4DV6T

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a915g
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 37
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4dv6T00
4LFBT 4X65T 4LFCT 4DR3T 1HNXT 3T1YT 2UUBT 1XNQT 1FJGT 2ZM6T 1HNZT 3OTOT 1J5ET 4JI4T 4DV5T 4B3TT 4DV3T 4LFAT 1HR0T 4JI3T 2E5LT 4JI2T 4DV2T 1N36T 4DR4T 4DR5T 2F4VT 2UUCT 1XMQT 1N33T 5BR8T 4DV6T 4LF8T 4JYAT 4JI8T 1IBKT 4LF4T 2UU9T 1IBLT 1HNWT 4DV0T 2UXDT 4B3RT 4X66T 5LMNT 4LF5T 2UXCT 4OX9T 1I94T 2VQFT 1IBMT 4X62T 4B3MT 4NXNT 4B3ST 1N32T 1XMOT 4K0KT 2HHHT 4DV4T 2UXBT 4DR2T 4X64T 4NXMT 4JI1T 4DUYT 2UUAT 4JV5T 4DV1T 4AQYT 4LF7T 4GKKT 2VQET 4YHHT 4JI0T 5LMUT 4JI5T 4GKJT 4DR7T 4DR6T 4JI6T 4LF6T 4DR1T 4YY3T 3T1HT 1XNRT 4JI7T 4DUZT 1N34T 4LF9T 4KHPT 5IWAT 4DV7T
chains in the Genus database with same CATH superfamily
2H7OA 2NW8A 2LSIA 3RHWA 1HNXT 4A56A 3RGLA 2H7VC 2PG8A 1BR4A 4P1NA 3TKLB 3O1JA 3AE8A 3KVAA 4ANJA 1J1JA 2E9XD 1M7KA 3AE3A 3W15B 3N9LA 5CFBA 3RC3A 3ABVA 3TLVA 3RIFA 4IIJE 5JVDE 4XBFB 2B76A 2X9WA 2QGSA 4DR4T 4YHJA 4JEHB 5AFUL 4LF8T 3RIUC 4MBQA 4HWDA 4ILAA 4MHCA 2V26A 4A98A 2SPCA 2HN1A 4PNIA 4UVCB 3BQKA 2K24A 3HL6A 3Q5XA 4EYUA 1MIYA 2ODVA 2XZEA 2CA5A 3CK6A 3KINB 1Y01A 2WMNA 1G8XA 5J2UE 3PDYA 5F3JA 4ISSA 5BMVE 1MIWA 2E5VA 3PUSA 2AXDS 1W09A 3AEBA 3Q5WA 4U72A 2ZM8A 3KBUA 4YLHA 3SFEA 2XSBA 1D0YA 1D1BA 3HI2A 4UXNB 3UU3A 2V7LA 3C4XA 2MTQA 5LGUB 2WY2A 5L3DB 4P0BA 3LK2B 4AKRB 3TLWA 1HX1B 4I0UA 2WB5A 2RP4A 3N5LA 5FXZA 4PFOA 2J47A 3ONXA 3FXDB 2ZM6T 1J5ET 2DNXA 4ZZCA 5AQHB 4ZI3C 4TNWA 2LSJA 3HKCE 2CXDA 2Y48B 1ZP0A 3ZLIA 3JAEA 4BJMA 4HTEA 3CPZA 1ZEEA 2D0UA 2CMRA 4YFSA 4HFDA 3ZSTA 4PK5A 5FMNA 3A5XA 1UX4A 2LKHA 4OX9T 1B7TA 4DBQA 2WSSV 1IBMT 5ABGA 4X62T 3E22E 3L3PA 5JH7E 3PU3A 4FI5A 4QX8B 4IDOA 2WMOA 2ZM0A 3RIAA 2ACXA 4IE6A 4QWNB 5EZYE 4YSXA 1X79A 2WDQA 3AVRA 4QH5A 4WZXA 3OBVE 4NUVA 3UU8A 2Y6XA 4AQGA 1WFDA 3UTKA 4IE0A 5LMUT 2CLYC 4DBRA 5CGMA 4LF6T 4TN7B 4JI7T 2JQKA 3FHNA 1IAPA 2XQ4A 2KT9A 5LP6E 2K48A 2VKJA 3AE2A 3T1YT 2CBIA 4U3CA 1T8BA 2LM9A 3JAFA 4HWCA 5HXCA 1FJGT 4YTPA 2IIUA 4U2YA 2VASA 1QUUA 2QYWA 5J2TE 1MIVA 3CWZB 3RYCE 4F8HA 1WRDA 2H88A 1D0ZA 3FB2A 2E2AA 4ISTA 1S35A 2NTYA 2W2UA 2WWVA 3EDVA 3ZMVB 2VURA 2JMKA 4LF5T 2MPKA 2IMLA 4LMLA 4I4TE 4Q25A 2HPJA 4F6RC 4CN6A 4CZZB 2LRLA 3M3ZB 2P9BA 4ZS2A 4HWIB 3UQ4A 3ZSSA 3LK42 4COFA 3AE5A 3AVSA 5AQVB 2K5BB 4ILBA 2AE9A 2JIWA 2XQ8A 5GONE 4WYVA 2Q9QA 2LSYA 4YJ3E 5L3GB 5HEOA 4DUYT 3KV9A 4TNVA 5ABHA 1T7SA 5FY7A 5ABEA 2LHRA 3AEGA 5ABFA 2R6GF 1BR2A 4CXWA 2A72A 2NW9A 1YKHB 3PUAA 4E7SA 2YDSA 3CMLA 3IBPA 3ZC1A 4AKGA 3RQUA 2V1DB 4UIGA 5AQKB 2UUBT 4CN1A 2ES0A 2H89A 5FL0A 2X9XA 2X67A 4IT4A 1KF6A 1ZOYA 5FY0A 1CHUA 2BVMA 3L8RA 3UULA 3Q5DA 5EK2A 2KMFA 4A5XA 4ZZBA 4AKLA 1W0BA 3KV4A 2UU9T 3EABA 3GMIA 5FXVA 4DV0T 2CLYB 2XM1A 2FJDA 4TWFA 2BG9B 2XY8B 3ZN1B 4TWHA 5E0OA 5LNKA 2W4XA 2YEVC 5JQGE 2IC6A 3ZKRA 3O1IA 4AI6A 2L8KA 4ZXLA 4DNDA 4KX6A 4AKIA 4HEAA 3JC6D 1YXRA 5EK3A 1UK5A 3A8YC 4AISA 4A97A 3KV5A 2YOEA 2Z6EA 4JUYA 2VKOA 2CWOA 1D1CA 3OJAA 3H3MA 1FEWA 5AQSB 3UQ7A 1N34T 3P50A 3MACA 2UXNB 2XAQB 2LLYA 1UURA 4IL9A 2VL0A 1WCRA 4IDQA 2PFVA 3OVUA 1VOMA 4MALA 2KINB 3SRZA 5C8YE 3ONLC 4UVAB 3EI0A 4EOZB 1KK7A 2W62A 2YU2A 2DCFA 3O1HA 2UUCT 3ZCJA 5BR8T 3AECA 1E7PA 4JYAT 2D0TA 4ILCA 1IBLT 3F31A 4X1KE 2UXDT 2J1DG 4PK6A 2IHR1 5JDGA 4L9IA 4B3MT 3PURA 3VRBA 2WZHA 4V1Av 4M1PA 4NIQA 4TUYE 4YSYA 5FVKA 2Q9QC 3RYHE 3ETUA 4ERRA 3CIRA 3ZT6A 3PUQA 4P09A 3PUZF 3PJAA 2VK9A 2YK0A 3OYXA 3IA3A 1OEDB 1X9BA 4EAHA 3P7IA 3TLSA 4H9PC 4IREA 3PUWF 2FJEA 4UV8B 4DV7T 3IF8B 3SFDA 5LG4A 4YT0A 5JTGA 4I43B 4JI4T 2W63A 2WM9A 3U78A 4EB6E 2WCAA 3ZMSB 3PV0F 5JDNA 4G63A 2E5LT 3H37A 2DLRA 2M67A 5JDLA 2VB6A 3AEDA 2XAJB 5FY1A 4HFVA 4FJOA 1EZ3A 3RC8A 2YDRA 3DJBA 5ETWA 5FXXA 3L09A 2IC9A 1HG5A 4YSZA 3JCFA 4QH4A 2VQFT 4ASKA 3N9MA 3FZMB 1N32T 4QH1A 2MAWA 3PJAJ 4EEDA 2W00A 5M4YA 3ESLA 3JADA 5AQUB 2WU5A 2UXBT 3F57A 2A3DA 4PJNA 4HWHA 3S4UA 1XWMA 4MFRA 5AQJB 3CQXC 3ZMUB 2NWBA 2XJ7A 2ODUA 1G73A 3BQLA 3Q5EA 2XHEB 2QA7A 1JNZA 2FJAA 5L2LA 3VHLA 1SUMB 3QK6A 3QUJA 3ZYLA 5IWAT 4O4LE 3LBXA 2V8SV 3LFMA 2D2SA 4X65T 4LMKA 3EUHA 4YTMA 5AQNB 5CA1E 1ZV4X 2KWHA 4J2CA 4ZI7E 2LHNA 4BAYB 4H9QC 1UUSA 2Q9QB 3NRYA 1M62A 1N36T 4EZHA 2HN2A 3TLTA 2J4GA 4X5TA 3VR9A 2BKNA 3AAEB 5HYAA 5ABFB 2WS3A 3GN5B 4B3RT 2WWUA 5LA6E 2CHNA 2MOZA 1SHZC 4L0RA 4PJMA 1XDPA 4IE7A 4C90A 4OHFA 5A1LA 2YN6A 4GK5E 3WAJA 3FZKB 4B6XA 1YQ3A 4TV9E 1WR6A 2X0HA 3AAAB 3B57A 4X1IE 2VKHA 3RRCA 3FBZA 2VQET 2MYSA 1LKXA 4JI0T 2KSRA 4X20E 4EZ4A 5HXSA 2YDQA 4O4IE 1IJ6A 3P4WA 2UXXB 2YU1A 5FL1A 2WQYA 1T72A 1GQEA 3OKQA 5IYZE 3ZT7A 5FP3A 5L3CB 3ZYKA 2JJ9A 3Q9DA 4KUMB 3RQWA 4LFBT 4ZS3A 2I59A 5LG3A 2V7IA 2EHOA 3CX8B 1SA0E 3RRWA 3AEAA 4LFAT 1HR0T 2KNDA 4DMWA 2XQ5A 4UR9A 5LBMA 3UUBA 2F4VT 2VVNA 3Q2MA 4PAGA 2E9XA 1FMWA 2OV9A 3EHZA 1VCTA 3RKGA 3ANWA 2JQQA 5KMGP 2DL1A 4IGUA 4PJJA 1NAFA 3AEEA 3RKOA 1FIOA 3CVRA 2J62A 2W0GA 3CQCB 1YD8G 3HR0A 1MNDA 4YXDA 3QB5K 4HFCA 3ZJ1A 4DR2T 2BBHA 2BKPA 3L39A 2N1GA 1KNZA 5JDHA 4JV5T 4DV1T 3B13A 4H63H 2CM0A 4LF7T 4YHHT 4KMCA 5F8PA 4MLKA 4UEMA 4DR6T 2LRKA 4JI6T 3K3OA 1L0VA 3EAMA 2IUBA 1YW0A 5AQFB 4IE4A 2CXLA 2KLQA 1V9DA 4Z8XA 3HKEE 4ZI3D 4HFBA 4G2AA 3N2KE 3N9PA 2ZM2A 2C0SA 2V5CA 3VR8A 4LFCT 2WDRA 4NPPA 4DR3T 5L4EA 3PUYF 2PTFA 5FYMA 4C91A 3C64A 2L9QA 4GYRA 3RH3A 4JI2T 5L3FB 4TV8E 2N9DA 2V7JA 1UGOA 2LE8A 5IHYA 3MA9A 2I6HA 3KV6A 1IBKT 1KFYA 1US7B 1HNWT 2NR4A 1YQ4A 2XUEA 3DP7A 1HFAA 4QXHB 4UELA 5FKYA 2XAGB 3SWHA 3PTRB 3ZMTB 3UUXB 4OFZA 2JQHA 4K0KT 2E8IA 2XTLA 3VRAA 3K8PC 3C50A 3A7MA 1T98A 5CB4E 4Z90A 3PU8A 4BJNA 3T8OA 4HN9A 3C51A 3EDUA 1XZYA 3AE1A 4LMJA 2A9UA 3EVYA 2QRXA 3I9YA 4JLEA 2XSAA 4IDNA 5JDQA 2CRBA 3MZKB 3WAKA 1WR0A 4NUUA 3VKGA 2JMHA 3D0TA 1UX5A 3IEEA 2LSGA 4OK0A 5L3EB 3HKDE 4H9NC 4U74A 2A2FX 3FZHB 5KX5E 2PBIA 5LYJE 4HFHA 2CCQA 2K3WA 3AE9A 1MMAA 2EHOC 5LCYA 4AQFA 2WP9A 2K9AA 5AQPB 4B3TT 1Z8UA 3J9X1 4JI3T 5JR9A 4DV2T 2NP9A 5JREA 2E9XC 2RPAA 3PUGA 5LGTB 3C98B 4DV6T 5HXRA 5DABA 3UU6A 5CA0E 4QXBB 1NWMX 4X66T 2BS2A 4CI2B 1I6ZA 3G06A 3P4SA 4UV9B 3H3AA 4NXNT 3LBXB 1XMOT 4O4JE 4U31A 1LVKA 4DIDB 4X64T 4DVDA 1WYCA 4CQIA 3MKDA 3AA7B 2XAHB 3QB5A 1O3XA 4AQYT 3LDQB 4BA9A 4EV6A 4UVBB 5LGNB 2XQ9A 2LSKA 2WU2A 4ZHQE 5AQMB 4DR1T 2NOXA 4YY3T 2D5UA 3TLUA 3LSVA 2H3RA 2VWAA 3UU5A 3QNUA 3VKHA 3ZJ2A 3RLFF 2C5IT 3ZT5A 2CWYA 4KBMB 4IE5A 3NWIA 4CXYA 3N2GE 2V5DA 2X0LB 1U5PA 4IDPA 3NZQA 3RYFE 4CN4A 1VCSA 4LF4T 4PFPA 4EXTA 3I0QA 5AQIB 1NENA 4GOUA 2YINA 2BS4A 3MXZA 3BK9A 3O4XE 5DQWA 3LG7A 2V6YA 4HKAA 2HHHT 5HEGA 3LK3B 2M6BA 2EHOB 2EHOD 4YJ2E 3HKBE 4HGAA 2BVLA 5EK4A 1Z0PA 4OYKA 4WW0A 5AQLB 5ADXL 5KDMC 4AXPA 4H9SE 4ZOLE 4GKJT 1FMVA 1HS7A 2E9XB 2XQAA 4JBWF 3V5SA 2FBWA 3NZPA 2Y8DA 2XASB 1QSDA 3O9XA 3ANWB 2X68A 4KHZF 4KI0F 3R84B 3K3NA 4AQFC 1HX8A 2B1EA 5FNVE 1HNZT 2W66A 2FJBA 3AE4A 5HEHA 5JR9C 1KNPA 3ZN0B 1ZKEA 3B5MA 1XMQT 3AXJA 2JQ9A 2JPFA 4JI8T 1U4QA 3E0ZA 4IHJE 5H6QB 3BQIA 4H63V 1HG2A 3AA6B 2IAKA 1E1HB 1BR1A 2Q9QD 2XQ7A 2HH7A 3AB3B 1HCIA 2V7KA 1W0AA 4WNKA 4QKNA 1DU2A 1KNRA 4P0AA 4ZEYA 4O8SA 1YKEB 3AE7A 3ZEFB 2XPKA 4L5GA 4GKKT 4PW8A 2HPLA 3K3QC 4IDZA 5HCJA 4DR7T 3WI3A 5DQVA 1D1AA 1Y64B 3FXEB 2M6IA 2WZIA 3KVBA 2X0YA 3V5UA 4DMVA 4LF9T 4KHPT 2XM2A 1OEDA 3U3IA 4PJLA 2LEHA 1KEYA 3DTOA 3ZCIA 2BZBA 3RYIE 3OTOT 5LJMA 3AE6A 4QHOA 4CI3B 5HXEA 1HTJF 5LOVE 4N78D 3I0OA 4ILUA 3RX6A 5JRCA 5H6RB 2CHOA 3K1SA 2YKSA 4TWDA 4YTNA 2LOPA 1J5WA 2NTXA 1NEKA 2MBGA 4KP3C 4TX5A 4HFEA 3LJCA 4I50E 3NRXA 4PK4A 3UUMA 3ZMZB 4UF0A 3UUNA 3AA1B 2V7MA 2BKOA 1AJ3A 5LBQB 5LXTE 4AKHA 2W67A 5FVLA 4JEUB 3P4QA 5HCMA 2QVAA 1S94A 1XDOA 2BG9C 2KXPB 5HXHA 3P4RA 3IHRA 2BG9E 3J7Yq 1JNRA 2VKDA 4EEBA 1HF8A 3R6NA 4O2AE 2IDOB 5FXWA 3QOFA 3AEFA 5IUXA 2VVSA 3ETVA 3N9QA 4WBOA 5JR9B 5AQGB 2W61A 3PUVF 1W9RA 2X66A 2XQ6A 2L3LA 1XNRT 4HE8A 3JC6C 1LVFA 5HEJA 4DUZT 4H9OC 5HEUA 3NBXX 4XAXB 2OLTA 1D0XA 3MJXA 3UFGA 2DHRA 3UT5E 3QC9A 4EYYR 1XNQT 1CUNA 1E2AA 3UFEA 3CX7B 4EGWA 5AQTB 3M65A 2XQYA 5L4HA 2PJQA 2BDEA 4QXCB 2G0UA 1WYBA 2CBJA 1OXZA 2CXFA 4O4HE 2LKGA 1R8IA 5LHHB 3VU7H 4GIWA 1I94T 2DWKA 5KXJA 4ADZA 4Z91A 2BBJA 3GN5A 2RA1A 4GK0E 3SS1A 3GWHA 4JI1T 3N2OA 3ZC0A 4TZ4C 4IL4A 4H9RC 2WAUA 5DJQC 5L3BB 1OWAA 4ZI2C 1MMDA 1LRZA 2CEAA 4JI5T 2LM2A 3C4ZA 2LJLA 4GYSA 4U2ZA 1QLBA 5CJ5A 5LHIB 3ZYMA 2WDVA 4X1YE 1OEDC 1VRBA 1OEDE 2X9YA 4QX7B 2FUPA 4U7YA 3FZLB 3HA4A 1ZHCA 2I0MA 4O2BE 2KWIB 2V6YB 2C5JA 4XZCA 2XAFB 4OYJA 3CX6B 3RI5A 4DR5T 5C2TA 2BS3A 5HAXA 1N33T 3KBTA 2D9DA 4U33A 3MK7C 3GA8A 3ONJA 3RIUA 5HWYA 5TAOA 1IZNB 1UCUA 2UXCT 2IW5B 3AAIA 2JRKA 3SOLA 3AA0B 3UU4A 2LT3A 2CPTA 3KFWX 3PUXF 4AIUA 4DV4T 4CI1B 4WBNE 2DWGA 3C4WA 2GK9A 5AQRB 3RPUA 4CXXA 4U7IA 3X1DA 3NVOA 4I55E 3N9NA 5LHGB 1BR0A 1H7CA 3AXJB 2CE7A 3T1HT 1WLXA 5J0ZA 1MMNA 5J1GA 2WBLA 2XQ3A 2LOSA 2X51A 5JDMA 4HFIA 4DO0A 3E08A 2V6XA 3OYZA 3P8CD 3PE0A 5C3JA 2ZLYA 4DV5T 4DV3T 4HWFA 5JDFA 1IJ5A 3CKDA 2ACZA 3I1AA 1MNEA 1SE7A 5LB7B 4ZI2D 3ZPOA 5L47A 5LMNT 2DI4A 2VL8A 2NW7A 3NKZA 4B3ST 2N2NA 3CQGB 4E7ZA 3OPCA 3FZFB 3F2EA 3N9OA 4EIWA 2ZMAA 3I9WA 2OA5A 2KZ7B 4NXMT 5AQOB 5HWXA 2UUAT 2C5KT 3P4PA 5JRCB 2X9HA 3RF1A 3FBLA 4K0UA 5AQQB 2BG9A 3KDSE 5LJNA 4UF0B 5F5WA 1MMGA
chains in the Genus database with same CATH topology
4LFBT 4X65T 4LFCT 4DR3T 1HNXT 3T1YT 2UUBT 1XNQT 1FJGT 2ZM6T 1HNZT 3OTOT 1J5ET 4JI4T 4DV5T 4B3TT 4DV3T 4LFAT 1HR0T 4JI3T 2E5LT 4JI2T 4DV2T 1N36T 4DR4T 4DR5T 2F4VT 2UUCT 1XMQT 1N33T 5BR8T 4DV6T 4LF8T 4JYAT 4JI8T 1IBKT 4LF4T 2UU9T 1IBLT 1HNWT 4DV0T 2UXDT 4B3RT 4X66T 5LMNT 4LF5T 2UXCT 4OX9T 1I94T 2VQFT 1IBMT 4X62T 4B3MT 4NXNT 4B3ST 1N32T 1XMOT 4K0KT 2HHHT 4DV4T 2UXBT 4DR2T 4X64T 4NXMT 4JI1T 4DUYT 2UUAT 4JV5T 4DV1T 4AQYT 4LF7T 4GKKT 2VQET 4YHHT 4JI0T 5LMUT 4JI5T 4GKJT 4DR7T 4DR6T 4JI6T 4LF6T 4DR1T 4YY3T 3T1HT 1XNRT 4JI7T 4DUZT 1N34T 4LF9T 4KHPT 5IWAT 4DV7T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFB T;  4X65 T;  4LFC T;  4DR3 T;  1HNX T;  3T1Y T;  2UUB T;  1XNQ T;  1FJG T;  2ZM6 T;  1HNZ T;  3OTO T;  1J5E T;  4JI4 T;  4DV5 T;  4B3T T;  4DV3 T;  4LFA T;  1HR0 T;  4JI3 T;  2E5L T;  4JI2 T;  4DV2 T;  1N36 T;  4DR4 T;  4DR5 T;  2F4V T;  2UUC T;  1XMQ T;  1N33 T;  5BR8 T;  4DV6 T;  4LF8 T;  4JYA T;  4JI8 T;  1IBK T;  4LF4 T;  2UU9 T;  1IBL T;  1HNW T;  4DV0 T;  2UXD T;  4B3R T;  4X66 T;  5LMN T;  4LF5 T;  2UXC T;  4OX9 T;  1I94 T;  2VQF T;  1IBM T;  4X62 T;  4B3M T;  4NXN T;  4B3S T;  1N32 T;  1XMO T;  4K0K T;  2HHH T;  4DV4 T;  2UXB T;  4DR2 T;  4X64 T;  4NXM T;  4JI1 T;  4DUY T;  2UUA T;  4JV5 T;  4DV1 T;  4AQY T;  4LF7 T;  4GKK T;  2VQE T;  4YHH T;  4JI0 T;  5LMU T;  4JI5 T;  4GKJ T;  4DR7 T;  4DR6 T;  4JI6 T;  4LF6 T;  4DR1 T;  4YY3 T;  3T1H T;  1XNR T;  4JI7 T;  4DUZ T;  1N34 T;  4LF9 T;  4KHP T;  5IWA T;  4DV7 T; 
#chains in the Genus database with same CATH topology
 2H7O A;  2NW8 A;  2LSI A;  3RHW A;  1HNX T;  4A56 A;  3RGL A;  2H7V C;  2PG8 A;  1BR4 A;  4P1N A;  3TKL B;  3O1J A;  3AE8 A;  3KVA A;  4ANJ A;  1J1J A;  2E9X D;  1M7K A;  3AE3 A;  3W15 B;  3N9L A;  5CFB A;  3RC3 A;  3ABV A;  3TLV A;  3RIF A;  4IIJ E;  5JVD E;  4XBF B;  2B76 A;  2X9W A;  2QGS A;  4DR4 T;  4YHJ A;  4JEH B;  5AFU L;  4LF8 T;  3RIU C;  4MBQ A;  4HWD A;  4ILA A;  4MHC A;  2V26 A;  4A98 A;  2SPC A;  2HN1 A;  4PNI A;  4UVC B;  3BQK A;  2K24 A;  3HL6 A;  3Q5X A;  4EYU A;  1MIY A;  2ODV A;  2XZE A;  2CA5 A;  3CK6 A;  3KIN B;  1Y01 A;  2WMN A;  1G8X A;  5J2U E;  3PDY A;  5F3J A;  4ISS A;  5BMV E;  1MIW A;  2E5V A;  3PUS A;  2AXD S;  1W09 A;  3AEB A;  3Q5W A;  4U72 A;  2ZM8 A;  3KBU A;  4YLH A;  3SFE A;  2XSB A;  1D0Y A;  1D1B A;  3HI2 A;  4UXN B;  3UU3 A;  2V7L A;  3C4X A;  2MTQ A;  5LGU B;  2WY2 A;  5L3D B;  4P0B A;  3LK2 B;  4AKR B;  3TLW A;  1HX1 B;  4I0U A;  2WB5 A;  2RP4 A;  3N5L A;  5FXZ A;  4PFO A;  2J47 A;  3ONX A;  3FXD B;  2ZM6 T;  1J5E T;  2DNX A;  4ZZC A;  5AQH B;  4ZI3 C;  4TNW A;  2LSJ A;  3HKC E;  2CXD A;  2Y48 B;  1ZP0 A;  3ZLI A;  3JAE A;  4BJM A;  4HTE A;  3CPZ A;  1ZEE A;  2D0U A;  2CMR A;  4YFS A;  4HFD A;  3ZST A;  4PK5 A;  5FMN A;  3A5X A;  1UX4 A;  2LKH A;  4OX9 T;  1B7T A;  4DBQ A;  2WSS V;  1IBM T;  5ABG A;  4X62 T;  3E22 E;  3L3P A;  5JH7 E;  3PU3 A;  4FI5 A;  4QX8 B;  4IDO A;  2WMO A;  2ZM0 A;  3RIA A;  2ACX A;  4IE6 A;  4QWN B;  5EZY E;  4YSX A;  1X79 A;  2WDQ A;  3AVR A;  4QH5 A;  4WZX A;  3OBV E;  4NUV A;  3UU8 A;  2Y6X A;  4AQG A;  1WFD A;  3UTK A;  4IE0 A;  5LMU T;  2CLY C;  4DBR A;  5CGM A;  4LF6 T;  4TN7 B;  4JI7 T;  2JQK A;  3FHN A;  1IAP A;  2XQ4 A;  2KT9 A;  5LP6 E;  2K48 A;  2VKJ A;  3AE2 A;  3T1Y T;  2CBI A;  4U3C A;  1T8B A;  2LM9 A;  3JAF A;  4HWC A;  5HXC A;  1FJG T;  4YTP A;  2IIU A;  4U2Y A;  2VAS A;  1QUU A;  2QYW A;  5J2T E;  1MIV A;  3CWZ B;  3RYC E;  4F8H A;  1WRD A;  2H88 A;  1D0Z A;  3FB2 A;  2E2A A;  4IST A;  1S35 A;  2NTY A;  2W2U A;  2WWV A;  3EDV A;  3ZMV B;  2VUR A;  2JMK A;  4LF5 T;  2MPK A;  2IML A;  4LML A;  4I4T E;  4Q25 A;  2HPJ A;  4F6R C;  4CN6 A;  4CZZ B;  2LRL A;  3M3Z B;  2P9B A;  4ZS2 A;  4HWI B;  3UQ4 A;  3ZSS A;  3LK4 2;  4COF A;  3AE5 A;  3AVS A;  5AQV B;  2K5B B;  4ILB A;  2AE9 A;  2JIW A;  2XQ8 A;  5GON E;  4WYV A;  2Q9Q A;  2LSY A;  4YJ3 E;  5L3G B;  5HEO A;  4DUY T;  3KV9 A;  4TNV A;  5ABH A;  1T7S A;  5FY7 A;  5ABE A;  2LHR A;  3AEG A;  5ABF A;  2R6G F;  1BR2 A;  4CXW A;  2A72 A;  2NW9 A;  1YKH B;  3PUA A;  4E7S A;  2YDS A;  3CML A;  3IBP A;  3ZC1 A;  4AKG A;  3RQU A;  2V1D B;  4UIG A;  5AQK B;  2UUB T;  4CN1 A;  2ES0 A;  2H89 A;  5FL0 A;  2X9X A;  2X67 A;  4IT4 A;  1KF6 A;  1ZOY A;  5FY0 A;  1CHU A;  2BVM A;  3L8R A;  3UUL A;  3Q5D A;  5EK2 A;  2KMF A;  4A5X A;  4ZZB A;  4AKL A;  1W0B A;  3KV4 A;  2UU9 T;  3EAB A;  3GMI A;  5FXV A;  4DV0 T;  2CLY B;  2XM1 A;  2FJD A;  4TWF A;  2BG9 B;  2XY8 B;  3ZN1 B;  4TWH A;  5E0O A;  5LNK A;  2W4X A;  2YEV C;  5JQG E;  2IC6 A;  3ZKR A;  3O1I A;  4AI6 A;  2L8K A;  4ZXL A;  4DND A;  4KX6 A;  4AKI A;  4HEA A;  3JC6 D;  1YXR A;  5EK3 A;  1UK5 A;  3A8Y C;  4AIS A;  4A97 A;  3KV5 A;  2YOE A;  2Z6E A;  4JUY A;  2VKO A;  2CWO A;  1D1C A;  3OJA A;  3H3M A;  1FEW A;  5AQS B;  3UQ7 A;  1N34 T;  3P50 A;  3MAC A;  2UXN B;  2XAQ B;  2LLY A;  1UUR A;  4IL9 A;  2VL0 A;  1WCR A;  4IDQ A;  2PFV A;  3OVU A;  1VOM A;  4MAL A;  2KIN B;  3SRZ A;  5C8Y E;  3ONL C;  4UVA B;  3EI0 A;  4EOZ B;  1KK7 A;  2W62 A;  2YU2 A;  2DCF A;  3O1H A;  2UUC T;  3ZCJ A;  5BR8 T;  3AEC A;  1E7P A;  4JYA T;  2D0T A;  4ILC A;  1IBL T;  3F31 A;  4X1K E;  2UXD T;  2J1D G;  4PK6 A;  2IHR 1;  5JDG A;  4L9I A;  4B3M T;  3PUR A;  3VRB A;  2WZH A;  4V1A v;  4M1P A;  4NIQ A;  4TUY E;  4YSY A;  5FVK A;  2Q9Q C;  3RYH E;  3ETU A;  4ERR A;  3CIR A;  3ZT6 A;  3PUQ A;  4P09 A;  3PUZ F;  3PJA A;  2VK9 A;  2YK0 A;  3OYX A;  3IA3 A;  1OED B;  1X9B A;  4EAH A;  3P7I A;  3TLS A;  4H9P C;  4IRE A;  3PUW F;  2FJE A;  4UV8 B;  4DV7 T;  3IF8 B;  3SFD A;  5LG4 A;  4YT0 A;  5JTG A;  4I43 B;  4JI4 T;  2W63 A;  2WM9 A;  3U78 A;  4EB6 E;  2WCA A;  3ZMS B;  3PV0 F;  5JDN A;  4G63 A;  2E5L T;  3H37 A;  2DLR A;  2M67 A;  5JDL A;  2VB6 A;  3AED A;  2XAJ B;  5FY1 A;  4HFV A;  4FJO A;  1EZ3 A;  3RC8 A;  2YDR A;  3DJB A;  5ETW A;  5FXX A;  3L09 A;  2IC9 A;  1HG5 A;  4YSZ A;  3JCF A;  4QH4 A;  2VQF T;  4ASK A;  3N9M A;  3FZM B;  1N32 T;  4QH1 A;  2MAW A;  3PJA J;  4EED A;  2W00 A;  5M4Y A;  3ESL A;  3JAD A;  5AQU B;  2WU5 A;  2UXB T;  3F57 A;  2A3D A;  4PJN A;  4HWH A;  3S4U A;  1XWM A;  4MFR A;  5AQJ B;  3CQX C;  3ZMU B;  2NWB A;  2XJ7 A;  2ODU A;  1G73 A;  3BQL A;  3Q5E A;  2XHE B;  2QA7 A;  1JNZ A;  2FJA A;  5L2L A;  3VHL A;  1SUM B;  3QK6 A;  3QUJ A;  3ZYL A;  5IWA T;  4O4L E;  3LBX A;  2V8S V;  3LFM A;  2D2S A;  4X65 T;  4LMK A;  3EUH A;  4YTM A;  5AQN B;  5CA1 E;  1ZV4 X;  2KWH A;  4J2C A;  4ZI7 E;  2LHN A;  4BAY B;  4H9Q C;  1UUS A;  2Q9Q B;  3NRY A;  1M62 A;  1N36 T;  4EZH A;  2HN2 A;  3TLT A;  2J4G A;  4X5T A;  3VR9 A;  2BKN A;  3AAE B;  5HYA A;  5ABF B;  2WS3 A;  3GN5 B;  4B3R T;  2WWU A;  5LA6 E;  2CHN A;  2MOZ A;  1SHZ C;  4L0R A;  4PJM A;  1XDP A;  4IE7 A;  4C90 A;  4OHF A;  5A1L A;  2YN6 A;  4GK5 E;  3WAJ A;  3FZK B;  4B6X A;  1YQ3 A;  4TV9 E;  1WR6 A;  2X0H A;  3AAA B;  3B57 A;  4X1I E;  2VKH A;  3RRC A;  3FBZ A;  2VQE T;  2MYS A;  1LKX A;  4JI0 T;  2KSR A;  4X20 E;  4EZ4 A;  5HXS A;  2YDQ A;  4O4I E;  1IJ6 A;  3P4W A;  2UXX B;  2YU1 A;  5FL1 A;  2WQY A;  1T72 A;  1GQE A;  3OKQ A;  5IYZ E;  3ZT7 A;  5FP3 A;  5L3C B;  3ZYK A;  2JJ9 A;  3Q9D A;  4KUM B;  3RQW A;  4LFB T;  4ZS3 A;  2I59 A;  5LG3 A;  2V7I A;  2EHO A;  3CX8 B;  1SA0 E;  3RRW A;  3AEA A;  4LFA T;  1HR0 T;  2KND A;  4DMW A;  2XQ5 A;  4UR9 A;  5LBM A;  3UUB A;  2F4V T;  2VVN A;  3Q2M A;  4PAG A;  2E9X A;  1FMW A;  2OV9 A;  3EHZ A;  1VCT A;  3RKG A;  3ANW A;  2JQQ A;  5KMG P;  2DL1 A;  4IGU A;  4PJJ A;  1NAF A;  3AEE A;  3RKO A;  1FIO A;  3CVR A;  2J62 A;  2W0G A;  3CQC B;  1YD8 G;  3HR0 A;  1MND A;  4YXD A;  3QB5 K;  4HFC A;  3ZJ1 A;  4DR2 T;  2BBH A;  2BKP A;  3L39 A;  2N1G A;  1KNZ A;  5JDH A;  4JV5 T;  4DV1 T;  3B13 A;  4H63 H;  2CM0 A;  4LF7 T;  4YHH T;  4KMC A;  5F8P A;  4MLK A;  4UEM A;  4DR6 T;  2LRK A;  4JI6 T;  3K3O A;  1L0V A;  3EAM A;  2IUB A;  1YW0 A;  5AQF B;  4IE4 A;  2CXL A;  2KLQ A;  1V9D A;  4Z8X A;  3HKE E;  4ZI3 D;  4HFB A;  4G2A A;  3N2K E;  3N9P A;  2ZM2 A;  2C0S A;  2V5C A;  3VR8 A;  4LFC T;  2WDR A;  4NPP A;  4DR3 T;  5L4E A;  3PUY F;  2PTF A;  5FYM A;  4C91 A;  3C64 A;  2L9Q A;  4GYR A;  3RH3 A;  4JI2 T;  5L3F B;  4TV8 E;  2N9D A;  2V7J A;  1UGO A;  2LE8 A;  5IHY A;  3MA9 A;  2I6H A;  3KV6 A;  1IBK T;  1KFY A;  1US7 B;  1HNW T;  2NR4 A;  1YQ4 A;  2XUE A;  3DP7 A;  1HFA A;  4QXH B;  4UEL A;  5FKY A;  2XAG B;  3SWH A;  3PTR B;  3ZMT B;  3UUX B;  4OFZ A;  2JQH A;  4K0K T;  2E8I A;  2XTL A;  3VRA A;  3K8P C;  3C50 A;  3A7M A;  1T98 A;  5CB4 E;  4Z90 A;  3PU8 A;  4BJN A;  3T8O A;  4HN9 A;  3C51 A;  3EDU A;  1XZY A;  3AE1 A;  4LMJ A;  2A9U A;  3EVY A;  2QRX A;  3I9Y A;  4JLE A;  2XSA A;  4IDN A;  5JDQ A;  2CRB A;  3MZK B;  3WAK A;  1WR0 A;  4NUU A;  3VKG A;  2JMH A;  3D0T A;  1UX5 A;  3IEE A;  2LSG A;  4OK0 A;  5L3E B;  3HKD E;  4H9N C;  4U74 A;  2A2F X;  3FZH B;  5KX5 E;  2PBI A;  5LYJ E;  4HFH A;  2CCQ A;  2K3W A;  3AE9 A;  1MMA A;  2EHO C;  5LCY A;  4AQF A;  2WP9 A;  2K9A A;  5AQP B;  4B3T T;  1Z8U A;  3J9X 1;  4JI3 T;  5JR9 A;  4DV2 T;  2NP9 A;  5JRE A;  2E9X C;  2RPA A;  3PUG A;  5LGT B;  3C98 B;  4DV6 T;  5HXR A;  5DAB A;  3UU6 A;  5CA0 E;  4QXB B;  1NWM X;  4X66 T;  2BS2 A;  4CI2 B;  1I6Z A;  3G06 A;  3P4S A;  4UV9 B;  3H3A A;  4NXN T;  3LBX B;  1XMO T;  4O4J E;  4U31 A;  1LVK A;  4DID B;  4X64 T;  4DVD A;  1WYC A;  4CQI A;  3MKD A;  3AA7 B;  2XAH B;  3QB5 A;  1O3X A;  4AQY T;  3LDQ B;  4BA9 A;  4EV6 A;  4UVB B;  5LGN B;  2XQ9 A;  2LSK A;  2WU2 A;  4ZHQ E;  5AQM B;  4DR1 T;  2NOX A;  4YY3 T;  2D5U A;  3TLU A;  3LSV A;  2H3R A;  2VWA A;  3UU5 A;  3QNU A;  3VKH A;  3ZJ2 A;  3RLF F;  2C5I T;  3ZT5 A;  2CWY A;  4KBM B;  4IE5 A;  3NWI A;  4CXY A;  3N2G E;  2V5D A;  2X0L B;  1U5P A;  4IDP A;  3NZQ A;  3RYF E;  4CN4 A;  1VCS A;  4LF4 T;  4PFP A;  4EXT A;  3I0Q A;  5AQI B;  1NEN A;  4GOU A;  2YIN A;  2BS4 A;  3MXZ A;  3BK9 A;  3O4X E;  5DQW A;  3LG7 A;  2V6Y A;  4HKA A;  2HHH T;  5HEG A;  3LK3 B;  2M6B A;  2EHO B;  2EHO D;  4YJ2 E;  3HKB E;  4HGA A;  2BVL A;  5EK4 A;  1Z0P A;  4OYK A;  4WW0 A;  5AQL B;  5ADX L;  5KDM C;  4AXP A;  4H9S E;  4ZOL E;  4GKJ T;  1FMV A;  1HS7 A;  2E9X B;  2XQA A;  4JBW F;  3V5S A;  2FBW A;  3NZP A;  2Y8D A;  2XAS B;  1QSD A;  3O9X A;  3ANW B;  2X68 A;  4KHZ F;  4KI0 F;  3R84 B;  3K3N A;  4AQF C;  1HX8 A;  2B1E A;  5FNV E;  1HNZ T;  2W66 A;  2FJB A;  3AE4 A;  5HEH A;  5JR9 C;  1KNP A;  3ZN0 B;  1ZKE A;  3B5M A;  1XMQ T;  3AXJ A;  2JQ9 A;  2JPF A;  4JI8 T;  1U4Q A;  3E0Z A;  4IHJ E;  5H6Q B;  3BQI A;  4H63 V;  1HG2 A;  3AA6 B;  2IAK A;  1E1H B;  1BR1 A;  2Q9Q D;  2XQ7 A;  2HH7 A;  3AB3 B;  1HCI A;  2V7K A;  1W0A A;  4WNK A;  4QKN A;  1DU2 A;  1KNR A;  4P0A A;  4ZEY A;  4O8S A;  1YKE B;  3AE7 A;  3ZEF B;  2XPK A;  4L5G A;  4GKK T;  4PW8 A;  2HPL A;  3K3Q C;  4IDZ A;  5HCJ A;  4DR7 T;  3WI3 A;  5DQV A;  1D1A A;  1Y64 B;  3FXE B;  2M6I A;  2WZI A;  3KVB A;  2X0Y A;  3V5U A;  4DMV A;  4LF9 T;  4KHP T;  2XM2 A;  1OED A;  3U3I A;  4PJL A;  2LEH A;  1KEY A;  3DTO A;  3ZCI A;  2BZB A;  3RYI E;  3OTO T;  5LJM A;  3AE6 A;  4QHO A;  4CI3 B;  5HXE A;  1HTJ F;  5LOV E;  4N78 D;  3I0O A;  4ILU A;  3RX6 A;  5JRC A;  5H6R B;  2CHO A;  3K1S A;  2YKS A;  4TWD A;  4YTN A;  2LOP A;  1J5W A;  2NTX A;  1NEK A;  2MBG A;  4KP3 C;  4TX5 A;  4HFE A;  3LJC A;  4I50 E;  3NRX A;  4PK4 A;  3UUM A;  3ZMZ B;  4UF0 A;  3UUN A;  3AA1 B;  2V7M A;  2BKO A;  1AJ3 A;  5LBQ B;  5LXT E;  4AKH A;  2W67 A;  5FVL A;  4JEU B;  3P4Q A;  5HCM A;  2QVA A;  1S94 A;  1XDO A;  2BG9 C;  2KXP B;  5HXH A;  3P4R A;  3IHR A;  2BG9 E;  3J7Y q;  1JNR A;  2VKD A;  4EEB A;  1HF8 A;  3R6N A;  4O2A E;  2IDO B;  5FXW A;  3QOF A;  3AEF A;  5IUX A;  2VVS A;  3ETV A;  3N9Q A;  4WBO A;  5JR9 B;  5AQG B;  2W61 A;  3PUV F;  1W9R A;  2X66 A;  2XQ6 A;  2L3L A;  1XNR T;  4HE8 A;  3JC6 C;  1LVF A;  5HEJ A;  4DUZ T;  4H9O C;  5HEU A;  3NBX X;  4XAX B;  2OLT A;  1D0X A;  3MJX A;  3UFG A;  2DHR A;  3UT5 E;  3QC9 A;  4EYY R;  1XNQ T;  1CUN A;  1E2A A;  3UFE A;  3CX7 B;  4EGW A;  5AQT B;  3M65 A;  2XQY A;  5L4H A;  2PJQ A;  2BDE A;  4QXC B;  2G0U A;  1WYB A;  2CBJ A;  1OXZ A;  2CXF A;  4O4H E;  2LKG A;  1R8I A;  5LHH B;  3VU7 H;  4GIW A;  1I94 T;  2DWK A;  5KXJ A;  4ADZ A;  4Z91 A;  2BBJ A;  3GN5 A;  2RA1 A;  4GK0 E;  3SS1 A;  3GWH A;  4JI1 T;  3N2O A;  3ZC0 A;  4TZ4 C;  4IL4 A;  4H9R C;  2WAU A;  5DJQ C;  5L3B B;  1OWA A;  4ZI2 C;  1MMD A;  1LRZ A;  2CEA A;  4JI5 T;  2LM2 A;  3C4Z A;  2LJL A;  4GYS A;  4U2Z A;  1QLB A;  5CJ5 A;  5LHI B;  3ZYM A;  2WDV A;  4X1Y E;  1OED C;  1VRB A;  1OED E;  2X9Y A;  4QX7 B;  2FUP A;  4U7Y A;  3FZL B;  3HA4 A;  1ZHC A;  2I0M A;  4O2B E;  2KWI B;  2V6Y B;  2C5J A;  4XZC A;  2XAF B;  4OYJ A;  3CX6 B;  3RI5 A;  4DR5 T;  5C2T A;  2BS3 A;  5HAX A;  1N33 T;  3KBT A;  2D9D A;  4U33 A;  3MK7 C;  3GA8 A;  3ONJ A;  3RIU A;  5HWY A;  5TAO A;  1IZN B;  1UCU A;  2UXC T;  2IW5 B;  3AAI A;  2JRK A;  3SOL A;  3AA0 B;  3UU4 A;  2LT3 A;  2CPT A;  3KFW X;  3PUX F;  4AIU A;  4DV4 T;  4CI1 B;  4WBN E;  2DWG A;  3C4W A;  2GK9 A;  5AQR B;  3RPU A;  4CXX A;  4U7I A;  3X1D A;  3NVO A;  4I55 E;  3N9N A;  5LHG B;  1BR0 A;  1H7C A;  3AXJ B;  2CE7 A;  3T1H T;  1WLX A;  5J0Z A;  1MMN A;  5J1G A;  2WBL A;  2XQ3 A;  2LOS A;  2X51 A;  5JDM A;  4HFI A;  4DO0 A;  3E08 A;  2V6X A;  3OYZ A;  3P8C D;  3PE0 A;  5C3J A;  2ZLY A;  4DV5 T;  4DV3 T;  4HWF A;  5JDF A;  1IJ5 A;  3CKD A;  2ACZ A;  3I1A A;  1MNE A;  1SE7 A;  5LB7 B;  4ZI2 D;  3ZPO A;  5L47 A;  5LMN T;  2DI4 A;  2VL8 A;  2NW7 A;  3NKZ A;  4B3S T;  2N2N A;  3CQG B;  4E7Z A;  3OPC A;  3FZF B;  3F2E A;  3N9O A;  4EIW A;  2ZMA A;  3I9W A;  2OA5 A;  2KZ7 B;  4NXM T;  5AQO B;  5HWX A;  2UUA T;  2C5K T;  3P4P A;  5JRC B;  2X9H A;  3RF1 A;  3FBL A;  4K0U A;  5AQQ B;  2BG9 A;  3KDS E;  5LJN A;  4UF0 B;  5F5W A;  1MMG A; 
#chains in the Genus database with same CATH homology
 4LFB T;  4X65 T;  4LFC T;  4DR3 T;  1HNX T;  3T1Y T;  2UUB T;  1XNQ T;  1FJG T;  2ZM6 T;  1HNZ T;  3OTO T;  1J5E T;  4JI4 T;  4DV5 T;  4B3T T;  4DV3 T;  4LFA T;  1HR0 T;  4JI3 T;  2E5L T;  4JI2 T;  4DV2 T;  1N36 T;  4DR4 T;  4DR5 T;  2F4V T;  2UUC T;  1XMQ T;  1N33 T;  5BR8 T;  4DV6 T;  4LF8 T;  4JYA T;  4JI8 T;  1IBK T;  4LF4 T;  2UU9 T;  1IBL T;  1HNW T;  4DV0 T;  2UXD T;  4B3R T;  4X66 T;  5LMN T;  4LF5 T;  2UXC T;  4OX9 T;  1I94 T;  2VQF T;  1IBM T;  4X62 T;  4B3M T;  4NXN T;  4B3S T;  1N32 T;  1XMO T;  4K0K T;  2HHH T;  4DV4 T;  2UXB T;  4DR2 T;  4X64 T;  4NXM T;  4JI1 T;  4DUY T;  2UUA T;  4JV5 T;  4DV1 T;  4AQY T;  4LF7 T;  4GKK T;  2VQE T;  4YHH T;  4JI0 T;  5LMU T;  4JI5 T;  4GKJ T;  4DR7 T;  4DR6 T;  4JI6 T;  4LF6 T;  4DR1 T;  4YY3 T;  3T1H T;  1XNR T;  4JI7 T;  4DUZ T;  1N34 T;  4LF9 T;  4KHP T;  5IWA T;  4DV7 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...