECXA 1X5PA 4OX7A 4LF5J 2ZBQA 4YB5A 3W2VB 1HR0F 2XG8A 5IWAJ 3NS5A 1RHKB 4NLQA 1XMOJ 2XSJA 2FVCA 1XNQF 1MW7A 1LWFB 2DTJA 3P5TL 1VOMA 3UFCX 5IV4A 3TZYA 1YRUA 3D28A 4WFXA 3D67A 2WW8A 3IRWP 3DRRA 5LMUF 1WG1A 5HROA 2BVZA 3PKMA 3TWZA 3LGMA 1VISA 1NJYA 2IMWP 1Q81T 1ZTTA 5GVQA 1RU1A 1X4DA 2NQPA 1IR0A 3VCDA 5J1NA 4N56A 3Q8SB 1AA1B 3BBFA 3TQEA 2RHQB 1WDTA 2ZC4A 5AE2A 3EDRB 2J9EA 4IO9Q 3FEZA 4NLGA 2GW8A 2AJ4A 2J0WA 2O01C 3MM9A 4MK9A 3OR1B 2N82B 3JQJA 2FJBB 4E0DA 4FVCA 2EFVA 1UJ4A 2R7UA 4PZVA 3T1YJ 2F7VA 2RVJA 3SCJE 3TA1A 4B9TA 2ZITA 1NO8A 1LW0A 2MLXA 1CJKB 2OELA 3HHLC 4ZIVA 4A8WA 1SVDA 2V4JB 3C6UA 1XMQJ 1QLNA 2LEBA 2LU1A 4FYXB 4OJGA 3DRSB 3RZAA 2FVQA 2M8HA 2R7RA 3M8WA 1RHMB 3WHIA 2CQ1A 4LR8A 4WWSA 4J9MA 4DV2F 4RX6A 1S0OA 1FXDA 4O3RA 2OEKA 4QYRA 4CTAA 3FCHA 4YMEA 1RT3A 3PEJA 3DOKA 2LEAA 2RIJA 2MY8A 1L3TA 1HNIA 4KH0B 3PKYA 2CJAA 3LTOA 4RLEA 2YVSA 4RJVA 3KLFB 3RAQA 1D3WA 4XTTA 2KN4A 3R5GA 2XY6A 2MJNA 2G0IA 2XQCA 3LO3A 2HFNA 3DMJB 4UUXA 4PPZA 2MZRA 2AT1B 2AKWB 2ZHOA 4ZPAA 3RBZA 2RDJA 4IRDA 1OS5A 1HHQA 2IDEA 5A8WA 3CJ4A 2AGOA 5AXKA 1X8DA 3LP1B 1F9FA 3GYNA 3OUYB 1H0HB 3V6DB 5HBMA 3NL0A 3H25A 2BE7D 3F44A 2W4DA 4IG0A 3TR5A 2MQPA 2AX1A 3J7YI 1YJNS 3ENVA 4NZ7A 2H4YB 4DV7F 1KNZA 4DR4J 5F8NA 3IRXA 4OHYA 2QA2A 4OJHA 1NRKA 3LP0A 4DPYA 1U1KA 3BM7A 2KM8C 3KLEA 3NMRA 3GIMA 2P9EA 4KGKA 4EU0A 2DJWA 1XMQF 1HNZF 2OO4A 2KFZA 4IG0B 2HVZA 4Y65A 1ACMB 2RDDA 1SCJB 2E5GA 2HIYA 3L95X 4WE1A 5A2QY 3LWLA 3SEOA 1VC6A 1VQ5S 2ZOMA 4FVMA 1S1XA 1AROP 4DUZJ 1IWGA 2GO8A 3CJ2A 4LIRA 4CH1A 3JB9k 1OY6A 2WONB 4JB8B 4ZP8A 3VZHA 4OZLA 2RMLA 5IM0B 3JYTB 1FERA 4CRJA 1BC6A 1C0TA 2CPJA 1FKOA 3HJVA 5KFNA 2VBXA 2HYIB 2BW2A 3KLFA 3OBIA 2C2DA 1X4GA 2NZCA 3GIKA 4ED8A 4Y2AA 3UWTA 3ZTSA 2V9WA 4X62F 2OFGX 4LQ9A 4CLYA 4Q0BB 2VBZA 3SXLA 3OVBA 2ZBCA 3H5UA 2XWXA 4DZDA 2ZH6A 5D3GB 1RT1A 5I3UB 4RU2A 1RADB 4NXMF 2ZM6J 2APOA 3M8RA 2UXDF 1GQEA 1REVB 1JQGA 1DARA 1RT7B 2DISA 2UV8G 3QFWA 3QQCD 4X66J 2Z2MA 3L3CA 1PYSB 1Z4UA 3C14A 1F9HA 4TN2A 5ETOA 3BF4A 3GPAA 3F73A 4ZCMA 1YITS 4ILLA 4NMXA 2XO7A 1R8BA 4KSEB 5D0RA 2I5JA 5JVGQ 3FQLA 4ED1A 3O5TB 4M95A 2W25A 2H5EA 4OFZA 6FDRA 3UR0A 4WJBA 1L3VA 3UPFA 4MTPA 1TMMA 3Q0AA 4LR9A 3TJ9A 2BDPA 3W62A 1E6YA 2PSZA 3CIMA 5KFCA 4C3MA 4ED0A 3RBXA 2XS2A 2D9PA 2IM2A 5GMKa 3HD1A 1FA0A 1HQUB 1KS2A 1Y11A 2CNNB 2EK6A 2M3DA 5ETTA 5HANA 3TO8A 4DG1A 2G4BA 2YWGA 2BE9B 1Y5LB 3AH6A 5D4PA 2KB2A 4L3NA 1N36J 2PMWA 2CADA 2OAUA 4FYVB 4DSFA 3HSGA 4C8OA 4A8MP 4AT1B 4DV5J 2CQCA 1WI6A 1N52B 4LBPA 1YJVA 3ZO7A 4BHQA 2G2ZA 2QLJB 3B4DA 3PJ9A 3CCQS 3GP9A 1C2PA 1HFEL 1FRMA 4ECQA 4I2QA 1U48A 1URNA 2LXUA 3SFUA 4GKKJ 1AXQA 2LQJA 2EW9A 1MMLA 1GTHA 1FDBA 3W9JA 2CDRB 1ZH5A 5H9EK 1UTAA 1ICEB 3IN5A 3W5XA 2V4RA 3BH6B 3JQKA 2XO6A 1IBLF 1QSSA 5T14A 4AXIA 4WXWA 2ZZMA 2DNHA 3BYPA 2Y0BB 2FJWA 4PXCA 2HFSA 4ZHRA 3I5BA 8ATCB 2W9BA 3KTQA 1S9EB 2FTRA 4A48A 3H4DA 5EHHA 1AYEA 1S1WA 2F1FA 1KD1T 4CLFA 1JLBA 4J90A 3Q23A 2BE2B 4EBDA 4K59A 2GVDA 2H1YA 4C0BA 3NBPA 4NLSA 3SV4A 1JLAB 4RNMA 1RT5A 1DBDA 2YKMA 1B0PA 1HKAA 4P73A 1BHNA 1EP4A 1FKPB 2KXFA 2UXCJ 1R8HA 3SCLE 3K2YA 3I9V9 2XEXA 3ITHB 3EMTA 3W7BA 1CBKA 1SC3B 2GHVC 5DM6Q 3KUHA 2HHUA 1T03B 2Q3PA 1GX6A 2BMBA 4M5GA 2HAIA 4CCHA 3KK2B 1UZDA 2VFSA 3KK3B 4GKJF 3LGHA 1TFWA 5D4LA 4JV5F 3JYTA 3EE3A 3J7YU 4U95A 2MLYA 2HS4A 3CCZA 1OO0B 4GO7X 4IFVA 2WTFA 2VJVA 2MQLA 4C8MA 3K17A 4Q5VA 1AUDA 1IM6A 3NWRA 3ZZYA 4N47A 5DETA 3G6VA 1KONA 3G71S 3HO1A 4PQUA 1A9NB 1QJHA 2KKHA 2L9NA 2VUGA 4USVA 3M9OB 2CPIA 2XLKA 3KKFA 4WTOB 3SI8A 4UZCA 1IUJA 2NREA 3WC0A 2W4PA 3MEDB 2WCXA 1FF2A 4I6AA 2DVIA 1LK5A 3BBCA 3LP0B 2FZKB 3MM7B 1SQEA 3IRXB 1V6HA 2N3OA 3VAKA 5CYMB 2F4VJ 4DX5A 4QWDA 1QAJA 3CDWA 1FFGB 3HCXA 2DBBA 3IGNA 4G65A 4H4OA 5HVFA 1CEZA 5D78A 2NUUG 3OUYA 1RKJA 2EBGA 1M5KC 5HK4A 1FRHA 5E2QA 2ZUGA 3BPDA 1NH7A 5A8WB 1N56A 3EPIA 2F4FA 3OXGA 1N4LA 2KXHA 3KXDA 5FD1A 2O3DA 3S6EA 4X65J 3D6MB 3FC9A 3P45B 5A6PA 1VQOS 2DXDA 2RUGA 1VYAA 2KHCA 3Q86A 4ANDA 4ZVFA 3BN7A 3DN9A 3DLGA 3BKUA 2Y8WA 3MEDA 1CSJA 3FCVA 1UJ5A 1Z2ZA 3AOAA 3D66A 4ZCKA 4G1PA 3M2RA 3M8SA 3J81j 1OSCA 4NLUA 4CTAB 1B70B 3TX0A 1B7YB 4ITSA 2B5JA 3UVJB 3NGDA 3BV8A 1N5TA 2ZH1A 2DPJA 4K2JA 2HW3A 1U02A 2CNLB 3HHKA 4CO2A 2UVUA 2GMJA 2OD4A 3JSBA 2XI2A 4WK1A 4YY3F 5BYQA 3RB4A 4B3OA 2WK4A 1N5YA 2M52A 5AXLA 4B9VA 3M1VB 3I9ZA 3N5FA 3BKTA 3THPA 4O3QA 4BCAA 7AT1B 2FIUA 1XR5A 4HDGA 4RUBA 3LF0A 2YQ0A 5KFXA 4AUKA 5F8LA 5KG7A 3R9LA 3MAQA 3GONA 2ZH9A 4KAIA 3HSJA 1M5HA 3MEGA 1RWXB 1WKKA 2KU7A 2CQIA 2OGUA 1F9EB 1WTFA 2Q1LA 1KLMB 4Y00A 3UDVA 2IFXA 2IRUA 2DNNA 1JLAA 4HHHA 2LKZA 1TKZB 2B6AB 2DNGA 2WRMA 3MPYA 4KH1B 4LF2A 2I38A 4ICLB 2IVFB 4UQGA 3DLHA 4B08A 4FDFA 3OL7A 2CVIA 1KQGB 1FT8A 4DZ6A 1NJWA 3PIOQ 4F4WA 1KFSA 1M5PC 4G3IA 4ZHRB 1PKUA 4J7CA 1MU2B 2DGWA 2HHXA 4RW4B 3Q89A 3NCQA 3FSYA 3W64A 1QDUB 3MPDA 4PYAA 4FNHA 1RHRB 1R6YA 5D0GA 5SUHA 1QAYA 2CJBA 2BV3A 5LJ3Y 3TAQA 1VQ6S 4DJBA 4ETXA 4DPWA 1HI1A 3T1HF 2UUTA 1WC6A 2QFIA 4ED2A 2ZHBA 1U4BA 4WP8A 4X4TA 1GXLA 2C2ZB 2XTJP 3EZ5A 3EDQB 2CZ4A 4Z37A 4DSEA 2Z2YB 1C0UB 2IYGA 2PFDA 2QL9B 3OR2B 5F41A 3TZWA 2XHWA 1HNVA 1PC4A 5ETQA 3MR3A 1RT4B 3A8KA 4CLTA 2JHEA 3DRPA 4OI0A 4DR2F 1PILA 4JYAF 2ZJQQ 3BDEA 2I6WA 5L9XA 1HQUA 1U1LA 4KV8B 1XMBA 1WC5A 1F5AA 1KEKA 1T7PA 3QJLA 1A0OB 4USIA 2BM0A 3CNQP 4WFBQ 5D4NA 1UW4A 1T3OA 2B4OA 3WZ0A 1E6YB 2OPPA 4LQ3A 2HLUA 3V2UC 5IWAF 3DCAA 4F8RA 3CJKB 2RQ4A 5M2UA 2HLTA 2VG7B 2FD2A 2ZKTA 4EYIB 3D1OA 2FHKA 2CQGA 2RAQA 2HBZB 1LK7A 4KGZB 2YWHA 3JSMA 4DL7A 3CJRA 2DEJA 4NPOA 1YZ6A 2HS3A 1HBNB 3HSDA 3ZZUA 1FESA 1IBKJ 4A8QA 3K5PA 4EZ9A 2DGVA 4EBCA 1NHVA 4NLPA 1VBXA 1X9SA 3W5ZA 1YJRA 1S1UB 1PYTA 1CULB 1T95A 3MTJA 3CW2C 5J1EB 1J2VA 1RT1B 2WBMA 5HATA 3QBCA 2PA8D 1FVSA 3RB3A 5CCLA 2CVEA 1GX5A 1HI8A 2QX0A 1IJEB 1G7CB 1QVGR 2B8PA 4V19J 2DY1A 2V2VA 3FFIB 2UZAA 1VRUB 1ZZFA 2CJYB 3Q8QB 2HGNA 2HNYB 2WW4A 3M2UA 3CEDA 3TEGA 5CD4H 4J9KA 1O0PA 2CPHA 2MZJA 4HR2A 2V2ZA 3ZNUA 2QO3A 2K2PA 2PT0A 3VGTA 5AE1A 4B3TF 3NY0A 1REGX 1VJWA 4C8YA 3I82A 2KFYA 2IA6A 4F25A 1K0TA 2V9KA 1PJ7A 4WFAQ 1XIQA 1F6TA 2FPHX 1ZYQA 1HHSA 4Y0FA 2HHWA 1VMBA 2FUG9 5GMDA 5L1KA 4LF9J 1TKDA 3KG0A 3KJFB 2DRDA 4YR3A 3EX7B 4DR3F 3V81A 2V8HA 1FJGF 2Q43A 2RE1A 4MFBB 4OJ3A 2M9KA 1K73T 2DIVA 4EK2A 4UOCA 5CAAA 2MZQA 3MFHA 3WQPA 2BBEA 1RI7A 2O66A 3AOCA 1NU4A 5KFEA 3M6VA 2A2CA 2XI3A 3OXLA 3HHDA 4ZCLA 4URSA 4BWMA 2MKIA 2HRYA 3M30A 1P27B 2M0GB 3OLBA 3V4IB 3K89A 4J9OA 3A3PB 4C8NA 4ANCA 5IT4A 1DURA 2KT5A 3DDNA 4HI1A 1WHXA 2AZ1A 4ES1A 3TW0A 2W8LA 2MMYA 1XEZA 3D0GE 1TVRA 1C4AA 3MCMA 3M6XA 4FBUA 1PIEA 3KHRA 3BB5A 1F60B 2XGPA 1U0HB 2HQFA 2E29A 2E5LJ 3ILOA 2MPUA 2W01A 1ZTWA 2ASYA 1T0TV 1FHTA 5IC6B 4TLRA 5K20B 4JI4J 5J2MA 2O67A 1GMWD 1G4CA 1RHQB 3CGIA 4UY85 3D1HA 4IH7A 4ID8A 5B0GA 2QSFA 2ZH5A 2AEFA 2LXIA 3W61A 1D0EA 2BJ7A 1VQMS 2F8EX 1OY8A 1UP1A 3Q83A 4P71A 1RUSA 4JV2A 4TY8B 4ED7A 1X4BA 4JI1J 2BJ8A 1TL7B 3DRXA 4EUVA 1JLGA 4XO0A 1X9MA 1VQ8S 4ID5A 3MM9B 4QIEA 5DO2A 1WEYA 2CDQA 2Z57B 4X2BA 2ZNYA 3LAKA 4ZOSA 6AT1B 4Q7AA 1NCLA 3BGRB 2B8QA 3DHXA 3VALA 4KY3A 2ZJRQ 5IQQA 1Q79A 3RTVA 4U7UK 3HHNB 2HZVA 4JV0A 5LSOA 3J80U 3OTOJ 2RUSA 1T05A 4DR6F 3QNWB 2ILYA 1T9YA 3HVRA 2YNIB 4X4OA 4OI1A 1XR7A 3IR7B 1U0SA 4PAAA 1UWAA 3TVZA 3ETMA 3ILJA 2ABYA 1QUVA 1RA7A 3QAUA 2Y1IA 4LF5F 5KT2A 1RAEB 3BR9A 3KLHA 2BX6A 5L1IA 1KDNA 1XQIA 1O51A 3X1LB 2X7IA 1JKHB 4OMFG 1SC6A 3T3FA 2GC8A 1WTBA 2D3UA 3CF5Q 4TVAB 2MQOA 3TVKA 1KOHA 2D41A 2DNLA 1VK8A 4XIUA 4ECTA 1U8WA 1NJIT 2DNZA 4DX7A 1WHYA 2VFUA 2XULA 2AX0A 3I0SB 3G87A 3L7UA 3HZEA 4I68A 4QR2A 1S57A 3SDEB 4U67Q 2LQBA 4QR0A 2ADCA 2RF2B 4TU9A 1R6VA 2B9EA 3UDLA 1U8SA 2B9YA 2XSFA 3MF5A 3VR1A 1TL7A 2VV5A 4XPEA 2HBYB 1TKXA 3RUBL 2HG4A 1DTTA 4DV5F 3T9ZA 4RBTA 4DSIA 3NKYA 5L39A 1VQ9S 1K1SA 2E9RX 1OYDA 2DCUB 3AB4B 1S1VA 2JVOA 1UFLA 2J8SA 4FN5A 3RAMA 2FHJA 4LF6J 1LWEA 9ATCB 1S6UA 3GLJA 5THWA 2R2TA 4F3MA 2IA0A 2NPFA 1VGYA 4N8NA 3N28A 3RW7A 2V6AA 5C24A 3EM1A 5KFWA 1I6JA 4QW9A 2IBKA 2JLFA 3T19A 5LMUJ 3PX4A 3QWUA 4DPOA 4NOHA 4F26A 4Q45A 1T8EA 2C42A 2C3YA 4ILRA 3VWSA 1NZ8A 4YY3J 3N4WA 5K14A 1W26A 1ZOTA 1SUQB 3QT5A 1KVIA 4ZS6A 1KQFB 2J0XA 4NYOA 3IS9A 4FPRA 3MR5A 1I3OB 3AJ2A 3W8PA 1J5OB 1T9UA 4KGVB 4RR5A 2VQFJ 5KFJA 2RD5C 5DQGA 1MG7A 1KSPA 2V34A 3IR5B 2ZKUA 3GCXP 2RQMA 1Y3KA 3TZXA 2X1AA 4LF8J 2DPIA 4FZVA 1URRA 4O23A 1H7WA 1GXTA 4A4JA 2H3EB 2MQMA 2YNHA 2XC9A 2W9CB 1OJ4A 2P2CB 2ZFHA 3MD3A 5F8HA 3OXFA 4KFBA 3DXSX 2UUAF 4QU6A 2JC1A 2C3MA 3QLHA 2W8KA 2XMMA 3DI6A 1X9WA 2D7SA 4O4GB 1HHTP 1RCOB 2OEJA 1SB6A 3A8IA 3D54A 2IY5B 2BJ1A 3P49B 3T41A 1R0CB 2V63A 3A8JA 1WF1A 2BM1A 4G1IA 2GHWA 1RHUB 2XYHB 3AJDA 5CA5A 4NA3A 2J9DE 4IG3B 3Q8VA 1AFJA 2B9XA 4J9PA 2F63A 3P8BB 5IOLA 3BO2A 4DFPA 1S7HA 1NKBA 2ASLA 4M5KA 5U47A 3FMBA 4USKA 4ELTA 1NB2A 3M2UB 4UT4A 4TXSA 5CABA 4P2SA 1HMVA 2D69A 2BEFA 2F9DA 4IG3A 1D9DA 4OIXA 4E98A 2G1DA 3MAAB 2W7PA 1FJGJ 4C8KA 2HHVA 1YBTA 2OH2A 4DU7A 4FF3A 2KO1A 2GIQA 1KRPA 1RTDB 2V8PA 3RR8A 1TU0B 2CWKA 2N4DA 2Y9HA 4PEOA 2IM3A 3S01A 1WI8A 2E5JA 1QAXA 4QOTA 2L9DA 2HVEA 4X4RA 2IAJB 3F0NA 3NCPA 3P6YC 4QWEA 1RTJB 5KG4A 2VQEF 2DHGA 2AW0A 3NP5A 4XK8C 4DWIA 2DD8S 1R27B 3VTIA 1IKVB 4I0WA 3UN3A 4CZCA 2A6OA 1GT8A 2D3ZA 2E66A 2KHDA 2RKIA 3GFZA 3QGPA 2OFHX 4FPIA 3WDOA 2MKSA 1NZAA 4Q2MA 4ES2A 3QJJA 2JDJA 2QMUB 4LFBJ 5KT6A 2V8GA 3AQPA 3MCOA 3QT6A 3JSMB 3CO9A 3TOQA 3W3SA 1KVKA 1BQNB 3TZZA 1RWUA 1J5EF 4B9SA 1FRJA 1NMEB 1Q78A 3FNNA 1NSQA 5B0DA 4RNFA 3SV3A 4DL2A 4N76A 2AEMA 5E3RA 2JEJA 2P9GA 2MEWA 1CJTB 3CCLS 2ALZA 2KZMA 1M1HA 4DN9A 2QSWA 3H98A 3OPKA 4KKOB 4I69A 2QMWA 4QWAA 1JXEA 5CZXA 2LYVA 4KV8A 3KJVB 5AT1B 3NRBA 2KRRA 5B0EA 2Y1RI 4OHXA 1NK0A 1VBKA 5D0HA 1F3FA 1V3SA 4OYWA 4DV6F 1SJ4P 3G82A 1U1MA 3AB2B 1RT4A 3MMCB 3TJAA 3SSQA 2VH7A 3OSPA 2ZDPA 2GA7A 3HHEA 1Z1ZA 3LW5C 4WP9A 1RSCA 1RLDA 4NWBA 1S1VB 3GIRA 3W2WA 3QIPB 1S9GB 1UWBB 2VBYA 1UA1A 1TUVA 2DCLA 4MH8A 5DG7A 5C25A 3KLIA 4DUTA 2HNDA 2AP6A 5KFQA 1HWIA 4DR6J 3N79A 5B0CA 4DI6A 1FK9A 3JTOA 3EUNA 1FJEB 4DBQA 2SXLA 3MMJA 2VDIA 2KJVA 3HFKA 1BQMA 2CJXB 4RW4A 4UOFA 3IC1A 2QLXA 4UY8T 2C3UA 2AJ1A 3I0SA 4P75A 1CPZA 2CIMA 2OSRA 2ZE2A 3PO5A 3QO9B 3ZTRA 2UXCF 1FD8A 3BPSP 3DM2B 2J9DA 2C2RA 2RHSB 2YNFB 2R7TA 2ZZTA 3UE2A 3RGIA 2BJ9A 4IRCA 4QIGA 4LF6F 3UN5A 2OTLS 2XYPB 2XB2D 2HQGA 4QYZJ 2UXBF 5IT9Y 3J7AN 1PYOB 4DR5F 1HBMA 2IJRA 1N0VC 4BLGA 4C8ZA 1KFDA 4M5MA 1SQGA 2RILA 2KH9A 4ECWA 3SCIE 4EO8A 3I55S 5HP1A 3A12A 2EEYA 3GFHA 4P9SA 5K8OA 4LBIA 2BR0A 4ZPDA 3M1VA 1F3VA 3AXKA 4Y6IA 1T9WA 1NDLA 2WVEA 4NLVA 1C1CA 5C42B 5JVHQ 4DSKA 2EC0A 2QA4S 2PFFB 2MQQA 2HPUA 3TUZC 4WIQA 2NZ4A 2VC0A 2VPXB 1K8AT 4ID5B 4M5IA 3VAJA 2ZH3A 2IM0A 4I7FB 2ASDA 3M8QB 1GXUA 5KG6A 1YHQS 4DPUA 3TI0A 3D3CJ 3OVSA 2QA1A 3I32A 5KFRA 2QLWA 1NDPA 3U7JA 3EVOA 3T1AA 1BQXA 3LOUA 2PI4A 4C48A 3M7VA 3PYDA 3ENQA 4ZVEA 2WHOA 2C3OA 4DCJB 3P3DA 2W9AA 1BGXT 1DLOB 3CDEA 4PQAA 2UUAJ 2UUBJ 2LMIA 2YH0A 2ZOFA 1FI4A 3MEEB 1RT2A 5J1PA 1JX4A 4DDFA 2NXCA 2YBVA 4A8OA 3PW5A 4DQSA 2QEXS 4B3MF 1SPBP 1KOOA 5GADU 3DRYA 3HHLD 4I2PB 4M5JA 4QW8A 4DX8H 2ZDOA 2JJ4D 2ROPA 3R1LA 4UUWA 4HVZA 4O44B 4LIWA 4Y3CA 2B4UA 4WCEQ 3L7PA 1RT6A 3MMBB 3NG8A 1TL1A 1H38A 3MM7A 3NS7B 3ET6B 3J81Y 3W66A 1K0VA 1DQ8A 1DQ9A 2ZC3A 3L7OA 3HPOA 3A1YG 3I87A 2XY7A 2Y1LB 3R5CA 3TAPA 3CMES 4JOUA 2Q6CA 2GQQA 3M30B 3V4IA 3T1HJ 4RW6A 3M9MB 2BOAA 1U6BA 3QAEA 3VGVA 5RUBA 1TL3B 4UTGA 1ZA2B 1VI7A 3KG1A 4NLRA 1P1LA 3WIUA 3B4MA 3ISND 1B7FA 1XTZA 2Z56B 2B7BB 3PEHA 1Q86T 4M5NA 4WZMA 2IBOA 2OP5A 1FWPA 1QM9A 2Z0GA 4F4XA 3UD3P 4ZVGA 1U1QA 3OFHA 4V19X 4RW9B 1U1RA 4I67A 2XMUA 2HHHJ 5EX0A 1MN9A 5DGBA 1N32F 4RNOA 1PGZA 2IJNA 2OMOA 3ELHA 4OZ5A 1RWMB 3FGVA 4CT8A 5LXYA 3MAHA 3SFGA 3MURP 4LRAA 2H4WB 3R2CJ 3MI7X 5B0BA 4TYAA 2F40A 3T5KA 3CULA 4CM2A 4FXWA 2HNZA 4ZLPA 1XJWB 3VAMA 5LT5A 1JLFA 3QIDA 3MECB 2DGXA 3RJMB 7FDRA 2FHMA 4CLWA 3QGGA 4LF7J 1QAIA 1RTIB 3MOZA 2NYIA 3NOCA 5A8RA 4ZMMA 1NSPA 5KFHA 3FSIA 2M7SA 3AOBA 4CO3A 1NHUA 4NLOA 5GAEU 2XMVA 2E5HA 5DGAA 4DF4A 1SJ3P 1VQKS 2L48A 3FJ2A 1AT1B 2IJFA 3QSIA 4M5LA 4QIWD 5J1EA 2OMLA 2HBQB 5DG9A 3MR6A 1I51B 4ZVPB 1CJUA 1RAAB 1D1UA 3ONQA 5CD4A 3RBEA 1SKWA 2RU3A 4TQSA 2L08A 2W2QP 3IWXA 1LXNA 2PEHA 1WSRA 3X3UA 5JXSA 4P74A 2HK3A 2HVHA 3KNGA 1TMJA 2WB4A 2R3VA 4X65F 2JC0A 3GR0A 1IR2A 1UZHA 3GFXA 4NLDA 2OPRB 4DFKA 1Q8BA 3UD4P 4NASA 3HSZA 4V1Ak 2WAQD 4RNNA 1NB7A 5K8PA 2K8GA 1FFWB 4YR2A 2ROEA 4C3KA 2IYIA 4PG8A 2D3O1 3GR1A 2RU9A 1DTQA 4H4KC 4MIWA 5E33A 4ED6A 1SL1A 1EKSA 1ULRA 4EFAC 2OEMA 3Q8UA 4I1TA 1YBUA 2BZ2A 2MSSA 2Q66A 4A8XA 2W24A 3DC2A 4OHZA 2HHQA 4XPCA 3GZ7A 2PD1A 1YJ7A 3P96A 2I5JB 1U1OA 2HFUA 1YDLA 1HNVB 3CT9A 4G6VB 1TAQA 4USMA 1C0UA 1TV6B 3OR2A 3QT8A 5HMWA 3BQ1A 1YI2S 1G3OA 3UW1A 4I64A 1NK7A 1RGVA 3PHEA 2AYEA 1F0XA 3H40A 4PUOA 1FDAA 4MKVA 3ULHA 1D9FA 3MXHP 2AJQA 1S9FA 5K8NA 2FZCB 3D6TB 3DGVA 5IZHA 1V5VA 2JLGA 4YHHF 5KOWA 4J5OA 1JJHA 4KGXB 5D0EA 2RJZA 3PRVA 1N8RT 3RW6A 1H72C 1ZA1B 3IBWA 1U1PA 3LGNA 2IVYA 3WBZA 4ZPCA 3R27A 1RZMA 4DHVA 1FKOB 4J9UE 2BANB 2ACMA 3GTYX 4C8LA 2MDAA 1ZM4A 3I96A 9RUBA 2A18A 3DDKA 4RBUA 1HWKA 2WONA 3NWGA 5F3ZA 5E5NA 3R2DJ 1TUWA 2QIFA 3PV8A 1D8ZA 1TKTB 4I6YA 3MUVP 4JI6F 1IKWA 4YB1P 3OVAA 1HLWA 4LRCA 5JUMA 4NCAA 2KDOA 4OI6A 3NNHA 4MK7A 3JXOA 3VGSA 3M6UA 4WFNQ 1Y00A 1W2BR 1KLMA 4B3RJ 3IA0A 5DDRC 4PG7A 1YGYA 2DGTA 3KLEB 2MGZA 4P7TA 2GVZB 4TU7A 1HNWF 4OZ0A 1PAUB 1Z2LA 4L76A 1NSAA 4KO0A 3AA8A 3DKDA 4IFYB 4NEZA 2VODA 3HD2A 4RWXA 4HKQA 2Q6BA 1VQNS 1N0UA 4ED4A 5D15A 3A13A 4B3OB 2P9CA 3OFFA 4X4SA 5HBMB 4YFUA 5DQIA 2R9LA 2XY5A 5HO4A 4NXNF 3S1TA 4X84A 4ZPTR 1WC0A 1LFWA 2MSTA 4RW6B 3RU0A 5KFSA 2DKOB 3IMQJ 5SZTA 2GQCA 1LWCA 4CQ1A 4DL0C 3NEKA 1N54B 3BKFA 4PPDA 4DLGA 2AYMA 3NGRA 1HYSB 1SIZA 1LV5A 1S79A 1LKZA 4JBCA 3P5BP 2JNJA 3A8EA 2KM8B 3KHGA 2CWXA 1DHMA 4WU2A 1NK8A 4LF4F 1RT3B 1RB0A 3QJPA 1AFIA 4JI2F 2Z58B 3SQGA 3HT3A 2CPYA 1J5EJ 4J9NA 2YY3A 4QPTA 4YB6A 4RW8B 2DK2A 5CCMA 4OX9J 5BR8F 4X64J 2CNKB 2EKNA 1VS3A 4Z7CA 4ANEA 1RWNB 3TVYA 3B6BA 5JMNA 1FJCA 1L3SA 1R43A 2DXFA 1S0NA 1KVJA 1OQ3A 3PJWA 4X4VA 3BSAA 4YP3A 2KG0A 3QZ7A 2UU9F 3MEEA 2OLWA 3PW0A 4ZVOB 2XBPA 2RDIA 1CJKA 2P6TA 4Q8FA 2DHHA 2VF3A 1Q16B 1BMQB 2MJUA 3BYRA 3OFGA 3UNGC 3KK1B 2R2SA 2MGZB 1I1GA 5HQLA 2XMKA 1NUEA 1WJ9A 3EGNA 3H20A 4J9VA 3TA2A 3QZ8A 4I7FA 2X1FA 2WVDA 1P6TA 1BE4A 1UFKA 2DGUA 2IHR1 1TKTA 4M1KA 4U7UD 4KB7A 2FLOA 2GV1A 4PABA 4NL5A 2DB1A 4HLBA 2J0QD 3CVKA 3WX8A 1V3ZA 2GFFA 2DR8A 4MKYA 1AB8A 2F9JA 4B9UA 3KK2A 3KK3A 2BQ3A 2CG8A 2MYFA 2CUYA 4F04B 5KFMA 1T03A 1ZM3A 3D0IE 1FE0A 5AXMA 2IRYA 2YX4A 3IWLA 4OV1A 1JLEB 5K9FA 1E6VB 4G1QB 2F65A 5F8GA 3J7Z5 2UVWA 2OPQA 1S5ZA 2HFVA 3DRRB 5HROB 4NYZA 2FVRA 2H5IB 4U9RA 3QPIA 5I42A 1RAOA 2CJ9A 1Q8IA 2BKOA 3ILIA 2WZ1A 1W2IA 3CB4A 2JX2A 3MM5B 3NS6A 3SIPB 3VAHA 4J9QA 4DV3F 4AQYF 1JLBB 4DR7F 2OPSB 3QO9A 4K5SA 1H2TZ 2ZE2B 5HVGA 1XBWA 2A2DA 2KVIA 5LL6d 1NPRA 2ZJPQ 3BQ0A 2GQ2A 4LRDA 3IXQA 1BQMB 2AMCB 1GTEA 4C11B 4X4PA 4OYIA 1H3DA 3EGVA 4QJVA 3ZFVA 4WBFA 4PCQA 3TJ8A 3CCSS 4DQQA 1CS4A 1UVKA 2GGPA 3C6TA 4CLKA 3FRYA 3HKWA 3KLIB 1AW0A 3DU6A 3G9CA 1VHIA 4URQU 2DXEA 2FLLA 3TRGA 1ZAXA 2QT7A 2RRAA 2KVQE 2U1AA 2HRTA 3K5OA 4P2FA 5J2NB 3ZZRA 4D3HA 2LDIA 1BXNA 2OPRA 1R8CA 1XMOF 1XNQJ 4GVLA 4EWTA 2IC3B 3T6JA 2V2KA 1Q4RA 3FBEA 4Y2IA 4U7CA 2KXNB 1FTCA 2UP1A 1RYRA 3TP2A 1M0SA 1JNRB 2DHXA 4NA1A 4OLOA 3OJUA 3IBCB 1Q0NA 5GAEI 1QSLA 2UUBF 1U45A 1VK3A 3PW2A 4ECUA 4K2XA 4F2SA 1C4CA 4RUCA 1P9QC 2ZVSA 1S1TB 1NNDA 4ZLJA 1S10A 1HD0A 4K7QA 1CVJA 2EG1A 4RPFA 4UF4A 5A8RB 5F0WA 3R8YA 3THVA 2E7XA 5DDPC 4AD6A 4DR7J 1JIHA 4N8OA 1S6OA 1Y4ZB 1JLQB 3ZNJ1 4R5PA 1C1BB 2HIQA 4CWBA 4HEA9 4FF2A 5D8HB 1FXRA 1G6BA 1YG0A 3DXBA 5HL7Q 3MM8B 4JP8A 2DH7A 3QMQA 1EX8A 3PRDA 2XMAA 3IG1B 4S0MA 4HI2A 4RW8A 1EIYB 5DZ7A 4FYDA 3TAMA 4L3KA 4ILMA 4CYUB 2WVCA 4ZPBA 4L74A 1U26A 2G13A 3K58A 2WOMB 4RW9A 2H5JB 3OV7A 2FVSA 1MNEA 4WZQA 1H2VZ 4YQWA 3DLEB 4AL7A 4HT7A 4IQXA 3I5AA 4NI2A 3CJ0A 4I56A 1R7IA 1QY7A 4I6WA 4E8UA 2CA9A 1KC8T 1HMVB 4KHPF 1SL0A 4ZVUB 4CP5A 1YK9A 4NEYA 5IXUA 2VQFF 4LUBA 2CPDA 2C3PA 1JXLA 2LU2A 1IQTA 4QIFA 2Y0SD 3C2PA 3CUNA 4EGLA 1OWXA 4GVBA 5GMEA 2YKAA 3PM9A 1VBZA 4K4XA 2UVVA 1VJQA 4WP3A 2B4VA 2GJIA 4PXBA 1I94J 1NK4A 2VDHA 1EARA 1RTZA 2EKYA 4W4MA 3UCUP 3HHLB 4B3MJ 4IFYA 4H54A 3R5JB 3UO0A 5FLXU 3AA9A 4X64F 5BR8J 3KHLA 4GMKA 2POKA 1JWWA 3MMBA 3QFHA 3J80Y 3QGHA 4OYBA 5E41A 2ASJA 2ZD1A 4M8LA 4O44A 2X3GA 5I3QA 3V6DA 4PR6A 3LP1A 3Q22A 5T7LB 3PYGA 4R0EA 2FC9A 5L1LA 5E0OA 4J9RA 4DS5A 2J6UA 3G6ES 2CQ3A 2DY9A 3M32A 2GO9A 1SC1B 2KT3A 3NGSA 3G8QA 5D4OA 8AT1B 4DR1F 2GCFA 3PTWA 3JTNA 1APSA 3KNAA 2BANA 1LQ9A 5FDLA 1OY9A 1X4FA 3OTBA 5KT7A 2D3OR 1R0AA 3G6YA 1N88A 2DITA 1B0TA 2R42A 3MM6A 4UOGA 3PIPQ 1Q1KA 1PAEX 4RW7B 4LMZA 1PCAA 2XNQA 2E7VA 3FZBA 1J5OA 2E1CA 5HQ8A 1RBAA 3H5SA 5CZVA 4CO1A 5K14B 4P6QA 5I4MA 2HS0A 4B3RF 5KT3A 3GJSB 3O8WA 5AXNA 5M2RA 1O6XA 2YWWA 4O0IA 4PUOB 3TNVA 2A6MA 2DH8A 2V8DA 4B02A 3SCKE 5ETMA 2FQQB 1FE4A 1OQ6A 3IGVA 1TZ0A 4USWA 3VHQA 1R0BG 5HMYA 2VQEJ 1KTVA 3HM9A 1LWEB 2ZVIA 3H42A 3OW2R 1SJFA 2DYAA 1RAGB 2LECA 2AJFE 2DR5A 2H48B 3CTRA 3CSKA 4FXDA 3R6LB 3I6PA 3OHAA 2DT9A 1VQ7S 1QTMA 2QTWA 3HJFA 3POTA 2MQNA 4RUAA 1TL4A 4NCBA 1U2FA 1NHKL 1EETA 1KHWA 2AQ4A 1T3NA 1EZZB 1UW9A 3KJNB 4USJC 2D1CA 3DM2A 3JS9A 1RU2A 3PNIA 2JL9A 2VIHA 3BSNA 4A8FA 4F02A 2JZ5A 5CH7B 3ZTPA 3CC7S 3OD2A 4PWDB 4EBEA 2HQCA 1KP6A 2HMIB 4ZP7A 1J27A 4W98A 2YH1A 3U27A 1IM4A 2R8HA 4AQYJ 2JWNA 1EETB 1F5BA 2CNOB 1HPZA 1NDKA 2PIIA 2YQ3A 2ZBPA 3ENAA 4ZVRB 4ZJQA 2CKWA 3POTB 2E1RA 3DFEA 4ZVSB 2XNRA 1HWLA 2HNDB 4CLUA 1N32J 4K4VA 3G8SA 4IQMA 5AE3A 1YBAA 1FX2A 1LWFA 2B4PA 1HNXJ 3U1LA 1S9GA 1UWBA 2FJVA 3GV7B 1RLCL 2J8AA 3CE8A 2FLPA 2XMJA 1RTIA 1V9OA 2MKJA 1X5SA 4J9LA 1SJQA 3OQ2A 3FBCA 2M70A 3TX8A 2B56A 3HX9A 4BC7A 3DGPB 4DOZA 3HXMA 2JEGA 4DSJA 2P5VA 1N33J 2LQ9A 2Z2ZA 3QYYA 4B9NA 2XZTB 5KFVA 3D0HE 1JJ4A 2HGMA 4HTJA 5J2QB 1HNWJ 5D6GA 4IOAQ 1WC1A 3GE9A 5GAGU 4MKAA 3HZGA 5HJYA 3N6NA 3SSSA 4K4YA 4C0OC 1KQSR 2FHJD 2H51B 1NKEA 2RS8A 3CCWA 1JJ2R 2PEBA 2V8VA 2DHSA 2L3MA 3N5BA 4JI3F 4IUFA 1KN6A 2CJQA 4C97A 1ELOA 1SV5B 3UN2A 5CHCB 4NLYA 2CQHA 1YLXA 2Z8QA 4FYYB 2RSQA 4C9DA 1Q95G 5KFTA 1X4CA 5EX3A 3LPYA 5J2MB 3QT7A 4JI3J 1FVQA 4Y2KA 5G0RB 3CPWR 3HK2A 3HVTA 4OYAA 1UEUA 4DF8A 1M90T 4LF1A 5ITHA 3NGUA 2E7WA 4ATNA 2QL7B 1SBRA 3AHPA 1IKXB 4LF4J 3D4JA 4K50A 1S6PB 2L9WA 2QGFB 2IAJA 3VVTA 2W2OP 4IOBA 1TFYA 1WELA 1RABB 1CJVA 1HQEA 2WVFA 2YXLA 1JLCB 3I4HX 3P4UB 2WBRA 2W2NP 5B09A 3K57A 2W9CA 4HACB 2MLZA 2MY7A 4DL6A 2BQRA 1IBLJ 1WF2A 1SJ1A 3PG9A 3FBFA 4RL1A 4ZPVR 4Y34A 3DLLQ 4B3SJ 1UVJA 1TL1B 2DNMA 3MAAA 4KYZA 4ZVTB 2CYYA 1OYEA 2MZSA 4Z7YA 4F36A 3CDUA 5A8KA 2NLWA 5GAHI 3RAXA 3FKBA 4NZ6A 4B17A 2BXJA 2KTQA 4IRKA 4TU8A 4DL5A 4I2PA 3L9ZA 5G0RA 1UKUA 3HF5A 4C3LA 2A1BA 5HVHA 2R8JA 2G0JA 4OZJA 1WSVA 2V2QA 4OYOA 5KFGA 3O1LA 5KT5A 5DLFA 2HRUA 3CD6S 5E3QA 1GNKA 2GMLA 2YKNA 1KR4A 1G2EA 2LEPA 4CH7A 5KAKA 3NGKA 1UPPA 3D1QA 2ZWOA 4FNIA 2XLIA 2QA4G 2HAFA 4LF8F 4K4ZA 4C2MA 4JI7F 3MOJB 3LWMA 5L38A 4QYZK 4GKJJ 1U24A 1WC3A 3OTOF 3M6WA 1KQKA 1R3NA 1U7LA 2VG6A 2YWFA 2C1EB 3M8QA 3MUMP 4BDPA 2VB6A 3QLHB 2BQUA 4LFCF 4KPYA 4LRFA 3V4MA 4KFBB 2NXEA 3HI9A 2W7OA 1FDNA 4IYQA 4IR1A 1DQAA 2DGOA 1C1CB 1RP5A 3GJTB 5HI7A 5C42A 5L46A 3DGPA 4DFJA 1RK8A 1Q7YT 3PFEA 1LW2B 3C16A 1N5SA 4MKBA 5A0YB 1S1TA 4PG5A 3AD8C 2VG5A 3MMAB 3IS9B 1N34F 1YX2A 2ZUAA 4MK8A 3VVUA 4DCOB 4WFYA 2GIFA 3JAMU 4YHHJ 3KMQA 2E1AA 5L8RC 3IBFB 4WU3A 4L73A 3QGIA 3DLBA 3DYAA 3UQSA 4X62J 2K7KA 1FXLA 5C2GA 1GMUA 1RISA 1ZAVA 4RBVA 2X51A 4ECVA 2HMIA 1BY9A 3VQSA 5F8JA 1YIJS 3ICLA 1Y5IB 2HWHA 2I9SA 3MGJA 5FLXY 5J2NA 4EZ6A 2AYBA 2ZH4A 1D09B 1FK9B 3SBMA 3CJTA 1GMVA 5LXRA 5H9FK 2CAJA 2A10A 4OJ1A 3T5LA 1TKXB 4WIIA 3KYLA 3UR3C 2ZNZA 3CD5A 4Q43A 3HP6A 2ALYB 4P52A 3EZOA 1UEVA 1F1BB 4MMOA 1S59A 3SQOP 2V5HG 3ZXWA 2V67A 2B0GA 5E3AA 2Q79A 3NLCA 1PSDA 2VICA 1WG4A 1FKAF 2RT3A 5HAOA 3CJQA 4F3OA 2EFOA 4FKXA 2PE8A 3Q2TC 4ZVQB 4F4YA 3PRBA 1MWYA 4EMDA 1HWJA 2G0CA 4F0KA 4F7VA 4YS2A 3KLHB 3CC4S 2BABA 4OYPA 5ETNA 2ZH2A 2AU0A 2VG5B 1E6VA 4G1QA 1JLEA 3MWBA 4RW7A 5A0YA 1HR0J 4B9MA 3MM6B 1CJTA 3WIVA 2YNIA 4OZ2A 2FY1A 4JI7J 2DGSA 2FHOB 2VPZB 3MTKA 4B3TJ 1IN0A 4QCLA 3BGLA 2CQDA 4DU8A 4E2FB 3PW7A 3G4SS 3BGRA 3CD7A 3EGWB 1VQ4S 3L4BC 3H5XA 4QQBA 4P2MA 2HWIA 4O3PA 3EVWA 3QRQA 5T7LA 1PJ5A 3I0RA 3BDPA 2X3DA 1JLGB 1IKVA 1S99A 5F3TA 4WKYA 5KFUA 3T5JA 3QRRA 2B3TB 1YTYA 3H90A 2QL5B 2NUHA 2ZD1B 2BOPA 1BWEA 1EAYC 2W1BA 2XYGB 4TY8A 4DV3J 4TLQA 4ECYA 1U49A 4F4AA 3CDAA 4NZ0A 4OI3A 5IV3A 3GIIA 1KBRA 2QC3A 1UETA 5MAOA 5AJ3F 4DQIA 2J7KA 2YKNB 4IKAA 5IT0A 5H9FJ 1Y5NB 3G86A 2R7SA 1QTNB 3A3OB 3GWCA 4H4KA 4PWUA 4ZP6A 2XLJA 4DV4J 4CT9A 2B5JB 2QE5A 2ZWPA 2DEIA 1FNOA 2WB1D 3SQGB 4LFBF 1YJTA 2UXBJ 2HHPA 4N77A 5I3PA 2VU5A 1AUSL 1PBUA 3M2RB 5KFBA 4JV5J 1VQYA 2KYZA 2WSEC 2N7CA 2VONA 1W7WA 2LDYA 4NI2B 2K06A 5F8MA 4OI2A 2HBRB 2E1PA 1Q7LB 5KTQA 1U2CA 3BN4A 4ZVHA 2NXUA 3KDNA 1OMSA 1FRXA 1EHWA 1P8GA 1LWCB 4KQZA 2BKPA 2P6SA 1WOOA 4U8VA 3S7RA 4JI6J 1SQFA 2YPZA 5M2PA 1S6PA 1WACA 1YRXA 3CWJA 3KDOA 3MD1A 1IKXA 4LSNB 4DPTA 1RA6A 1KHVA 3MCSA 2IMOA 3IG1A 3PDNA 1RWWB 2E1MC 5H9EJ 2HHTA 1LOUA 3HVWA 3T9NA 1Y3JA 2GS8A 3V81B 4JI2J 4R5PB 4X4NA 1JLQA 4FKYA 4K4SA 2YQ1A 3VAIA 2CQBA 5KFKA 3I4PA 3PHTA 5IC4B 1IKYB
chains in the Genus database with same CATH topology
2MEWA 4AQYJ 4X62J 4DUYJ 1IBKJ 4DR7J 4LFAJ 3W1YC 4DUZJ 1N32J 2F4VJ 1HNXJ 3IMQJ 4DR1J 2HHHJ 2MQ8A 1HNZJ 1N33J 3R2CJ 1N34J 1HNWJ 4HHUA 4K0KJ 4X65J 4DV1J 1J5EJ 5LMNJ 2ZM6J 4LF6J 4LF5J 4DR5J 4OX9J 4X64J 4DR6J 4X66J 4DV7J 4LF7J 5IWAJ 4JI8J 5LMUJ 1XMOJ 4NEYA 4DR2J 4YY3J 4JYAJ 4LF9J 2VQFJ 2UUCJ 1HR0J 4JI3J 2UU9J 4JI5J 4KHPJ 1I94J 4JI7J 4B3MJ 4B3TJ 4LF8J 4B3RJ 5FLXU 3J7AN 5BR8J 4LF4J 4DV2J 4V1Ak 1N36J 4DV5J 1IBLJ 4PWWA 4DV6J 4B3SJ 4KYZA 5AJ3J 4DV3J 5IT9U 3T1YJ 2MTLA 4GKKJ 2E5LJ 3D3BJ 1XMQJ 4NXNJ 4JI4J 3D3CJ 5LM7E 4JI0J 3J81U 4DV4J 2UUAJ 2UUBJ 1XNRJ 2UXBJ 4DV0J 2KL8A 4JV5J 1IBMJ 4GKJJ 5A2QU 1FJGJ 4JI1J 4RJVA 2VQEJ 4JI6J 4DR3J 2KVQE 2UXCJ 1XNQJ 4KY3A 3R2DJ 3J80U 3OTOJ 4LFCJ 4LFBJ 4DR4J 4JI2J 3T1HJ 2UXDJ 3JAMU 4YHHJ 4NEZA 4NXMJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MEW A;  4AQY J;  4X62 J;  4DUY J;  1IBK J;  4DR7 J;  4LFA J;  3W1Y C;  4DUZ J;  1N32 J;  2F4V J;  1HNX J;  3IMQ J;  4DR1 J;  2HHH J;  2MQ8 A;  1HNZ J;  1N33 J;  3R2C J;  1N34 J;  1HNW J;  4HHU A;  4K0K J;  4X65 J;  4DV1 J;  1J5E J;  5LMN J;  2ZM6 J;  4LF6 J;  4LF5 J;  4DR5 J;  4OX9 J;  4X64 J;  4DR6 J;  4X66 J;  4DV7 J;  4LF7 J;  5IWA J;  4JI8 J;  5LMU J;  1XMO J;  4NEY A;  4DR2 J;  4YY3 J;  4JYA J;  4LF9 J;  2VQF J;  2UUC J;  1HR0 J;  4JI3 J;  2UU9 J;  4JI5 J;  4KHP J;  1I94 J;  4JI7 J;  4B3M J;  4B3T J;  4LF8 J;  4B3R J;  5FLX U;  3J7A N;  5BR8 J;  4LF4 J;  4DV2 J;  4V1A k;  1N36 J;  4DV5 J;  1IBL J;  4PWW A;  4DV6 J;  4B3S J;  4KYZ A;  5AJ3 J;  4DV3 J;  5IT9 U;  3T1Y J;  2MTL A;  4GKK J;  2E5L J;  3D3B J;  1XMQ J;  4NXN J;  4JI4 J;  3D3C J;  5LM7 E;  4JI0 J;  3J81 U;  4DV4 J;  2UUA J;  2UUB J;  1XNR J;  2UXB J;  4DV0 J;  2KL8 A;  4JV5 J;  1IBM J;  4GKJ J;  5A2Q U;  1FJG J;  4JI1 J;  4RJV A;  2VQE J;  4JI6 J;  4DR3 J;  2KVQ E;  2UXC J;  1XNQ J;  4KY3 A;  3R2D J;  3J80 U;  3OTO J;  4LFC J;  4LFB J;  4DR4 J;  4JI2 J;  3T1H J;  2UXD J;  3JAM U;  4YHH J;  4NEZ A;  4NXM J; 
#chains in the Genus database with same CATH topology
 3SYZ A;  1YZ7 A;  2VPW B;  3GG1 A;  2OI2 A;  5BJR A;  4M63 A;  3W9H A;  2BJ3 A;  4ALZ A;  4R25 A;  1T11 A;  3JAM Y;  3AAW B;  3PX0 A;  2LQ5 A;  1O8B A;  2FC8 A;  1RAF B;  2UUW A;  3B82 A;  4OYX A;  4ZJL A;  5KOX A;  2KJW A;  1S97 A;  4IH5 A;  1A6L A;  2IVM A;  3AFG A;  1X5T A;  5C2C A;  2HNY A;  2G9O A;  2XS7 A;  2A3J A;  1Y7P A;  2NXN A;  2LQ8 A;  3K8W A;  1RWK B;  3DLJ A;  3CCE S;  1VC5 A;  5C24 B;  1HNZ J;  2EFG A;  3I5C A;  3MPW A;  1O5J A;  4Y2C A;  5K5M A;  2NYH A;  1ROF A;  2BRK A;  5F0U A;  5BYS A;  4W90 B;  1DZ5 A;  3GYX B;  2M4M A;  4L6V 3;  1VQP S;  2J9C A;  1PJ6 A;  1ZS6 A;  4OYZ A;  2X1B A;  4CM0 A;  2J7U A;  1TK0 A;  2HQ3 A;  1RT5 B;  1GFW B;  1NK5 A;  2Y8Y A;  3QRP A;  4F0M A;  1ZPV A;  1WNE A;  1DTT B;  3BGO P;  3NBP B;  4DR5 J;  2HFZ A;  1CS4 B;  1YQH A;  2GGP B;  2YKQ A;  4LBH A;  4CNY A;  1T9T A;  2BE2 A;  3SMZ A;  2N7Y A;  1TK8 A;  2IRX A;  3M2V A;  1HPZ B;  1HBN A;  4EI2 A;  2HZC A;  1SH2 A;  3I31 A;  3WC2 A;  3DHW C;  1FD2 A;  1TV6 A;  4C11 A;  1HI0 P;  3SDE A;  5KFP A;  5KG5 A;  3T5H A;  1XC9 A;  1MWZ A;  4I4B A;  3LAL A;  4YR0 A;  4PWD A;  3BS9 A;  1YSJ A;  2OPS A;  4FP9 A;  5B0F A;  4OL8 A;  2AJ0 A;  3CDB A;  1JK9 B;  1RAH B;  2UUC J;  1AZS A;  4NLT A;  4X66 F;  1DFD A;  1QSY A;  4XDD A;  4ERD A;  1GAO A;  1U6F A;  1V5I B;  2OPP B;  1HBU B;  1DTQ B;  1NSK L;  1SIW B;  1JKH A;  5EUH A;  4CIO A;  3MM5 A;  4K8R A;  3VAG A;  3CCM S;  2FY8 A;  4OX8 A;  5F9L A;  3H7H B;  1LFP A;  1XER A;  4I2Q B;  5LOQ A;  1S4F A;  2OPQ B;  5GAG I;  2KFN A;  2YNG B;  1VBY A;  4MT1 A;  2YX7 A;  5KFF A;  2HGL A;  4N7T A;  4A8S A;  1LWX A;  5D77 A;  5EDW A;  2EFP A;  4QU7 A;  3BJY A;  2B43 A;  4LSZ B;  4L75 A;  1QVF R;  4DG1 B;  4WXO A;  3KUE A;  3MFI A;  2V4Q A;  4ELV A;  1CJU B;  3CJS A;  2EPI A;  1FFS B;  2N3L A;  4ECS A;  2RS2 A;  4A8K A;  4K4T A;  1MRO A;  1TP7 A;  4KE5 A;  3ZZO A;  4DFM A;  1VRT A;  3NGT A;  2HFO A;  4A8Y A;  1WG5 A;  1GEH A;  3V6J A;  1XWL A;  2A0F B;  1B0V A;  4LT6 A;  5FDL B;  1H7X A;  4UST A;  1Q5Y A;  2VL1 A;  3U1M A;  1X31 C;  2KL8 A;  3DOM B;  3M8P B;  3O2I A;  2BYC A;  1WHW A;  3QWP A;  4AYB D;  4RWW A;  2XM3 A;  3CJ5 A;  1CLF A;  1EQ0 A;  2VJU A;  1EQM A;  2C2K B;  1MN7 A;  2C22 A;  4DR3 J;  3DU5 A;  4XDC A;  2WSF C;  4QWB A;  1WEX A;  3EJM A;  2NR0 A;  1TVR B;  2GNK A;  1HYS A;  4NCG B;  4P7V A;  3AXM A;  4A46 A;  2OSQ A;  5HQM A;  3C46 A;  1UJ6 A;  1R8A A;  2FB0 A;  3EWG A;  2XMW A;  2LA4 A;  1FNX H;  4JI1 F;  4CLL A;  2YWK A;  3BZQ A;  3K5L A;  1FRI A;  4GVB B;  1RWP B;  2UXD J;  2QLF B;  5DJB A;  1PG5 B;  1TL3 A;  2CRL A;  5L1J A;  4FF4 A;  2BJE A;  5EWE A;  3UVJ A;  3D6F B;  2QRR A;  2KYX A;  2VBW A;  2R7O A;  3HKZ D;  3ILL A;  1WKJ A;  3NCR A;  4IO1 A;  4OQJ A;  3OSN A;  3OL9 A;  1RWV B;  1VLO A;  5DG8 A;  5KFY A;  4ZCI A;  2BUN A;  1DRZ A;  2C2N A;  4X4Q A;  3OL6 A;  3MUT P;  2DRA A;  3DLG B;  2XS5 A;  2MKC A;  3DLE A;  3DLK A;  2GX8 A;  1H98 A;  4YDD B;  1SL2 A;  2VOO A;  3V5R A;  1S76 D;  3CMQ A;  2V69 A;  2WOM A;  3W5Y A;  5HN0 A;  1OIA A;  2PDA A;  5CYJ A;  4WK3 A;  1U47 A;  1IXK A;  4N41 A;  4GKK F;  5KG2 A;  1S6Q A;  3MHY A;  5DZ6 A;  3TAM B;  1M5S A;  2LCW A;  5DDO C;  3IM9 A;  1NXI A;  4NA2 A;  2E9T A;  4C98 A;  1VDH A;  5ETL A;  3FZ2 A;  3R3T A;  4DXL A;  1Y10 A;  4ZN1 A;  2XHC A;  3DOL B;  3K8V A;  4HH1 A;  4OHW A;  2AGQ A;  3LPE A;  2C2M B;  1N36 F;  4O3S A;  3DNC A;  4PXD A;  2ZH8 A;  4DV1 J;  1C1B A;  1BWV A;  3FFI A;  4ELU A;  4U96 A;  3PYF A;  3G6X A;  2KT2 A;  2FLN A;  3CIZ A;  4KHR A;  3A4T A;  2ZHA A;  1T02 A;  1HNI B;  3R97 A;  3K59 A;  1HBO B;  1VRT B;  1D9A A;  1MRO B;  1HW8 A;  4KRW A;  4JI5 F;  2W4C A;  3E3X A;  3CMA S;  1N5Q A;  1S1U A;  3M8Y A;  2OHD A;  3FMW A;  5KG0 A;  4PQU B;  4RZR A;  1FDD A;  1H6K X;  3TEH B;  2F8H A;  3DRS A;  1ZPW X;  1WC4 A;  2MHN A;  2J7W A;  4HTI A;  3H0P A;  4Q44 A;  4F4Z A;  4JI5 J;  3G2X A;  1EB0 A;  1L3K A;  1Q8L A;  2CQ2 A;  2JSX A;  4P2X A;  1JJC B;  1NH8 A;  2RRN A;  2YX1 A;  2ZM6 F;  1RQ0 A;  6FD1 A;  3RB6 A;  3PAC A;  2IC3 A;  4MYT A;  2VHG A;  4K4U A;  4FYW B;  2VG7 A;  3UDC A;  4EO6 A;  4RKU C;  3BQ2 A;  4DV2 J;  3HDS A;  3WX4 A;  1XNR F;  4P72 A;  5A76 A;  3EPG A;  2G2Y A;  4K0K F;  2HQI A;  3JTP A;  3N01 A;  3MEK A;  4U6P A;  1N6Q A;  2J6S A;  3C6T B;  1UVL A;  2RNE A;  3GJQ B;  2O1P A;  4QBU A;  3PZP A;  2YNF A;  4MJK A;  5F9N A;  1PC5 A;  4NX9 A;  3OL8 A;  2VA3 A;  4J37 A;  3CCV S;  1S9E A;  2PMZ D;  2OD6 A;  5T41 A;  2W9B B;  3D68 A;  4DMZ A;  1FO1 A;  2HEK A;  5CXT A;  3FRZ A;  1S0V A;  1IJF B;  4B9L A;  2YPY A;  3IAS 9;  2B51 A;  1WWH A;  1CQN A;  3GYG A;  1UFW A;  3VZI A;  2W2P P;  3M2V B;  4BS2 A;  3J81 U;  3UCG A;  2VPY B;  3KLG A;  1RKI A;  2BA9 A;  1OPI A;  3H2V E;  2FVP A;  1EKR A;  1B64 A;  1NPK A;  5FII A;  3GMG A;  1FEH A;  1GH8 A;  4ZLL A;  5I42 B;  3N6M A;  1V3R A;  1WOS A;  4DV0 J;  7FD1 A;  4YEA A;  2FJA B;  3D6H B;  3KLG B;  1PBA A;  5E3C A;  1EJ7 L;  1IBM J;  2Z4P A;  5DLG A;  5ETP A;  3NMA A;  1F2G A;  3CCR S;  3S8S A;  1T9V A;  2RB7 A;  2R8I A;  3K0J A;  4LF9 F;  1CG2 A;  3MEC A;  4DQR A;  2ATL A;  1T94 A;  1MMN A;  2OUG A;  2VAS A;  3KWM A;  3G82 B;  1UVM A;  4OI4 A;  1RTH B;  3DDI A;  3L09 A;  2VC1 A;  1IVZ A;  4YUD A;  1WHV A;  1NM2 A;  2DNQ A;  4WKR A;  3HVA A;  2DR7 A;  3D5M A;  3TQ1 A;  2F5G A;  2VFV A;  3UDE A;  1RBL A;  1N6Q B;  1RWO B;  3MDF A;  2ZOG A;  3K5N A;  3RRK A;  1U2R A;  4DN0 A;  3KUG A;  4USU A;  2CJK A;  4AL5 A;  3SSR A;  2GIR A;  5ETS A;  1M5V C;  4ZIW A;  1NK9 A;  2LA6 A;  5KFI A;  4M94 A;  1U09 A;  3KK1 A;  2QYG A;  3KOA A;  3MR2 A;  1YVF A;  3LAM A;  1BLU A;  1UCN A;  2NCK L;  2YKP A;  3R7N B;  2YWE A;  3BSO A;  2CQ0 A;  4NXM J;  4U8Y A;  4ED3 A;  1SH3 A;  2DH9 A;  4TQR A;  1ZZN A;  3LUY A;  2M2B A;  1HD1 A;  4YN3 B;  2AIR B;  4KT0 C;  1CQM A;  1REV A;  5MLC V;  3AOD A;  2I2Y A;  1RTJ A;  3AQO A;  2L41 A;  2ZH7 A;  3V6H A;  5I3U A;  3QAT A;  2JRS A;  2HWT A;  4LFA F;  4DR1 J;  5C5J A;  1VQL S;  4ZIT A;  5D3G A;  4ZN3 A;  2ZZN A;  1HBO A;  2MQ8 A;  4DUY F;  4TKT A;  3EZU A;  4DUZ F;  3OTE A;  4Q0B A;  2HSE B;  3UCZ P;  5EWF A;  1NEE A;  1IBK F;  1DAX A;  1FX4 A;  4GC6 A;  2JVR A;  2I0X A;  5CYQ A;  2AD9 A;  1C0T B;  1S0M A;  1RT6 B;  3RYL A;  3VAF A;  4MYU A;  5DDQ C;  4D3G A;  3BEG B;  2HUR A;  1SH0 A;  2DGQ A;  3PR5 B;  2WSC C;  4F0H A;  4JV1 A;  5IFM A;  3DOL A;  5LMN J;  4OZ3 A;  2ERR A;  4IOC Q;  5LSR A;  3M9N B;  4ED5 A;  2K3K A;  1K47 A;  5IQ6 A;  3E2E A;  4OYM A;  1TL5 A;  4CH0 S;  3EXC X;  4H4O B;  1S6Q B;  2MXY A;  3PVX A;  1B99 A;  2CPE A;  5KFZ A;  3GFY A;  2RQC A;  1SKS A;  2E44 A;  3KJQ B;  3VQT A;  4KO0 B;  3DLK B;  4JYA J;  2R8K A;  3OJS A;  1RE1 B;  2GVZ A;  1K1Q A;  3U02 A;  3LQV A;  5G4D A;  4JI8 F;  1TEL A;  4YDX A;  1HL6 A;  4AE5 A;  1GMW A;  5BXI A;  2CPZ A;  2UU9 J;  1DJ0 A;  3R5D A;  3ZTO A;  1X7V A;  2R8G A;  4LF7 F;  1IKW B;  4EEY A;  3GSD A;  2Y3Y A;  3FK4 A;  2LP4 A;  1PO6 A;  4OZ1 A;  3TA0 A;  3UNY A;  4F67 A;  1CC8 A;  1X4E A;  1HWU A;  2D74 B;  2EWH A;  3DMJ A;  2GJF A;  2MKK A;  2OJ3 A;  4C4W A;  1WDD A;  2M88 A;  2JLE A;  3BBB A;  3LP2 B;  3RG6 A;  1SJR A;  4NCG A;  4PWW A;  3U1N A;  2JEI A;  4JI4 F;  1TK5 A;  3ITH A;  1KKH A;  4Z2X A;  2ROG A;  3GG0 A;  5HJX A;  3E01 B;  1HBM B;  5AJ3 J;  4WF9 Q;  4LJM A;  2YTC A;  2YKM B;  1NPP A;  1SUQ A;  3MZI A;  5HMX A;  5EN1 A;  4CLS A;  3IP0 A;  5B7W A;  3OLA A;  1RCX B;  2CZV C;  3NAH A;  1RHJ B;  2GVD B;  3C8Y A;  4NXN J;  3FDS A;  1FWK A;  1S1W B;  3GU0 A;  3H5Y A;  3DOM A;  3M8P A;  1RBO B;  4YOE A;  3ISN C;  2V4J A;  2HKE A;  3C6U B;  4ENO A;  3GIJ A;  3I56 S;  2ZBI A;  3BSC A;  1XR6 A;  2X1G A;  1VR6 A;  2VOP A;  1MSW D;  2IPO B;  2JFD A;  4MAK A;  1S4E A;  1UL3 A;  4BWJ A;  1S77 D;  2DO0 A;  3MR7 A;  4OX6 A;  3W63 A;  3ZZT A;  3BR8 A;  5A2Q U;  3SZ2 A;  2N4C A;  3N6L A;  3IAM 9;  1HQ2 A;  3OR1 A;  5C25 B;  2Z30 B;  1YKW A;  2KRB A;  3NXZ A;  3PYE A;  2VKR A;  2FJX A;  2BKN A;  4HDH A;  2PO4 A;  3QIP A;  3JQM A;  3N9U C;  4H4M B;  2AYG A;  4O3O A;  3LA0 A;  2VKZ G;  4F50 A;  1RAJ A;  2R2R A;  2E9Z A;  1UAW A;  2HVD A;  3W65 A;  1XK8 A;  1MLA A;  3GB0 A;  3MMC A;  4DQP A;  1NBE B;  3FSX A;  1Y9O A;  4TY9 A;  1JMT A;  2EXU A;  3FEY B;  4DPX A;  1M1G A;  3J7Z T;  3DYA B;  4AFF A;  1N48 A;  4F4K A;  3CJ3 A;  2GMH A;  2HZA A;  2YNG A;  3W60 A;  3ZTQ A;  4FS1 A;  2M5Y A;  3FUY A;  2QJ3 A;  3O3L A;  4NML A;  3KJV A;  2DRB A;  4KJI A;  2IIH A;  1UMJ A;  4KR0 B;  4IDK B;  4NRU A;  4JI0 F;  3EYZ A;  1HBU A;  1IBC B;  2PMH A;  4KIA A;  1AZS B;  3CJ8 A;  3ADA C;  4DUY J;  3R1H A;  4Q2L A;  1T9X A;  4QIV A;  4PYD A;  1LW2 A;  1H74 A;  3C16 B;  3KFW X;  3W2V A;  4CO5 A;  3NNC A;  1HW9 A;  3CD0 A;  3PFO A;  1JLF B;  3TYT A;  1Q5V A;  2XWY A;  4MIA A;  2CQP A;  3H2L A;  5HMZ A;  5J2P B;  3GIL A;  3ETO A;  3KMS A;  2HNZ B;  3BO4 A;  1HNX F;  1SKU B;  3FVY A;  4URG A;  5EGY A;  4ZLN A;  2QZ8 A;  1IR1 A;  2KI2 A;  3AD7 C;  5E7O B;  2BRL A;  4USH A;  4ZP9 A;  3C14 B;  2DR6 A;  1P1T A;  3N0V A;  2AEJ A;  2EK1 A;  1K9M T;  2QN6 B;  1RT7 A;  2QFJ A;  1WKL A;  2IDL A;  2VG6 B;  2B9W A;  1UVI A;  4KBI A;  4AXJ A;  1RAI B;  1N34 J;  5DM7 Q;  3UI3 A;  2H65 B;  2NXJ A;  1X4A A;  3C66 A;  3KG4 A;  2F3J A;  3F41 A;  1SXL A;  2VFR A;  3JSR A;  4KPC A;  1ZET A;  1M5O C;  2K1R A;  3A3N B;  2XGQ A;  4KGM A;  3BRE A;  4DL3 A;  4CLZ A;  1RTD A;  3CC2 S;  3Q24 A;  1X60 A;  2EFN A;  4ZJO A;  4DR4 F;  4JI8 J;  2HK2 A;  1I94 F;  3CXC R;  5IM0 A;  1FCA A;  2IM1 A;  2K7J A;  1FTR A;  4DR2 J;  1FNM A;  2V0N A;  1NJX A;  4TYB A;  1S1X B;  1U0H A;  4RO0 A;  2FGO A;  2H54 B;  4NYP A;  4WYW A;  4WE1 B;  5A8K B;  1ZAW A;  1B4S A;  2G2O A;  2EVZ A;  4N5S A;  4KHP J;  1MMD A;  3CO0 P;  4KC5 A;  1MWQ A;  2XCP A;  4J9S A;  5E3P A;  3IM8 A;  1WUU A;  1IKY A;  5LMN F;  2NPI A;  2AWZ A;  4ECZ A;  1SKR A;  1JLC A;  3B54 A;  3B8H A;  1YJW S;  3O44 A;  3ET6 A;  1VQS A;  5DQH A;  4PRF A;  1LNQ A;  3F56 A;  5GAH U;  5HSP A;  5ETK A;  2XCA A;  4HH0 A;  4LSL B;  4DV1 F;  4O4G A;  2CZ9 A;  1JXV A;  4Y28 C;  2DR9 A;  1ZBT A;  2K3I A;  3HT0 A;  3MCN A;  3GV8 B;  5HLF B;  1WOR A;  4ZDN A;  3FQK A;  3RRG A;  3HVT B;  3E8O A;  1A7G E;  1Q53 A;  2G1H A;  4RU9 A;  4PG4 A;  4UW2 A;  4ZA1 A;  4DV6 J;  2ATC B;  3R7B B;  4LSN A;  3EXY A;  2F4V F;  1JNZ B;  3EIC A;  4LSL A;  4CLP A;  2ADB A;  4OLP A;  2DHA A;  2B7C B;  2FGC A;  4HT5 A;  2AJ2 A;  3PO4 A;  1QE1 B;  1RT2 B;  1UEK A;  2FJE B;  2VZ9 A;  4YB7 A;  4FBT A;  2R7X A;  1FRL A;  1RJJ A;  1DLO A;  1IWA A;  3FEX B;  3IR6 B;  3K7R A;  4QR1 A;  3TUI C;  4F3Q A;  3D3B J;  4QPX A;  3T1Y F;  2YKO A;  3JSY A;  3CCJ S;  3EGZ A;  2VD3 A;  4WFZ A;  4NE9 C;  4A47 A;  4DEZ A;  2HHS A;  1QD1 A;  1TR0 A;  2P8I A;  3DOK B;  3MPV A;  1S72 S;  2KZZ A;  2VFT A;  1X4H A;  2NSB A;  3NNA A;  3HFZ B;  4R8U B;  1NK6 A;  1F5C A;  2AHO B;  2MZT A;  3ISZ A;  3VV2 B;  1U25 A;  2CPX A;  5J2Q A;  1NJZ A;  4BC9 A;  1VRU A;  2GJ2 A;  1KLN A;  4GC7 A;  4K4W A;  3W9I A;  3C15 A;  4O3N A;  1NAQ A;  2RRB A;  1LW0 B;  4CDI A;  3IFE A;  5HP1 B;  1KWM A;  5KG3 A;  1R89 A;  4RNH A;  2CPF A;  3EVM A;  4HYK A;  3OHB A;  2AV5 A;  1I5O B;  3H59 A;  4O4R A;  2BJD A;  4DL4 A;  5FJ4 A;  2DNP A;  5A6W A;  2GAG C;  2I8E A;  2I1R A;  2W7A A;  3I0R B;  4F2R A;  3H2U B;  5DRK A;  3K5M A;  4UQT A;  2R2U A;  2COL A;  5ETR A;  2LLZ A;  2HVI A;  3THT A;  4DX6 A;  1L3U A;  5J2P A;  3TAR A;  2EFQ A;  4LRE A;  2ILZ A;  1P9Y A;  2U2F A;  4DV0 F;  2MKY A;  2AZ3 A;  2V94 A;  3Q2S C;  3KHH A;  3V6K A;  5DS7 A;  3PW4 A;  5LSL A;  5EWG A;  4LR7 A;  1B3T A;  2XZW A;  1WF0 A;  1VLY A;  1ITP A;  2HQD A;  4M5H A;  3BGU A;  1U6Z A;  3GCW P;  1FWL A;  2C2O B;  2GAH C;  4IDK A;  3BH7 B;  3G8T A;  3Q8Y A;  1VIX A;  2J5A A;  3FBB A;  4WYL A;  5KFO A;  2AGP A;  2E5L F;  3J7A 1;  1NDC A;  3OT9 A;  4IH6 A;  1TAU A;  3M4X A;  1YWX A;  3IO1 A;  1ZM2 A;  1GK8 A;  3AT1 B;  2XSJ B;  1BD6 A;  3HFV A;  5KG1 A;  1VIO A;  4PXE A;  4OV6 A;  3W2W B;  1NLK L;  5H1S V;  3BO3 A;  3OFE A;  1QUP A;  1T05 B;  4FF1 A;  4HHJ A;  1FEE A;  1RAC B;  4C6A A;  5LJ5 Y;  1TTH B;  1K44 A;  2PC6 A;  3ENW A;  4CO4 A;  3PR4 A;  4NLW A;  3PXG a;  5B0A A;  4UOH A;  4RUH A;  1OPZ A;  1RXO B;  1UPM B;  2OKQ A;  3BGF A;  2CXE A;  4H4M A;  4NRT A;  3Q8R B;  3G96 A;  4DS4 A;  5JJB A;  3MPU B;  4XAK A;  2PGC A;  3LH2 S;  4K5R A;  1CC7 A;  4CNZ A;  1LXJ A;  1YJ9 S;  3HUL A;  1S48 A;  4J91 A;  2Z2L A;  4DV7 J;  2D9O A;  2DNK A;  4KKO A;  2ZEJ A;  4NLX A;  5ADZ A;  1R8P A;  2EC2 A;  1F2H A;  4ECR A;  1HAR A;  1R0A B;  1FRK A;  1OSD A;  1MU2 A;  3VF0 B;  4JUZ A;  3RBD A;  8RUC A;  2UUC F;  4KTQ A;  2UV8 A;  3ZC4 A;  1BQN A;  3TUP A;  4DCP B;  3NAI A;  1BUX A;  1WEZ A;  3M32 B;  3OTD A;  3PY8 A;  3PX6 A;  4WTY A;  2JFK A;  3PJX A;  2CFX A;  4OX9 F;  5KFD A;  1IBM F;  2RKI B;  3IWN C;  4ICL A;  3KLV A;  1TKZ A;  2B6A A;  4OZN A;  4ZKA A;  3NOG A;  2DO4 A;  3LAN A;  3E01 A;  3GV5 B;  3MMA A;  3MEG B;  2XMT A;  3RB0 A;  2MZ1 A;  2MKH A;  3GJR B;  5CQG A;  4DV4 F;  3HHL A;  3LP2 A;  2JEF A;  3TAN A;  5GAD I;  3C15 B;  2F8M A;  3H8Y A;  3D9B A;  1UA0 A;  1N5Y B;  2HHH F;  5B08 A;  2RQK A;  3R7S B;  1RYS A;  2J76 E;  3PCO B;  4CI0 B;  5IT9 U;  3HMJ G;  2DNY A;  1VCT A;  2FYX A;  2MTL A;  1X0F A;  4MIB A;  2LFV A;  3VGU A;  1R31 A;  4R8U A;  4W92 B;  2JH3 A;  4ZK7 M;  2LVW A;  2V68 A;  3UD5 A;  2NS1 B;  4MFB A;  3D7S B;  1H2U X;  4TNO A;  5LM7 E;  5C7P A;  4OHV A;  2H9Z A;  3AY0 A;  4M5D B;  5KT4 A;  4KHM A;  4DSL A;  3US5 A;  3CCU S;  4JI0 J;  2QV6 A;  1VRQ C;  4FXV A;  4ETZ A;  2VA2 A;  5IS2 A;  3C3L A;  2WVB A;  3M05 A;  3ZZZ A;  3E51 A;  3CCT A;  5KFL A;  4GO5 X;  2EI5 A;  2M8D B;  2MHE A;  1SC4 B;  2W2M P;  3FCW A;  5BYR A;  1XNR J;  1QE1 A;  1RDR A;  4QWC A;  2DNR A;  4DLE A;  2UVR A;  2OTJ S;  1H73 A;  2J0S D;  4CYU A;  3AD9 C;  4M5D A;  2DNO A;  2BW7 A;  1D8Y A;  1Y0H A;  1XN9 A;  2FZG B;  5ETV A;  3Q8P B;  3M8Z A;  4ER8 A;  2Y1J A;  1KTQ A;  3O6Q A;  4IR9 A;  3DI6 B;  4QZV B;  2QG9 B;  4P10 A;  3TUJ C;  2NSC A;  2GZO A;  1W25 A;  2V50 A;  2CQ4 A;  3MM8 A;  2E5I A;  3H4B A;  5HLF A;  2DIU A;  2EG2 A;  2QYC A;  1VFJ A;  4PG6 A;  2R7Q A;  2YNH B;  2ACY A;  2C2E A;  1YJU A;  5CYM A;  2C28 A;  2JOQ A;  3W8G A;  4LVN P;  4O0N A;  2EBE A;  1WD6 A;  5CYQ B;  4C7Q A;  4CO0 A;  4FS2 A;  1LEO A;  2FJD B;  4HAC A;  2LXF A;  1G1X A;  4LFC J;  5KFA A;  2QMX A;  3D2W A;  1S12 A;  1CJV B;  1HQE B;  4PKD B;  1IQZ A;  2R7W A;  1WOP A;  1Q8K A;  3HLU A;  1S49 A;  1CUL A;  3OTC A;  2PI5 A;  1TUG B;  4ES3 A;  2PA3 A;  5K8M A;  5L9N A;  2O5D A;  2KG1 A;  1DY3 A;  4ZPW R;  1YRT A;  4EYH B;  4LVO P;  4R0J A;  1X0P A;  4IFV B;  3ZZP A;  1HA1 A;  3QSY B;  1X5O A;  3T6B A;  4L72 B;  2CG4 A;  5F8I A;  1M1K T;  2FDN A;  1N33 F;  2MB0 B;  1VHF A;  2BAC A;  4LFA J;  4HL9 A;  2R4F A;  3W1Y C;  4C0H A;  2GHP A;  4X4U A;  3R5A A;  1ZM9 A;  4GRS A;  1U1N A;  1SV5 A;  1S7I A;  1SI9 A;  2K1R B;  3B78 A;  4Y2M A;  3CJK A;  1L5U A;  1VC0 A;  2OIH A;  3GSI A;  4Q8E A;  1EP4 B;  1FKP A;  2XZD B;  3R5B A;  1NKC A;  3C19 A;  4B3S F;  1JB0 C;  3R6G B;  4BBY A;  1Q82 T;  1FJ7 A;  3RRH A;  2ZBR A;  2QLB B;  1HIY A;  1N5V A;  4WPA A;  4AL6 A;  2J6T A;  1UVN A;  1TQL A;  2R7V A;  3RR7 A;  2PN6 A;  1RTH A;  2RF2 A;  3AJ1 A;  4LRB A;  4HHU A;  3GQC A;  4UZB A;  4K0K J;  2AF6 A;  2RH3 A;  3DRP B;  3ZZ0 A;  4ECX A;  1X5P A;  4OX7 A;  4LF5 J;  2ZBQ A;  4YB5 A;  3W2V B;  1HR0 F;  2XG8 A;  5IWA J;  3NS5 A;  1RHK B;  4NLQ A;  1XMO J;  2XSJ A;  2FVC A;  1XNQ F;  1MW7 A;  1LWF B;  2DTJ A;  3P5T L;  1VOM A;  3UFC X;  5IV4 A;  3TZY A;  1YRU A;  3D28 A;  4WFX A;  3D67 A;  2WW8 A;  3IRW P;  3DRR A;  5LMU F;  1WG1 A;  5HRO A;  2BVZ A;  3PKM A;  3TWZ A;  3LGM A;  1VIS A;  1NJY A;  2IMW P;  1Q81 T;  1ZTT A;  5GVQ A;  1RU1 A;  1X4D A;  2NQP A;  1IR0 A;  3VCD A;  5J1N A;  4N56 A;  3Q8S B;  1AA1 B;  3BBF A;  3TQE A;  2RHQ B;  1WDT A;  2ZC4 A;  5AE2 A;  3EDR B;  2J9E A;  4IO9 Q;  3FEZ A;  4NLG A;  2GW8 A;  2AJ4 A;  2J0W A;  2O01 C;  3MM9 A;  4MK9 A;  3OR1 B;  2N82 B;  3JQJ A;  2FJB B;  4E0D A;  4FVC A;  2EFV A;  1UJ4 A;  2R7U A;  4PZV A;  3T1Y J;  2F7V A;  2RVJ A;  3SCJ E;  3TA1 A;  4B9T A;  2ZIT A;  1NO8 A;  1LW0 A;  2MLX A;  1CJK B;  2OEL A;  3HHL C;  4ZIV A;  4A8W A;  1SVD A;  2V4J B;  3C6U A;  1XMQ J;  1QLN A;  2LEB A;  2LU1 A;  4FYX B;  4OJG A;  3DRS B;  3RZA A;  2FVQ A;  2M8H A;  2R7R A;  3M8W A;  1RHM B;  3WHI A;  2CQ1 A;  4LR8 A;  4WWS A;  4J9M A;  4DV2 F;  4RX6 A;  1S0O A;  1FXD A;  4O3R A;  2OEK A;  4QYR A;  4CTA A;  3FCH A;  4YME A;  1RT3 A;  3PEJ A;  3DOK A;  2LEA A;  2RIJ A;  2MY8 A;  1L3T A;  1HNI A;  4KH0 B;  3PKY A;  2CJA A;  3LTO A;  4RLE A;  2YVS A;  4RJV A;  3KLF B;  3RAQ A;  1D3W A;  4XTT A;  2KN4 A;  3R5G A;  2XY6 A;  2MJN A;  2G0I A;  2XQC A;  3LO3 A;  2HFN A;  3DMJ B;  4UUX A;  4PPZ A;  2MZR A;  2AT1 B;  2AKW B;  2ZHO A;  4ZPA A;  3RBZ A;  2RDJ A;  4IRD A;  1OS5 A;  1HHQ A;  2IDE A;  5A8W A;  3CJ4 A;  2AGO A;  5AXK A;  1X8D A;  3LP1 B;  1F9F A;  3GYN A;  3OUY B;  1H0H B;  3V6D B;  5HBM A;  3NL0 A;  3H25 A;  2BE7 D;  3F44 A;  2W4D A;  4IG0 A;  3TR5 A;  2MQP A;  2AX1 A;  3J7Y I;  1YJN S;  3ENV A;  4NZ7 A;  2H4Y B;  4DV7 F;  1KNZ A;  4DR4 J;  5F8N A;  3IRX A;  4OHY A;  2QA2 A;  4OJH A;  1NRK A;  3LP0 A;  4DPY A;  1U1K A;  3BM7 A;  2KM8 C;  3KLE A;  3NMR A;  3GIM A;  2P9E A;  4KGK A;  4EU0 A;  2DJW A;  1XMQ F;  1HNZ F;  2OO4 A;  2KFZ A;  4IG0 B;  2HVZ A;  4Y65 A;  1ACM B;  2RDD A;  1SCJ B;  2E5G A;  2HIY A;  3L95 X;  4WE1 A;  5A2Q Y;  3LWL A;  3SEO A;  1VC6 A;  1VQ5 S;  2ZOM A;  4FVM A;  1S1X A;  1ARO P;  4DUZ J;  1IWG A;  2GO8 A;  3CJ2 A;  4LIR A;  4CH1 A;  3JB9 k;  1OY6 A;  2WON B;  4JB8 B;  4ZP8 A;  3VZH A;  4OZL A;  2RML A;  5IM0 B;  3JYT B;  1FER A;  4CRJ A;  1BC6 A;  1C0T A;  2CPJ A;  1FKO A;  3HJV A;  5KFN A;  2VBX A;  2HYI B;  2BW2 A;  3KLF A;  3OBI A;  2C2D A;  1X4G A;  2NZC A;  3GIK A;  4ED8 A;  4Y2A A;  3UWT A;  3ZTS A;  2V9W A;  4X62 F;  2OFG X;  4LQ9 A;  4CLY A;  4Q0B B;  2VBZ A;  3SXL A;  3OVB A;  2ZBC A;  3H5U A;  2XWX A;  4DZD A;  2ZH6 A;  5D3G B;  1RT1 A;  5I3U B;  4RU2 A;  1RAD B;  4NXM F;  2ZM6 J;  2APO A;  3M8R A;  2UXD F;  1GQE A;  1REV B;  1JQG A;  1DAR A;  1RT7 B;  2DIS A;  2UV8 G;  3QFW A;  3QQC D;  4X66 J;  2Z2M A;  3L3C A;  1PYS B;  1Z4U A;  3C14 A;  1F9H A;  4TN2 A;  5ETO A;  3BF4 A;  3GPA A;  3F73 A;  4ZCM A;  1YIT S;  4ILL A;  4NMX A;  2XO7 A;  1R8B A;  4KSE B;  5D0R A;  2I5J A;  5JVG Q;  3FQL A;  4ED1 A;  3O5T B;  4M95 A;  2W25 A;  2H5E A;  4OFZ A;  6FDR A;  3UR0 A;  4WJB A;  1L3V A;  3UPF A;  4MTP A;  1TMM A;  3Q0A A;  4LR9 A;  3TJ9 A;  2BDP A;  3W62 A;  1E6Y A;  2PSZ A;  3CIM A;  5KFC A;  4C3M A;  4ED0 A;  3RBX A;  2XS2 A;  2D9P A;  2IM2 A;  5GMK a;  3HD1 A;  1FA0 A;  1HQU B;  1KS2 A;  1Y11 A;  2CNN B;  2EK6 A;  2M3D A;  5ETT A;  5HAN A;  3TO8 A;  4DG1 A;  2G4B A;  2YWG A;  2BE9 B;  1Y5L B;  3AH6 A;  5D4P A;  2KB2 A;  4L3N A;  1N36 J;  2PMW A;  2CAD A;  2OAU A;  4FYV B;  4DSF A;  3HSG A;  4C8O A;  4A8M P;  4AT1 B;  4DV5 J;  2CQC A;  1WI6 A;  1N52 B;  4LBP A;  1YJV A;  3ZO7 A;  4BHQ A;  2G2Z A;  2QLJ B;  3B4D A;  3PJ9 A;  3CCQ S;  3GP9 A;  1C2P A;  1HFE L;  1FRM A;  4ECQ A;  4I2Q A;  1U48 A;  1URN A;  2LXU A;  3SFU A;  4GKK J;  1AXQ A;  2LQJ A;  2EW9 A;  1MML A;  1GTH A;  1FDB A;  3W9J A;  2CDR B;  1ZH5 A;  5H9E K;  1UTA A;  1ICE B;  3IN5 A;  3W5X A;  2V4R A;  3BH6 B;  3JQK A;  2XO6 A;  1IBL F;  1QSS A;  5T14 A;  4AXI A;  4WXW A;  2ZZM A;  2DNH A;  3BYP A;  2Y0B B;  2FJW A;  4PXC A;  2HFS A;  4ZHR A;  3I5B A;  8ATC B;  2W9B A;  3KTQ A;  1S9E B;  2FTR A;  4A48 A;  3H4D A;  5EHH A;  1AYE A;  1S1W A;  2F1F A;  1KD1 T;  4CLF A;  1JLB A;  4J90 A;  3Q23 A;  2BE2 B;  4EBD A;  4K59 A;  2GVD A;  2H1Y A;  4C0B A;  3NBP A;  4NLS A;  3SV4 A;  1JLA B;  4RNM A;  1RT5 A;  1DBD A;  2YKM A;  1B0P A;  1HKA A;  4P73 A;  1BHN A;  1EP4 A;  1FKP B;  2KXF A;  2UXC J;  1R8H A;  3SCL E;  3K2Y A;  3I9V 9;  2XEX A;  3ITH B;  3EMT A;  3W7B A;  1CBK A;  1SC3 B;  2GHV C;  5DM6 Q;  3KUH A;  2HHU A;  1T03 B;  2Q3P A;  1GX6 A;  2BMB A;  4M5G A;  2HAI A;  4CCH A;  3KK2 B;  1UZD A;  2VFS A;  3KK3 B;  4GKJ F;  3LGH A;  1TFW A;  5D4L A;  4JV5 F;  3JYT A;  3EE3 A;  3J7Y U;  4U95 A;  2MLY A;  2HS4 A;  3CCZ A;  1OO0 B;  4GO7 X;  4IFV A;  2WTF A;  2VJV A;  2MQL A;  4C8M A;  3K17 A;  4Q5V A;  1AUD A;  1IM6 A;  3NWR A;  3ZZY A;  4N47 A;  5DET A;  3G6V A;  1KON A;  3G71 S;  3HO1 A;  4PQU A;  1A9N B;  1QJH A;  2KKH A;  2L9N A;  2VUG A;  4USV A;  3M9O B;  2CPI A;  2XLK A;  3KKF A;  4WTO B;  3SI8 A;  4UZC A;  1IUJ A;  2NRE A;  3WC0 A;  2W4P A;  3MED B;  2WCX A;  1FF2 A;  4I6A A;  2DVI A;  1LK5 A;  3BBC A;  3LP0 B;  2FZK B;  3MM7 B;  1SQE A;  3IRX B;  1V6H A;  2N3O A;  3VAK A;  5CYM B;  2F4V J;  4DX5 A;  4QWD A;  1QAJ A;  3CDW A;  1FFG B;  3HCX A;  2DBB A;  3IGN A;  4G65 A;  4H4O A;  5HVF A;  1CEZ A;  5D78 A;  2NUU G;  3OUY A;  1RKJ A;  2EBG A;  1M5K C;  5HK4 A;  1FRH A;  5E2Q A;  2ZUG A;  3BPD A;  1NH7 A;  5A8W B;  1N56 A;  3EPI A;  2F4F A;  3OXG A;  1N4L A;  2KXH A;  3KXD A;  5FD1 A;  2O3D A;  3S6E A;  4X65 J;  3D6M B;  3FC9 A;  3P45 B;  5A6P A;  1VQO S;  2DXD A;  2RUG A;  1VYA A;  2KHC A;  3Q86 A;  4AND A;  4ZVF A;  3BN7 A;  3DN9 A;  3DLG A;  3BKU A;  2Y8W A;  3MED A;  1CSJ A;  3FCV A;  1UJ5 A;  1Z2Z A;  3AOA A;  3D66 A;  4ZCK A;  4G1P A;  3M2R A;  3M8S A;  3J81 j;  1OSC A;  4NLU A;  4CTA B;  1B70 B;  3TX0 A;  1B7Y B;  4ITS A;  2B5J A;  3UVJ B;  3NGD A;  3BV8 A;  1N5T A;  2ZH1 A;  2DPJ A;  4K2J A;  2HW3 A;  1U02 A;  2CNL B;  3HHK A;  4CO2 A;  2UVU A;  2GMJ A;  2OD4 A;  3JSB A;  2XI2 A;  4WK1 A;  4YY3 F;  5BYQ A;  3RB4 A;  4B3O A;  2WK4 A;  1N5Y A;  2M52 A;  5AXL A;  4B9V A;  3M1V B;  3I9Z A;  3N5F A;  3BKT A;  3THP A;  4O3Q A;  4BCA A;  7AT1 B;  2FIU A;  1XR5 A;  4HDG A;  4RUB A;  3LF0 A;  2YQ0 A;  5KFX A;  4AUK A;  5F8L A;  5KG7 A;  3R9L A;  3MAQ A;  3GON A;  2ZH9 A;  4KAI A;  3HSJ A;  1M5H A;  3MEG A;  1RWX B;  1WKK A;  2KU7 A;  2CQI A;  2OGU A;  1F9E B;  1WTF A;  2Q1L A;  1KLM B;  4Y00 A;  3UDV A;  2IFX A;  2IRU A;  2DNN A;  1JLA A;  4HHH A;  2LKZ A;  1TKZ B;  2B6A B;  2DNG A;  2WRM A;  3MPY A;  4KH1 B;  4LF2 A;  2I38 A;  4ICL B;  2IVF B;  4UQG A;  3DLH A;  4B08 A;  4FDF A;  3OL7 A;  2CVI A;  1KQG B;  1FT8 A;  4DZ6 A;  1NJW A;  3PIO Q;  4F4W A;  1KFS A;  1M5P C;  4G3I A;  4ZHR B;  1PKU A;  4J7C A;  1MU2 B;  2DGW A;  2HHX A;  4RW4 B;  3Q89 A;  3NCQ A;  3FSY A;  3W64 A;  1QDU B;  3MPD A;  4PYA A;  4FNH A;  1RHR B;  1R6Y A;  5D0G A;  5SUH A;  1QAY A;  2CJB A;  2BV3 A;  5LJ3 Y;  3TAQ A;  1VQ6 S;  4DJB A;  4ETX A;  4DPW A;  1HI1 A;  3T1H F;  2UUT A;  1WC6 A;  2QFI A;  4ED2 A;  2ZHB A;  1U4B A;  4WP8 A;  4X4T A;  1GXL A;  2C2Z B;  2XTJ P;  3EZ5 A;  3EDQ B;  2CZ4 A;  4Z37 A;  4DSE A;  2Z2Y B;  1C0U B;  2IYG A;  2PFD A;  2QL9 B;  3OR2 B;  5F41 A;  3TZW A;  2XHW A;  1HNV A;  1PC4 A;  5ETQ A;  3MR3 A;  1RT4 B;  3A8K A;  4CLT A;  2JHE A;  3DRP A;  4OI0 A;  4DR2 F;  1PIL A;  4JYA F;  2ZJQ Q;  3BDE A;  2I6W A;  5L9X A;  1HQU A;  1U1L A;  4KV8 B;  1XMB A;  1WC5 A;  1F5A A;  1KEK A;  1T7P A;  3QJL A;  1A0O B;  4USI A;  2BM0 A;  3CNQ P;  4WFB Q;  5D4N A;  1UW4 A;  1T3O A;  2B4O A;  3WZ0 A;  1E6Y B;  2OPP A;  4LQ3 A;  2HLU A;  3V2U C;  5IWA F;  3DCA A;  4F8R A;  3CJK B;  2RQ4 A;  5M2U A;  2HLT A;  2VG7 B;  2FD2 A;  2ZKT A;  4EYI B;  3D1O A;  2FHK A;  2CQG A;  2RAQ A;  2HBZ B;  1LK7 A;  4KGZ B;  2YWH A;  3JSM A;  4DL7 A;  3CJR A;  2DEJ A;  4NPO A;  1YZ6 A;  2HS3 A;  1HBN B;  3HSD A;  3ZZU A;  1FES A;  1IBK J;  4A8Q A;  3K5P A;  4EZ9 A;  2DGV A;  4EBC A;  1NHV A;  4NLP A;  1VBX A;  1X9S A;  3W5Z A;  1YJR A;  1S1U B;  1PYT A;  1CUL B;  1T95 A;  3MTJ A;  3CW2 C;  5J1E B;  1J2V A;  1RT1 B;  2WBM A;  5HAT A;  3QBC A;  2PA8 D;  1FVS A;  3RB3 A;  5CCL A;  2CVE A;  1GX5 A;  1HI8 A;  2QX0 A;  1IJE B;  1G7C B;  1QVG R;  2B8P A;  4V19 J;  2DY1 A;  2V2V A;  3FFI B;  2UZA A;  1VRU B;  1ZZF A;  2CJY B;  3Q8Q B;  2HGN A;  2HNY B;  2WW4 A;  3M2U A;  3CED A;  3TEG A;  5CD4 H;  4J9K A;  1O0P A;  2CPH A;  2MZJ A;  4HR2 A;  2V2Z A;  3ZNU A;  2QO3 A;  2K2P A;  2PT0 A;  3VGT A;  5AE1 A;  4B3T F;  3NY0 A;  1REG X;  1VJW A;  4C8Y A;  3I82 A;  2KFY A;  2IA6 A;  4F25 A;  1K0T A;  2V9K A;  1PJ7 A;  4WFA Q;  1XIQ A;  1F6T A;  2FPH X;  1ZYQ A;  1HHS A;  4Y0F A;  2HHW A;  1VMB A;  2FUG 9;  5GMD A;  5L1K A;  4LF9 J;  1TKD A;  3KG0 A;  3KJF B;  2DRD A;  4YR3 A;  3EX7 B;  4DR3 F;  3V81 A;  2V8H A;  1FJG F;  2Q43 A;  2RE1 A;  4MFB B;  4OJ3 A;  2M9K A;  1K73 T;  2DIV A;  4EK2 A;  4UOC A;  5CAA A;  2MZQ A;  3MFH A;  3WQP A;  2BBE A;  1RI7 A;  2O66 A;  3AOC A;  1NU4 A;  5KFE A;  3M6V A;  2A2C A;  2XI3 A;  3OXL A;  3HHD A;  4ZCL A;  4URS A;  4BWM A;  2MKI A;  2HRY A;  3M30 A;  1P27 B;  2M0G B;  3OLB A;  3V4I B;  3K89 A;  4J9O A;  3A3P B;  4C8N A;  4ANC A;  5IT4 A;  1DUR A;  2KT5 A;  3DDN A;  4HI1 A;  1WHX A;  2AZ1 A;  4ES1 A;  3TW0 A;  2W8L A;  2MMY A;  1XEZ A;  3D0G E;  1TVR A;  1C4A A;  3MCM A;  3M6X A;  4FBU A;  1PIE A;  3KHR A;  3BB5 A;  1F60 B;  2XGP A;  1U0H B;  2HQF A;  2E29 A;  2E5L J;  3ILO A;  2MPU A;  2W01 A;  1ZTW A;  2ASY A;  1T0T V;  1FHT A;  5IC6 B;  4TLR A;  5K20 B;  4JI4 J;  5J2M A;  2O67 A;  1GMW D;  1G4C A;  1RHQ B;  3CGI A;  4UY8 5;  3D1H A;  4IH7 A;  4ID8 A;  5B0G A;  2QSF A;  2ZH5 A;  2AEF A;  2LXI A;  3W61 A;  1D0E A;  2BJ7 A;  1VQM S;  2F8E X;  1OY8 A;  1UP1 A;  3Q83 A;  4P71 A;  1RUS A;  4JV2 A;  4TY8 B;  4ED7 A;  1X4B A;  4JI1 J;  2BJ8 A;  1TL7 B;  3DRX A;  4EUV A;  1JLG A;  4XO0 A;  1X9M A;  1VQ8 S;  4ID5 A;  3MM9 B;  4QIE A;  5DO2 A;  1WEY A;  2CDQ A;  2Z57 B;  4X2B A;  2ZNY A;  3LAK A;  4ZOS A;  6AT1 B;  4Q7A A;  1NCL A;  3BGR B;  2B8Q A;  3DHX A;  3VAL A;  4KY3 A;  2ZJR Q;  5IQQ A;  1Q79 A;  3RTV A;  4U7U K;  3HHN B;  2HZV A;  4JV0 A;  5LSO A;  3J80 U;  3OTO J;  2RUS A;  1T05 A;  4DR6 F;  3QNW B;  2ILY A;  1T9Y A;  3HVR A;  2YNI B;  4X4O A;  4OI1 A;  1XR7 A;  3IR7 B;  1U0S A;  4PAA A;  1UWA A;  3TVZ A;  3ETM A;  3ILJ A;  2ABY A;  1QUV A;  1RA7 A;  3QAU A;  2Y1I A;  4LF5 F;  5KT2 A;  1RAE B;  3BR9 A;  3KLH A;  2BX6 A;  5L1I A;  1KDN A;  1XQI A;  1O51 A;  3X1L B;  2X7I A;  1JKH B;  4OMF G;  1SC6 A;  3T3F A;  2GC8 A;  1WTB A;  2D3U A;  3CF5 Q;  4TVA B;  2MQO A;  3TVK A;  1KOH A;  2D41 A;  2DNL A;  1VK8 A;  4XIU A;  4ECT A;  1U8W A;  1NJI T;  2DNZ A;  4DX7 A;  1WHY A;  2VFU A;  2XUL A;  2AX0 A;  3I0S B;  3G87 A;  3L7U A;  3HZE A;  4I68 A;  4QR2 A;  1S57 A;  3SDE B;  4U67 Q;  2LQB A;  4QR0 A;  2ADC A;  2RF2 B;  4TU9 A;  1R6V A;  2B9E A;  3UDL A;  1U8S A;  2B9Y A;  2XSF A;  3MF5 A;  3VR1 A;  1TL7 A;  2VV5 A;  4XPE A;  2HBY B;  1TKX A;  3RUB L;  2HG4 A;  1DTT A;  4DV5 F;  3T9Z A;  4RBT A;  4DSI A;  3NKY A;  5L39 A;  1VQ9 S;  1K1S A;  2E9R X;  1OYD A;  2DCU B;  3AB4 B;  1S1V A;  2JVO A;  1UFL A;  2J8S A;  4FN5 A;  3RAM A;  2FHJ A;  4LF6 J;  1LWE A;  9ATC B;  1S6U A;  3GLJ A;  5THW A;  2R2T A;  4F3M A;  2IA0 A;  2NPF A;  1VGY A;  4N8N A;  3N28 A;  3RW7 A;  2V6A A;  5C24 A;  3EM1 A;  5KFW A;  1I6J A;  4QW9 A;  2IBK A;  2JLF A;  3T19 A;  5LMU J;  3PX4 A;  3QWU A;  4DPO A;  4NOH A;  4F26 A;  4Q45 A;  1T8E A;  2C42 A;  2C3Y A;  4ILR A;  3VWS A;  1NZ8 A;  4YY3 J;  3N4W A;  5K14 A;  1W26 A;  1ZOT A;  1SUQ B;  3QT5 A;  1KVI A;  4ZS6 A;  1KQF B;  2J0X A;  4NYO A;  3IS9 A;  4FPR A;  3MR5 A;  1I3O B;  3AJ2 A;  3W8P A;  1J5O B;  1T9U A;  4KGV B;  4RR5 A;  2VQF J;  5KFJ A;  2RD5 C;  5DQG A;  1MG7 A;  1KSP A;  2V34 A;  3IR5 B;  2ZKU A;  3GCX P;  2RQM A;  1Y3K A;  3TZX A;  2X1A A;  4LF8 J;  2DPI A;  4FZV A;  1URR A;  4O23 A;  1H7W A;  1GXT A;  4A4J A;  2H3E B;  2MQM A;  2YNH A;  2XC9 A;  2W9C B;  1OJ4 A;  2P2C B;  2ZFH A;  3MD3 A;  5F8H A;  3OXF A;  4KFB A;  3DXS X;  2UUA F;  4QU6 A;  2JC1 A;  2C3M A;  3QLH A;  2W8K A;  2XMM A;  3DI6 A;  1X9W A;  2D7S A;  4O4G B;  1HHT P;  1RCO B;  2OEJ A;  1SB6 A;  3A8I A;  3D54 A;  2IY5 B;  2BJ1 A;  3P49 B;  3T41 A;  1R0C B;  2V63 A;  3A8J A;  1WF1 A;  2BM1 A;  4G1I A;  2GHW A;  1RHU B;  2XYH B;  3AJD A;  5CA5 A;  4NA3 A;  2J9D E;  4IG3 B;  3Q8V A;  1AFJ A;  2B9X A;  4J9P A;  2F63 A;  3P8B B;  5IOL A;  3BO2 A;  4DFP A;  1S7H A;  1NKB A;  2ASL A;  4M5K A;  5U47 A;  3FMB A;  4USK A;  4ELT A;  1NB2 A;  3M2U B;  4UT4 A;  4TXS A;  5CAB A;  4P2S A;  1HMV A;  2D69 A;  2BEF A;  2F9D A;  4IG3 A;  1D9D A;  4OIX A;  4E98 A;  2G1D A;  3MAA B;  2W7P A;  1FJG J;  4C8K A;  2HHV A;  1YBT A;  2OH2 A;  4DU7 A;  4FF3 A;  2KO1 A;  2GIQ A;  1KRP A;  1RTD B;  2V8P A;  3RR8 A;  1TU0 B;  2CWK A;  2N4D A;  2Y9H A;  4PEO A;  2IM3 A;  3S01 A;  1WI8 A;  2E5J A;  1QAX A;  4QOT A;  2L9D A;  2HVE A;  4X4R A;  2IAJ B;  3F0N A;  3NCP A;  3P6Y C;  4QWE A;  1RTJ B;  5KG4 A;  2VQE F;  2DHG A;  2AW0 A;  3NP5 A;  4XK8 C;  4DWI A;  2DD8 S;  1R27 B;  3VTI A;  1IKV B;  4I0W A;  3UN3 A;  4CZC A;  2A6O A;  1GT8 A;  2D3Z A;  2E66 A;  2KHD A;  2RKI A;  3GFZ A;  3QGP A;  2OFH X;  4FPI A;  3WDO A;  2MKS A;  1NZA A;  4Q2M A;  4ES2 A;  3QJJ A;  2JDJ A;  2QMU B;  4LFB J;  5KT6 A;  2V8G A;  3AQP A;  3MCO A;  3QT6 A;  3JSM B;  3CO9 A;  3TOQ A;  3W3S A;  1KVK A;  1BQN B;  3TZZ A;  1RWU A;  1J5E F;  4B9S A;  1FRJ A;  1NME B;  1Q78 A;  3FNN A;  1NSQ A;  5B0D A;  4RNF A;  3SV3 A;  4DL2 A;  4N76 A;  2AEM A;  5E3R A;  2JEJ A;  2P9G A;  2MEW A;  1CJT B;  3CCL S;  2ALZ A;  2KZM A;  1M1H A;  4DN9 A;  2QSW A;  3H98 A;  3OPK A;  4KKO B;  4I69 A;  2QMW A;  4QWA A;  1JXE A;  5CZX A;  2LYV A;  4KV8 A;  3KJV B;  5AT1 B;  3NRB A;  2KRR A;  5B0E A;  2Y1R I;  4OHX A;  1NK0 A;  1VBK A;  5D0H A;  1F3F A;  1V3S A;  4OYW A;  4DV6 F;  1SJ4 P;  3G82 A;  1U1M A;  3AB2 B;  1RT4 A;  3MMC B;  3TJA A;  3SSQ A;  2VH7 A;  3OSP A;  2ZDP A;  2GA7 A;  3HHE A;  1Z1Z A;  3LW5 C;  4WP9 A;  1RSC A;  1RLD A;  4NWB A;  1S1V B;  3GIR A;  3W2W A;  3QIP B;  1S9G B;  1UWB B;  2VBY A;  1UA1 A;  1TUV A;  2DCL A;  4MH8 A;  5DG7 A;  5C25 A;  3KLI A;  4DUT A;  2HND A;  2AP6 A;  5KFQ A;  1HWI A;  4DR6 J;  3N79 A;  5B0C A;  4DI6 A;  1FK9 A;  3JTO A;  3EUN A;  1FJE B;  4DBQ A;  2SXL A;  3MMJ A;  2VDI A;  2KJV A;  3HFK A;  1BQM A;  2CJX B;  4RW4 A;  4UOF A;  3IC1 A;  2QLX A;  4UY8 T;  2C3U A;  2AJ1 A;  3I0S A;  4P75 A;  1CPZ A;  2CIM A;  2OSR A;  2ZE2 A;  3PO5 A;  3QO9 B;  3ZTR A;  2UXC F;  1FD8 A;  3BPS P;  3DM2 B;  2J9D A;  2C2R A;  2RHS B;  2YNF B;  2R7T A;  2ZZT A;  3UE2 A;  3RGI A;  2BJ9 A;  4IRC A;  4QIG A;  4LF6 F;  3UN5 A;  2OTL S;  2XYP B;  2XB2 D;  2HQG A;  4QYZ J;  2UXB F;  5IT9 Y;  3J7A N;  1PYO B;  4DR5 F;  1HBM A;  2IJR A;  1N0V C;  4BLG A;  4C8Z A;  1KFD A;  4M5M A;  1SQG A;  2RIL A;  2KH9 A;  4ECW A;  3SCI E;  4EO8 A;  3I55 S;  5HP1 A;  3A12 A;  2EEY A;  3GFH A;  4P9S A;  5K8O A;  4LBI A;  2BR0 A;  4ZPD A;  3M1V A;  1F3V A;  3AXK A;  4Y6I A;  1T9W A;  1NDL A;  2WVE A;  4NLV A;  1C1C A;  5C42 B;  5JVH Q;  4DSK A;  2EC0 A;  2QA4 S;  2PFF B;  2MQQ A;  2HPU A;  3TUZ C;  4WIQ A;  2NZ4 A;  2VC0 A;  2VPX B;  1K8A T;  4ID5 B;  4M5I A;  3VAJ A;  2ZH3 A;  2IM0 A;  4I7F B;  2ASD A;  3M8Q B;  1GXU A;  5KG6 A;  1YHQ S;  4DPU A;  3TI0 A;  3D3C J;  3OVS A;  2QA1 A;  3I32 A;  5KFR A;  2QLW A;  1NDP A;  3U7J A;  3EVO A;  3T1A A;  1BQX A;  3LOU A;  2PI4 A;  4C48 A;  3M7V A;  3PYD A;  3ENQ A;  4ZVE A;  2WHO A;  2C3O A;  4DCJ B;  3P3D A;  2W9A A;  1BGX T;  1DLO B;  3CDE A;  4PQA A;  2UUA J;  2UUB J;  2LMI A;  2YH0 A;  2ZOF A;  1FI4 A;  3MEE B;  1RT2 A;  5J1P A;  1JX4 A;  4DDF A;  2NXC A;  2YBV A;  4A8O A;  3PW5 A;  4DQS A;  2QEX S;  4B3M F;  1SPB P;  1KOO A;  5GAD U;  3DRY A;  3HHL D;  4I2P B;  4M5J A;  4QW8 A;  4DX8 H;  2ZDO A;  2JJ4 D;  2ROP A;  3R1L A;  4UUW A;  4HVZ A;  4O44 B;  4LIW A;  4Y3C A;  2B4U A;  4WCE Q;  3L7P A;  1RT6 A;  3MMB B;  3NG8 A;  1TL1 A;  1H38 A;  3MM7 A;  3NS7 B;  3ET6 B;  3J81 Y;  3W66 A;  1K0V A;  1DQ8 A;  1DQ9 A;  2ZC3 A;  3L7O A;  3HPO A;  3A1Y G;  3I87 A;  2XY7 A;  2Y1L B;  3R5C A;  3TAP A;  3CME S;  4JOU A;  2Q6C A;  2GQQ A;  3M30 B;  3V4I A;  3T1H J;  4RW6 A;  3M9M B;  2BOA A;  1U6B A;  3QAE A;  3VGV A;  5RUB A;  1TL3 B;  4UTG A;  1ZA2 B;  1VI7 A;  3KG1 A;  4NLR A;  1P1L A;  3WIU A;  3B4M A;  3ISN D;  1B7F A;  1XTZ A;  2Z56 B;  2B7B B;  3PEH A;  1Q86 T;  4M5N A;  4WZM A;  2IBO A;  2OP5 A;  1FWP A;  1QM9 A;  2Z0G A;  4F4X A;  3UD3 P;  4ZVG A;  1U1Q A;  3OFH A;  4V19 X;  4RW9 B;  1U1R A;  4I67 A;  2XMU A;  2HHH J;  5EX0 A;  1MN9 A;  5DGB A;  1N32 F;  4RNO A;  1PGZ A;  2IJN A;  2OMO A;  3ELH A;  4OZ5 A;  1RWM B;  3FGV A;  4CT8 A;  5LXY A;  3MAH A;  3SFG A;  3MUR P;  4LRA A;  2H4W B;  3R2C J;  3MI7 X;  5B0B A;  4TYA A;  2F40 A;  3T5K A;  3CUL A;  4CM2 A;  4FXW A;  2HNZ A;  4ZLP A;  1XJW B;  3VAM A;  5LT5 A;  1JLF A;  3QID A;  3MEC B;  2DGX A;  3RJM B;  7FDR A;  2FHM A;  4CLW A;  3QGG A;  4LF7 J;  1QAI A;  1RTI B;  3MOZ A;  2NYI A;  3NOC A;  5A8R A;  4ZMM A;  1NSP A;  5KFH A;  3FSI A;  2M7S A;  3AOB A;  4CO3 A;  1NHU A;  4NLO A;  5GAE U;  2XMV A;  2E5H A;  5DGA A;  4DF4 A;  1SJ3 P;  1VQK S;  2L48 A;  3FJ2 A;  1AT1 B;  2IJF A;  3QSI A;  4M5L A;  4QIW D;  5J1E A;  2OML A;  2HBQ B;  5DG9 A;  3MR6 A;  1I51 B;  4ZVP B;  1CJU A;  1RAA B;  1D1U A;  3ONQ A;  5CD4 A;  3RBE A;  1SKW A;  2RU3 A;  4TQS A;  2L08 A;  2W2Q P;  3IWX A;  1LXN A;  2PEH A;  1WSR A;  3X3U A;  5JXS A;  4P74 A;  2HK3 A;  2HVH A;  3KNG A;  1TMJ A;  2WB4 A;  2R3V A;  4X65 F;  2JC0 A;  3GR0 A;  1IR2 A;  1UZH A;  3GFX A;  4NLD A;  2OPR B;  4DFK A;  1Q8B A;  3UD4 P;  4NAS A;  3HSZ A;  4V1A k;  2WAQ D;  4RNN A;  1NB7 A;  5K8P A;  2K8G A;  1FFW B;  4YR2 A;  2ROE A;  4C3K A;  2IYI A;  4PG8 A;  2D3O 1;  3GR1 A;  2RU9 A;  1DTQ A;  4H4K C;  4MIW A;  5E33 A;  4ED6 A;  1SL1 A;  1EKS A;  1ULR A;  4EFA C;  2OEM A;  3Q8U A;  4I1T A;  1YBU A;  2BZ2 A;  2MSS A;  2Q66 A;  4A8X A;  2W24 A;  3DC2 A;  4OHZ A;  2HHQ A;  4XPC A;  3GZ7 A;  2PD1 A;  1YJ7 A;  3P96 A;  2I5J B;  1U1O A;  2HFU A;  1YDL A;  1HNV B;  3CT9 A;  4G6V B;  1TAQ A;  4USM A;  1C0U A;  1TV6 B;  3OR2 A;  3QT8 A;  5HMW A;  3BQ1 A;  1YI2 S;  1G3O A;  3UW1 A;  4I64 A;  1NK7 A;  1RGV A;  3PHE A;  2AYE A;  1F0X A;  3H40 A;  4PUO A;  1FDA A;  4MKV A;  3ULH A;  1D9F A;  3MXH P;  2AJQ A;  1S9F A;  5K8N A;  2FZC B;  3D6T B;  3DGV A;  5IZH A;  1V5V A;  2JLG A;  4YHH F;  5KOW A;  4J5O A;  1JJH A;  4KGX B;  5D0E A;  2RJZ A;  3PRV A;  1N8R T;  3RW6 A;  1H72 C;  1ZA1 B;  3IBW A;  1U1P A;  3LGN A;  2IVY A;  3WBZ A;  4ZPC A;  3R27 A;  1RZM A;  4DHV A;  1FKO B;  4J9U E;  2BAN B;  2ACM A;  3GTY X;  4C8L A;  2MDA A;  1ZM4 A;  3I96 A;  9RUB A;  2A18 A;  3DDK A;  4RBU A;  1HWK A;  2WON A;  3NWG A;  5F3Z A;  5E5N A;  3R2D J;  1TUW A;  2QIF A;  3PV8 A;  1D8Z A;  1TKT B;  4I6Y A;  3MUV P;  4JI6 F;  1IKW A;  4YB1 P;  3OVA A;  1HLW A;  4LRC A;  5JUM A;  4NCA A;  2KDO A;  4OI6 A;  3NNH A;  4MK7 A;  3JXO A;  3VGS A;  3M6U A;  4WFN Q;  1Y00 A;  1W2B R;  1KLM A;  4B3R J;  3IA0 A;  5DDR C;  4PG7 A;  1YGY A;  2DGT A;  3KLE B;  2MGZ A;  4P7T A;  2GVZ B;  4TU7 A;  1HNW F;  4OZ0 A;  1PAU B;  1Z2L A;  4L76 A;  1NSA A;  4KO0 A;  3AA8 A;  3DKD A;  4IFY B;  4NEZ A;  2VOD A;  3HD2 A;  4RWX A;  4HKQ A;  2Q6B A;  1VQN S;  1N0U A;  4ED4 A;  5D15 A;  3A13 A;  4B3O B;  2P9C A;  3OFF A;  4X4S A;  5HBM B;  4YFU A;  5DQI A;  2R9L A;  2XY5 A;  5HO4 A;  4NXN F;  3S1T A;  4X84 A;  4ZPT R;  1WC0 A;  1LFW A;  2MST A;  4RW6 B;  3RU0 A;  5KFS A;  2DKO B;  3IMQ J;  5SZT A;  2GQC A;  1LWC A;  4CQ1 A;  4DL0 C;  3NEK A;  1N54 B;  3BKF A;  4PPD A;  4DLG A;  2AYM A;  3NGR A;  1HYS B;  1SIZ A;  1LV5 A;  1S79 A;  1LKZ A;  4JBC A;  3P5B P;  2JNJ A;  3A8E A;  2KM8 B;  3KHG A;  2CWX A;  1DHM A;  4WU2 A;  1NK8 A;  4LF4 F;  1RT3 B;  1RB0 A;  3QJP A;  1AFI A;  4JI2 F;  2Z58 B;  3SQG A;  3HT3 A;  2CPY A;  1J5E J;  4J9N A;  2YY3 A;  4QPT A;  4YB6 A;  4RW8 B;  2DK2 A;  5CCM A;  4OX9 J;  5BR8 F;  4X64 J;  2CNK B;  2EKN A;  1VS3 A;  4Z7C A;  4ANE A;  1RWN B;  3TVY A;  3B6B A;  5JMN A;  1FJC A;  1L3S A;  1R43 A;  2DXF A;  1S0N A;  1KVJ A;  1OQ3 A;  3PJW A;  4X4V A;  3BSA A;  4YP3 A;  2KG0 A;  3QZ7 A;  2UU9 F;  3MEE A;  2OLW A;  3PW0 A;  4ZVO B;  2XBP A;  2RDI A;  1CJK A;  2P6T A;  4Q8F A;  2DHH A;  2VF3 A;  1Q16 B;  1BMQ B;  2MJU A;  3BYR A;  3OFG A;  3UNG C;  3KK1 B;  2R2S A;  2MGZ B;  1I1G A;  5HQL A;  2XMK A;  1NUE A;  1WJ9 A;  3EGN A;  3H20 A;  4J9V A;  3TA2 A;  3QZ8 A;  4I7F A;  2X1F A;  2WVD A;  1P6T A;  1BE4 A;  1UFK A;  2DGU A;  2IHR 1;  1TKT A;  4M1K A;  4U7U D;  4KB7 A;  2FLO A;  2GV1 A;  4PAB A;  4NL5 A;  2DB1 A;  4HLB A;  2J0Q D;  3CVK A;  3WX8 A;  1V3Z A;  2GFF A;  2DR8 A;  4MKY A;  1AB8 A;  2F9J A;  4B9U A;  3KK2 A;  3KK3 A;  2BQ3 A;  2CG8 A;  2MYF A;  2CUY A;  4F04 B;  5KFM A;  1T03 A;  1ZM3 A;  3D0I E;  1FE0 A;  5AXM A;  2IRY A;  2YX4 A;  3IWL A;  4OV1 A;  1JLE B;  5K9F A;  1E6V B;  4G1Q B;  2F65 A;  5F8G A;  3J7Z 5;  2UVW A;  2OPQ A;  1S5Z A;  2HFV A;  3DRR B;  5HRO B;  4NYZ A;  2FVR A;  2H5I B;  4U9R A;  3QPI A;  5I42 A;  1RAO A;  2CJ9 A;  1Q8I A;  2BKO A;  3ILI A;  2WZ1 A;  1W2I A;  3CB4 A;  2JX2 A;  3MM5 B;  3NS6 A;  3SIP B;  3VAH A;  4J9Q A;  4DV3 F;  4AQY F;  1JLB B;  4DR7 F;  2OPS B;  3QO9 A;  4K5S A;  1H2T Z;  2ZE2 B;  5HVG A;  1XBW A;  2A2D A;  2KVI A;  5LL6 d;  1NPR A;  2ZJP Q;  3BQ0 A;  2GQ2 A;  4LRD A;  3IXQ A;  1BQM B;  2AMC B;  1GTE A;  4C11 B;  4X4P A;  4OYI A;  1H3D A;  3EGV A;  4QJV A;  3ZFV A;  4WBF A;  4PCQ A;  3TJ8 A;  3CCS S;  4DQQ A;  1CS4 A;  1UVK A;  2GGP A;  3C6T A;  4CLK A;  3FRY A;  3HKW A;  3KLI B;  1AW0 A;  3DU6 A;  3G9C A;  1VHI A;  4URQ U;  2DXE A;  2FLL A;  3TRG A;  1ZAX A;  2QT7 A;  2RRA A;  2KVQ E;  2U1A A;  2HRT A;  3K5O A;  4P2F A;  5J2N B;  3ZZR A;  4D3H A;  2LDI A;  1BXN A;  2OPR A;  1R8C A;  1XMO F;  1XNQ J;  4GVL A;  4EWT A;  2IC3 B;  3T6J A;  2V2K A;  1Q4R A;  3FBE A;  4Y2I A;  4U7C A;  2KXN B;  1FTC A;  2UP1 A;  1RYR A;  3TP2 A;  1M0S A;  1JNR B;  2DHX A;  4NA1 A;  4OLO A;  3OJU A;  3IBC B;  1Q0N A;  5GAE I;  1QSL A;  2UUB F;  1U45 A;  1VK3 A;  3PW2 A;  4ECU A;  4K2X A;  4F2S A;  1C4C A;  4RUC A;  1P9Q C;  2ZVS A;  1S1T B;  1NND A;  4ZLJ A;  1S10 A;  1HD0 A;  4K7Q A;  1CVJ A;  2EG1 A;  4RPF A;  4UF4 A;  5A8R B;  5F0W A;  3R8Y A;  3THV A;  2E7X A;  5DDP C;  4AD6 A;  4DR7 J;  1JIH A;  4N8O A;  1S6O A;  1Y4Z B;  1JLQ B;  3ZNJ 1;  4R5P A;  1C1B B;  2HIQ A;  4CWB A;  4HEA 9;  4FF2 A;  5D8H B;  1FXR A;  1G6B A;  1YG0 A;  3DXB A;  5HL7 Q;  3MM8 B;  4JP8 A;  2DH7 A;  3QMQ A;  1EX8 A;  3PRD A;  2XMA A;  3IG1 B;  4S0M A;  4HI2 A;  4RW8 A;  1EIY B;  5DZ7 A;  4FYD A;  3TAM A;  4L3K A;  4ILM A;  4CYU B;  2WVC A;  4ZPB A;  4L74 A;  1U26 A;  2G13 A;  3K58 A;  2WOM B;  4RW9 A;  2H5J B;  3OV7 A;  2FVS A;  1MNE A;  4WZQ A;  1H2V Z;  4YQW A;  3DLE B;  4AL7 A;  4HT7 A;  4IQX A;  3I5A A;  4NI2 A;  3CJ0 A;  4I56 A;  1R7I A;  1QY7 A;  4I6W A;  4E8U A;  2CA9 A;  1KC8 T;  1HMV B;  4KHP F;  1SL0 A;  4ZVU B;  4CP5 A;  1YK9 A;  4NEY A;  5IXU A;  2VQF F;  4LUB A;  2CPD A;  2C3P A;  1JXL A;  2LU2 A;  1IQT A;  4QIF A;  2Y0S D;  3C2P A;  3CUN A;  4EGL A;  1OWX A;  4GVB A;  5GME A;  2YKA A;  3PM9 A;  1VBZ A;  4K4X A;  2UVV A;  1VJQ A;  4WP3 A;  2B4V A;  2GJI A;  4PXB A;  1I94 J;  1NK4 A;  2VDH A;  1EAR A;  1RTZ A;  2EKY A;  4W4M A;  3UCU P;  3HHL B;  4B3M J;  4IFY A;  4H54 A;  3R5J B;  3UO0 A;  5FLX U;  3AA9 A;  4X64 F;  5BR8 J;  3KHL A;  4GMK A;  2POK A;  1JWW A;  3MMB A;  3QFH A;  3J80 Y;  3QGH A;  4OYB A;  5E41 A;  2ASJ A;  2ZD1 A;  4M8L A;  4O44 A;  2X3G A;  5I3Q A;  3V6D A;  4PR6 A;  3LP1 A;  3Q22 A;  5T7L B;  3PYG A;  4R0E A;  2FC9 A;  5L1L A;  5E0O A;  4J9R A;  4DS5 A;  2J6U A;  3G6E S;  2CQ3 A;  2DY9 A;  3M32 A;  2GO9 A;  1SC1 B;  2KT3 A;  3NGS A;  3G8Q A;  5D4O A;  8AT1 B;  4DR1 F;  2GCF A;  3PTW A;  3JTN A;  1APS A;  3KNA A;  2BAN A;  1LQ9 A;  5FDL A;  1OY9 A;  1X4F A;  3OTB A;  5KT7 A;  2D3O R;  1R0A A;  3G6Y A;  1N88 A;  2DIT A;  1B0T A;  2R42 A;  3MM6 A;  4UOG A;  3PIP Q;  1Q1K A;  1PAE X;  4RW7 B;  4LMZ A;  1PCA A;  2XNQ A;  2E7V A;  3FZB A;  1J5O A;  2E1C A;  5HQ8 A;  1RBA A;  3H5S A;  5CZV A;  4CO1 A;  5K14 B;  4P6Q A;  5I4M A;  2HS0 A;  4B3R F;  5KT3 A;  3GJS B;  3O8W A;  5AXN A;  5M2R A;  1O6X A;  2YWW A;  4O0I A;  4PUO B;  3TNV A;  2A6M A;  2DH8 A;  2V8D A;  4B02 A;  3SCK E;  5ETM A;  2FQQ B;  1FE4 A;  1OQ6 A;  3IGV A;  1TZ0 A;  4USW A;  3VHQ A;  1R0B G;  5HMY A;  2VQE J;  1KTV A;  3HM9 A;  1LWE B;  2ZVI A;  3H42 A;  3OW2 R;  1SJF A;  2DYA A;  1RAG B;  2LEC A;  2AJF E;  2DR5 A;  2H48 B;  3CTR A;  3CSK A;  4FXD A;  3R6L B;  3I6P A;  3OHA A;  2DT9 A;  1VQ7 S;  1QTM A;  2QTW A;  3HJF A;  3POT A;  2MQN A;  4RUA A;  1TL4 A;  4NCB A;  1U2F A;  1NHK L;  1EET A;  1KHW A;  2AQ4 A;  1T3N A;  1EZZ B;  1UW9 A;  3KJN B;  4USJ C;  2D1C A;  3DM2 A;  3JS9 A;  1RU2 A;  3PNI A;  2JL9 A;  2VIH A;  3BSN A;  4A8F A;  4F02 A;  2JZ5 A;  5CH7 B;  3ZTP A;  3CC7 S;  3OD2 A;  4PWD B;  4EBE A;  2HQC A;  1KP6 A;  2HMI B;  4ZP7 A;  1J27 A;  4W98 A;  2YH1 A;  3U27 A;  1IM4 A;  2R8H A;  4AQY J;  2JWN A;  1EET B;  1F5B A;  2CNO B;  1HPZ A;  1NDK A;  2PII A;  2YQ3 A;  2ZBP A;  3ENA A;  4ZVR B;  4ZJQ A;  2CKW A;  3POT B;  2E1R A;  3DFE A;  4ZVS B;  2XNR A;  1HWL A;  2HND B;  4CLU A;  1N32 J;  4K4V A;  3G8S A;  4IQM A;  5AE3 A;  1YBA A;  1FX2 A;  1LWF A;  2B4P A;  1HNX J;  3U1L A;  1S9G A;  1UWB A;  2FJV A;  3GV7 B;  1RLC L;  2J8A A;  3CE8 A;  2FLP A;  2XMJ A;  1RTI A;  1V9O A;  2MKJ A;  1X5S A;  4J9L A;  1SJQ A;  3OQ2 A;  3FBC A;  2M70 A;  3TX8 A;  2B56 A;  3HX9 A;  4BC7 A;  3DGP B;  4DOZ A;  3HXM A;  2JEG A;  4DSJ A;  2P5V A;  1N33 J;  2LQ9 A;  2Z2Z A;  3QYY A;  4B9N A;  2XZT B;  5KFV A;  3D0H E;  1JJ4 A;  2HGM A;  4HTJ A;  5J2Q B;  1HNW J;  5D6G A;  4IOA Q;  1WC1 A;  3GE9 A;  5GAG U;  4MKA A;  3HZG A;  5HJY A;  3N6N A;  3SSS A;  4K4Y A;  4C0O C;  1KQS R;  2FHJ D;  2H51 B;  1NKE A;  2RS8 A;  3CCW A;  1JJ2 R;  2PEB A;  2V8V A;  2DHS A;  2L3M A;  3N5B A;  4JI3 F;  4IUF A;  1KN6 A;  2CJQ A;  4C97 A;  1ELO A;  1SV5 B;  3UN2 A;  5CHC B;  4NLY A;  2CQH A;  1YLX A;  2Z8Q A;  4FYY B;  2RSQ A;  4C9D A;  1Q95 G;  5KFT A;  1X4C A;  5EX3 A;  3LPY A;  5J2M B;  3QT7 A;  4JI3 J;  1FVQ A;  4Y2K A;  5G0R B;  3CPW R;  3HK2 A;  3HVT A;  4OYA A;  1UEU A;  4DF8 A;  1M90 T;  4LF1 A;  5ITH A;  3NGU A;  2E7W A;  4ATN A;  2QL7 B;  1SBR A;  3AHP A;  1IKX B;  4LF4 J;  3D4J A;  4K50 A;  1S6P B;  2L9W A;  2QGF B;  2IAJ A;  3VVT A;  2W2O P;  4IOB A;  1TFY A;  1WEL A;  1RAB B;  1CJV A;  1HQE A;  2WVF A;  2YXL A;  1JLC B;  3I4H X;  3P4U B;  2WBR A;  2W2N P;  5B09 A;  3K57 A;  2W9C A;  4HAC B;  2MLZ A;  2MY7 A;  4DL6 A;  2BQR A;  1IBL J;  1WF2 A;  1SJ1 A;  3PG9 A;  3FBF A;  4RL1 A;  4ZPV R;  4Y34 A;  3DLL Q;  4B3S J;  1UVJ A;  1TL1 B;  2DNM A;  3MAA A;  4KYZ A;  4ZVT B;  2CYY A;  1OYE A;  2MZS A;  4Z7Y A;  4F36 A;  3CDU A;  5A8K A;  2NLW A;  5GAH I;  3RAX A;  3FKB A;  4NZ6 A;  4B17 A;  2BXJ A;  2KTQ A;  4IRK A;  4TU8 A;  4DL5 A;  4I2P A;  3L9Z A;  5G0R A;  1UKU A;  3HF5 A;  4C3L A;  2A1B A;  5HVH A;  2R8J A;  2G0J A;  4OZJ A;  1WSV A;  2V2Q A;  4OYO A;  5KFG A;  3O1L A;  5KT5 A;  5DLF A;  2HRU A;  3CD6 S;  5E3Q A;  1GNK A;  2GML A;  2YKN A;  1KR4 A;  1G2E A;  2LEP A;  4CH7 A;  5KAK A;  3NGK A;  1UPP A;  3D1Q A;  2ZWO A;  4FNI A;  2XLI A;  2QA4 G;  2HAF A;  4LF8 F;  4K4Z A;  4C2M A;  4JI7 F;  3MOJ B;  3LWM A;  5L38 A;  4QYZ K;  4GKJ J;  1U24 A;  1WC3 A;  3OTO F;  3M6W A;  1KQK A;  1R3N A;  1U7L A;  2VG6 A;  2YWF A;  2C1E B;  3M8Q A;  3MUM P;  4BDP A;  2VB6 A;  3QLH B;  2BQU A;  4LFC F;  4KPY A;  4LRF A;  3V4M A;  4KFB B;  2NXE A;  3HI9 A;  2W7O A;  1FDN A;  4IYQ A;  4IR1 A;  1DQA A;  2DGO A;  1C1C B;  1RP5 A;  3GJT B;  5HI7 A;  5C42 A;  5L46 A;  3DGP A;  4DFJ A;  1RK8 A;  1Q7Y T;  3PFE A;  1LW2 B;  3C16 A;  1N5S A;  4MKB A;  5A0Y B;  1S1T A;  4PG5 A;  3AD8 C;  2VG5 A;  3MMA B;  3IS9 B;  1N34 F;  1YX2 A;  2ZUA A;  4MK8 A;  3VVU A;  4DCO B;  4WFY A;  2GIF A;  3JAM U;  4YHH J;  3KMQ A;  2E1A A;  5L8R C;  3IBF B;  4WU3 A;  4L73 A;  3QGI A;  3DLB A;  3DYA A;  3UQS A;  4X62 J;  2K7K A;  1FXL A;  5C2G A;  1GMU A;  1RIS A;  1ZAV A;  4RBV A;  2X51 A;  4ECV A;  2HMI A;  1BY9 A;  3VQS A;  5F8J A;  1YIJ S;  3ICL A;  1Y5I B;  2HWH A;  2I9S A;  3MGJ A;  5FLX Y;  5J2N A;  4EZ6 A;  2AYB A;  2ZH4 A;  1D09 B;  1FK9 B;  3SBM A;  3CJT A;  1GMV A;  5LXR A;  5H9F K;  2CAJ A;  2A10 A;  4OJ1 A;  3T5L A;  1TKX B;  4WII A;  3KYL A;  3UR3 C;  2ZNZ A;  3CD5 A;  4Q43 A;  3HP6 A;  2ALY B;  4P52 A;  3EZO A;  1UEV A;  1F1B B;  4MMO A;  1S59 A;  3SQO P;  2V5H G;  3ZXW A;  2V67 A;  2B0G A;  5E3A A;  2Q79 A;  3NLC A;  1PSD A;  2VIC A;  1WG4 A;  1FKA F;  2RT3 A;  5HAO A;  3CJQ A;  4F3O A;  2EFO A;  4FKX A;  2PE8 A;  3Q2T C;  4ZVQ B;  4F4Y A;  3PRB A;  1MWY A;  4EMD A;  1HWJ A;  2G0C A;  4F0K A;  4F7V A;  4YS2 A;  3KLH B;  3CC4 S;  2BAB A;  4OYP A;  5ETN A;  2ZH2 A;  2AU0 A;  2VG5 B;  1E6V A;  4G1Q A;  1JLE A;  3MWB A;  4RW7 A;  5A0Y A;  1HR0 J;  4B9M A;  3MM6 B;  1CJT A;  3WIV A;  2YNI A;  4OZ2 A;  2FY1 A;  4JI7 J;  2DGS A;  2FHO B;  2VPZ B;  3MTK A;  4B3T J;  1IN0 A;  4QCL A;  3BGL A;  2CQD A;  4DU8 A;  4E2F B;  3PW7 A;  3G4S S;  3BGR A;  3CD7 A;  3EGW B;  1VQ4 S;  3L4B C;  3H5X A;  4QQB A;  4P2M A;  2HWI A;  4O3P A;  3EVW A;  3QRQ A;  5T7L A;  1PJ5 A;  3I0R A;  3BDP A;  2X3D A;  1JLG B;  1IKV A;  1S99 A;  5F3T A;  4WKY A;  5KFU A;  3T5J A;  3QRR A;  2B3T B;  1YTY A;  3H90 A;  2QL5 B;  2NUH A;  2ZD1 B;  2BOP A;  1BWE A;  1EAY C;  2W1B A;  2XYG B;  4TY8 A;  4DV3 J;  4TLQ A;  4ECY A;  1U49 A;  4F4A A;  3CDA A;  4NZ0 A;  4OI3 A;  5IV3 A;  3GII A;  1KBR A;  2QC3 A;  1UET A;  5MAO A;  5AJ3 F;  4DQI A;  2J7K A;  2YKN B;  4IKA A;  5IT0 A;  5H9F J;  1Y5N B;  3G86 A;  2R7S A;  1QTN B;  3A3O B;  3GWC A;  4H4K A;  4PWU A;  4ZP6 A;  2XLJ A;  4DV4 J;  4CT9 A;  2B5J B;  2QE5 A;  2ZWP A;  2DEI A;  1FNO A;  2WB1 D;  3SQG B;  4LFB F;  1YJT A;  2UXB J;  2HHP A;  4N77 A;  5I3P A;  2VU5 A;  1AUS L;  1PBU A;  3M2R B;  5KFB A;  4JV5 J;  1VQY A;  2KYZ A;  2WSE C;  2N7C A;  2VON A;  1W7W A;  2LDY A;  4NI2 B;  2K06 A;  5F8M A;  4OI2 A;  2HBR B;  2E1P A;  1Q7L B;  5KTQ A;  1U2C A;  3BN4 A;  4ZVH A;  2NXU A;  3KDN A;  1OMS A;  1FRX A;  1EHW A;  1P8G A;  1LWC B;  4KQZ A;  2BKP A;  2P6S A;  1WOO A;  4U8V A;  3S7R A;  4JI6 J;  1SQF A;  2YPZ A;  5M2P A;  1S6P A;  1WAC A;  1YRX A;  3CWJ A;  3KDO A;  3MD1 A;  1IKX A;  4LSN B;  4DPT A;  1RA6 A;  1KHV A;  3MCS A;  2IMO A;  3IG1 A;  3PDN A;  1RWW B;  2E1M C;  5H9E J;  2HHT A;  1LOU A;  3HVW A;  3T9N A;  1Y3J A;  2GS8 A;  3V81 B;  4JI2 J;  4R5P B;  4X4N A;  1JLQ A;  4FKY A;  4K4S A;  2YQ1 A;  3VAI A;  2CQB A;  5KFK A;  3I4P A;  3PHT A;  5IC4 B;  1IKY B; 
#chains in the Genus database with same CATH homology
 2MEW A;  4AQY J;  4X62 J;  4DUY J;  1IBK J;  4DR7 J;  4LFA J;  3W1Y C;  4DUZ J;  1N32 J;  2F4V J;  1HNX J;  3IMQ J;  4DR1 J;  2HHH J;  2MQ8 A;  1HNZ J;  1N33 J;  3R2C J;  1N34 J;  1HNW J;  4HHU A;  4K0K J;  4X65 J;  4DV1 J;  1J5E J;  5LMN J;  2ZM6 J;  4LF6 J;  4LF5 J;  4DR5 J;  4OX9 J;  4X64 J;  4DR6 J;  4X66 J;  4DV7 J;  4LF7 J;  5IWA J;  4JI8 J;  5LMU J;  1XMO J;  4NEY A;  4DR2 J;  4YY3 J;  4JYA J;  4LF9 J;  2VQF J;  2UUC J;  1HR0 J;  4JI3 J;  2UU9 J;  4JI5 J;  4KHP J;  1I94 J;  4JI7 J;  4B3M J;  4B3T J;  4LF8 J;  4B3R J;  5FLX U;  3J7A N;  5BR8 J;  4LF4 J;  4DV2 J;  4V1A k;  1N36 J;  4DV5 J;  1IBL J;  4PWW A;  4DV6 J;  4B3S J;  4KYZ A;  5AJ3 J;  4DV3 J;  5IT9 U;  3T1Y J;  2MTL A;  4GKK J;  2E5L J;  3D3B J;  1XMQ J;  4NXN J;  4JI4 J;  3D3C J;  5LM7 E;  4JI0 J;  3J81 U;  4DV4 J;  2UUA J;  2UUB J;  1XNR J;  2UXB J;  4DV0 J;  2KL8 A;  4JV5 J;  1IBM J;  4GKJ J;  5A2Q U;  1FJG J;  4JI1 J;  4RJV A;  2VQE J;  4JI6 J;  4DR3 J;  2KVQ E;  2UXC J;  1XNQ J;  4KY3 A;  3R2D J;  3J80 U;  3OTO J;  4LFC J;  4LFB J;  4DR4 J;  4JI2 J;  3T1H J;  2UXD J;  3JAM U;  4YHH J;  4NEZ A;  4NXM J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...