4DV6J

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a915g
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 14
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4dv6J00
5LMNJ 3R2CJ 4PWWA 1N36J 4LF4J 4DUYJ 4DR2J 4DUZJ 3J80U 4OX9J 4YHHJ 4DR7J 4LFAJ 1J5EJ 4JI3J 4B3MJ 4DV2J 4LF9J 1IBMJ 4DV3J 4LF5J 4LF7J 3JAMU 4RJVA 4DR1J 2UUAJ 1FJGJ 4JI2J 4LF6J 4DV7J 1XNQJ 4KYZA 4DR6J 2E5LJ 4X65J 4DV5J 4DR4J 5LMUJ 4KY3A 4JI6J 3W1YC 1XMQJ 2UU9J 3D3BJ 5IT9U 5BR8J 3J7AN 2UXBJ 4KHPJ 4JI8J 2KL8A 2HHHJ 4DR3J 4JI4J 3J81U 4AQYJ 4B3RJ 3T1YJ 4NEZA 4DR5J 2ZM6J 4JI7J 4NXMJ 2UXCJ 2UXDJ 1XNRJ 5FLXU 4K0KJ 1HNZJ 2MEWA 4V1Ak 2F4VJ 3OTOJ 4X64J 1N34J 2UUCJ 1N32J 4YY3J 4B3TJ 4X66J 4DV1J 1IBLJ 1XMOJ 2VQFJ 4DV0J 4DV4J 2UUBJ 4GKKJ 4JI5J 4GKJJ 4NXNJ 1I94J 3T1HJ 5IWAJ 3D3CJ 4B3SJ 4JYAJ 4X62J 1HR0J 4HHUA 4LFBJ 2MTLA 4JV5J 3IMQJ 1IBKJ 1N33J 4LFCJ 3R2DJ 2VQEJ 4JI0J 4DV6J 1HNXJ 2MQ8A 2KVQE 5AJ3J 4NEYA 1HNWJ 5A2QU 4JI1J 4LF8J 5LM7E
chains in the Genus database with same CATH superfamily
3Q24A 2MKHA 2CG8A 4NCBA 5L1LA 2HNZA 2FHJD 5CA5A 3AJ2A 1CQNA 2Z58B 4NLUA 4NLVA 2YX1A 4CIOA 2VG7A 2BRLA 2RU9A 3CIZA 4OQJA 2JNJA 1FNXH 1BMQB 2DXDA 4A47A 3TVYA 4QPTA 4K5SA 4X4SA 5U47A 5CYQA 2BE2B 2BJDA 2OPRB 3PHTA 5K14B 1HHTP 5DLGA 1RHJB 4YR3A 2AX0A 3KK3B 3HFVA 1VRQC 3MMCB 4IR9A 1HNWF 5D4PA 3ZO7A 4AXJA 2APOA 2L48A 4KSEB 5DDQC 1Z1ZA 3PJWA 2G2OA 2M3DA 3CDBA 4ZITA 3T9NA 3JAMU 4NYOA 2R7WA 3DLGA 2MQQA 1PJ6A 2B7CB 3LPEA 4J37A 4TLRA 4TQSA 2D74B 3C6UA 4RBTA 4BC7A 4TU7A 2Y8WA 3BH7B 3PX0A 3QFHA 4NA3A 3RTVA 4ATNA 4FP9A 2ZHAA 2NYHA 2YKPA 4RUBA 4ZVHA 3MECB 1QE1A 1YK9A 4BHQA 5HMYA 4NL5A 3MMJA 1OO0B 1LXJA 4I1TA 2EG1A 4CLPA 3G8SA 3O3LA 1VBXA 1G1XA 3BGRB 5LXYA 4OHYA 2DNHA 3ZXWA 2VIHA 4E0DA 2VOOA 2RHQB 4LSLB 1JLEB 1IKVA 2EK1A 1LWCB 2J7KA 3KG0A 3LH2S 4DXLA 4ECXA 3IAM9 3D28A 1UVIA 3V4IA 3PFOA 2Q43A 4ZDNA 4LT6A 2HFNA 4MKYA 2CQPA 2FVSA 2RNEA 2ZWOA 1KLMB 3D4JA 1BQNA 2H3EB 3PR4A 1ACMB 3NMAA 4RUCA 5FD1A 3DLKA 4KE5A 2JDJA 4JV5F 4TNOA 4DV4F 4AL6A 5KFZA 2G2YA 4IO1A 2F8HA 5FLXU 4RW7A 1Q53A 3GG1A 4LRBA 1OY8A 2V2VA 4K2JA 2DR7A 1N34J 5M2PA 4M63A 3HVRA 1B4SA 3BJYA 2BQUA 1H38A 5THWA 1SUQA 3LP1A 2A6MA 4AXIA 5AXNA 2MQNA 1HHSA 3ITHA 5EUHA 1VC5A 1T0TV 3P45B 3RG6A 1VIOA 3HT3A 4QIGA 4NXNJ 3CC4S 5D15A 5IV4A 4ZVRB 4O3NA 4X62F 4DQQA 2KZMA 4EWTA 3OV7A 1Y5NB 3T5HA 3LTOA 4USJC 8ATCB 4HH0A 4CLSA 2HG4A 1J27A 4I2QB 4DSKA 4LR9A 3AD7C 5A0YB 3TAMB 1RAAB 2DISA 3DRPA 4DX8H 2KI2A 2IC3B 1U1OA 2XB2D 2HQIA 3SV4A 1HNIA 1LKZA 3QJJA 3O1LA 3VZHA 3HF5A 4OZ1A 1FF2A 2M8HA 2MQMA 4CO2A 4RNOA 4F4YA 5J2QA 2HBYB 2R42A 4C8MA 2RF2B 1FRXA 1RT5A 2D3UA 2I38A 1X5SA 4JI0J 2QYCA 5BYSA 4DV6J 1VQ9S 1RK8A 4PXBA 5CD4H 1VFJA 7FDRA 4P75A 3MEGB 1S97A 4UTGA 4F25A 1NDLA 2CPXA 4HACB 1N6QB 2E9RX 1HNZF 2VA3A 3NNCA 2BRKA 3PRVA 3R3TA 2GO8A 2LFVA 2R2RA 5J2PB 4CO5A 2ASYA 5DGBA 2VG5A 1X8DA 4LF6F 2E7WA 1MLAA 2EKYA 4P2XA 3MEGA 1QD1A 3L95X 5BYQA 4EEYA 4U67Q 3E51A 4G1QB 2Q3PA 1KP6A 4GMKA 1P1LA 4N47A 1A0OB 3CCJS 1JLFA 4MK8A 2Z2LA 3BKUA 3H0PA 3PDNA 4USIA 4LF4J 4KHPJ 1N54B 3M6UA 3Q8QB 4WP9A 1TTHB 1YRUA 2LQ8A 1SBRA 4AUKA 1NK6A 3B82A 3THVA 3IRWP 2YPYA 2DGVA 2ZH5A 4YB7A 2ASDA 2LP4A 1KQSR 5IT0A 3OHAA 2DNZA 5B0AA 2D3ZA 4HTJA 4WK1A 1JLFB 2QLJB 1IBKF 4UQGA 4J9KA 1RYSA 2IY5B 2CQ4A 4K2XA 1L3VA 2MXYA 5IQ6A 4NCGA 5DDOC 1WC6A 1F9FA 2HQDA 2MZTA 3A12A 1MWYA 4FKXA 4QZVB 1N5YA 3J7A1 4TKTA 3E2EA 3K2YA 1WOOA 2WOMA 5GVQA 5LJ5Y 3IWXA 1CPZA 3MM7A 3ONQA 4ED8A 1S1UA 5KOXA 2GGPB 3QIPA 1W2IA 3UNYA 2KG1A 2ZOFA 2M5YA 4X65J 5B08A 2LCWA 4WFAQ 1FD8A 1K8AT 2J8AA 4TVAB 2N82B 2F1FA 3LP0A 2O5DA 3DOLA 2LQ9A 1RT5B 2BKNA 2VQEF 1UEKA 2FPHX 5HJYA 5T7LB 4RW8B 4I68A 2H1YA 3UD3P 4ED6A 1I3OB 4NYPA 1PGZA 5ETMA 4L3NA 4PRFA 3G6XA 1Z2LA 4EU0A 2GQCA 4B9NA 2RIJA 2XBPA 3QGIA 3A4TA 4EMDA 4R0JA 2ROGA 3LWMA 4JI4J 2F4VJ 1VC6A 1VJQA 2IPOB 5KFEA 3IN5A 2B9YA 3S01A 5DQGA 3ILOA 1SI9A 3CJ3A 3BBCA 3T1HF 3RAMA 4EZ6A 4HHHA 1RJJA 2DGSA 2IAJB 3ZZPA 3SCJE 3BB5A 4QW9A 3MI7X 2DXEA 3TX0A 3I9ZA 4MTPA 3RJMB 3UDEA 5I3UB 1PIEA 3KJFB 1BQNB 5DQIA 2DR5A 1TV6A 3AHPA 2MKJA 2DY1A 1U49A 4OZ5A 4KB7A 2GJ2A 1IJFB 3MEEA 2G1HA 2BZ2A 2GO9A 2AJ1A 1FK9A 2PIIA 4HDHA 4QWDA 5DG7A 3L7PA 3MM8B 1ZTWA 3NS6A 2OPPA 2VG7B 3LGHA 1T11A 3ZZRA 4DV4J 3DXBA 5D4OA 1SQEA 1PYOB 2FJDB 4LSNB 4KHPF 1TMMA 2N4CA 2J9EA 3BGRA 5IT9Y 5LXRA 1U24A 2PFDA 3OR2A 5E3CA 5I3UA 4G3IA 4P72A 3GPAA 5JXSA 3KHRA 4CM2A 3DLKB 4YN3B 1RBLA 2IAJA 3HJVA 2W4CA 3LW5C 2CQGA 3BGFA 3TW0A 5DG9A 2XMWA 1RAEB 4QQBA 1FRHA 2NSBA 4C8ZA 1CJKB 3AB4B 3CCZA 2N3OA 2MTLA 3ISND 3DRYA 4G6VB 1KONA 2KXFA 1C0UA 2BJ7A 4R0EA 3EICA 4WYWA 3D1QA 3ILLA 3QRPA 4ZPCA 2VH7A 2VOPA 5KG4A 2HHWA 1RGVA 1RKIA 3FEZA 3CJTA 1HWKA 2E1MC 3H7HB 3UCGA 2CNNB 4NRTA 4E2FB 2CZ4A 1FHTA 2YH0A 1WEZA 2DH7A 4Y2CA 2E66A 2R4FA 4WXWA 3WQPA 3LANA 3HKWA 1H72C 3FCVA 2MKIA 3TUPA 2IRXA 3IRXA 4RPFA 4DR3F 1RWKB 3D6MB 2KB2A 1D3WA 1S1UB 2YWEA 2QFJA 2ASLA 2HNZB 4B9UA 2CYYA 3AQPA 3JB9k 2KZZA 2UXBF 1UFKA 4HI1A 2AX1A 3MR7A 3QFWA 1QAYA 2OO4A 3Q89A 1S7IA 2BUNA 3H40A 4KO0A 3ULHA 2MLXA 4PQAA 1Y9OA 5K8PA 4Y28C 2X3DA 1RHKB 4E98A 1N0VC 1RLDA 3V5RA 3FBBA 4ALZA 3DGPB 3BQ1A 4DUYJ 5F8GA 4O3RA 3TUIC 1NJYA 4RU2A 1F2GA 1VISA 5GAHU 2JH3A 4DN9A 3J81Y 4HLBA 3P5TL 5KT5A 1RA6A 4OX9F 5EWGA 4DMZA 2ZHOA 4ZIVA 2KM8C 4CLLA 3FNNA 4GC7A 5HLFA 2ZITA 4ZVGA 2QLBB 2CJYB 3DOLB 2V8GA 3SFUA 3W3SA 2RU3A 4KJIA 4ZVUB 1AZSA 4PYAA 2H5JB 3A8IA 1YIJS 4ZLPA 4B9SA 3CT9A 3GJSB 3G6YA 4QR1A 1D9AA 4ITSA 3EGWB 3PX6A 2B4UA 3VAMA 3PRDA 2HHVA 4OX7A 1LW2A 3ZTPA 4KHRA 1HD1A 3D6TB 4CT8A 4K4UA 4YR0A 1DAXA 1U0HB 3BH6B 2H65B 2Y9HA 4DSEA 2M8DB 1HWLA 1QVGR 2CFXA 1RB0A 5IM0B 2FVQA 3IWNC 2W2QP 5KAKA 3EWGA 2BE9B 3D3BJ 4C48A 5HL7Q 5ETTA 4JI8J 2CNLB 2HGLA 4ZCIA 4QWAA 4OMFG 2FJEB 1X4HA 2VG5B 3FBFA 3OQ2A 4JP8A 4KH1B 3FSIA 3HSDA 4X4PA 1MN9A 4JBCA 1OJ4A 2A2CA 4I2QA 4P71A 3SSRA 4DL4A 1TQLA 1YX2A 4QWEA 3PW4A 4DBQA 4WKRA 3GJRB 4WXOA 3CCQS 3RAQA 2MQOA 2P9EA 2UUBF 1S1TA 1CEZA 1S6OA 2D9PA 3GJTB 3JAMY 3GLJA 1U26A 2G4BA 3P5BP 3VGTA 4ED4A 1MMNA 2EKNA 4I4BA 5K8NA 1RHRB 4ED3A 3KJNB 3P4UB 3GIKA 5IQQA 5L8RC 2FYXA 3QGPA 1YTYA 1RT7B 5ETQA 3T9ZA 4B02A 3D5MA 4KFBA 2VQFF 2DIVA 2CQ1A 1T9VA 2Q6CA 3QGHA 2V0NA 4M5IA 4OZNA 4DU8A 1SKWA 1F0XA 2FHOB 4KKOA 1RWPB 2F7VA 2HHQA 1B99A 1GTEA 3L4BC 1YJRA 4ZPBA 3Q8VA 1V3ZA 4UY85 3GIRA 2E5LF 3TJ8A 1DQ9A 3D54A 2BE7D 2QA2A 1RSCA 3IBWA 2KRBA 3PEJA 4I56A 4ETZA 2DO0A 2R2UA 2UUCF 2IC3A 3HO1A 1N0UA 1S59A 1UP1A 2O1PA 3OFGA 4JI8F 1XBWA 2IVYA 3JXOA 4FYXB 1KLMA 3KLGA 2WW8A 5GAHI 1BD6A 3PVXA 2UP1A 4B9VA 4HI2A 1QY7A 2OHDA 3R5JB 4KR0B 4L76A 1JK9B 4WYLA 3SCLE 3JSRA 2QTWA 4DSFA 1XMQF 1N33J 1E6VA 1PBUA 4LSZB 3W5YA 1JLAA 5C2GA 3EPIA 2BYCA 2HLTA 4ZIWA 3IR7B 3KLVA 2YTCA 4J9VA 4OYZA 3NS7B 2F40A 1NHUA 5H9FJ 2CAJA 2RRNA 1JLCB 5DJBA 5IC4B 1HNIB 1D8YA 4NPOA 2NUHA 3GYNA 3MF5A 4IFVB 3OL9A 3OVBA 2FUG9 4F04B 2VPZB 2GMLA 3RBZA 4W92B 1FJ7A 4A48A 4FS1A 4NEYA 3LP2A 3N01A 1S1WA 2HK3A 4ED5A 2MY7A 4FZVA 3E8OA 2LEAA 2C2KB 2FGOA 1HARA 1NNDA 2WBMA 1QE1B 1VDHA 2JHEA 2IM3A 1NHVA 2WVBA 3MPDA 5G4DA 4PG4A 1RKJA 4ZMMA 1YZ7A 3EM1A 1LWFB 1BQXA 4DZ6A 1VQLS 1SH0A 1NU4A 1M5VC 2JEIA 4A8OA 3ZTRA 4YDDB 1RT2B 5GAGI 2G2ZA 2LXFA 1Q0NA 2FVRA 3X3UA 1HWUA 4YHHF 4PQUA 4KH0B 3KTQA 2EG2A 2J7UA 3OTCA 2EC2A 3BBBA 1U1QA 1C0TA 1EHWA 3DLEA 1CULB 2BJ9A 2AMCB 4GVBB 4ZS6A 1SC6A 2Z8QA 4ID8A 5LJ3Y 4F36A 2RS8A 3F73A 1S57A 3IWLA 3CTRA 5KFFA 1HBNA 1SL1A 4DDFA 3M2VA 1WWHA 5D4NA 2VL1A 3FK4A 4ZVEA 1IUJA 1HMVA 4L72B 3GSDA 3MOZA 1W2BR 3N6LA 2BJ8A 3BBFA 4TU8A 1L3SA 3QLHB 2QE5A 3CJ5A 2V4JB 4K7QA 3HHLA 2VPXB 5FDLA 1DTQB 3VQTA 2BQRA 4KYZA 4URGA 2X51A 4P74A 4QPXA 4DL5A 2KO1A 1GTHA 2B56A 2ZZTA 3HZGA 1LWCA 3QAUA 5LMUJ 2A1BA 2E1CA 1VBZA 2P5VA 3OL8A 2AKWB 3MMCA 1S12A 2FZCB 4URQU 2GVDA 5KFQA 4F4KA 3IR5B 4RZRA 5D0HA 2J0XA 4ZN1A 3KK2B 3M32A 4CNZA 3NOCA 2FHMA 1G3OA 4RO0A 3RAXA 1S9EB 4U7UD 3CPWR 1RBAA 4ECRA 3BR9A 2B3TB 1OYEA 3ETMA 4OJ3A 4RUAA 4DHVA 4YY3F 3C2PA 1EQMA 3DYAB 1C4CA 3ISNC 3RGIA 2W9CA 4U96A 4NA2A 4CP5A 4EI2A 1GMVA 5HN0A 4OL8A 3VVUA 3MMAB 3J81j 3TA2A 1S1VA 3OBIA 1PYTA 2RKIB 1TKDA 3TRGA 1LFWA 4GKJF 2I5JB 4C0BA 2Z2ZA 1XWLA 4PG5A 1PAUB 3K89A 4YY3J 5J2NA 1D9FA 1LWEB 2HPUA 3WBZA 4AE5A 2OELA 3OTDA 1Q79A 1HR0F 4IOAQ 4K0KF 1AFIA 3L7UA 2DKOB 1Q16B 2HWTA 4M5HA 4ZLJA 4U6PA 4N5SA 5HANA 3VQSA 2HBRB 1LK7A 4FXVA 4I7FA 5JMNA 4PR6A 2BJEA 2K7JA 4X64F 3T19A 3W8GA 3MCMA 4J9RA 2HGMA 2VBYA 5C25A 5H9FK 3C8YA 4K4WA 2XTJP 4N77A 1JX4A 1SJ3P 1S9FA 1RT6B 4OI1A 3AJDA 4ZHRA 2DXFA 1KS2A 2KYXA 2BABA 3CC2S 1WDTA 2CQDA 4JV0A 1TELA 2XCAA 1SB6A 1UPPA 3CDWA 4DL0C 1FD2A 3CCWA 3NEKA 2HNYA 4UW2A 4UQTA 2PSZA 4YDXA 5KT7A 1OSDA 1UPMB 1BLUA 2IM0A 4LVNP 2VD3A 4O23A 2VV5A 3DRRB 4XAKA 2G0JA 5DZ7A 1JXVA 5F8JA 1A6LA 1FDBA 1GXUA 4LJMA 1N5VA 4Y65A 2HW3A 1R27B 3QQCD 1D0EA 4LRDA 4OYIA 5CZVA 5KG1A 5D0EA 2UVUA 3M6WA 4DL3A 1JLGB 2BXJA 3DMJA 3N6NA 1IKWB 2ILYA 4Y2KA 2ZH4A 2PT0A 2F4VF 3OLAA 3GYXB 1S9GA 3I9V9 2DYAA 2IJNA 1KQKA 2E44A 2AYEA 4PPDA 4J90A 4KPYA 5D4LA 2DNGA 4OV1A 2KFZA 3R2CJ 4ZCLA 2JJ4D 4PWWA 4MIBA 1JLQA 1IBMF 4F02A 2HSEB 2WONB 3RW7A 1ZTTA 1D8ZA 4KTQA 1F60B 3N6MA 5IV3A 2R7RA 3PNIA 2AD9A 3QT7A 2EC0A 1VLYA 4DR7F 5KFTA 2B9XA 2O67A 3ZTQA 3K17A 4NMXA 1KKHA 3FQKA 2HAIA 3JQJA 1FVQA 3NAIA 1WTFA 4M1KA 2ILZA 3TWZA 2ZH2A 2IA6A 4DUZF 4N41A 5E3RA 1N36F 3T6BA 2KJWA 4QU6A 3NAHA 1OYDA 2EFQA 3AXMA 2HGNA 2UVVA 2XS5A 2BACA 3MR6A 3KK1A 3C3LA 4LFAF 1YJWS 1F3FA 2CPFA 3EZUA 1WF0A 3MM6A 3UDLA 4ZN3A 4IUFA 3MHYA 4YOEA 2IIHA 4DI6A 3VAHA 1EB0A 1SQGA 3DDKA 3K5LA 3K5OA 3H5XA 1GQEA 4LRCA 3DC2A 1TKTA 3DRRA 3GR0A 1R0CB 5KFNA 1AW0A 1O0PA 5L9XA 4UF4A 2NXCA 3G4SS 5F8NA 2ZC4A 3H8YA 3MTJA 4H4OA 4N76A 3H90A 4PCQA 3CD6S 1MN7A 3HSGA 1ZM3A 1R6VA 4ZPTR 1RT6A 3MZIA 1G2EA 1QTNB 4NZ6A 2KH9A 1FKOA 1KFSA 5KFJA 3FEYB 4FPRA 3KMSA 4PABA 2KXHA 4RW9A 1P9YA 1FEEA 4RNNA 1YJ7A 5DQHA 2ZM6F 4LFBF 1HYSB 4I6AA 1RT7A 4ZVPB 1WI6A 2RRBA 4XIUA 2GVZA 1ZZNA 3HX9A 4B9LA 1XJWB 1NK4A 4A8MP 1SJFA 3GQCA 5KFCA 5B09A 4YP3A 1XR5A 2OKQA 3KXDA 3OSPA 1TR0A 2QLXA 3NGKA 4X66J 2HMIA 1S0OA 3M4XA 5IXUA 5CAAA 2GJFA 2ZZNA 3CULA 2HS3A 3EVMA 5GADU 3RB0A 3M8QA 1IBLF 4QIVA 3D1OA 5KFMA 2LDIA 2XYHB 3SCKE 1VJWA 1TFYA 2HFVA 1ZYQA 2ZBRA 3UVJB 3MR3A 3FDSA 3TANA 1GNKA 2CNKB 3AB2B 2XWXA 3GG0A 2WW4A 4F67A 4IRCA 3RZAA 2OUGA 5DRKA 4DCPB 1RWUA 3R7SB 3ZNJ1 4AL7A 4CDIA 3CWJA 3HMJG 2W9CB 1SJ4P 2BV3A 1NH8A 1IR0A 4FYYB 4CH0S 1S6PB 3W66A 3CD0A 2AIRB 3R1HA 4TN2A 1S77D 3I5AA 2CQBA 4B3OB 4DR6F 3ET6B 1TAUA 4CYUB 2QL7B 4HDGA 1Y5IB 1GT8A 4KV8A 5HSPA 4OZLA 2UU9F 1SH3A 4R25A 1KHWA 2JLFA 5H9EK 2ZHBA 4NA1A 1Q5YA 1HIYA 4J7CA 4TY8B 1KC8T 2KFNA 2V4JA 1WJ9A 3AA8A 4DZDA 2YNHA 1HNWJ 5FJ4A 4U8VA 5A2QU 4UZBA 1C2PA 1TL3A 2L3MA 1WOPA 3MEDB 2G0CA 4M5GA 4LF8J 3LPYA 1M5OC 1PO6A 2OIHA 4Q0BA 2GHVC 2C22A 3DOMA 3UD4P 3NRBA 3DHXA 4LBPA 3FFIB 1QSYA 5HQMA 4HL9A 3W8PA 3WC0A 5ITHA 2KDOA 2RH3A 1R8BA 4ZLNA 3EYZA 4DR2J 2E9ZA 2BR0A 4YHHJ 5K8OA 1K1QA 1B0PA 2RQMA 4U7CA 1NBEB 1VYAA 1V5VA 4O44A 1YSJA 2B4VA 2E1RA 4X4NA 2W2OP 1RE1B 2EK6A 1ZAWA 1T05A 2R7XA 2BOAA 3Q2SC 1UVJA 3DLEB 5AXLA 1O6XA 3TX8A 3UE2A 1OPIA 3N4WA 2LU1A 4YMEA 3GIJA 4R8UB 1UVMA 4E8UA 1RXOB 4C98A 2V69A 3VGVA 3WDOA 3MURP 5L46A 1R8CA 2MSSA 2RE1A 4ZLLA 4M5DB 1FNOA 3SDEA 3PKYA 1RAJA 5HI7A 4ED2A 3ENWA 2PC6A 1RISA 2HRUA 2MPUA 3I96A 3CMAS 2XZDB 1C0UB 4TLQA 2DIUA 2HNDA 1JLCA 4OHWA 3R7BB 3FCHA 2BM1A 1QAIA 5KG2A 2PMWA 4ZK7M 2R7QA 4JI1F 5JVHQ 2KT2A 2HVZA 2OPSB 3C19A 4F4WA 2HZAA 5HATA 5D3GB 1V5IB 2ZFHA 1V9OA 2D41A 4GO7X 4NE9C 1VQOS 2R8HA 4J9LA 3LOUA 4RW6A 1FXRA 2FZKB 1VK8A 1R0AA 4NEZA 2MKYA 2HQGA 2J9CA 3BSCA 1CJVA 1ZPVA 2ZBCA 3IS9B 1F2HA 2KKHA 4M8LA 2ZH7A 1NJIT 4RWWA 1JLAB 3G8QA 2PN6A 3GTYX 2DGTA 1FK9B 3PO5A 3PW2A 2AEJA 2I9SA 3W2WA 2H5EA 4C9DA 4KFBB 3HFKA 5AT1B 1SJ1A 3POTA 2CPDA 4EBDA 1R6YA 4O0IA 1ZETA 1I94F 1HNZJ 1NPPA 1RTJA 5CH7B 5C42B 2DNQA 3MM7B 3NLCA 3R8YA 4A8SA 4B3TJ 1BE4A 1HPZB 3NNHA 3MDFA 4DV0F 1UJ4A 5LSLA 1JJHA 1SL2A 1N52B 1WC0A 2YBVA 4L74A 2OMOA 5BR8F 4LUBA 4GKKJ 1R7IA 4CM0A 1I5OB 3OHBA 1VHFA 4ZA1A 2VZ9A 1XK8A 3MCOA 3IP0A 3M9OB 4I2PB 4JI5J 1UETA 4R5PB 3DOKA 4DR5F 4YB5A 3DN9A 3HPOA 4DUTA 1QAJA 1REVB 5HQLA 2HEKA 1XNRF 1VRTA 2C42A 1WNEA 3UD5A 3QT8A 5GAEI 3I56S 3CDEA 2ABYA 1FVSA 3UFCX 4EUVA 3J7Z5 1B70B 2P9GA 3V81A 1U0HA 2B9EA 2OSRA 4NLQA 4M5JA 4LMZA 1R8AA 2CNOB 2GQQA 2HKEA 1UVKA 1Q1KA 2WAQD 4RNFA 4J9PA 3E01A 2M7SA 5A0YA 1HW9A 1ZPWX 2ZUAA 2FVCA 3TARA 3G82A 2DGQA 2VC0A 2FHJA 2HNYB 5LSOA 4L75A 2VG6A 1UA1A 1IM4A 3U1NA 3D67A 1TKXB 2YWKA 2JEFA 1K0TA 1FXDA 1T02A 2ZKTA 3GE9A 2H4WB 5LT5A 3TZZA 4NYZA 4OHXA 2JEJA 3MFHA 3G71S 2MZJA 3ETOA 4PUOA 3K58A 1S9EA 4C0HA 2PE8A 3VAIA 2CPEA 1HI1A 3VVTA 1KOHA 3OL6A 2CUYA 4B3OA 4BS2A 1RA7A 2R7OA 3HHDA 4WPAA 3K57A 4ZP9A 1JXLA 2V9WA 2P6TA 3CDUA 4J9QA 3B8HA 4XTTA 4ZVTB 4DG1B 4Q8FA 4DPXA 1RTDA 2CDRB 3CDAA 1T9YA 1E6YA 1AZSB 1RU2A 2JLEA 3KKFA 5KFDA 1HBMB 2CADA 2A18A 4PPZA 2OLWA 3MM9B 4NLRA 1VMBA 2G0IA 2IRUA 5A76A 4CO1A 2XWYA 1GXTA 2IRYA 3AAWB 5HVGA 4CH1A 3V4MA 2MJNA 2CZVC 1SIZA 1UFWA 3AODA 3QLHA 5KOWA 4P7TA 4IDKA 2RDDA 2J76E 3UQSA 4NLGA 4LF9F 4DS4A 4CWBA 1NAQA 4JYAF 4K4SA 4OZ2A 4WP3A 1U48A 1PKUA 4KGZB 4DX6A 1HW8A 3UN5A 4ILLA 2PO4A 4P10A 9ATCB 5AE3A 3JYTA 2BW2A 2R2SA 1CULA 3I0RA 1YBAA 1G7CB 2MZRA 4HYKA 2CKWA 3M8RA 3CMES 3KUEA 3NBPB 1D1UA 4TYBA 4LRAA 3GV5B 2AHOB 3E3XA 3TEGA 1HKAA 4QCLA 2GV1A 1Q8IA 2PEBA 1PJ5A 5MLCV 1T03A 4F3MA 2HNDB 2L9NA 3HSJA 3SSQA 4GC6A 1RWXB 3MMBA 4I69A 2DEIA 3IGNA 3FC9A 2VFTA 1VOMA 1Q8KA 2EBGA 2W24A 1JJCB 4USKA 3GONA 5HBMA 4ZKAA 1NB7A 2XMJA 1U6BA 1YBTA 2ACMA 2MY8A 3AA9A 2ROEA 1OY9A 3M2RA 5A8WB 3J7YI 4ER8A 3ILJA 1NUEA 4OX6A 2CQCA 2RDJA 1S49A 2IDEA 2IJFA 4ELUA 4Y0FA 1YITS 2WK4A 3US5A 1B3TA 1FJCA 2E9TA 2VU5A 1HNVA 4H4KC 2QA1A 2Y1RI 3H4DA 1F9EB 4BCAA 2HS4A 3TNVA 2XS2A 4NI2A 4DF4A 4FBUA 1WORA 3Q22A 3MPUB 2RMLA 1FRMA 1SV5A 4USMA 4OI2A 2AGOA 5CXTA 3MXHP 3D66A 5F8HA 1RABB 1H7WA 1XN9A 2E5JA 2OPSA 4MAKA 1L3UA 2XMTA 2NXNA 1EETA 2EI5A 4P2SA 2JWNA 1PG5B 2QSFA 4NI2B 1WSRA 3PXGa 1KBRA 2V4RA 4MKBA 4HTIA 4WCEQ 2DH9A 3TUZC 5E0OA 2ZJRQ 4ZP7A 5DDPC 3T1HJ 1U1KA 3OTOF 3D6FB 1YRXA 1T03B 2HAFA 3ZZZA 3MUMP 1SC3B 2BJ1A 2FJAB 4IKAA 2WSCC 2XNQA 3S6EA 3HM9A 4DSLA 4PXCA 3W7BA 1APSA 2HZVA 2DR9A 1CJTB 2RDIA 3IMQJ 3CJ4A 4KKOB 3OXLA 1HHQA 1CQMA 4ES1A 2K1RA 1UEVA 2IM1A 2FLLA 3ELHA 1WHVA 2J0WA 3CB4A 1EAYC 4IFVA 5B0EA 4USVA 3G8TA 2X1GA 3JQKA 3Q23A 2LQ5A 2JLGA 4LFCJ 2NLWA 2XEXA 1M1GA 3U1LA 4CH7A 4CTAB 2MZQA 5C2CA 1WKKA 2VQEJ 3EVOA 4OYXA 1UZDA 1XEZA 2MQ8A 4DPTA 1UZHA 2C3YA 2VF3A 2MHNA 2RQCA 1ZS6A 4B3RF 2OMLA 2ZWPA 3HHEA 2HFZA 3PIPQ 2W7OA 4DV5F 2WVEA 3CJRA 4M5NA 1HFEL 2DNKA 1OWXA 4NLSA 2CQ0A 4FYVB 4X4VA 5D0GA 3CCVS 4K4VA 1WKJA 4PYDA 4ZP6A 1H0HB 1GMUA 1TL5A 3TYTA 3EDRB 2Q79A 2K7KA 2DNNA 5C5JA 4IDKB 1T3NA 1HI0P 4OLPA 4ZVOB 2MDAA 2XI3A 4OFZA 1NHKL 1B7FA 1RHQB 1NJWA 2WRMA 1HD0A 4LF1A 4G1QA 2RQKA 4I64A 4C2MA 4XDCA 1NDPA 3JSMA 4R5PA 4LFAJ 1ZH5A 1L5UA 1F6TA 4PG8A 3OTBA 1U2FA 4W4MA 4KGKA 2DHHA 4FDFA 3P49B 1H2UX 5HQ8A 2LECA 1M5HA 1U8WA 4KGXB 4ZJLA 3GFXA 2OD4A 2QN6B 2WB4A 3RBDA 1HQEA 2Y0BB 2IMOA 1QUVA 3C16A 4HR2A 1A7GE 2CJQA 3QIDA 2GNKA 4TQRA 2OFHX 5KG5A 2ZOGA 2DH8A 3T5KA 2EFOA 5L1JA 5J2QB 1U1RA 1SCJB 3NG8A 3DLJA 1WC4A 2BM0A 3O8WA 5CYMA 5SZTA 4F2SA 3K8VA 4DOZA 2ZVSA 2XMUA 2AYBA 4NOHA 2MSTA 1FEHA 3W1YC 2W2NP 3DRPB 3PHEA 2V5HG 1WUUA 1MROA 4ES2A 5AE1A 2WB1D 1QSSA 1XERA 2NQPA 1W26A 3QBCA 5CQGA 1NXIA 2KRRA 2DRBA 5KG3A 1GMWA 4ECSA 3I82A 4LR7A 3I55S 2FY1A 3G87A 5G0RA 4HKQA 2GFFA 3HHKA 2V94A 1S0VA 3DXSX 4XK8C 3NS5A 2Z57B 1MROB 3D68A 3TQEA 3H98A 5CCLA 3LO3A 3MCNA 3K5NA 4B3RJ 1QUPA 5A8RB 4WIIA 2P6SA 1DQ8A 1UW9A 4UZCA 5B0GA 4OYMA 1HPZA 1EP4A 1FDDA 3TEHB 3LA0A 4RU9A 4LSLA 5ADZA 1WHYA 3VAGA 2QMWA 2MEWA 1JLBA 1WD6A 2IYGA 3B54A 3KJQB 2YNFA 4OLOA 4XDDA 4ZVFA 1OS5A 1V3RA 3BSAA 1DTTB 2L41A 2XGPA 4JI5F 1ZZFA 3K59A 1ICEB 3OFHA 1HWIA 2DCUB 4F7VA 4DV1J 4A8WA 4G1PA 1O8BA 4UUWA 1FI4A 1FRLA 4C8OA 3NNAA 2AJQA 4F0HA 2V6AA 4WU3A 2YX7A 4DV0J 4LIWA 5KT6A 1Q82T 4HT7A 1FNMA 5LOQA 3TI0A 1VI7A 2QGFB 1SC4B 1R8HA 4C8YA 2F3JA 4O44B 4PAAA 4JI7F 3L3CA 4FYWB 1I94J 1RAOA 2C2ZB 1YBUA 2M70A 3LGMA 4U7UK 3WX8A 4L3KA 1D9DA 3QMQA 5DDRC 1X9WA 4Y3CA 2V8HA 4IQXA 1S9GB 1V3SA 1UWBA 1UWAA 2DCLA 2X7IA 2UVRA 2BKPA 2RVJA 3MM6B 2MZSA 1RT3B 2AJ2A 3HK2A 5F8MA 2CQ2A 2QC3A 3DMJB 3I32A 4DV7F 3PW7A 2I0XA 3LAMA 2UXCF 4QWBA 3SDEB 5KFPA 2NPFA 1H73A 3BPDA 3SCIE 3WHIA 3W61A 4LQ3A 2M0GB 2ZUGA 3G6ES 3IO1A 5HBMB 3VAKA 5JJBA 2YH1A 3BREA 4OYOA 4UOHA 1VQMS 3H4BA 3PY8A 1T94A 5B0FA 4TU9A 4KRWA 4FYDA 3JQMA 4QYZJ 2R7SA 1GXLA 2YNIA 1Q7YT 3FBCA 1VCTA 3HXMA 1HQUB 2UUWA 2VBWA 4I0WA 2XG8A 1IBCB 2Y1LB 4R8UA 3J7YU 5AXMA 1BY9A 4LBIA 2VKRA 1SKRA 1EIYB 2OFGX 2DK2A 5BXIA 2BJ3A 4DU7A 3D2WA 4IOCQ 4OYBA 3L09A 1FESA 2OPRA 1RWNB 2W8KA 5KFKA 1NK7A 1VGYA 4J9UE 4C11A 4LF7F 1TKZA 5F8IA 1FWPA 4P52A 3DCAA 2R7VA 1H2TZ 1YJVA 4IH7A 2HS0A 4A8YA 3GSIA 2OH2A 1I51B 1S6QB 4Z7CA 4F8RA 4MT1A 5ETPA 3KLFB 4IG0B 4WE1B 1GEHA 1KTQA 2CA9A 2XI2A 3Q8SB 3OFFA 4K4YA 4LF9J 2F4FA 1T9WA 2G1DA 5A2QY 3ZTOA 4H4KA 4LF5J 2ATCB 4JI2F 3Q8RB 4LF7J 3H5YA 4CO3A 2ZD1A 4GO5X 3D1HA 3ICLA 5C24B 1FWKA 4FF4A 2HZCA 2GAGC 1HI8A 2V34A 1RCXB 2YNHB 3AT1B 5KT3A 3C14A 4IFYB 1DJ0A 5KFSA 3BO2A 4H4MB 4N8NA 1KR4A 3QGGA 1W25A 1LFPA 3CJ2A 3HCXA 4KY3A 2IA0A 3RYLA 1QTMA 3VAJA 4IYQA 4PG7A 4USHA 1RTHB 2GC8A 5D77A 3VWSA 4PEOA 4C3KA 3MAAB 3C6UB 2VODA 3LAKA 1SVDA 4MIWA 2P9CA 1BWVA 3IC1A 3VCDA 2ZD1B 1KFDA 4JOUA 2MMYA 2VJVA 4ECQA 4ICLB 2HHHJ 3BYPA 2HIQA 2DNOA 3D6HB 4EYIB 6FDRA 3TJ9A 2E5HA 1VS3A 2GMHA 1MNEA 3OTEA 1VIXA 2ZOMA 4I6YA 4MKAA 4CLZA 1MMDA 3CC7S 3ZZUA 2CQ3A 1UA0A 2RKIA 3NGSA 1HBUB 5FDLB 1X4GA 3CJ8A 1DQAA 2EFPA 3U02A 1MU2A 2JC0A 4Q0BB 3TUJC 1AYEA 1N5YB 3NMRA 2ZC3A 4USWA 4RNMA 3CCUS 2HWIA 3A3PB 3DRSB 4FKYA 2WSEC 5E5NA 3L7OA 3PX4A 1NM2A 1T7PA 4PWDB 3M8QB 5A6PA 5B0CA 2UV8A 2DVIA 5FIIA 4V1Ak 4W98A 2AJFE 4RUHA 2J6SA 3B4MA 1XMOF 2DNYA 3LALA 4F3OA 1QVFR 4CCHA 3QO9B 2IVMA 3K8WA 3BN7A 2AW0A 3CNQP 3DKDA 4ILRA 5IS2A 1R43A 4B9TA 3KK2A 2HQ3A 5KFRA 2J6TA 3KNAA 1TUWA 4RX6A 2KU7A 1WEXA 1FRKA 1AFJA 1HBMA 1S1XB 1SIWB 3P8BB 2KFYA 1FXLA 4DV1F 1YI2S 4F3QA 4RR5A 5F41A 2R8IA 4ZP8A 5IWAJ 2HQCA 3GIIA 2XHCA 3MM5A 4JYAJ 4X62J 4K59A 2D3OR 4Y2AA 2GVZB 2HRTA 4QR2A 1Y5LB 2V63A 3K5PA 4NMLA 2V68A 2I8EA 4ECVA 2WVDA 1HBOA 3C66A 2FIUA 2IHR1 3OJSA 2QA4S 4J9MA 4PWUA 1QLNA 2OPQB 3R7NB 1F1BB 2M2BA 1X9MA 2WSFC 2RRAA 3TQ1A 1QM9A 3PFEA 2PD1A 1VRUA 4DPYA 1SXLA 1N5TA 4O0NA 2GA7A 3UWTA 4CI0B 4JB8B 2RUSA 1X60A 2E7VA 3BGLA 3D0GE 1XNQF 2LYVA 5E2QA 2KXNB 2HHPA 4B9MA 1RADB 3RRKA 5MAOA 1WACA 1S0MA 1BXNA 3IM8A 2VONA 4A8KA 2ZDOA 2CVIA 4JI1J 2RT3A 4DX5A 1WI8A 5IZHA 2AP6A 2WCXA 3H2LA 3V6DA 4JI3F 1U1LA 1C1BB 3I5BA 1WOSA 2DEJA 4RW9B 2DRDA 5B7WA 4Q43A 1LV5A 3RR7A 1F5BA 4M5DA 2GX8A 3T5LA 1JKHB 1N36J 2C28A 4DJBA 4NLPA 2IM2A 3KLIA 1M0SA 9RUBA 3SQOP 2G9OA 2EFNA 5CCMA 1RDRA 2E1PA 4ED7A 3Q8YA 3WX4A 4XPEA 3RRHA 2FJVA 2MZ1A 3U7JA 2B5JB 3M2UA 3MWBA 4DR7J 1JMTA 3S1TA 2ZVIA 2D7SA 2LQBA 3QO9A 2CJBA 1BQMA 1JIHA 1FT8A 2JX2A 5E3AA 4OIXA 1JKHA 2XO7A 4WKYA 1NKBA 4Q8EA 4YUDA 2VFSA 1FFWB 1VRUB 3PTWA 4YR2A 2XMVA 1VQ8S 3GCXP 2FY8A 2ADBA 4FBTA 4ZPVR 1EZZB 2HWHA 2OTJS 4ENOA 2HURA 3RBXA 2V4QA 3RB4A 4CNYA 2RD5C 3PEHA 4OHZA 1VQPS 3S7RA 2YKNA 1S99A 5J2MB 3DLLQ 5LSRA 5I42B 1WHWA 2C2DA 1UKUA 4USUA 4K4XA 4BDPA 3QAEA 2E5LJ 1UJ5A 4ANDA 4DUYF 4DV5J 2FC9A 2O66A 4GKKF 1PBAA 3MEDA 3W2VB 3PIOQ 2FGCA 4ANEA 2CWKA 3EJMA 2GAHC 5ETOA 1ROFA 1RACB 3KJVB 4FF3A 4QWCA 1TUGB 4UOFA 4ECUA 3GYGA 5EDWA 1TK8A 3CCTA 1PYSB 1S7HA 3PM9A 3C46A 2X1FA 1N8RT 4LRFA 3AH6A 2KT5A 1NPRA 1QDUB 4A8FA 1NDKA 5KFYA 2RSQA 4MJKA 1AA1B 2YKQA 5IOLA 3T1YJ 3DLGB 3JSMB 2LXUA 1DLOB 1KQGB 4DF8A 1V6HA 2ZE2B 4NLXA 3KYLA 4MK9A 3AOBA 1TL1B 1WKLA 2QYGA 5CHCB 3D7SB 3SSSA 4DFMA 3FQLA 2VUGA 1C4AA 1WSVA 4ECYA 2Y1JA 2RILA 1U1MA 3QYYA 1B64A 5F0UA 1HBUA 2VKZG 4IQMA 2PA3A 1Q8BA 3OTOJ 3M30B 3BO3A 2YWFA 2LVWA 3NGRA 3FKBA 3QATA 1T3OA 1Y00A 3PYGA 3GV8B 2AV5A 2NSCA 4QU7A 1LEOA 2XY6A 3NP5A 5F9LA 1U02A 4X2BA 3BKTA 1TZ0A 1VBKA 3VGUA 3TVKA 4MFBA 3TAQA 1YVFA 3AY0A 3H5UA 3NKYA 5HMZA 3DHWC 3KHGA 2E5GA 2C3PA 4ED1A 2AGPA 1DRZA 1ZA1B 4GKJJ 4C7QA 2R3VA 3CJSA 1FJEB 1TL1A 4EO8A 4ICLA 4H4MA 4Q44A 4QIFA 1K1SA 2DNPA 4RBVA 2RUGA 4RW4A 1GFWB 4CZCA 3EPGA 1HLWA 2FJXA 2AT1B 2NCKL 3CO9A 1LK5A 1DURA 4P2FA 3NY0A 4CTAA 8RUCA 4URSA 5F3ZA 5EHHA 1RTHA 3FGVA 1J5OB 4DSIA 3M7VA 2ZE2A 1M90T 1CS4B 3D0IE 5HROB 4IO9Q 1PC5A 1RQ0A 3N79A 3BM7A 5KFGA 5D8HB 2N3LA 1BUXA 2H48B 4WE1A 1CJTA 3EDQB 1T8EA 2ZJPQ 2KG0A 1N5QA 3UDVA 4FF2A 3I87A 3X1LB 1P27B 2DB1A 3SXLA 2WZ1A 3M9MB 4C8KA 1Q7LB 2UXDF 1AUSL 4YS2A 1VLOA 2VBXA 4YEAA 1FCAA 1H2VZ 1OQ3A 1U25A 2CPHA 3IBFB 1NB2A 2V2QA 3BQ0A 1Y7PA 3ENVA 1FE4A 1TVRB 2QMXA 1RAGB 1UAWA 2MKKA 3N5BA 3VALA 2MB0B 2R8KA 4PQUB 3H42A 3NXZA 3F44A 3GFYA 3HZEA 3DYAA 4OJ1A 3NOGA 2XGQA 2DGOA 3THTA 1HQUA 1LWXA 1NZAA 2W7AA 2HVHA 1ZM2A 3UVJA 2WTFA 4FF1A 2K3KA 5AXKA 3MM8A 2MKSA 5M2RA 1LOUA 3MFIA 3SIPB 4MYTA 3PYEA 3QT5A 2CQHA 4ZVQB 4C11B 3VAFA 3FVYA 1RT1B 2XZTB 5J2MA 2NUUG 3ZZ0A 5A8KA 2HHSA 3SMZA 5KFUA 4WBFA 3WIVA 2YWHA 4K4TA 1MG7A 4DV3J 3HVWA 4PKDB 4ECZA 1NSQA 3HLUA 2OP5A 3DU5A 4NLYA 1Q95G 3NWRA 3ZZOA 4RJVA 3BKFA 2V2KA 3DM2B 2K8GA 2X3GA 1RBOB 3FEXB 1CC7A 3A8KA 4MMOA 2LQJA 3CJQA 4AL5A 1RWVB 4DR4J 4YB6A 2FJWA 2BMBA 4OZ3A 3GB0A 1SKUB 2AU0A 1FKPA 1H7XA 3MUVP 2KHDA 3HVTA 3V6KA 3PW0A 4JI6J 1UEUA 1DTTA 1IQTA 2R9LA 3B6BA 4ILMA 3JYTB 1X5PA 2AEFA 2CJKA 2HVDA 1JLGA 2DD8S 2FZGB 2HBQB 3DRXA 5GADI 1K0VA 1YLXA 3LP0B 2GHWA 2YNGB 3V6HA 1FTRA 1KQFB 4KC5A 1VQYA 2BBEA 2JOQA 5I3QA 1XMBA 3J81U 2J0SD 4X4TA 2HIYA 2W01A 1TL7A 3BYRA 2YQ0A 3EGVA 3UW1A 5KFLA 5B0DA 3J80Y 2MGZB 2XSJA 3OVSA 1CBKA 4DN0A 2ZM6J 4JI7J 3HVAA 4Z2XA 1UFLA 4U95A 2H4YB 5G0RB 1XNRJ 5F0WA 2F8MA 4NCGB 2JVRA 4AYBD 4JI4F 4PUOB 3R6LB 2B51A 3KLGB 2V8VA 1BC6A 6AT1B 4Y2MA 3NWGA 3VR1A 3UNGC 1LQ9A 3OFEA 1RU1A 2YQ3A 5I3PA 3HHNB 1CG2A 2D69A 2Y3YA 1IKXB 4Y34A 3GZ7A 2D9OA 3UN2A 3PW5A 3FMWA 2MKCA 4ED0A 2YWGA 1FX2A 1S1TB 5D78A 5KFWA 4AQYF 1H74A 3Q83A 4RL1A 4AD6A 5DM6Q 2QRRA 2VQFJ 2VB6A 1N4LA 1VHIA 3G96A 1X4CA 2YNFB 3TP2A 5T14A 3CO0P 3MR5A 3UCZP 4ELTA 3K0JA 1U4BA 2K3IA 1G6BA 1IWAA 2XO6A 4EYHB 1CLFA 1FKAF 1HL6A 2GCFA 2RS2A 2B8PA 2XLIA 3EE3A 2DNRA 1TL4A 1HA1A 5J2NB 4WIQA 5KT4A 1X5TA 3N28A 2QSWA 2HVEA 1HR0J 3GR1A 3HSZA 4ANCA 5GAGU 1KD1T 4MYUA 2J9DA 3C6TA 3IA0A 1G4CA 5D6GA 2W2PP 3OXFA 4JI6F 2UUAF 3OUYA 3W62A 3S8SA 4C8LA 3U1MA 5D0RA 4JV2A 2N7YA 4WTOB 4OZ0A 2H51B 5EX3A 3CCRS 3MOJB 2MQPA 2OPQA 4KQZA 4ZPDA 5JVGQ 1NCLA 2LA6A 4P9SA 4DQRA 3R5AA 4DL6A 1EKRA 2CPZA 1RAHB 2RAQA 3C14B 3P3DA 2VC1A 2XYPB 3HD2A 4IFYA 5ETNA 1XTZA 1YKWA 4DV3F 2GHPA 2MLYA 4ECWA 1YJUA 4A8XA 4ECTA 2E5IA 5EX0A 2XLKA 2GJIA 3KG4A 4NX9A 1TFWA 2N4DA 3DU6A 3A8JA 1GAOA 2I5JA 4OI4A 3TJAA 4DCOB 5J2PA 3P96A 2J6UA 1URNA 5J1EB 5HLFB 1PILA 1XR7A 2GQ2A 2POKA 3O44A 3KLFA 3G2XA 3BDPA 4A46A 3W9IA 3G9CA 4N8OA 3N5FA 1A9NB 2B7BB 2UVWA 1R3NA 3KG1A 3SV3A 2DHXA 1M1HA 1X31C 1SV5B 1SC1B 4ZPWR 5GMEA 3OR2B 4D3GA 2GIFA 4CT9A 3GILA 3FZBA 4IH6A 5IC6B 4CLUA 5C24A 3AJ1A 3BV8A 4WWSA 2BVZA 3NGUA 3TR5A 1X0PA 3DRSA 2ZNYA 1WC1A 3Q86A 5DETA 4RW7B 1JQGA 1LW0A 1N88A 1TUVA 4NLDA 3R5BA 1NMEB 3CCES 1M5SA 1TKZB 3TAMA 2YX4A 4ID5A 4NLTA 3KLHA 3PV8A 2C3UA 4IG0A 1OY6A 2XY5A 3CJKA 2CJXB 5J1NA 4I67A 3HHLD 5E3PA 4CO0A 1AB8A 2XSFA 2VDIA 3ILIA 4MK7A 3TZWA 1SJRA 2EEYA 5K9FA 4WK3A 2K06A 4WU2A 1EARA 1NEEA 4WFYA 4EK2A 4KPCA 2DT9A 3HHLB 3WZ0A 2M88A 1JNRB 3HI9A 3CJKB 4YB1P 1PC4A 2UV8G 3I0SA 1MW7A 2WBRA 4LIRA 5M2UA 4UT4A 2E1AA 1FTCA 5BYRA 3QRQA 3P6YC 3M1VB 2IMWP 1WELA 2C2NA 1RP5A 3MGJA 1LW0B 3KJVA 3TOQA 1CJUA 2QEXS 3F56A 2QJ3A 4LBHA 2UXCJ 3PCOB 5E7OB 2HLUA 3OJUA 3M8YA 3QNWB 4F4AA 3A1YG 4KO0B 1EETB 3T41A 1YJ9S 4WFNQ 1JWWA 2FTRA 3PZPA 2Z2MA 2CG4A 4B17A 2W4DA 3CGIA 3D9BA 4TY9A 3H5SA 3M2RB 1T9XA 2YKNB 3M9NB 4HHJA 3KLHB 3CCLS 3R27A 1KOOA 1Q4RA 1UJ6A 3MM9A 1Z2ZA 3QSIA 4BLGA 2XLJA 5DGAA 1HNVB 1TK0A 3T5JA 2AZ1A 1IBLJ 2PDAA 3FCWA 4FVCA 2OEMA 3I5CA 1HBNB 1RTDB 1T95A 4FN5A 2XM3A 3Q0AA 1VK3A 3RW6A 1T9UA 2HFUA 4GVBA 1IWGA 4IH5A 2U2FA 4O3SA 2LU2A 4KT0C 4X66F 3OSNA 4V19J 6FD1A 3M05A 4ZCMA 1K9MT 4DX7A 1NJZA 2O3DA 3T1YF 5SUHA 3I0RB 1TAQA 1RT2A 5J1EA 1R8PA 3LF0A 5E33A 5HMWA 5HVHA 3BEGB 2DRAA 2OD6A 1C1BA 2YWWA 3NBPA 1E6YB 3CD7A 4CLKA 3RB3A 1L3KA 2EFGA 1BWEA 2LEPA 4DLGA 1WC5A 2H54B 3KDOA 4U8YA 3QIPB 4EGLA 3R5CA 4Y2IA 1IXKA 2J5AA 5RUBA 2VA2A 2R2TA 1S1WB 3RBEA 3BS9A 3PO4A 4IOBA 2X1BA 1JLBB 3FRZA 3OVAA 2BDPA 4HH1A 2VFUA 3LUYA 1WTBA 4OI0A 1FX4A 1H6KX 2PMHA 1SJQA 4N56A 1RT3A 2BOPA 1UVLA 1D09B 2C3OA 3W65A 2GGPA 3AD9C 1S48A 1UMJA 1YRTA 3BGOP 3MD1A 3SYZA 1FRIA 1KNZA 2CZ9A 1NKCA 4Z7YA 1EP4B 4UUXA 3V6JA 1EJ7L 3N9UC 3C6TB 5L1IA 5L9NA 2W9BB 5ETSA 2F65A 1KN6A 1KVIA 2CIMA 4Y00A 5FLXY 5LMNJ 3BR8A 2QO3A 3MR2A 2ALZA 4M95A 2CXEA 3LQVA 3MTKA 2RQ4A 1JJ4A 3L9ZA 3MAQA 1VQNS 5DO2A 3TAPA 5DM7Q 2DTJA 1S76D 1NRKA 4F4XA 2FLNA 4HEA9 1RAFB 4RKUC 4RLEA 2JL9A 4FPIA 4MH8A 3UO0A 3DI6A 2A3JA 2B4PA 4JI3J 3BPSP 4B3MJ 1SKSA 3ITHB 1IBMJ 2W9BA 1REVA 3W64A 2UXDJ 1VQ5S 1IM6A 1CC8A 1IR2A 5HAOA 5CYMB 4K5RA 2OJ3A 4DSJA 1LNQA 4I2PA 2ERRA 1J5EF 1Y10A 1CJVB 3TO8A 1T9TA 5EWEA 4QBUA 2KT3A 2YKMA 2DPJA 5LL6d 4KGMA 3OL7A 4EBEA 4ZOSA 1ITPA 1HQEB 3W9HA 4OZJA 4RBUA 4YFUA 4EFAC 2ZKUA 4OJGA 3CJ0A 3G82B 4WJBA 4ZPAA 4X4RA 4DPWA 4OI6A 2FB0A 5I4MA 2ZBPA 3KWMA 3KHHA 4J9NA 3FSXA 4WZMA 2PMZD 2E7XA 3IRXB 2UXBJ 5BJRA 2VICA 5GAEU 2DHSA 2MHEA 3DLHA 2NXEA 4PG6A 2I6WA 4DR3J 1DY3A 5IM0A 4U9RA 4DQPA 4X4QA 1RHMB 2W9AA 1WG1A 4AQYJ 4DR5J 5A8KB 4NXMJ 3OD2A 4P6QA 2XCPA 2MLZA 5HVFA 3QRRA 3CF5Q 4K4ZA 3B78A 3VHQA 3VV2B 4Z37A 2YXLA 3F41A 3MEKA 3EZ5A 1CSJA 1CJKA 1U6ZA 1AROP 2V8DA 2WONA 3A3NB 4NWBA 4EO6A 5KT2A 1NK5A 3HJFA 2AJ0A 3ZTSA 2EVZA 2QL9B 2V8PA 3A8EA 1UCNA 3R5DA 3ZNUA 4X64J 3M8PB 2JEGA 4HACA 3H2VE 4NASA 1XMOJ 3W2WB 2QIFA 3AD8C 4KAIA 3SBMA 2C3MA 1NK0A 4P7VA 1FERA 1KSPA 1NSPA 3KK3A 4WF9Q 1S5ZA 3PG9A 3JSBA 3CXCR 2OEKA 5T41A 1HQ2A 3PACA 4C8NA 5CYQB 1FO1A 1VQSA 1BGXT 4QIEA 5K14A 2PEHA 4DPOA 4ZJQA 3MPYA 3J7ZT 3FUYA 2VASA 3QJLA 2ROPA 2DJWA 2I2YA 2R7UA 2HK2A 2K1RB 5KG6A 3M1VA 1TP7A 2DPIA 1Q78A 5KTQA 1MSWD 1NSAA 4B3SJ 3PYDA 4RW6B 2D1CA 1R0AB 1NK8A 1CJUB 3GIMA 3GMGA 1F9HA 3JTNA 3HVTB 1RTZA 3PYFA 4O4GB 5AE2A 2GIRA 4LR8A 2B0GA 2NPIA 1Y4ZB 1U8SA 2QG9B 3I0SB 3FSYA 1NH7A 4RWXA 1YG0A 3BF4A 4WP8A 2FDNA 3IBCB 2YNIB 1WF2A 2HYIB 1S0NA 2IBKA 1VQ6S 5KFVA 2AYGA 3ISZA 1RLCL 2VFVA 7AT1B 5IT4A 2XMAA 1YJNS 1X9SA 2EPIA 1DZ5A 3RU0A 3BSOA 3B4DA 2PI4A 4S0MA 2W8LA 2ZH8A 2KVQE 5F3TA 1IKVB 4NLWA 4K50A 2L08A 3RB6A 4O4GA 4DQIA 3BDEA 1X4EA 2B43A 3EXCX 3M6VA 4Q45A 2ZJQQ 4CLYA 4M94A 1H3DA 3FMBA 4LF5F 5HMXA 3AOAA 3OPKA 4NXMF 2GZOA 4W90B 5LM7E 3KMQA 1FA0A 4O3PA 4CYUA 2OTLS 5K5MA 5JUMA 4OYWA 3QZ8A 3RR8A 2C1EB 4DR2F 3VZIA 2HHTA 2LMIA 3EUNA 4J91A 2WOMB 3NCQA 2Z4PA 3MMBB 2NZ4A 1GX5A 1P9QC 2OAUA 1R89A 3UN3A 2EFVA 7FD1A 3M8PA 2KHCA 5DG8A 2R8JA 2PA8D 4I6WA 3TA0A 4LSNA 1R31A 2RJZA 4WZQA 4XPCA 1DLOA 3T3FA 1TMJA 2BANA 1QSLA 2OPPB 3O5TB 2JVOA 4CQ1A 2VHGA 2QL5B 2B4OA 2VDHA 1RUSA 2YPZA 2MYFA 4L73A 1JXEA 1EQ0A 2XC9A 4A8QA 3CCMS 2GW8A 4NRUA 1NDCA 1F3VA 1GMWD 4DG1A 5CD4A 2F8EX 1TV6B 2GS8A 3DDIA 4M5LA 3M30A 2DHAA 3OR1B 2OSQA 3QT6A 4RW8A 2ZH9A 4ELVA 3HDSA 1WG5A 4DR6J 5HROA 2FLPA 2ZZMA 2BEFA 2DBBA 2DGWA 1IVZA 1ZA2B 2HFOA 4M5KA 4QIWD 3R2DJ 1MWZA 1SQFA 1HNXF 2ZH6A 1KWMA 5I42A 2BE2A 2IVFB 2EBEA 3E01B 3OUYB 2AJ4A 4WFBQ 1TKXA 5BR8J 4QYZK 2HHUA 1ZM4A 1N6QA 3I6PA 5IT9U 1YZ6A 1Z4UA 2KL8A 2BX6A 2EXUA 2K2PA 3FBEA 5F9NA 2Z2YB 4DLEA 2JZ5A 1U09A 4Q2MA 2OI2A 2WHOA 4C6AA 1YJTA 2DGXA 4D3HA 5CYJA 1KEKA 5LMNF 1K47A 3FZ2A 3M8WA 2PFFB 5K8MA 5L39A 1P1TA 3HKZD 3W60A 1JNZB 2GMJA 2B8QA 2BW7A 3CE8A 5DZ6A 3OW2R 3IM9A 2XYGB 4UOGA 5KFBA 3K7RA 2L9WA 2YNGA 2ZNZA 4JI0F 1VC0A 4LQ9A 1REGX 1VR6A 2BA9A 2M52A 4QOTA 1DHMA 2P8IA 3DOKB 2H9ZA 2N7CA 1FKOB 2CPIA 2ATLA 1NLKL 1ZAVA 2R8GA 4FNHA 2XULA 1NK9A 4XO0A 2UUCJ 3Q2TC 1WHXA 3HT0A 2W25A 3CMQA 2A6OA 2QMUB 1KHVA 2A10A 5EWFA 3PR5B 3KUHA 1X5OA 4OYAA 4F4ZA 1YHQS 1S72S 1F5AA 1PSDA 1WF1A 5C7PA 2Y8YA 1U1PA 3GV7B 5ETLA 4OHVA 3W5XA 1RTJB 2W1BA 3AOCA 4USTA 5C42A 4Q5VA 2UUTA 1FDAA 4LVOP 2DR8A 3FJ2A 5E3QA 4B3TF 1SUQB 3LP1B 1U47A 2DGUA 2RB7A 4GVLA 1B7YB 2LXIA 1SH2A 2F9JA 3OT9A 4ZCKA 2DNLA 1IKXA 4OJHA 4LREA 3QPIA 1IJEB 1TL7B 2RF2A 2MGZA 3A13A 3POTB 3PRBA 3M8SA 1AT1B 4HHUA 3R5GA 1PCAA 3FRYA 3KK1B 4FVMA 3VF0B 1S10A 1IBKJ 2VG6B 3GFHA 3EMTA 1RAIB 3WIUA 4M5MA 1W7WA 2AF6A 5EGYA 1FDNA 4KIAA 1M5KC 1WC3A 1FFGB 2R7TA 3CW2C 1N56A 3G6VA 2A0FB 2LLZA 2ADCA 3N0VA 4V19X 4DR4F 3IG1B 3JTOA 3UDCA 2QFIA 2AEMA 1RWOB 4ZVSB 3V4IB 3RRGA 1JLEA 5HJXA 1CVJA 1OSCA 3BN4A 3IS9A 2LDYA 3I4HX 1RI7A 2DY9A 4OX8A 2Y0SD 2CQIA 1VRTB 1XIQA 2V67A 4BWMA 4F26A 1VBYA 1WG4A 3EZOA 3JS9A 1RTIA 1ULRA 1X7VA 2HRYA 4IRKA 3MECA 2EWHA 4J5OA 3JTPA 4WTYA 4DR1F 1FFSB 1HBOB 3UR0A 3R9LA 2Q1LA 1ZOTA 8AT1B 3OLBA 4HT5A 3BGUA 4TYAA 1SL0A 1O51A 1RT1A 1MMLA 3R6GB 3UI3A 4OI3A 3BSNA 2XMKA 1M5PC 1X4DA 2HHHF 1FRJA 1J2VA 3NCPA 4P73A 3QZ7A 4C0OC 3PKMA 3MAHA 2GIQA 3I4PA 4OX9J 1PAEX 2JFDA 1U45A 3IG1A 1J5OA 3CD5A 2JFKA 2M4MA 3C15A 2W2MP 5DLFA 4ES3A 2NREA 4PXDA 1X0FA 3JSYA 2JSXA 3V2UC 4C3LA 1U7LA 4ID5B 3KLEA 4Y6IA 1I6JA 2QLWA 2Z56B 4X4OA 3O2IA 3DNCA 1QAXA 2EW9A 1Q81T 1NZ8A 4BBYA 3AQOA 2FC8A 1KLNA 3VGSA 1FJGJ 4JI2J 3EVWA 2ZEJA 1WEYA 3KUGA 3ZC4A 2YKOA 1Y11A 3MAAA 4NXNF 1O5JA 3DLBA 4C4WA 5D3GA 3CSKA 4LFCF 2O01C 4C3MA 1TVRA 5A8WA 2C2MB 5CABA 3CVKA 4A4JA 3HD1A 4QYRA 1B0VA 2XY7A 3O6QA 2UU9J 2CPYA 3HP6A 2KM8B 2C2OB 5ETKA 2QLFB 1RT4A 3QWUA 5HP1B 1RHUB 4P2MA 1X4FA 1VQKS 3ET6A 3M6XA 2NYIA 4G1IA 3AFGA 4MIAA 3MPVA 4N7TA 2E29A 2G13A 4RW4B 2CPJA 3GFZA 2CJ9A 2FJBB 4BWJA 1UTAA 3OR1A 4JV1A 2DHGA 3DOMB 3HHLC 3H59A 2F63A 2DNMA 4TY8A 1C1CB 1N48A 5B0BA 3EX7B 3CCSS 4PXEA 1IKYA 4K0KJ 1URRA 1TL3B 1RYRA 3ENAA 2WVFA 2W7PA 3SFGA 1TU0B 4MFBB 2XNRA 2XHWA 5EN1A 1PJ7A 2IBOA 2KJVA 3H20A 5KFOA 1N32J 1UVNA 1RWWB 5HO4A 4EBCA 3U27A 2NXJA 2VBZA 1IR1A 1Q8LA 1RCOB 2WVCA 1EX8A 3IXQA 4B3SF 4TXSA 3KLEB 3NCRA 5K20B 5H9EJ 2Q66A 2GVDB 3T6JA 2ZH3A 3MMAA 2V50A 4Q7AA 1S6QA 4ERDA 2NZCA 3CEDA 4IG3A 5H1SV 3UR3C 4F2RA 2ZH1A 2QA4G 1YGYA 4K8RA 2FVPA 1DFDA 2XQCA 2F5GA 1QJHA 2XS7A 1ZM9A 4C97A 5HP1A 2DR6A 2ACYA 3DGVA 4DL7A 1KRPA 1KDNA 1EKSA 3SEOA 2PGCA 4LFBJ 2YQ1A 4AT1B 3LP2B 3K5MA 1RZMA 1C0TB 2KYZA 2AWZA 4KBIA 4PZVA 2YVSA 2B5JA 3M2UB 3UPFA 1XQIA 3THPA 4KV8B 3Q8PB 4OV6A 5IFMA 2V9KA 2NR0A 4LF2A 4HVZA 2M9KA 1X4BA 1NPKA 3M2VB 1JJ2R 3SQGA 2BANB 2RHSB 3W2VA 1TKTB 1NJXA 3D0HE 2HMIB 1E6VB 1UL3A 1P6TA 2NS1B 2IJRA 2LKZA 4QR0A 3ADAC 2KVIA 5KG0A 3TVZA 1F5CA 3V6DB 2YY3A 2P2CB 1DTQA 2XSJB 1P8GA 3A3OB 3GJQB 4FNIA 4DCJB 2MJUA 4RNHA 4X65F 4DS5A 3GU0A 1OQ6A 1S4EA 1LXNA 1Y0HA 3C15B 1GK8A 1HMVB 1IKYB 2IFXA 4CLWA 4DEZA 1FJGF 3V81B 1C1CA 3RUBL 2V2ZA 2XZWA 5AJ3F 2QV6A 2B6AA 3MEEB 1YDLA 2CDQA 1UWBB 1S6UA 3KNGA 1BQMB 4OYPA 4IR1A 4FXDA 2I1RA 4BC9A 3SZ2A 1U0SA 3H2UB 4ZJOA 4DUZJ 1ZBTA 1DARA 3J80U 3NGTA 4J9SA 1RT4B 3I31A 2HHXA 1LWFA 2F9DA 4QJVA 1Q86T 1B0TA 2IYIA 1YQHA 2COLA 3KLIB 2LA4A 1J5EJ 4O4RA 2A2DA 4F0MA 3G86A 5A8RA 3H25A 4LF8F 5HK4A 1JLQB 4CRJA 1OMSA 3Q8UA 4DV2J 4LF4F 3MM5B 4KGVB 1I1GA 3M8ZA 5L38A 1HYSA 3EGNA 2U1AA 3KHLA 3ZFVA 1Q5VA 3F0NA 1XR6A 2HBZB 3TZYA 2UZAA 5L1KA 2FQQB 2IDLA 4DR1J 2UUAJ 4X4UA 2MQLA 5KG7A 4FS2A 1KVJA 1IQZA 4LF6J 1JB0C 2KTQA 4DV7J 1AXQA 1XNQJ 5T7LA 3NL0A 3OXGA 1YWXA 3HFZB 4NZ0A 2FLOA 2FHKA 1VQ7S 1NSKL 1RTIB 2KN4A 3CIMA 4H4OB 2LEBA 3BZQA 4G65A 2ASJA 1H98A 1XMQJ 3J7AN 1N33F 1BHNA 2VFRA 1FWLA 3BQ2A 3R97A 5ETVA 4DV6F 2VPYB 3QWPA 4YQWA 2Y1IA 4O3OA 3EGZA 4CLFA 1MWQA 2AZ3A 1UW4A 1FKPB 2CVEA 2H5IB 1GX6A 1Y3JA 2ZBIA 3C16B 2OEJA 2X1AA 2ALYB 3SI8A 2D3O1 1SPBP 2C2RA 1L3TA 2VPWB 4MKVA 1VQ4S 3ZZYA 2B9WA 3LWLA 2J0QD 3W63A 3BO4A 1S1XA 3GP9A 2BKOA 2JC1A 3KFWX 2DO4A 3DM2A 1IKWA 3MD3A 4L6V3 3AXKA 5IWAF 1TK5A 1GH8A 5DS7A 1OPZA 2J7WA 3QSYB 4DFPA 1IN0A 1S79A 1N5SA 2CWXA 3MCSA 2BQ3A 2QX0A 3CUNA 2C2EA 3IFEA 3KOAA 3DFEA 1NO8A 2QT7A 4DPUA 4ZHRB 5F8LA 1U1NA 1K44A 1DBDA 1U2RA 2B6AB 5C25B 3PJXA 2SXLA 3HULA 3GWCA 5GMDA 1FE0A 1Y3KA 3DI6B 5ETRA 4NZ7A 2HQFA 3IAS9 5KFAA 3VTIA 2VJUA 1LW2B 3QJPA 4PWDA 1T05B 3KDNA 3IR6B 3MPWA 4H54A 2HFSA 1WDDA 1S4FA 3DGPA 1MU2B 2Z0GA 4O3QA 2DITA 3NGDA 2AGQA 2UUBJ 1ZAXA 2HVIA 1RWMB 2CRLA 2NXUA 5KFHA 1ELOA 1N34F 3GCWP 1X4AA 2L9DA 2J8SA 4IRDA 5GMKa 1U2CA 3D3CJ 4UOCA 5J1PA 1NKEA 2ZDPA 3TA1A 3R1LA 3FFIA 3ZZTA 4J9OA 2YKMB 3ENQA 2AYMA 2W4PA 2Q6BA 3PJ9A 1S1VB 2XMMA 4X84A 3SQGB 4Q2LA 5KFIA 1AUDA 3WC2A 2PI5A 4JV5J 4NCAA 4F0KA 4EZ9A 4UY8T 2QZ8A 3UCUP 4F50A 2J9DE 4DV2F 1N32F 4GRSA 4B3MF 1KTVA 2AQ4A 1LWEA 4DL2A 4I7FB 5KFXA 4JUZA 4DFKA 3MUTP 4KHMA 4FXWA 4WFZA 3TZXA 1K73T 2CJAA 3M32B 1HNXJ 1CS4A 3W5ZA 4DQSA 3EXYA 1XC9A 3T1AA 5E41A 1U6FA 2ZBQA 2JRSA 4IG3B 3LGNA 3IGVA 3W9JA 2FD2A 2YKAA 5AJ3J 1M1KT 3DDNA 1S6PA 4QW8A 5LMUF 4DWIA 2OGUA 1OIAA 5CZXA 1KVKA 4ETXA 4DFJA 4B08A 1HWJA 4WFXA 2Z30B 4NLOA 5A6WA 1R0BG 4CO4A 4CLTA 4AFFA
chains in the Genus database with same CATH topology
5LMNJ 3R2CJ 4PWWA 1N36J 4LF4J 4DUYJ 4DR2J 4DUZJ 3J80U 4OX9J 4YHHJ 4DR7J 4LFAJ 1J5EJ 4JI3J 4B3MJ 4DV2J 4LF9J 1IBMJ 4DV3J 4LF5J 4LF7J 3JAMU 4RJVA 4DR1J 2UUAJ 1FJGJ 4JI2J 4LF6J 4DV7J 1XNQJ 4KYZA 4DR6J 2E5LJ 4X65J 4DV5J 4DR4J 5LMUJ 4KY3A 4JI6J 3W1YC 1XMQJ 2UU9J 3D3BJ 5IT9U 5BR8J 3J7AN 2UXBJ 4KHPJ 4JI8J 2KL8A 2HHHJ 4DR3J 4JI4J 3J81U 4AQYJ 4B3RJ 3T1YJ 4NEZA 4DR5J 2ZM6J 4JI7J 4NXMJ 2UXCJ 2UXDJ 1XNRJ 5FLXU 4K0KJ 1HNZJ 2MEWA 4V1Ak 2F4VJ 3OTOJ 4X64J 1N34J 2UUCJ 1N32J 4YY3J 4B3TJ 4X66J 4DV1J 1IBLJ 1XMOJ 2VQFJ 4DV0J 4DV4J 2UUBJ 4GKKJ 4JI5J 4GKJJ 4NXNJ 1I94J 3T1HJ 5IWAJ 3D3CJ 4B3SJ 4JYAJ 4X62J 1HR0J 4HHUA 4LFBJ 2MTLA 4JV5J 3IMQJ 1IBKJ 1N33J 4LFCJ 3R2DJ 2VQEJ 4JI0J 4DV6J 1HNXJ 2MQ8A 2KVQE 5AJ3J 4NEYA 1HNWJ 5A2QU 4JI1J 4LF8J 5LM7E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMN J;  3R2C J;  4PWW A;  1N36 J;  4LF4 J;  4DUY J;  4DR2 J;  4DUZ J;  3J80 U;  4OX9 J;  4YHH J;  4DR7 J;  4LFA J;  1J5E J;  4JI3 J;  4B3M J;  4DV2 J;  4LF9 J;  1IBM J;  4DV3 J;  4LF5 J;  4LF7 J;  3JAM U;  4RJV A;  4DR1 J;  2UUA J;  1FJG J;  4JI2 J;  4LF6 J;  4DV7 J;  1XNQ J;  4KYZ A;  4DR6 J;  2E5L J;  4X65 J;  4DV5 J;  4DR4 J;  5LMU J;  4KY3 A;  4JI6 J;  3W1Y C;  1XMQ J;  2UU9 J;  3D3B J;  5IT9 U;  5BR8 J;  3J7A N;  2UXB J;  4KHP J;  4JI8 J;  2KL8 A;  2HHH J;  4DR3 J;  4JI4 J;  3J81 U;  4AQY J;  4B3R J;  3T1Y J;  4NEZ A;  4DR5 J;  2ZM6 J;  4JI7 J;  4NXM J;  2UXC J;  2UXD J;  1XNR J;  5FLX U;  4K0K J;  1HNZ J;  2MEW A;  4V1A k;  2F4V J;  3OTO J;  4X64 J;  1N34 J;  2UUC J;  1N32 J;  4YY3 J;  4B3T J;  4X66 J;  4DV1 J;  1IBL J;  1XMO J;  2VQF J;  4DV0 J;  4DV4 J;  2UUB J;  4GKK J;  4JI5 J;  4GKJ J;  4NXN J;  1I94 J;  3T1H J;  5IWA J;  3D3C J;  4B3S J;  4JYA J;  4X62 J;  1HR0 J;  4HHU A;  4LFB J;  2MTL A;  4JV5 J;  3IMQ J;  1IBK J;  1N33 J;  4LFC J;  3R2D J;  2VQE J;  4JI0 J;  4DV6 J;  1HNX J;  2MQ8 A;  2KVQ E;  5AJ3 J;  4NEY A;  1HNW J;  5A2Q U;  4JI1 J;  4LF8 J;  5LM7 E; 
#chains in the Genus database with same CATH topology
 3Q24 A;  2MKH A;  2CG8 A;  4NCB A;  5L1L A;  2HNZ A;  2FHJ D;  5CA5 A;  3AJ2 A;  1CQN A;  2Z58 B;  4NLU A;  4NLV A;  2YX1 A;  4CIO A;  2VG7 A;  2BRL A;  2RU9 A;  3CIZ A;  4OQJ A;  2JNJ A;  1FNX H;  1BMQ B;  2DXD A;  4A47 A;  3TVY A;  4QPT A;  4K5S A;  4X4S A;  5U47 A;  5CYQ A;  2BE2 B;  2BJD A;  2OPR B;  3PHT A;  5K14 B;  1HHT P;  5DLG A;  1RHJ B;  4YR3 A;  2AX0 A;  3KK3 B;  3HFV A;  1VRQ C;  3MMC B;  4IR9 A;  1HNW F;  5D4P A;  3ZO7 A;  4AXJ A;  2APO A;  2L48 A;  4KSE B;  5DDQ C;  1Z1Z A;  3PJW A;  2G2O A;  2M3D A;  3CDB A;  4ZIT A;  3T9N A;  3JAM U;  4NYO A;  2R7W A;  3DLG A;  2MQQ A;  1PJ6 A;  2B7C B;  3LPE A;  4J37 A;  4TLR A;  4TQS A;  2D74 B;  3C6U A;  4RBT A;  4BC7 A;  4TU7 A;  2Y8W A;  3BH7 B;  3PX0 A;  3QFH A;  4NA3 A;  3RTV A;  4ATN A;  4FP9 A;  2ZHA A;  2NYH A;  2YKP A;  4RUB A;  4ZVH A;  3MEC B;  1QE1 A;  1YK9 A;  4BHQ A;  5HMY A;  4NL5 A;  3MMJ A;  1OO0 B;  1LXJ A;  4I1T A;  2EG1 A;  4CLP A;  3G8S A;  3O3L A;  1VBX A;  1G1X A;  3BGR B;  5LXY A;  4OHY A;  2DNH A;  3ZXW A;  2VIH A;  4E0D A;  2VOO A;  2RHQ B;  4LSL B;  1JLE B;  1IKV A;  2EK1 A;  1LWC B;  2J7K A;  3KG0 A;  3LH2 S;  4DXL A;  4ECX A;  3IAM 9;  3D28 A;  1UVI A;  3V4I A;  3PFO A;  2Q43 A;  4ZDN A;  4LT6 A;  2HFN A;  4MKY A;  2CQP A;  2FVS A;  2RNE A;  2ZWO A;  1KLM B;  3D4J A;  1BQN A;  2H3E B;  3PR4 A;  1ACM B;  3NMA A;  4RUC A;  5FD1 A;  3DLK A;  4KE5 A;  2JDJ A;  4JV5 F;  4TNO A;  4DV4 F;  4AL6 A;  5KFZ A;  2G2Y A;  4IO1 A;  2F8H A;  5FLX U;  4RW7 A;  1Q53 A;  3GG1 A;  4LRB A;  1OY8 A;  2V2V A;  4K2J A;  2DR7 A;  1N34 J;  5M2P A;  4M63 A;  3HVR A;  1B4S A;  3BJY A;  2BQU A;  1H38 A;  5THW A;  1SUQ A;  3LP1 A;  2A6M A;  4AXI A;  5AXN A;  2MQN A;  1HHS A;  3ITH A;  5EUH A;  1VC5 A;  1T0T V;  3P45 B;  3RG6 A;  1VIO A;  3HT3 A;  4QIG A;  4NXN J;  3CC4 S;  5D15 A;  5IV4 A;  4ZVR B;  4O3N A;  4X62 F;  4DQQ A;  2KZM A;  4EWT A;  3OV7 A;  1Y5N B;  3T5H A;  3LTO A;  4USJ C;  8ATC B;  4HH0 A;  4CLS A;  2HG4 A;  1J27 A;  4I2Q B;  4DSK A;  4LR9 A;  3AD7 C;  5A0Y B;  3TAM B;  1RAA B;  2DIS A;  3DRP A;  4DX8 H;  2KI2 A;  2IC3 B;  1U1O A;  2XB2 D;  2HQI A;  3SV4 A;  1HNI A;  1LKZ A;  3QJJ A;  3O1L A;  3VZH A;  3HF5 A;  4OZ1 A;  1FF2 A;  2M8H A;  2MQM A;  4CO2 A;  4RNO A;  4F4Y A;  5J2Q A;  2HBY B;  2R42 A;  4C8M A;  2RF2 B;  1FRX A;  1RT5 A;  2D3U A;  2I38 A;  1X5S A;  4JI0 J;  2QYC A;  5BYS A;  4DV6 J;  1VQ9 S;  1RK8 A;  4PXB A;  5CD4 H;  1VFJ A;  7FDR A;  4P75 A;  3MEG B;  1S97 A;  4UTG A;  4F25 A;  1NDL A;  2CPX A;  4HAC B;  1N6Q B;  2E9R X;  1HNZ F;  2VA3 A;  3NNC A;  2BRK A;  3PRV A;  3R3T A;  2GO8 A;  2LFV A;  2R2R A;  5J2P B;  4CO5 A;  2ASY A;  5DGB A;  2VG5 A;  1X8D A;  4LF6 F;  2E7W A;  1MLA A;  2EKY A;  4P2X A;  3MEG A;  1QD1 A;  3L95 X;  5BYQ A;  4EEY A;  4U67 Q;  3E51 A;  4G1Q B;  2Q3P A;  1KP6 A;  4GMK A;  1P1L A;  4N47 A;  1A0O B;  3CCJ S;  1JLF A;  4MK8 A;  2Z2L A;  3BKU A;  3H0P A;  3PDN A;  4USI A;  4LF4 J;  4KHP J;  1N54 B;  3M6U A;  3Q8Q B;  4WP9 A;  1TTH B;  1YRU A;  2LQ8 A;  1SBR A;  4AUK A;  1NK6 A;  3B82 A;  3THV A;  3IRW P;  2YPY A;  2DGV A;  2ZH5 A;  4YB7 A;  2ASD A;  2LP4 A;  1KQS R;  5IT0 A;  3OHA A;  2DNZ A;  5B0A A;  2D3Z A;  4HTJ A;  4WK1 A;  1JLF B;  2QLJ B;  1IBK F;  4UQG A;  4J9K A;  1RYS A;  2IY5 B;  2CQ4 A;  4K2X A;  1L3V A;  2MXY A;  5IQ6 A;  4NCG A;  5DDO C;  1WC6 A;  1F9F A;  2HQD A;  2MZT A;  3A12 A;  1MWY A;  4FKX A;  4QZV B;  1N5Y A;  3J7A 1;  4TKT A;  3E2E A;  3K2Y A;  1WOO A;  2WOM A;  5GVQ A;  5LJ5 Y;  3IWX A;  1CPZ A;  3MM7 A;  3ONQ A;  4ED8 A;  1S1U A;  5KOX A;  2GGP B;  3QIP A;  1W2I A;  3UNY A;  2KG1 A;  2ZOF A;  2M5Y A;  4X65 J;  5B08 A;  2LCW A;  4WFA Q;  1FD8 A;  1K8A T;  2J8A A;  4TVA B;  2N82 B;  2F1F A;  3LP0 A;  2O5D A;  3DOL A;  2LQ9 A;  1RT5 B;  2BKN A;  2VQE F;  1UEK A;  2FPH X;  5HJY A;  5T7L B;  4RW8 B;  4I68 A;  2H1Y A;  3UD3 P;  4ED6 A;  1I3O B;  4NYP A;  1PGZ A;  5ETM A;  4L3N A;  4PRF A;  3G6X A;  1Z2L A;  4EU0 A;  2GQC A;  4B9N A;  2RIJ A;  2XBP A;  3QGI A;  3A4T A;  4EMD A;  4R0J A;  2ROG A;  3LWM A;  4JI4 J;  2F4V J;  1VC6 A;  1VJQ A;  2IPO B;  5KFE A;  3IN5 A;  2B9Y A;  3S01 A;  5DQG A;  3ILO A;  1SI9 A;  3CJ3 A;  3BBC A;  3T1H F;  3RAM A;  4EZ6 A;  4HHH A;  1RJJ A;  2DGS A;  2IAJ B;  3ZZP A;  3SCJ E;  3BB5 A;  4QW9 A;  3MI7 X;  2DXE A;  3TX0 A;  3I9Z A;  4MTP A;  3RJM B;  3UDE A;  5I3U B;  1PIE A;  3KJF B;  1BQN B;  5DQI A;  2DR5 A;  1TV6 A;  3AHP A;  2MKJ A;  2DY1 A;  1U49 A;  4OZ5 A;  4KB7 A;  2GJ2 A;  1IJF B;  3MEE A;  2G1H A;  2BZ2 A;  2GO9 A;  2AJ1 A;  1FK9 A;  2PII A;  4HDH A;  4QWD A;  5DG7 A;  3L7P A;  3MM8 B;  1ZTW A;  3NS6 A;  2OPP A;  2VG7 B;  3LGH A;  1T11 A;  3ZZR A;  4DV4 J;  3DXB A;  5D4O A;  1SQE A;  1PYO B;  2FJD B;  4LSN B;  4KHP F;  1TMM A;  2N4C A;  2J9E A;  3BGR A;  5IT9 Y;  5LXR A;  1U24 A;  2PFD A;  3OR2 A;  5E3C A;  5I3U A;  4G3I A;  4P72 A;  3GPA A;  5JXS A;  3KHR A;  4CM2 A;  3DLK B;  4YN3 B;  1RBL A;  2IAJ A;  3HJV A;  2W4C A;  3LW5 C;  2CQG A;  3BGF A;  3TW0 A;  5DG9 A;  2XMW A;  1RAE B;  4QQB A;  1FRH A;  2NSB A;  4C8Z A;  1CJK B;  3AB4 B;  3CCZ A;  2N3O A;  2MTL A;  3ISN D;  3DRY A;  4G6V B;  1KON A;  2KXF A;  1C0U A;  2BJ7 A;  4R0E A;  3EIC A;  4WYW A;  3D1Q A;  3ILL A;  3QRP A;  4ZPC A;  2VH7 A;  2VOP A;  5KG4 A;  2HHW A;  1RGV A;  1RKI A;  3FEZ A;  3CJT A;  1HWK A;  2E1M C;  3H7H B;  3UCG A;  2CNN B;  4NRT A;  4E2F B;  2CZ4 A;  1FHT A;  2YH0 A;  1WEZ A;  2DH7 A;  4Y2C A;  2E66 A;  2R4F A;  4WXW A;  3WQP A;  3LAN A;  3HKW A;  1H72 C;  3FCV A;  2MKI A;  3TUP A;  2IRX A;  3IRX A;  4RPF A;  4DR3 F;  1RWK B;  3D6M B;  2KB2 A;  1D3W A;  1S1U B;  2YWE A;  2QFJ A;  2ASL A;  2HNZ B;  4B9U A;  2CYY A;  3AQP A;  3JB9 k;  2KZZ A;  2UXB F;  1UFK A;  4HI1 A;  2AX1 A;  3MR7 A;  3QFW A;  1QAY A;  2OO4 A;  3Q89 A;  1S7I A;  2BUN A;  3H40 A;  4KO0 A;  3ULH A;  2MLX A;  4PQA A;  1Y9O A;  5K8P A;  4Y28 C;  2X3D A;  1RHK B;  4E98 A;  1N0V C;  1RLD A;  3V5R A;  3FBB A;  4ALZ A;  3DGP B;  3BQ1 A;  4DUY J;  5F8G A;  4O3R A;  3TUI C;  1NJY A;  4RU2 A;  1F2G A;  1VIS A;  5GAH U;  2JH3 A;  4DN9 A;  3J81 Y;  4HLB A;  3P5T L;  5KT5 A;  1RA6 A;  4OX9 F;  5EWG A;  4DMZ A;  2ZHO A;  4ZIV A;  2KM8 C;  4CLL A;  3FNN A;  4GC7 A;  5HLF A;  2ZIT A;  4ZVG A;  2QLB B;  2CJY B;  3DOL B;  2V8G A;  3SFU A;  3W3S A;  2RU3 A;  4KJI A;  4ZVU B;  1AZS A;  4PYA A;  2H5J B;  3A8I A;  1YIJ S;  4ZLP A;  4B9S A;  3CT9 A;  3GJS B;  3G6Y A;  4QR1 A;  1D9A A;  4ITS A;  3EGW B;  3PX6 A;  2B4U A;  3VAM A;  3PRD A;  2HHV A;  4OX7 A;  1LW2 A;  3ZTP A;  4KHR A;  1HD1 A;  3D6T B;  4CT8 A;  4K4U A;  4YR0 A;  1DAX A;  1U0H B;  3BH6 B;  2H65 B;  2Y9H A;  4DSE A;  2M8D B;  1HWL A;  1QVG R;  2CFX A;  1RB0 A;  5IM0 B;  2FVQ A;  3IWN C;  2W2Q P;  5KAK A;  3EWG A;  2BE9 B;  3D3B J;  4C48 A;  5HL7 Q;  5ETT A;  4JI8 J;  2CNL B;  2HGL A;  4ZCI A;  4QWA A;  4OMF G;  2FJE B;  1X4H A;  2VG5 B;  3FBF A;  3OQ2 A;  4JP8 A;  4KH1 B;  3FSI A;  3HSD A;  4X4P A;  1MN9 A;  4JBC A;  1OJ4 A;  2A2C A;  4I2Q A;  4P71 A;  3SSR A;  4DL4 A;  1TQL A;  1YX2 A;  4QWE A;  3PW4 A;  4DBQ A;  4WKR A;  3GJR B;  4WXO A;  3CCQ S;  3RAQ A;  2MQO A;  2P9E A;  2UUB F;  1S1T A;  1CEZ A;  1S6O A;  2D9P A;  3GJT B;  3JAM Y;  3GLJ A;  1U26 A;  2G4B A;  3P5B P;  3VGT A;  4ED4 A;  1MMN A;  2EKN A;  4I4B A;  5K8N A;  1RHR B;  4ED3 A;  3KJN B;  3P4U B;  3GIK A;  5IQQ A;  5L8R C;  2FYX A;  3QGP A;  1YTY A;  1RT7 B;  5ETQ A;  3T9Z A;  4B02 A;  3D5M A;  4KFB A;  2VQF F;  2DIV A;  2CQ1 A;  1T9V A;  2Q6C A;  3QGH A;  2V0N A;  4M5I A;  4OZN A;  4DU8 A;  1SKW A;  1F0X A;  2FHO B;  4KKO A;  1RWP B;  2F7V A;  2HHQ A;  1B99 A;  1GTE A;  3L4B C;  1YJR A;  4ZPB A;  3Q8V A;  1V3Z A;  4UY8 5;  3GIR A;  2E5L F;  3TJ8 A;  1DQ9 A;  3D54 A;  2BE7 D;  2QA2 A;  1RSC A;  3IBW A;  2KRB A;  3PEJ A;  4I56 A;  4ETZ A;  2DO0 A;  2R2U A;  2UUC F;  2IC3 A;  3HO1 A;  1N0U A;  1S59 A;  1UP1 A;  2O1P A;  3OFG A;  4JI8 F;  1XBW A;  2IVY A;  3JXO A;  4FYX B;  1KLM A;  3KLG A;  2WW8 A;  5GAH I;  1BD6 A;  3PVX A;  2UP1 A;  4B9V A;  4HI2 A;  1QY7 A;  2OHD A;  3R5J B;  4KR0 B;  4L76 A;  1JK9 B;  4WYL A;  3SCL E;  3JSR A;  2QTW A;  4DSF A;  1XMQ F;  1N33 J;  1E6V A;  1PBU A;  4LSZ B;  3W5Y A;  1JLA A;  5C2G A;  3EPI A;  2BYC A;  2HLT A;  4ZIW A;  3IR7 B;  3KLV A;  2YTC A;  4J9V A;  4OYZ A;  3NS7 B;  2F40 A;  1NHU A;  5H9F J;  2CAJ A;  2RRN A;  1JLC B;  5DJB A;  5IC4 B;  1HNI B;  1D8Y A;  4NPO A;  2NUH A;  3GYN A;  3MF5 A;  4IFV B;  3OL9 A;  3OVB A;  2FUG 9;  4F04 B;  2VPZ B;  2GML A;  3RBZ A;  4W92 B;  1FJ7 A;  4A48 A;  4FS1 A;  4NEY A;  3LP2 A;  3N01 A;  1S1W A;  2HK3 A;  4ED5 A;  2MY7 A;  4FZV A;  3E8O A;  2LEA A;  2C2K B;  2FGO A;  1HAR A;  1NND A;  2WBM A;  1QE1 B;  1VDH A;  2JHE A;  2IM3 A;  1NHV A;  2WVB A;  3MPD A;  5G4D A;  4PG4 A;  1RKJ A;  4ZMM A;  1YZ7 A;  3EM1 A;  1LWF B;  1BQX A;  4DZ6 A;  1VQL S;  1SH0 A;  1NU4 A;  1M5V C;  2JEI A;  4A8O A;  3ZTR A;  4YDD B;  1RT2 B;  5GAG I;  2G2Z A;  2LXF A;  1Q0N A;  2FVR A;  3X3U A;  1HWU A;  4YHH F;  4PQU A;  4KH0 B;  3KTQ A;  2EG2 A;  2J7U A;  3OTC A;  2EC2 A;  3BBB A;  1U1Q A;  1C0T A;  1EHW A;  3DLE A;  1CUL B;  2BJ9 A;  2AMC B;  4GVB B;  4ZS6 A;  1SC6 A;  2Z8Q A;  4ID8 A;  5LJ3 Y;  4F36 A;  2RS8 A;  3F73 A;  1S57 A;  3IWL A;  3CTR A;  5KFF A;  1HBN A;  1SL1 A;  4DDF A;  3M2V A;  1WWH A;  5D4N A;  2VL1 A;  3FK4 A;  4ZVE A;  1IUJ A;  1HMV A;  4L72 B;  3GSD A;  3MOZ A;  1W2B R;  3N6L A;  2BJ8 A;  3BBF A;  4TU8 A;  1L3S A;  3QLH B;  2QE5 A;  3CJ5 A;  2V4J B;  4K7Q A;  3HHL A;  2VPX B;  5FDL A;  1DTQ B;  3VQT A;  2BQR A;  4KYZ A;  4URG A;  2X51 A;  4P74 A;  4QPX A;  4DL5 A;  2KO1 A;  1GTH A;  2B56 A;  2ZZT A;  3HZG A;  1LWC A;  3QAU A;  5LMU J;  2A1B A;  2E1C A;  1VBZ A;  2P5V A;  3OL8 A;  2AKW B;  3MMC A;  1S12 A;  2FZC B;  4URQ U;  2GVD A;  5KFQ A;  4F4K A;  3IR5 B;  4RZR A;  5D0H A;  2J0X A;  4ZN1 A;  3KK2 B;  3M32 A;  4CNZ A;  3NOC A;  2FHM A;  1G3O A;  4RO0 A;  3RAX A;  1S9E B;  4U7U D;  3CPW R;  1RBA A;  4ECR A;  3BR9 A;  2B3T B;  1OYE A;  3ETM A;  4OJ3 A;  4RUA A;  4DHV A;  4YY3 F;  3C2P A;  1EQM A;  3DYA B;  1C4C A;  3ISN C;  3RGI A;  2W9C A;  4U96 A;  4NA2 A;  4CP5 A;  4EI2 A;  1GMV A;  5HN0 A;  4OL8 A;  3VVU A;  3MMA B;  3J81 j;  3TA2 A;  1S1V A;  3OBI A;  1PYT A;  2RKI B;  1TKD A;  3TRG A;  1LFW A;  4GKJ F;  2I5J B;  4C0B A;  2Z2Z A;  1XWL A;  4PG5 A;  1PAU B;  3K89 A;  4YY3 J;  5J2N A;  1D9F A;  1LWE B;  2HPU A;  3WBZ A;  4AE5 A;  2OEL A;  3OTD A;  1Q79 A;  1HR0 F;  4IOA Q;  4K0K F;  1AFI A;  3L7U A;  2DKO B;  1Q16 B;  2HWT A;  4M5H A;  4ZLJ A;  4U6P A;  4N5S A;  5HAN A;  3VQS A;  2HBR B;  1LK7 A;  4FXV A;  4I7F A;  5JMN A;  4PR6 A;  2BJE A;  2K7J A;  4X64 F;  3T19 A;  3W8G A;  3MCM A;  4J9R A;  2HGM A;  2VBY A;  5C25 A;  5H9F K;  3C8Y A;  4K4W A;  2XTJ P;  4N77 A;  1JX4 A;  1SJ3 P;  1S9F A;  1RT6 B;  4OI1 A;  3AJD A;  4ZHR A;  2DXF A;  1KS2 A;  2KYX A;  2BAB A;  3CC2 S;  1WDT A;  2CQD A;  4JV0 A;  1TEL A;  2XCA A;  1SB6 A;  1UPP A;  3CDW A;  4DL0 C;  1FD2 A;  3CCW A;  3NEK A;  2HNY A;  4UW2 A;  4UQT A;  2PSZ A;  4YDX A;  5KT7 A;  1OSD A;  1UPM B;  1BLU A;  2IM0 A;  4LVN P;  2VD3 A;  4O23 A;  2VV5 A;  3DRR B;  4XAK A;  2G0J A;  5DZ7 A;  1JXV A;  5F8J A;  1A6L A;  1FDB A;  1GXU A;  4LJM A;  1N5V A;  4Y65 A;  2HW3 A;  1R27 B;  3QQC D;  1D0E A;  4LRD A;  4OYI A;  5CZV A;  5KG1 A;  5D0E A;  2UVU A;  3M6W A;  4DL3 A;  1JLG B;  2BXJ A;  3DMJ A;  3N6N A;  1IKW B;  2ILY A;  4Y2K A;  2ZH4 A;  2PT0 A;  2F4V F;  3OLA A;  3GYX B;  1S9G A;  3I9V 9;  2DYA A;  2IJN A;  1KQK A;  2E44 A;  2AYE A;  4PPD A;  4J90 A;  4KPY A;  5D4L A;  2DNG A;  4OV1 A;  2KFZ A;  3R2C J;  4ZCL A;  2JJ4 D;  4PWW A;  4MIB A;  1JLQ A;  1IBM F;  4F02 A;  2HSE B;  2WON B;  3RW7 A;  1ZTT A;  1D8Z A;  4KTQ A;  1F60 B;  3N6M A;  5IV3 A;  2R7R A;  3PNI A;  2AD9 A;  3QT7 A;  2EC0 A;  1VLY A;  4DR7 F;  5KFT A;  2B9X A;  2O67 A;  3ZTQ A;  3K17 A;  4NMX A;  1KKH A;  3FQK A;  2HAI A;  3JQJ A;  1FVQ A;  3NAI A;  1WTF A;  4M1K A;  2ILZ A;  3TWZ A;  2ZH2 A;  2IA6 A;  4DUZ F;  4N41 A;  5E3R A;  1N36 F;  3T6B A;  2KJW A;  4QU6 A;  3NAH A;  1OYD A;  2EFQ A;  3AXM A;  2HGN A;  2UVV A;  2XS5 A;  2BAC A;  3MR6 A;  3KK1 A;  3C3L A;  4LFA F;  1YJW S;  1F3F A;  2CPF A;  3EZU A;  1WF0 A;  3MM6 A;  3UDL A;  4ZN3 A;  4IUF A;  3MHY A;  4YOE A;  2IIH A;  4DI6 A;  3VAH A;  1EB0 A;  1SQG A;  3DDK A;  3K5L A;  3K5O A;  3H5X A;  1GQE A;  4LRC A;  3DC2 A;  1TKT A;  3DRR A;  3GR0 A;  1R0C B;  5KFN A;  1AW0 A;  1O0P A;  5L9X A;  4UF4 A;  2NXC A;  3G4S S;  5F8N A;  2ZC4 A;  3H8Y A;  3MTJ A;  4H4O A;  4N76 A;  3H90 A;  4PCQ A;  3CD6 S;  1MN7 A;  3HSG A;  1ZM3 A;  1R6V A;  4ZPT R;  1RT6 A;  3MZI A;  1G2E A;  1QTN B;  4NZ6 A;  2KH9 A;  1FKO A;  1KFS A;  5KFJ A;  3FEY B;  4FPR A;  3KMS A;  4PAB A;  2KXH A;  4RW9 A;  1P9Y A;  1FEE A;  4RNN A;  1YJ7 A;  5DQH A;  2ZM6 F;  4LFB F;  1HYS B;  4I6A A;  1RT7 A;  4ZVP B;  1WI6 A;  2RRB A;  4XIU A;  2GVZ A;  1ZZN A;  3HX9 A;  4B9L A;  1XJW B;  1NK4 A;  4A8M P;  1SJF A;  3GQC A;  5KFC A;  5B09 A;  4YP3 A;  1XR5 A;  2OKQ A;  3KXD A;  3OSP A;  1TR0 A;  2QLX A;  3NGK A;  4X66 J;  2HMI A;  1S0O A;  3M4X A;  5IXU A;  5CAA A;  2GJF A;  2ZZN A;  3CUL A;  2HS3 A;  3EVM A;  5GAD U;  3RB0 A;  3M8Q A;  1IBL F;  4QIV A;  3D1O A;  5KFM A;  2LDI A;  2XYH B;  3SCK E;  1VJW A;  1TFY A;  2HFV A;  1ZYQ A;  2ZBR A;  3UVJ B;  3MR3 A;  3FDS A;  3TAN A;  1GNK A;  2CNK B;  3AB2 B;  2XWX A;  3GG0 A;  2WW4 A;  4F67 A;  4IRC A;  3RZA A;  2OUG A;  5DRK A;  4DCP B;  1RWU A;  3R7S B;  3ZNJ 1;  4AL7 A;  4CDI A;  3CWJ A;  3HMJ G;  2W9C B;  1SJ4 P;  2BV3 A;  1NH8 A;  1IR0 A;  4FYY B;  4CH0 S;  1S6P B;  3W66 A;  3CD0 A;  2AIR B;  3R1H A;  4TN2 A;  1S77 D;  3I5A A;  2CQB A;  4B3O B;  4DR6 F;  3ET6 B;  1TAU A;  4CYU B;  2QL7 B;  4HDG A;  1Y5I B;  1GT8 A;  4KV8 A;  5HSP A;  4OZL A;  2UU9 F;  1SH3 A;  4R25 A;  1KHW A;  2JLF A;  5H9E K;  2ZHB A;  4NA1 A;  1Q5Y A;  1HIY A;  4J7C A;  4TY8 B;  1KC8 T;  2KFN A;  2V4J A;  1WJ9 A;  3AA8 A;  4DZD A;  2YNH A;  1HNW J;  5FJ4 A;  4U8V A;  5A2Q U;  4UZB A;  1C2P A;  1TL3 A;  2L3M A;  1WOP A;  3MED B;  2G0C A;  4M5G A;  4LF8 J;  3LPY A;  1M5O C;  1PO6 A;  2OIH A;  4Q0B A;  2GHV C;  2C22 A;  3DOM A;  3UD4 P;  3NRB A;  3DHX A;  4LBP A;  3FFI B;  1QSY A;  5HQM A;  4HL9 A;  3W8P A;  3WC0 A;  5ITH A;  2KDO A;  2RH3 A;  1R8B A;  4ZLN A;  3EYZ A;  4DR2 J;  2E9Z A;  2BR0 A;  4YHH J;  5K8O A;  1K1Q A;  1B0P A;  2RQM A;  4U7C A;  1NBE B;  1VYA A;  1V5V A;  4O44 A;  1YSJ A;  2B4V A;  2E1R A;  4X4N A;  2W2O P;  1RE1 B;  2EK6 A;  1ZAW A;  1T05 A;  2R7X A;  2BOA A;  3Q2S C;  1UVJ A;  3DLE B;  5AXL A;  1O6X A;  3TX8 A;  3UE2 A;  1OPI A;  3N4W A;  2LU1 A;  4YME A;  3GIJ A;  4R8U B;  1UVM A;  4E8U A;  1RXO B;  4C98 A;  2V69 A;  3VGV A;  3WDO A;  3MUR P;  5L46 A;  1R8C A;  2MSS A;  2RE1 A;  4ZLL A;  4M5D B;  1FNO A;  3SDE A;  3PKY A;  1RAJ A;  5HI7 A;  4ED2 A;  3ENW A;  2PC6 A;  1RIS A;  2HRU A;  2MPU A;  3I96 A;  3CMA S;  2XZD B;  1C0U B;  4TLQ A;  2DIU A;  2HND A;  1JLC A;  4OHW A;  3R7B B;  3FCH A;  2BM1 A;  1QAI A;  5KG2 A;  2PMW A;  4ZK7 M;  2R7Q A;  4JI1 F;  5JVH Q;  2KT2 A;  2HVZ A;  2OPS B;  3C19 A;  4F4W A;  2HZA A;  5HAT A;  5D3G B;  1V5I B;  2ZFH A;  1V9O A;  2D41 A;  4GO7 X;  4NE9 C;  1VQO S;  2R8H A;  4J9L A;  3LOU A;  4RW6 A;  1FXR A;  2FZK B;  1VK8 A;  1R0A A;  4NEZ A;  2MKY A;  2HQG A;  2J9C A;  3BSC A;  1CJV A;  1ZPV A;  2ZBC A;  3IS9 B;  1F2H A;  2KKH A;  4M8L A;  2ZH7 A;  1NJI T;  4RWW A;  1JLA B;  3G8Q A;  2PN6 A;  3GTY X;  2DGT A;  1FK9 B;  3PO5 A;  3PW2 A;  2AEJ A;  2I9S A;  3W2W A;  2H5E A;  4C9D A;  4KFB B;  3HFK A;  5AT1 B;  1SJ1 A;  3POT A;  2CPD A;  4EBD A;  1R6Y A;  4O0I A;  1ZET A;  1I94 F;  1HNZ J;  1NPP A;  1RTJ A;  5CH7 B;  5C42 B;  2DNQ A;  3MM7 B;  3NLC A;  3R8Y A;  4A8S A;  4B3T J;  1BE4 A;  1HPZ B;  3NNH A;  3MDF A;  4DV0 F;  1UJ4 A;  5LSL A;  1JJH A;  1SL2 A;  1N52 B;  1WC0 A;  2YBV A;  4L74 A;  2OMO A;  5BR8 F;  4LUB A;  4GKK J;  1R7I A;  4CM0 A;  1I5O B;  3OHB A;  1VHF A;  4ZA1 A;  2VZ9 A;  1XK8 A;  3MCO A;  3IP0 A;  3M9O B;  4I2P B;  4JI5 J;  1UET A;  4R5P B;  3DOK A;  4DR5 F;  4YB5 A;  3DN9 A;  3HPO A;  4DUT A;  1QAJ A;  1REV B;  5HQL A;  2HEK A;  1XNR F;  1VRT A;  2C42 A;  1WNE A;  3UD5 A;  3QT8 A;  5GAE I;  3I56 S;  3CDE A;  2ABY A;  1FVS A;  3UFC X;  4EUV A;  3J7Z 5;  1B70 B;  2P9G A;  3V81 A;  1U0H A;  2B9E A;  2OSR A;  4NLQ A;  4M5J A;  4LMZ A;  1R8A A;  2CNO B;  2GQQ A;  2HKE A;  1UVK A;  1Q1K A;  2WAQ D;  4RNF A;  4J9P A;  3E01 A;  2M7S A;  5A0Y A;  1HW9 A;  1ZPW X;  2ZUA A;  2FVC A;  3TAR A;  3G82 A;  2DGQ A;  2VC0 A;  2FHJ A;  2HNY B;  5LSO A;  4L75 A;  2VG6 A;  1UA1 A;  1IM4 A;  3U1N A;  3D67 A;  1TKX B;  2YWK A;  2JEF A;  1K0T A;  1FXD A;  1T02 A;  2ZKT A;  3GE9 A;  2H4W B;  5LT5 A;  3TZZ A;  4NYZ A;  4OHX A;  2JEJ A;  3MFH A;  3G71 S;  2MZJ A;  3ETO A;  4PUO A;  3K58 A;  1S9E A;  4C0H A;  2PE8 A;  3VAI A;  2CPE A;  1HI1 A;  3VVT A;  1KOH A;  3OL6 A;  2CUY A;  4B3O A;  4BS2 A;  1RA7 A;  2R7O A;  3HHD A;  4WPA A;  3K57 A;  4ZP9 A;  1JXL A;  2V9W A;  2P6T A;  3CDU A;  4J9Q A;  3B8H A;  4XTT A;  4ZVT B;  4DG1 B;  4Q8F A;  4DPX A;  1RTD A;  2CDR B;  3CDA A;  1T9Y A;  1E6Y A;  1AZS B;  1RU2 A;  2JLE A;  3KKF A;  5KFD A;  1HBM B;  2CAD A;  2A18 A;  4PPZ A;  2OLW A;  3MM9 B;  4NLR A;  1VMB A;  2G0I A;  2IRU A;  5A76 A;  4CO1 A;  2XWY A;  1GXT A;  2IRY A;  3AAW B;  5HVG A;  4CH1 A;  3V4M A;  2MJN A;  2CZV C;  1SIZ A;  1UFW A;  3AOD A;  3QLH A;  5KOW A;  4P7T A;  4IDK A;  2RDD A;  2J76 E;  3UQS A;  4NLG A;  4LF9 F;  4DS4 A;  4CWB A;  1NAQ A;  4JYA F;  4K4S A;  4OZ2 A;  4WP3 A;  1U48 A;  1PKU A;  4KGZ B;  4DX6 A;  1HW8 A;  3UN5 A;  4ILL A;  2PO4 A;  4P10 A;  9ATC B;  5AE3 A;  3JYT A;  2BW2 A;  2R2S A;  1CUL A;  3I0R A;  1YBA A;  1G7C B;  2MZR A;  4HYK A;  2CKW A;  3M8R A;  3CME S;  3KUE A;  3NBP B;  1D1U A;  4TYB A;  4LRA A;  3GV5 B;  2AHO B;  3E3X A;  3TEG A;  1HKA A;  4QCL A;  2GV1 A;  1Q8I A;  2PEB A;  1PJ5 A;  5MLC V;  1T03 A;  4F3M A;  2HND B;  2L9N A;  3HSJ A;  3SSQ A;  4GC6 A;  1RWX B;  3MMB A;  4I69 A;  2DEI A;  3IGN A;  3FC9 A;  2VFT A;  1VOM A;  1Q8K A;  2EBG A;  2W24 A;  1JJC B;  4USK A;  3GON A;  5HBM A;  4ZKA A;  1NB7 A;  2XMJ A;  1U6B A;  1YBT A;  2ACM A;  2MY8 A;  3AA9 A;  2ROE A;  1OY9 A;  3M2R A;  5A8W B;  3J7Y I;  4ER8 A;  3ILJ A;  1NUE A;  4OX6 A;  2CQC A;  2RDJ A;  1S49 A;  2IDE A;  2IJF A;  4ELU A;  4Y0F A;  1YIT S;  2WK4 A;  3US5 A;  1B3T A;  1FJC A;  2E9T A;  2VU5 A;  1HNV A;  4H4K C;  2QA1 A;  2Y1R I;  3H4D A;  1F9E B;  4BCA A;  2HS4 A;  3TNV A;  2XS2 A;  4NI2 A;  4DF4 A;  4FBU A;  1WOR A;  3Q22 A;  3MPU B;  2RML A;  1FRM A;  1SV5 A;  4USM A;  4OI2 A;  2AGO A;  5CXT A;  3MXH P;  3D66 A;  5F8H A;  1RAB B;  1H7W A;  1XN9 A;  2E5J A;  2OPS A;  4MAK A;  1L3U A;  2XMT A;  2NXN A;  1EET A;  2EI5 A;  4P2S A;  2JWN A;  1PG5 B;  2QSF A;  4NI2 B;  1WSR A;  3PXG a;  1KBR A;  2V4R A;  4MKB A;  4HTI A;  4WCE Q;  2DH9 A;  3TUZ C;  5E0O A;  2ZJR Q;  4ZP7 A;  5DDP C;  3T1H J;  1U1K A;  3OTO F;  3D6F B;  1YRX A;  1T03 B;  2HAF A;  3ZZZ A;  3MUM P;  1SC3 B;  2BJ1 A;  2FJA B;  4IKA A;  2WSC C;  2XNQ A;  3S6E A;  3HM9 A;  4DSL A;  4PXC A;  3W7B A;  1APS A;  2HZV A;  2DR9 A;  1CJT B;  2RDI A;  3IMQ J;  3CJ4 A;  4KKO B;  3OXL A;  1HHQ A;  1CQM A;  4ES1 A;  2K1R A;  1UEV A;  2IM1 A;  2FLL A;  3ELH A;  1WHV A;  2J0W A;  3CB4 A;  1EAY C;  4IFV A;  5B0E A;  4USV A;  3G8T A;  2X1G A;  3JQK A;  3Q23 A;  2LQ5 A;  2JLG A;  4LFC J;  2NLW A;  2XEX A;  1M1G A;  3U1L A;  4CH7 A;  4CTA B;  2MZQ A;  5C2C A;  1WKK A;  2VQE J;  3EVO A;  4OYX A;  1UZD A;  1XEZ A;  2MQ8 A;  4DPT A;  1UZH A;  2C3Y A;  2VF3 A;  2MHN A;  2RQC A;  1ZS6 A;  4B3R F;  2OML A;  2ZWP A;  3HHE A;  2HFZ A;  3PIP Q;  2W7O A;  4DV5 F;  2WVE A;  3CJR A;  4M5N A;  1HFE L;  2DNK A;  1OWX A;  4NLS A;  2CQ0 A;  4FYV B;  4X4V A;  5D0G A;  3CCV S;  4K4V A;  1WKJ A;  4PYD A;  4ZP6 A;  1H0H B;  1GMU A;  1TL5 A;  3TYT A;  3EDR B;  2Q79 A;  2K7K A;  2DNN A;  5C5J A;  4IDK B;  1T3N A;  1HI0 P;  4OLP A;  4ZVO B;  2MDA A;  2XI3 A;  4OFZ A;  1NHK L;  1B7F A;  1RHQ B;  1NJW A;  2WRM A;  1HD0 A;  4LF1 A;  4G1Q A;  2RQK A;  4I64 A;  4C2M A;  4XDC A;  1NDP A;  3JSM A;  4R5P A;  4LFA J;  1ZH5 A;  1L5U A;  1F6T A;  4PG8 A;  3OTB A;  1U2F A;  4W4M A;  4KGK A;  2DHH A;  4FDF A;  3P49 B;  1H2U X;  5HQ8 A;  2LEC A;  1M5H A;  1U8W A;  4KGX B;  4ZJL A;  3GFX A;  2OD4 A;  2QN6 B;  2WB4 A;  3RBD A;  1HQE A;  2Y0B B;  2IMO A;  1QUV A;  3C16 A;  4HR2 A;  1A7G E;  2CJQ A;  3QID A;  2GNK A;  4TQR A;  2OFH X;  5KG5 A;  2ZOG A;  2DH8 A;  3T5K A;  2EFO A;  5L1J A;  5J2Q B;  1U1R A;  1SCJ B;  3NG8 A;  3DLJ A;  1WC4 A;  2BM0 A;  3O8W A;  5CYM A;  5SZT A;  4F2S A;  3K8V A;  4DOZ A;  2ZVS A;  2XMU A;  2AYB A;  4NOH A;  2MST A;  1FEH A;  3W1Y C;  2W2N P;  3DRP B;  3PHE A;  2V5H G;  1WUU A;  1MRO A;  4ES2 A;  5AE1 A;  2WB1 D;  1QSS A;  1XER A;  2NQP A;  1W26 A;  3QBC A;  5CQG A;  1NXI A;  2KRR A;  2DRB A;  5KG3 A;  1GMW A;  4ECS A;  3I82 A;  4LR7 A;  3I55 S;  2FY1 A;  3G87 A;  5G0R A;  4HKQ A;  2GFF A;  3HHK A;  2V94 A;  1S0V A;  3DXS X;  4XK8 C;  3NS5 A;  2Z57 B;  1MRO B;  3D68 A;  3TQE A;  3H98 A;  5CCL A;  3LO3 A;  3MCN A;  3K5N A;  4B3R J;  1QUP A;  5A8R B;  4WII A;  2P6S A;  1DQ8 A;  1UW9 A;  4UZC A;  5B0G A;  4OYM A;  1HPZ A;  1EP4 A;  1FDD A;  3TEH B;  3LA0 A;  4RU9 A;  4LSL A;  5ADZ A;  1WHY A;  3VAG A;  2QMW A;  2MEW A;  1JLB A;  1WD6 A;  2IYG A;  3B54 A;  3KJQ B;  2YNF A;  4OLO A;  4XDD A;  4ZVF A;  1OS5 A;  1V3R A;  3BSA A;  1DTT B;  2L41 A;  2XGP A;  4JI5 F;  1ZZF A;  3K59 A;  1ICE B;  3OFH A;  1HWI A;  2DCU B;  4F7V A;  4DV1 J;  4A8W A;  4G1P A;  1O8B A;  4UUW A;  1FI4 A;  1FRL A;  4C8O A;  3NNA A;  2AJQ A;  4F0H A;  2V6A A;  4WU3 A;  2YX7 A;  4DV0 J;  4LIW A;  5KT6 A;  1Q82 T;  4HT7 A;  1FNM A;  5LOQ A;  3TI0 A;  1VI7 A;  2QGF B;  1SC4 B;  1R8H A;  4C8Y A;  2F3J A;  4O44 B;  4PAA A;  4JI7 F;  3L3C A;  4FYW B;  1I94 J;  1RAO A;  2C2Z B;  1YBU A;  2M70 A;  3LGM A;  4U7U K;  3WX8 A;  4L3K A;  1D9D A;  3QMQ A;  5DDR C;  1X9W A;  4Y3C A;  2V8H A;  4IQX A;  1S9G B;  1V3S A;  1UWB A;  1UWA A;  2DCL A;  2X7I A;  2UVR A;  2BKP A;  2RVJ A;  3MM6 B;  2MZS A;  1RT3 B;  2AJ2 A;  3HK2 A;  5F8M A;  2CQ2 A;  2QC3 A;  3DMJ B;  3I32 A;  4DV7 F;  3PW7 A;  2I0X A;  3LAM A;  2UXC F;  4QWB A;  3SDE B;  5KFP A;  2NPF A;  1H73 A;  3BPD A;  3SCI E;  3WHI A;  3W61 A;  4LQ3 A;  2M0G B;  2ZUG A;  3G6E S;  3IO1 A;  5HBM B;  3VAK A;  5JJB A;  2YH1 A;  3BRE A;  4OYO A;  4UOH A;  1VQM S;  3H4B A;  3PY8 A;  1T94 A;  5B0F A;  4TU9 A;  4KRW A;  4FYD A;  3JQM A;  4QYZ J;  2R7S A;  1GXL A;  2YNI A;  1Q7Y T;  3FBC A;  1VCT A;  3HXM A;  1HQU B;  2UUW A;  2VBW A;  4I0W A;  2XG8 A;  1IBC B;  2Y1L B;  4R8U A;  3J7Y U;  5AXM A;  1BY9 A;  4LBI A;  2VKR A;  1SKR A;  1EIY B;  2OFG X;  2DK2 A;  5BXI A;  2BJ3 A;  4DU7 A;  3D2W A;  4IOC Q;  4OYB A;  3L09 A;  1FES A;  2OPR A;  1RWN B;  2W8K A;  5KFK A;  1NK7 A;  1VGY A;  4J9U E;  4C11 A;  4LF7 F;  1TKZ A;  5F8I A;  1FWP A;  4P52 A;  3DCA A;  2R7V A;  1H2T Z;  1YJV A;  4IH7 A;  2HS0 A;  4A8Y A;  3GSI A;  2OH2 A;  1I51 B;  1S6Q B;  4Z7C A;  4F8R A;  4MT1 A;  5ETP A;  3KLF B;  4IG0 B;  4WE1 B;  1GEH A;  1KTQ A;  2CA9 A;  2XI2 A;  3Q8S B;  3OFF A;  4K4Y A;  4LF9 J;  2F4F A;  1T9W A;  2G1D A;  5A2Q Y;  3ZTO A;  4H4K A;  4LF5 J;  2ATC B;  4JI2 F;  3Q8R B;  4LF7 J;  3H5Y A;  4CO3 A;  2ZD1 A;  4GO5 X;  3D1H A;  3ICL A;  5C24 B;  1FWK A;  4FF4 A;  2HZC A;  2GAG C;  1HI8 A;  2V34 A;  1RCX B;  2YNH B;  3AT1 B;  5KT3 A;  3C14 A;  4IFY B;  1DJ0 A;  5KFS A;  3BO2 A;  4H4M B;  4N8N A;  1KR4 A;  3QGG A;  1W25 A;  1LFP A;  3CJ2 A;  3HCX A;  4KY3 A;  2IA0 A;  3RYL A;  1QTM A;  3VAJ A;  4IYQ A;  4PG7 A;  4USH A;  1RTH B;  2GC8 A;  5D77 A;  3VWS A;  4PEO A;  4C3K A;  3MAA B;  3C6U B;  2VOD A;  3LAK A;  1SVD A;  4MIW A;  2P9C A;  1BWV A;  3IC1 A;  3VCD A;  2ZD1 B;  1KFD A;  4JOU A;  2MMY A;  2VJV A;  4ECQ A;  4ICL B;  2HHH J;  3BYP A;  2HIQ A;  2DNO A;  3D6H B;  4EYI B;  6FDR A;  3TJ9 A;  2E5H A;  1VS3 A;  2GMH A;  1MNE A;  3OTE A;  1VIX A;  2ZOM A;  4I6Y A;  4MKA A;  4CLZ A;  1MMD A;  3CC7 S;  3ZZU A;  2CQ3 A;  1UA0 A;  2RKI A;  3NGS A;  1HBU B;  5FDL B;  1X4G A;  3CJ8 A;  1DQA A;  2EFP A;  3U02 A;  1MU2 A;  2JC0 A;  4Q0B B;  3TUJ C;  1AYE A;  1N5Y B;  3NMR A;  2ZC3 A;  4USW A;  4RNM A;  3CCU S;  2HWI A;  3A3P B;  3DRS B;  4FKY A;  2WSE C;  5E5N A;  3L7O A;  3PX4 A;  1NM2 A;  1T7P A;  4PWD B;  3M8Q B;  5A6P A;  5B0C A;  2UV8 A;  2DVI A;  5FII A;  4V1A k;  4W98 A;  2AJF E;  4RUH A;  2J6S A;  3B4M A;  1XMO F;  2DNY A;  3LAL A;  4F3O A;  1QVF R;  4CCH A;  3QO9 B;  2IVM A;  3K8W A;  3BN7 A;  2AW0 A;  3CNQ P;  3DKD A;  4ILR A;  5IS2 A;  1R43 A;  4B9T A;  3KK2 A;  2HQ3 A;  5KFR A;  2J6T A;  3KNA A;  1TUW A;  4RX6 A;  2KU7 A;  1WEX A;  1FRK A;  1AFJ A;  1HBM A;  1S1X B;  1SIW B;  3P8B B;  2KFY A;  1FXL A;  4DV1 F;  1YI2 S;  4F3Q A;  4RR5 A;  5F41 A;  2R8I A;  4ZP8 A;  5IWA J;  2HQC A;  3GII A;  2XHC A;  3MM5 A;  4JYA J;  4X62 J;  4K59 A;  2D3O R;  4Y2A A;  2GVZ B;  2HRT A;  4QR2 A;  1Y5L B;  2V63 A;  3K5P A;  4NML A;  2V68 A;  2I8E A;  4ECV A;  2WVD A;  1HBO A;  3C66 A;  2FIU A;  2IHR 1;  3OJS A;  2QA4 S;  4J9M A;  4PWU A;  1QLN A;  2OPQ B;  3R7N B;  1F1B B;  2M2B A;  1X9M A;  2WSF C;  2RRA A;  3TQ1 A;  1QM9 A;  3PFE A;  2PD1 A;  1VRU A;  4DPY A;  1SXL A;  1N5T A;  4O0N A;  2GA7 A;  3UWT A;  4CI0 B;  4JB8 B;  2RUS A;  1X60 A;  2E7V A;  3BGL A;  3D0G E;  1XNQ F;  2LYV A;  5E2Q A;  2KXN B;  2HHP A;  4B9M A;  1RAD B;  3RRK A;  5MAO A;  1WAC A;  1S0M A;  1BXN A;  3IM8 A;  2VON A;  4A8K A;  2ZDO A;  2CVI A;  4JI1 J;  2RT3 A;  4DX5 A;  1WI8 A;  5IZH A;  2AP6 A;  2WCX A;  3H2L A;  3V6D A;  4JI3 F;  1U1L A;  1C1B B;  3I5B A;  1WOS A;  2DEJ A;  4RW9 B;  2DRD A;  5B7W A;  4Q43 A;  1LV5 A;  3RR7 A;  1F5B A;  4M5D A;  2GX8 A;  3T5L A;  1JKH B;  1N36 J;  2C28 A;  4DJB A;  4NLP A;  2IM2 A;  3KLI A;  1M0S A;  9RUB A;  3SQO P;  2G9O A;  2EFN A;  5CCM A;  1RDR A;  2E1P A;  4ED7 A;  3Q8Y A;  3WX4 A;  4XPE A;  3RRH A;  2FJV A;  2MZ1 A;  3U7J A;  2B5J B;  3M2U A;  3MWB A;  4DR7 J;  1JMT A;  3S1T A;  2ZVI A;  2D7S A;  2LQB A;  3QO9 A;  2CJB A;  1BQM A;  1JIH A;  1FT8 A;  2JX2 A;  5E3A A;  4OIX A;  1JKH A;  2XO7 A;  4WKY A;  1NKB A;  4Q8E A;  4YUD A;  2VFS A;  1FFW B;  1VRU B;  3PTW A;  4YR2 A;  2XMV A;  1VQ8 S;  3GCX P;  2FY8 A;  2ADB A;  4FBT A;  4ZPV R;  1EZZ B;  2HWH A;  2OTJ S;  4ENO A;  2HUR A;  3RBX A;  2V4Q A;  3RB4 A;  4CNY A;  2RD5 C;  3PEH A;  4OHZ A;  1VQP S;  3S7R A;  2YKN A;  1S99 A;  5J2M B;  3DLL Q;  5LSR A;  5I42 B;  1WHW A;  2C2D A;  1UKU A;  4USU A;  4K4X A;  4BDP A;  3QAE A;  2E5L J;  1UJ5 A;  4AND A;  4DUY F;  4DV5 J;  2FC9 A;  2O66 A;  4GKK F;  1PBA A;  3MED A;  3W2V B;  3PIO Q;  2FGC A;  4ANE A;  2CWK A;  3EJM A;  2GAH C;  5ETO A;  1ROF A;  1RAC B;  3KJV B;  4FF3 A;  4QWC A;  1TUG B;  4UOF A;  4ECU A;  3GYG A;  5EDW A;  1TK8 A;  3CCT A;  1PYS B;  1S7H A;  3PM9 A;  3C46 A;  2X1F A;  1N8R T;  4LRF A;  3AH6 A;  2KT5 A;  1NPR A;  1QDU B;  4A8F A;  1NDK A;  5KFY A;  2RSQ A;  4MJK A;  1AA1 B;  2YKQ A;  5IOL A;  3T1Y J;  3DLG B;  3JSM B;  2LXU A;  1DLO B;  1KQG B;  4DF8 A;  1V6H A;  2ZE2 B;  4NLX A;  3KYL A;  4MK9 A;  3AOB A;  1TL1 B;  1WKL A;  2QYG A;  5CHC B;  3D7S B;  3SSS A;  4DFM A;  3FQL A;  2VUG A;  1C4A A;  1WSV A;  4ECY A;  2Y1J A;  2RIL A;  1U1M A;  3QYY A;  1B64 A;  5F0U A;  1HBU A;  2VKZ G;  4IQM A;  2PA3 A;  1Q8B A;  3OTO J;  3M30 B;  3BO3 A;  2YWF A;  2LVW A;  3NGR A;  3FKB A;  3QAT A;  1T3O A;  1Y00 A;  3PYG A;  3GV8 B;  2AV5 A;  2NSC A;  4QU7 A;  1LEO A;  2XY6 A;  3NP5 A;  5F9L A;  1U02 A;  4X2B A;  3BKT A;  1TZ0 A;  1VBK A;  3VGU A;  3TVK A;  4MFB A;  3TAQ A;  1YVF A;  3AY0 A;  3H5U A;  3NKY A;  5HMZ A;  3DHW C;  3KHG A;  2E5G A;  2C3P A;  4ED1 A;  2AGP A;  1DRZ A;  1ZA1 B;  4GKJ J;  4C7Q A;  2R3V A;  3CJS A;  1FJE B;  1TL1 A;  4EO8 A;  4ICL A;  4H4M A;  4Q44 A;  4QIF A;  1K1S A;  2DNP A;  4RBV A;  2RUG A;  4RW4 A;  1GFW B;  4CZC A;  3EPG A;  1HLW A;  2FJX A;  2AT1 B;  2NCK L;  3CO9 A;  1LK5 A;  1DUR A;  4P2F A;  3NY0 A;  4CTA A;  8RUC A;  4URS A;  5F3Z A;  5EHH A;  1RTH A;  3FGV A;  1J5O B;  4DSI A;  3M7V A;  2ZE2 A;  1M90 T;  1CS4 B;  3D0I E;  5HRO B;  4IO9 Q;  1PC5 A;  1RQ0 A;  3N79 A;  3BM7 A;  5KFG A;  5D8H B;  2N3L A;  1BUX A;  2H48 B;  4WE1 A;  1CJT A;  3EDQ B;  1T8E A;  2ZJP Q;  2KG0 A;  1N5Q A;  3UDV A;  4FF2 A;  3I87 A;  3X1L B;  1P27 B;  2DB1 A;  3SXL A;  2WZ1 A;  3M9M B;  4C8K A;  1Q7L B;  2UXD F;  1AUS L;  4YS2 A;  1VLO A;  2VBX A;  4YEA A;  1FCA A;  1H2V Z;  1OQ3 A;  1U25 A;  2CPH A;  3IBF B;  1NB2 A;  2V2Q A;  3BQ0 A;  1Y7P A;  3ENV A;  1FE4 A;  1TVR B;  2QMX A;  1RAG B;  1UAW A;  2MKK A;  3N5B A;  3VAL A;  2MB0 B;  2R8K A;  4PQU B;  3H42 A;  3NXZ A;  3F44 A;  3GFY A;  3HZE A;  3DYA A;  4OJ1 A;  3NOG A;  2XGQ A;  2DGO A;  3THT A;  1HQU A;  1LWX A;  1NZA A;  2W7A A;  2HVH A;  1ZM2 A;  3UVJ A;  2WTF A;  4FF1 A;  2K3K A;  5AXK A;  3MM8 A;  2MKS A;  5M2R A;  1LOU A;  3MFI A;  3SIP B;  4MYT A;  3PYE A;  3QT5 A;  2CQH A;  4ZVQ B;  4C11 B;  3VAF A;  3FVY A;  1RT1 B;  2XZT B;  5J2M A;  2NUU G;  3ZZ0 A;  5A8K A;  2HHS A;  3SMZ A;  5KFU A;  4WBF A;  3WIV A;  2YWH A;  4K4T A;  1MG7 A;  4DV3 J;  3HVW A;  4PKD B;  4ECZ A;  1NSQ A;  3HLU A;  2OP5 A;  3DU5 A;  4NLY A;  1Q95 G;  3NWR A;  3ZZO A;  4RJV A;  3BKF A;  2V2K A;  3DM2 B;  2K8G A;  2X3G A;  1RBO B;  3FEX B;  1CC7 A;  3A8K A;  4MMO A;  2LQJ A;  3CJQ A;  4AL5 A;  1RWV B;  4DR4 J;  4YB6 A;  2FJW A;  2BMB A;  4OZ3 A;  3GB0 A;  1SKU B;  2AU0 A;  1FKP A;  1H7X A;  3MUV P;  2KHD A;  3HVT A;  3V6K A;  3PW0 A;  4JI6 J;  1UEU A;  1DTT A;  1IQT A;  2R9L A;  3B6B A;  4ILM A;  3JYT B;  1X5P A;  2AEF A;  2CJK A;  2HVD A;  1JLG A;  2DD8 S;  2FZG B;  2HBQ B;  3DRX A;  5GAD I;  1K0V A;  1YLX A;  3LP0 B;  2GHW A;  2YNG B;  3V6H A;  1FTR A;  1KQF B;  4KC5 A;  1VQY A;  2BBE A;  2JOQ A;  5I3Q A;  1XMB A;  3J81 U;  2J0S D;  4X4T A;  2HIY A;  2W01 A;  1TL7 A;  3BYR A;  2YQ0 A;  3EGV A;  3UW1 A;  5KFL A;  5B0D A;  3J80 Y;  2MGZ B;  2XSJ A;  3OVS A;  1CBK A;  4DN0 A;  2ZM6 J;  4JI7 J;  3HVA A;  4Z2X A;  1UFL A;  4U95 A;  2H4Y B;  5G0R B;  1XNR J;  5F0W A;  2F8M A;  4NCG B;  2JVR A;  4AYB D;  4JI4 F;  4PUO B;  3R6L B;  2B51 A;  3KLG B;  2V8V A;  1BC6 A;  6AT1 B;  4Y2M A;  3NWG A;  3VR1 A;  3UNG C;  1LQ9 A;  3OFE A;  1RU1 A;  2YQ3 A;  5I3P A;  3HHN B;  1CG2 A;  2D69 A;  2Y3Y A;  1IKX B;  4Y34 A;  3GZ7 A;  2D9O A;  3UN2 A;  3PW5 A;  3FMW A;  2MKC A;  4ED0 A;  2YWG A;  1FX2 A;  1S1T B;  5D78 A;  5KFW A;  4AQY F;  1H74 A;  3Q83 A;  4RL1 A;  4AD6 A;  5DM6 Q;  2QRR A;  2VQF J;  2VB6 A;  1N4L A;  1VHI A;  3G96 A;  1X4C A;  2YNF B;  3TP2 A;  5T14 A;  3CO0 P;  3MR5 A;  3UCZ P;  4ELT A;  3K0J A;  1U4B A;  2K3I A;  1G6B A;  1IWA A;  2XO6 A;  4EYH B;  1CLF A;  1FKA F;  1HL6 A;  2GCF A;  2RS2 A;  2B8P A;  2XLI A;  3EE3 A;  2DNR A;  1TL4 A;  1HA1 A;  5J2N B;  4WIQ A;  5KT4 A;  1X5T A;  3N28 A;  2QSW A;  2HVE A;  1HR0 J;  3GR1 A;  3HSZ A;  4ANC A;  5GAG U;  1KD1 T;  4MYU A;  2J9D A;  3C6T A;  3IA0 A;  1G4C A;  5D6G A;  2W2P P;  3OXF A;  4JI6 F;  2UUA F;  3OUY A;  3W62 A;  3S8S A;  4C8L A;  3U1M A;  5D0R A;  4JV2 A;  2N7Y A;  4WTO B;  4OZ0 A;  2H51 B;  5EX3 A;  3CCR S;  3MOJ B;  2MQP A;  2OPQ A;  4KQZ A;  4ZPD A;  5JVG Q;  1NCL A;  2LA6 A;  4P9S A;  4DQR A;  3R5A A;  4DL6 A;  1EKR A;  2CPZ A;  1RAH B;  2RAQ A;  3C14 B;  3P3D A;  2VC1 A;  2XYP B;  3HD2 A;  4IFY A;  5ETN A;  1XTZ A;  1YKW A;  4DV3 F;  2GHP A;  2MLY A;  4ECW A;  1YJU A;  4A8X A;  4ECT A;  2E5I A;  5EX0 A;  2XLK A;  2GJI A;  3KG4 A;  4NX9 A;  1TFW A;  2N4D A;  3DU6 A;  3A8J A;  1GAO A;  2I5J A;  4OI4 A;  3TJA A;  4DCO B;  5J2P A;  3P96 A;  2J6U A;  1URN A;  5J1E B;  5HLF B;  1PIL A;  1XR7 A;  2GQ2 A;  2POK A;  3O44 A;  3KLF A;  3G2X A;  3BDP A;  4A46 A;  3W9I A;  3G9C A;  4N8O A;  3N5F A;  1A9N B;  2B7B B;  2UVW A;  1R3N A;  3KG1 A;  3SV3 A;  2DHX A;  1M1H A;  1X31 C;  1SV5 B;  1SC1 B;  4ZPW R;  5GME A;  3OR2 B;  4D3G A;  2GIF A;  4CT9 A;  3GIL A;  3FZB A;  4IH6 A;  5IC6 B;  4CLU A;  5C24 A;  3AJ1 A;  3BV8 A;  4WWS A;  2BVZ A;  3NGU A;  3TR5 A;  1X0P A;  3DRS A;  2ZNY A;  1WC1 A;  3Q86 A;  5DET A;  4RW7 B;  1JQG A;  1LW0 A;  1N88 A;  1TUV A;  4NLD A;  3R5B A;  1NME B;  3CCE S;  1M5S A;  1TKZ B;  3TAM A;  2YX4 A;  4ID5 A;  4NLT A;  3KLH A;  3PV8 A;  2C3U A;  4IG0 A;  1OY6 A;  2XY5 A;  3CJK A;  2CJX B;  5J1N A;  4I67 A;  3HHL D;  5E3P A;  4CO0 A;  1AB8 A;  2XSF A;  2VDI A;  3ILI A;  4MK7 A;  3TZW A;  1SJR A;  2EEY A;  5K9F A;  4WK3 A;  2K06 A;  4WU2 A;  1EAR A;  1NEE A;  4WFY A;  4EK2 A;  4KPC A;  2DT9 A;  3HHL B;  3WZ0 A;  2M88 A;  1JNR B;  3HI9 A;  3CJK B;  4YB1 P;  1PC4 A;  2UV8 G;  3I0S A;  1MW7 A;  2WBR A;  4LIR A;  5M2U A;  4UT4 A;  2E1A A;  1FTC A;  5BYR A;  3QRQ A;  3P6Y C;  3M1V B;  2IMW P;  1WEL A;  2C2N A;  1RP5 A;  3MGJ A;  1LW0 B;  3KJV A;  3TOQ A;  1CJU A;  2QEX S;  3F56 A;  2QJ3 A;  4LBH A;  2UXC J;  3PCO B;  5E7O B;  2HLU A;  3OJU A;  3M8Y A;  3QNW B;  4F4A A;  3A1Y G;  4KO0 B;  1EET B;  3T41 A;  1YJ9 S;  4WFN Q;  1JWW A;  2FTR A;  3PZP A;  2Z2M A;  2CG4 A;  4B17 A;  2W4D A;  3CGI A;  3D9B A;  4TY9 A;  3H5S A;  3M2R B;  1T9X A;  2YKN B;  3M9N B;  4HHJ A;  3KLH B;  3CCL S;  3R27 A;  1KOO A;  1Q4R A;  1UJ6 A;  3MM9 A;  1Z2Z A;  3QSI A;  4BLG A;  2XLJ A;  5DGA A;  1HNV B;  1TK0 A;  3T5J A;  2AZ1 A;  1IBL J;  2PDA A;  3FCW A;  4FVC A;  2OEM A;  3I5C A;  1HBN B;  1RTD B;  1T95 A;  4FN5 A;  2XM3 A;  3Q0A A;  1VK3 A;  3RW6 A;  1T9U A;  2HFU A;  4GVB A;  1IWG A;  4IH5 A;  2U2F A;  4O3S A;  2LU2 A;  4KT0 C;  4X66 F;  3OSN A;  4V19 J;  6FD1 A;  3M05 A;  4ZCM A;  1K9M T;  4DX7 A;  1NJZ A;  2O3D A;  3T1Y F;  5SUH A;  3I0R B;  1TAQ A;  1RT2 A;  5J1E A;  1R8P A;  3LF0 A;  5E33 A;  5HMW A;  5HVH A;  3BEG B;  2DRA A;  2OD6 A;  1C1B A;  2YWW A;  3NBP A;  1E6Y B;  3CD7 A;  4CLK A;  3RB3 A;  1L3K A;  2EFG A;  1BWE A;  2LEP A;  4DLG A;  1WC5 A;  2H54 B;  3KDO A;  4U8Y A;  3QIP B;  4EGL A;  3R5C A;  4Y2I A;  1IXK A;  2J5A A;  5RUB A;  2VA2 A;  2R2T A;  1S1W B;  3RBE A;  3BS9 A;  3PO4 A;  4IOB A;  2X1B A;  1JLB B;  3FRZ A;  3OVA A;  2BDP A;  4HH1 A;  2VFU A;  3LUY A;  1WTB A;  4OI0 A;  1FX4 A;  1H6K X;  2PMH A;  1SJQ A;  4N56 A;  1RT3 A;  2BOP A;  1UVL A;  1D09 B;  2C3O A;  3W65 A;  2GGP A;  3AD9 C;  1S48 A;  1UMJ A;  1YRT A;  3BGO P;  3MD1 A;  3SYZ A;  1FRI A;  1KNZ A;  2CZ9 A;  1NKC A;  4Z7Y A;  1EP4 B;  4UUX A;  3V6J A;  1EJ7 L;  3N9U C;  3C6T B;  5L1I A;  5L9N A;  2W9B B;  5ETS A;  2F65 A;  1KN6 A;  1KVI A;  2CIM A;  4Y00 A;  5FLX Y;  5LMN J;  3BR8 A;  2QO3 A;  3MR2 A;  2ALZ A;  4M95 A;  2CXE A;  3LQV A;  3MTK A;  2RQ4 A;  1JJ4 A;  3L9Z A;  3MAQ A;  1VQN S;  5DO2 A;  3TAP A;  5DM7 Q;  2DTJ A;  1S76 D;  1NRK A;  4F4X A;  2FLN A;  4HEA 9;  1RAF B;  4RKU C;  4RLE A;  2JL9 A;  4FPI A;  4MH8 A;  3UO0 A;  3DI6 A;  2A3J A;  2B4P A;  4JI3 J;  3BPS P;  4B3M J;  1SKS A;  3ITH B;  1IBM J;  2W9B A;  1REV A;  3W64 A;  2UXD J;  1VQ5 S;  1IM6 A;  1CC8 A;  1IR2 A;  5HAO A;  5CYM B;  4K5R A;  2OJ3 A;  4DSJ A;  1LNQ A;  4I2P A;  2ERR A;  1J5E F;  1Y10 A;  1CJV B;  3TO8 A;  1T9T A;  5EWE A;  4QBU A;  2KT3 A;  2YKM A;  2DPJ A;  5LL6 d;  4KGM A;  3OL7 A;  4EBE A;  4ZOS A;  1ITP A;  1HQE B;  3W9H A;  4OZJ A;  4RBU A;  4YFU A;  4EFA C;  2ZKU A;  4OJG A;  3CJ0 A;  3G82 B;  4WJB A;  4ZPA A;  4X4R A;  4DPW A;  4OI6 A;  2FB0 A;  5I4M A;  2ZBP A;  3KWM A;  3KHH A;  4J9N A;  3FSX A;  4WZM A;  2PMZ D;  2E7X A;  3IRX B;  2UXB J;  5BJR A;  2VIC A;  5GAE U;  2DHS A;  2MHE A;  3DLH A;  2NXE A;  4PG6 A;  2I6W A;  4DR3 J;  1DY3 A;  5IM0 A;  4U9R A;  4DQP A;  4X4Q A;  1RHM B;  2W9A A;  1WG1 A;  4AQY J;  4DR5 J;  5A8K B;  4NXM J;  3OD2 A;  4P6Q A;  2XCP A;  2MLZ A;  5HVF A;  3QRR A;  3CF5 Q;  4K4Z A;  3B78 A;  3VHQ A;  3VV2 B;  4Z37 A;  2YXL A;  3F41 A;  3MEK A;  3EZ5 A;  1CSJ A;  1CJK A;  1U6Z A;  1ARO P;  2V8D A;  2WON A;  3A3N B;  4NWB A;  4EO6 A;  5KT2 A;  1NK5 A;  3HJF A;  2AJ0 A;  3ZTS A;  2EVZ A;  2QL9 B;  2V8P A;  3A8E A;  1UCN A;  3R5D A;  3ZNU A;  4X64 J;  3M8P B;  2JEG A;  4HAC A;  3H2V E;  4NAS A;  1XMO J;  3W2W B;  2QIF A;  3AD8 C;  4KAI A;  3SBM A;  2C3M A;  1NK0 A;  4P7V A;  1FER A;  1KSP A;  1NSP A;  3KK3 A;  4WF9 Q;  1S5Z A;  3PG9 A;  3JSB A;  3CXC R;  2OEK A;  5T41 A;  1HQ2 A;  3PAC A;  4C8N A;  5CYQ B;  1FO1 A;  1VQS A;  1BGX T;  4QIE A;  5K14 A;  2PEH A;  4DPO A;  4ZJQ A;  3MPY A;  3J7Z T;  3FUY A;  2VAS A;  3QJL A;  2ROP A;  2DJW A;  2I2Y A;  2R7U A;  2HK2 A;  2K1R B;  5KG6 A;  3M1V A;  1TP7 A;  2DPI A;  1Q78 A;  5KTQ A;  1MSW D;  1NSA A;  4B3S J;  3PYD A;  4RW6 B;  2D1C A;  1R0A B;  1NK8 A;  1CJU B;  3GIM A;  3GMG A;  1F9H A;  3JTN A;  3HVT B;  1RTZ A;  3PYF A;  4O4G B;  5AE2 A;  2GIR A;  4LR8 A;  2B0G A;  2NPI A;  1Y4Z B;  1U8S A;  2QG9 B;  3I0S B;  3FSY A;  1NH7 A;  4RWX A;  1YG0 A;  3BF4 A;  4WP8 A;  2FDN A;  3IBC B;  2YNI B;  1WF2 A;  2HYI B;  1S0N A;  2IBK A;  1VQ6 S;  5KFV A;  2AYG A;  3ISZ A;  1RLC L;  2VFV A;  7AT1 B;  5IT4 A;  2XMA A;  1YJN S;  1X9S A;  2EPI A;  1DZ5 A;  3RU0 A;  3BSO A;  3B4D A;  2PI4 A;  4S0M A;  2W8L A;  2ZH8 A;  2KVQ E;  5F3T A;  1IKV B;  4NLW A;  4K50 A;  2L08 A;  3RB6 A;  4O4G A;  4DQI A;  3BDE A;  1X4E A;  2B43 A;  3EXC X;  3M6V A;  4Q45 A;  2ZJQ Q;  4CLY A;  4M94 A;  1H3D A;  3FMB A;  4LF5 F;  5HMX A;  3AOA A;  3OPK A;  4NXM F;  2GZO A;  4W90 B;  5LM7 E;  3KMQ A;  1FA0 A;  4O3P A;  4CYU A;  2OTL S;  5K5M A;  5JUM A;  4OYW A;  3QZ8 A;  3RR8 A;  2C1E B;  4DR2 F;  3VZI A;  2HHT A;  2LMI A;  3EUN A;  4J91 A;  2WOM B;  3NCQ A;  2Z4P A;  3MMB B;  2NZ4 A;  1GX5 A;  1P9Q C;  2OAU A;  1R89 A;  3UN3 A;  2EFV A;  7FD1 A;  3M8P A;  2KHC A;  5DG8 A;  2R8J A;  2PA8 D;  4I6W A;  3TA0 A;  4LSN A;  1R31 A;  2RJZ A;  4WZQ A;  4XPC A;  1DLO A;  3T3F A;  1TMJ A;  2BAN A;  1QSL A;  2OPP B;  3O5T B;  2JVO A;  4CQ1 A;  2VHG A;  2QL5 B;  2B4O A;  2VDH A;  1RUS A;  2YPZ A;  2MYF A;  4L73 A;  1JXE A;  1EQ0 A;  2XC9 A;  4A8Q A;  3CCM S;  2GW8 A;  4NRU A;  1NDC A;  1F3V A;  1GMW D;  4DG1 A;  5CD4 A;  2F8E X;  1TV6 B;  2GS8 A;  3DDI A;  4M5L A;  3M30 A;  2DHA A;  3OR1 B;  2OSQ A;  3QT6 A;  4RW8 A;  2ZH9 A;  4ELV A;  3HDS A;  1WG5 A;  4DR6 J;  5HRO A;  2FLP A;  2ZZM A;  2BEF A;  2DBB A;  2DGW A;  1IVZ A;  1ZA2 B;  2HFO A;  4M5K A;  4QIW D;  3R2D J;  1MWZ A;  1SQF A;  1HNX F;  2ZH6 A;  1KWM A;  5I42 A;  2BE2 A;  2IVF B;  2EBE A;  3E01 B;  3OUY B;  2AJ4 A;  4WFB Q;  1TKX A;  5BR8 J;  4QYZ K;  2HHU A;  1ZM4 A;  1N6Q A;  3I6P A;  5IT9 U;  1YZ6 A;  1Z4U A;  2KL8 A;  2BX6 A;  2EXU A;  2K2P A;  3FBE A;  5F9N A;  2Z2Y B;  4DLE A;  2JZ5 A;  1U09 A;  4Q2M A;  2OI2 A;  2WHO A;  4C6A A;  1YJT A;  2DGX A;  4D3H A;  5CYJ A;  1KEK A;  5LMN F;  1K47 A;  3FZ2 A;  3M8W A;  2PFF B;  5K8M A;  5L39 A;  1P1T A;  3HKZ D;  3W60 A;  1JNZ B;  2GMJ A;  2B8Q A;  2BW7 A;  3CE8 A;  5DZ6 A;  3OW2 R;  3IM9 A;  2XYG B;  4UOG A;  5KFB A;  3K7R A;  2L9W A;  2YNG A;  2ZNZ A;  4JI0 F;  1VC0 A;  4LQ9 A;  1REG X;  1VR6 A;  2BA9 A;  2M52 A;  4QOT A;  1DHM A;  2P8I A;  3DOK B;  2H9Z A;  2N7C A;  1FKO B;  2CPI A;  2ATL A;  1NLK L;  1ZAV A;  2R8G A;  4FNH A;  2XUL A;  1NK9 A;  4XO0 A;  2UUC J;  3Q2T C;  1WHX A;  3HT0 A;  2W25 A;  3CMQ A;  2A6O A;  2QMU B;  1KHV A;  2A10 A;  5EWF A;  3PR5 B;  3KUH A;  1X5O A;  4OYA A;  4F4Z A;  1YHQ S;  1S72 S;  1F5A A;  1PSD A;  1WF1 A;  5C7P A;  2Y8Y A;  1U1P A;  3GV7 B;  5ETL A;  4OHV A;  3W5X A;  1RTJ B;  2W1B A;  3AOC A;  4UST A;  5C42 A;  4Q5V A;  2UUT A;  1FDA A;  4LVO P;  2DR8 A;  3FJ2 A;  5E3Q A;  4B3T F;  1SUQ B;  3LP1 B;  1U47 A;  2DGU A;  2RB7 A;  4GVL A;  1B7Y B;  2LXI A;  1SH2 A;  2F9J A;  3OT9 A;  4ZCK A;  2DNL A;  1IKX A;  4OJH A;  4LRE A;  3QPI A;  1IJE B;  1TL7 B;  2RF2 A;  2MGZ A;  3A13 A;  3POT B;  3PRB A;  3M8S A;  1AT1 B;  4HHU A;  3R5G A;  1PCA A;  3FRY A;  3KK1 B;  4FVM A;  3VF0 B;  1S10 A;  1IBK J;  2VG6 B;  3GFH A;  3EMT A;  1RAI B;  3WIU A;  4M5M A;  1W7W A;  2AF6 A;  5EGY A;  1FDN A;  4KIA A;  1M5K C;  1WC3 A;  1FFG B;  2R7T A;  3CW2 C;  1N56 A;  3G6V A;  2A0F B;  2LLZ A;  2ADC A;  3N0V A;  4V19 X;  4DR4 F;  3IG1 B;  3JTO A;  3UDC A;  2QFI A;  2AEM A;  1RWO B;  4ZVS B;  3V4I B;  3RRG A;  1JLE A;  5HJX A;  1CVJ A;  1OSC A;  3BN4 A;  3IS9 A;  2LDY A;  3I4H X;  1RI7 A;  2DY9 A;  4OX8 A;  2Y0S D;  2CQI A;  1VRT B;  1XIQ A;  2V67 A;  4BWM A;  4F26 A;  1VBY A;  1WG4 A;  3EZO A;  3JS9 A;  1RTI A;  1ULR A;  1X7V A;  2HRY A;  4IRK A;  3MEC A;  2EWH A;  4J5O A;  3JTP A;  4WTY A;  4DR1 F;  1FFS B;  1HBO B;  3UR0 A;  3R9L A;  2Q1L A;  1ZOT A;  8AT1 B;  3OLB A;  4HT5 A;  3BGU A;  4TYA A;  1SL0 A;  1O51 A;  1RT1 A;  1MML A;  3R6G B;  3UI3 A;  4OI3 A;  3BSN A;  2XMK A;  1M5P C;  1X4D A;  2HHH F;  1FRJ A;  1J2V A;  3NCP A;  4P73 A;  3QZ7 A;  4C0O C;  3PKM A;  3MAH A;  2GIQ A;  3I4P A;  4OX9 J;  1PAE X;  2JFD A;  1U45 A;  3IG1 A;  1J5O A;  3CD5 A;  2JFK A;  2M4M A;  3C15 A;  2W2M P;  5DLF A;  4ES3 A;  2NRE A;  4PXD A;  1X0F A;  3JSY A;  2JSX A;  3V2U C;  4C3L A;  1U7L A;  4ID5 B;  3KLE A;  4Y6I A;  1I6J A;  2QLW A;  2Z56 B;  4X4O A;  3O2I A;  3DNC A;  1QAX A;  2EW9 A;  1Q81 T;  1NZ8 A;  4BBY A;  3AQO A;  2FC8 A;  1KLN A;  3VGS A;  1FJG J;  4JI2 J;  3EVW A;  2ZEJ A;  1WEY A;  3KUG A;  3ZC4 A;  2YKO A;  1Y11 A;  3MAA A;  4NXN F;  1O5J A;  3DLB A;  4C4W A;  5D3G A;  3CSK A;  4LFC F;  2O01 C;  4C3M A;  1TVR A;  5A8W A;  2C2M B;  5CAB A;  3CVK A;  4A4J A;  3HD1 A;  4QYR A;  1B0V A;  2XY7 A;  3O6Q A;  2UU9 J;  2CPY A;  3HP6 A;  2KM8 B;  2C2O B;  5ETK A;  2QLF B;  1RT4 A;  3QWU A;  5HP1 B;  1RHU B;  4P2M A;  1X4F A;  1VQK S;  3ET6 A;  3M6X A;  2NYI A;  4G1I A;  3AFG A;  4MIA A;  3MPV A;  4N7T A;  2E29 A;  2G13 A;  4RW4 B;  2CPJ A;  3GFZ A;  2CJ9 A;  2FJB B;  4BWJ A;  1UTA A;  3OR1 A;  4JV1 A;  2DHG A;  3DOM B;  3HHL C;  3H59 A;  2F63 A;  2DNM A;  4TY8 A;  1C1C B;  1N48 A;  5B0B A;  3EX7 B;  3CCS S;  4PXE A;  1IKY A;  4K0K J;  1URR A;  1TL3 B;  1RYR A;  3ENA A;  2WVF A;  2W7P A;  3SFG A;  1TU0 B;  4MFB B;  2XNR A;  2XHW A;  5EN1 A;  1PJ7 A;  2IBO A;  2KJV A;  3H20 A;  5KFO A;  1N32 J;  1UVN A;  1RWW B;  5HO4 A;  4EBC A;  3U27 A;  2NXJ A;  2VBZ A;  1IR1 A;  1Q8L A;  1RCO B;  2WVC A;  1EX8 A;  3IXQ A;  4B3S F;  4TXS A;  3KLE B;  3NCR A;  5K20 B;  5H9E J;  2Q66 A;  2GVD B;  3T6J A;  2ZH3 A;  3MMA A;  2V50 A;  4Q7A A;  1S6Q A;  4ERD A;  2NZC A;  3CED A;  4IG3 A;  5H1S V;  3UR3 C;  4F2R A;  2ZH1 A;  2QA4 G;  1YGY A;  4K8R A;  2FVP A;  1DFD A;  2XQC A;  2F5G A;  1QJH A;  2XS7 A;  1ZM9 A;  4C97 A;  5HP1 A;  2DR6 A;  2ACY A;  3DGV A;  4DL7 A;  1KRP A;  1KDN A;  1EKS A;  3SEO A;  2PGC A;  4LFB J;  2YQ1 A;  4AT1 B;  3LP2 B;  3K5M A;  1RZM A;  1C0T B;  2KYZ A;  2AWZ A;  4KBI A;  4PZV A;  2YVS A;  2B5J A;  3M2U B;  3UPF A;  1XQI A;  3THP A;  4KV8 B;  3Q8P B;  4OV6 A;  5IFM A;  2V9K A;  2NR0 A;  4LF2 A;  4HVZ A;  2M9K A;  1X4B A;  1NPK A;  3M2V B;  1JJ2 R;  3SQG A;  2BAN B;  2RHS B;  3W2V A;  1TKT B;  1NJX A;  3D0H E;  2HMI B;  1E6V B;  1UL3 A;  1P6T A;  2NS1 B;  2IJR A;  2LKZ A;  4QR0 A;  3ADA C;  2KVI A;  5KG0 A;  3TVZ A;  1F5C A;  3V6D B;  2YY3 A;  2P2C B;  1DTQ A;  2XSJ B;  1P8G A;  3A3O B;  3GJQ B;  4FNI A;  4DCJ B;  2MJU A;  4RNH A;  4X65 F;  4DS5 A;  3GU0 A;  1OQ6 A;  1S4E A;  1LXN A;  1Y0H A;  3C15 B;  1GK8 A;  1HMV B;  1IKY B;  2IFX A;  4CLW A;  4DEZ A;  1FJG F;  3V81 B;  1C1C A;  3RUB L;  2V2Z A;  2XZW A;  5AJ3 F;  2QV6 A;  2B6A A;  3MEE B;  1YDL A;  2CDQ A;  1UWB B;  1S6U A;  3KNG A;  1BQM B;  4OYP A;  4IR1 A;  4FXD A;  2I1R A;  4BC9 A;  3SZ2 A;  1U0S A;  3H2U B;  4ZJO A;  4DUZ J;  1ZBT A;  1DAR A;  3J80 U;  3NGT A;  4J9S A;  1RT4 B;  3I31 A;  2HHX A;  1LWF A;  2F9D A;  4QJV A;  1Q86 T;  1B0T A;  2IYI A;  1YQH A;  2COL A;  3KLI B;  2LA4 A;  1J5E J;  4O4R A;  2A2D A;  4F0M A;  3G86 A;  5A8R A;  3H25 A;  4LF8 F;  5HK4 A;  1JLQ B;  4CRJ A;  1OMS A;  3Q8U A;  4DV2 J;  4LF4 F;  3MM5 B;  4KGV B;  1I1G A;  3M8Z A;  5L38 A;  1HYS A;  3EGN A;  2U1A A;  3KHL A;  3ZFV A;  1Q5V A;  3F0N A;  1XR6 A;  2HBZ B;  3TZY A;  2UZA A;  5L1K A;  2FQQ B;  2IDL A;  4DR1 J;  2UUA J;  4X4U A;  2MQL A;  5KG7 A;  4FS2 A;  1KVJ A;  1IQZ A;  4LF6 J;  1JB0 C;  2KTQ A;  4DV7 J;  1AXQ A;  1XNQ J;  5T7L A;  3NL0 A;  3OXG A;  1YWX A;  3HFZ B;  4NZ0 A;  2FLO A;  2FHK A;  1VQ7 S;  1NSK L;  1RTI B;  2KN4 A;  3CIM A;  4H4O B;  2LEB A;  3BZQ A;  4G65 A;  2ASJ A;  1H98 A;  1XMQ J;  3J7A N;  1N33 F;  1BHN A;  2VFR A;  1FWL A;  3BQ2 A;  3R97 A;  5ETV A;  4DV6 F;  2VPY B;  3QWP A;  4YQW A;  2Y1I A;  4O3O A;  3EGZ A;  4CLF A;  1MWQ A;  2AZ3 A;  1UW4 A;  1FKP B;  2CVE A;  2H5I B;  1GX6 A;  1Y3J A;  2ZBI A;  3C16 B;  2OEJ A;  2X1A A;  2ALY B;  3SI8 A;  2D3O 1;  1SPB P;  2C2R A;  1L3T A;  2VPW B;  4MKV A;  1VQ4 S;  3ZZY A;  2B9W A;  3LWL A;  2J0Q D;  3W63 A;  3BO4 A;  1S1X A;  3GP9 A;  2BKO A;  2JC1 A;  3KFW X;  2DO4 A;  3DM2 A;  1IKW A;  3MD3 A;  4L6V 3;  3AXK A;  5IWA F;  1TK5 A;  1GH8 A;  5DS7 A;  1OPZ A;  2J7W A;  3QSY B;  4DFP A;  1IN0 A;  1S79 A;  1N5S A;  2CWX A;  3MCS A;  2BQ3 A;  2QX0 A;  3CUN A;  2C2E A;  3IFE A;  3KOA A;  3DFE A;  1NO8 A;  2QT7 A;  4DPU A;  4ZHR B;  5F8L A;  1U1N A;  1K44 A;  1DBD A;  1U2R A;  2B6A B;  5C25 B;  3PJX A;  2SXL A;  3HUL A;  3GWC A;  5GMD A;  1FE0 A;  1Y3K A;  3DI6 B;  5ETR A;  4NZ7 A;  2HQF A;  3IAS 9;  5KFA A;  3VTI A;  2VJU A;  1LW2 B;  3QJP A;  4PWD A;  1T05 B;  3KDN A;  3IR6 B;  3MPW A;  4H54 A;  2HFS A;  1WDD A;  1S4F A;  3DGP A;  1MU2 B;  2Z0G A;  4O3Q A;  2DIT A;  3NGD A;  2AGQ A;  2UUB J;  1ZAX A;  2HVI A;  1RWM B;  2CRL A;  2NXU A;  5KFH A;  1ELO A;  1N34 F;  3GCW P;  1X4A A;  2L9D A;  2J8S A;  4IRD A;  5GMK a;  1U2C A;  3D3C J;  4UOC A;  5J1P A;  1NKE A;  2ZDP A;  3TA1 A;  3R1L A;  3FFI A;  3ZZT A;  4J9O A;  2YKM B;  3ENQ A;  2AYM A;  2W4P A;  2Q6B A;  3PJ9 A;  1S1V B;  2XMM A;  4X84 A;  3SQG B;  4Q2L A;  5KFI A;  1AUD A;  3WC2 A;  2PI5 A;  4JV5 J;  4NCA A;  4F0K A;  4EZ9 A;  4UY8 T;  2QZ8 A;  3UCU P;  4F50 A;  2J9D E;  4DV2 F;  1N32 F;  4GRS A;  4B3M F;  1KTV A;  2AQ4 A;  1LWE A;  4DL2 A;  4I7F B;  5KFX A;  4JUZ A;  4DFK A;  3MUT P;  4KHM A;  4FXW A;  4WFZ A;  3TZX A;  1K73 T;  2CJA A;  3M32 B;  1HNX J;  1CS4 A;  3W5Z A;  4DQS A;  3EXY A;  1XC9 A;  3T1A A;  5E41 A;  1U6F A;  2ZBQ A;  2JRS A;  4IG3 B;  3LGN A;  3IGV A;  3W9J A;  2FD2 A;  2YKA A;  5AJ3 J;  1M1K T;  3DDN A;  1S6P A;  4QW8 A;  5LMU F;  4DWI A;  2OGU A;  1OIA A;  5CZX A;  1KVK A;  4ETX A;  4DFJ A;  4B08 A;  1HWJ A;  4WFX A;  2Z30 B;  4NLO A;  5A6W A;  1R0B G;  4CO4 A;  4CLT A;  4AFF A; 
#chains in the Genus database with same CATH homology
 5LMN J;  3R2C J;  4PWW A;  1N36 J;  4LF4 J;  4DUY J;  4DR2 J;  4DUZ J;  3J80 U;  4OX9 J;  4YHH J;  4DR7 J;  4LFA J;  1J5E J;  4JI3 J;  4B3M J;  4DV2 J;  4LF9 J;  1IBM J;  4DV3 J;  4LF5 J;  4LF7 J;  3JAM U;  4RJV A;  4DR1 J;  2UUA J;  1FJG J;  4JI2 J;  4LF6 J;  4DV7 J;  1XNQ J;  4KYZ A;  4DR6 J;  2E5L J;  4X65 J;  4DV5 J;  4DR4 J;  5LMU J;  4KY3 A;  4JI6 J;  3W1Y C;  1XMQ J;  2UU9 J;  3D3B J;  5IT9 U;  5BR8 J;  3J7A N;  2UXB J;  4KHP J;  4JI8 J;  2KL8 A;  2HHH J;  4DR3 J;  4JI4 J;  3J81 U;  4AQY J;  4B3R J;  3T1Y J;  4NEZ A;  4DR5 J;  2ZM6 J;  4JI7 J;  4NXM J;  2UXC J;  2UXD J;  1XNR J;  5FLX U;  4K0K J;  1HNZ J;  2MEW A;  4V1A k;  2F4V J;  3OTO J;  4X64 J;  1N34 J;  2UUC J;  1N32 J;  4YY3 J;  4B3T J;  4X66 J;  4DV1 J;  1IBL J;  1XMO J;  2VQF J;  4DV0 J;  4DV4 J;  2UUB J;  4GKK J;  4JI5 J;  4GKJ J;  4NXN J;  1I94 J;  3T1H J;  5IWA J;  3D3C J;  4B3S J;  4JYA J;  4X62 J;  1HR0 J;  4HHU A;  4LFB J;  2MTL A;  4JV5 J;  3IMQ J;  1IBK J;  1N33 J;  4LFC J;  3R2D J;  2VQE J;  4JI0 J;  4DV6 J;  1HNX J;  2MQ8 A;  2KVQ E;  5AJ3 J;  4NEY A;  1HNW J;  5A2Q U;  4JI1 J;  4LF8 J;  5LM7 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...