4DV6T

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a915g
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 37
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4dv6T00
4LF6T 4DUZT 2UUAT 4YY3T 1XMOT 4JI3T 4DV0T 4LF4T 3OTOT 4DR6T 4LF7T 5IWAT 4X64T 1N34T 4DR3T 1N32T 5LMUT 1XMQT 4GKKT 5LMNT 4JI8T 2E5LT 4JI0T 4X66T 4B3TT 4DV2T 2F4VT 4B3ST 1HNXT 2VQET 4DR2T 1N33T 4B3RT 4K0KT 3T1YT 4DV1T 4JV5T 4DR1T 4JYAT 3T1HT 2VQFT 2ZM6T 4NXNT 4JI2T 5BR8T 1HNZT 4JI1T 4DV4T 4DV6T 4X65T 4JI6T 4DUYT 4DR5T 1XNRT 4X62T 4NXMT 4KHPT 1HR0T 4JI7T 4DV7T 1HNWT 4DV3T 4LF8T 4LFCT 2HHHT 4B3MT 2UUBT 4LF5T 4DR4T 1I94T 4DV5T 4LF9T 2UU9T 1FJGT 1XNQT 4JI4T 2UXCT 4DR7T 4LFAT 4OX9T 1J5ET 2UXBT 4JI5T 2UUCT 4YHHT 1IBKT 4AQYT 1IBLT 1IBMT 1N36T 4GKJT 4LFBT 2UXDT
chains in the Genus database with same CATH superfamily
4JEUB 2MBGA 4DIDB 2CWOA 3UU3A 5AQFB 4LF6T 2QVAA 4HKAA 4AKLA 3QUJA 4P0AA 4I4TE 1OEDA 5ADXL 5HCJA 4YY3T 3I9WA 4ISSA 2DWKA 2W0GA 4JI3T 3UFEA 4ZHQE 5LJNA 2WZIA 1ZOYA 2LT3A 3IEEA 2I0MA 5LBMA 1HG2A 3CPZA 4DVDA 4DR6T 3R84B 1ZKEA 4CI3B 3ZN0B 5JR9B 2XAHB 4DR3T 1MNEA 2P9BA 3K1SA 4UF0B 1BR4A 3KVAA 1N32T 5HEGA 2X66A 3NRYA 4QXCB 3AE1A 3LFMA 2FUPA 4O4JE 3SFEA 1OXZA 2E5LT 4KBMB 4AKHA 4AKGA 3JC6D 2IAKA 1YQ3A 2NW7A 4B3TT 4EXTA 1N33T 1X79A 5EK2A 1HCIA 2YDRA 4IHJE 4M1PA 4ILBA 5J2UE 4AQFA 2YU1A 1AJ3A 2GK9A 3BQLA 3RIAA 2CCQA 2WMOA 3LBXA 3MACA 3LDQB 1Z0PA 4E7ZA 2LKHA 4UVAB 2LJLA 4UVCB 3QB5K 4ASKA 3K8PC 1E7PA 3M65A 4XZCA 4DR2T 2VASA 1NEKA 3BQIA 4B3RT 5FXVA 3R6NA 1XZYA 3AAEB 3N2OA 3UFGA 3N2GE 1FMWA 1Y01A 2DHRA 3AE8A 3O4XE 4IT4A 5AQQB 3EHZA 3PV0F 4Z8XA 4G2AA 5L4HA 3P50A 2W63A 4F8HA 4PK4A 2VVSA 2UXXB 2XY8B 3P7IA 4J2CA 5FMNA 3GMIA 2ZMAA 2NW9A 3VR8A 2K48A 1D0ZA 2B1EA 4DMVA 4EIWA 4X5TA 3ZT5A 3J7Yq 2VQFT 3T1HT 3CIRA 2ZM6T 4ZZBA 3PUXF 3MKDA 4MHCA 4JI2T 2JMHA 5DJQC 4IE5A 4Z90A 5JQGE 5LG3A 4U3CA 2JPFA 4JI1T 5HXRA 2E9XA 3RYFE 2L3LA 3AE6A 4X1YE 2VB6A 4EAHA 4OYJA 4COFA 3LK3B 2LLYA 3AEFA 1CUNA 3KBUA 3PUVF 4QKNA 2OA5A 3RC3A 4JI6T 1B7TA 4DR5T 4L0RA 4TX5A 3AEGA 2XAGB 3I0QA 4I50E 4I55E 3HR0A 4AXPA 4YTPA 4JI7T 4GIWA 2CM0A 2LEHA 4DO0A 1M7KA 2KINB 4IL4A 2XQYA 4LF8T 2CBIA 2CA5A 2J62A 2V6XA 4LMLA 5JDHA 4ZI7E 2KWIB 5AQRB 1QUUA 2KXPB 2XQ3A 3JADA 3OKQA 3KV6A 3RQUA 3QB5A 1LRZA 3QNUA 1UUSA 2X68A 3AE5A 3CQXC 3N5LA 3AE2A 4WNKA 5HXCA 2D0UA 2CRBA 4H9OC 2D0TA 1SUMB 4DBRA 3VKGA 5F3JA 3J9X1 5L47A 1YKEB 4LF5T 4DR4T 4TV8E 2N9DA 4TN7B 3V5UA 4UXNB 4EZHA 4EB6E 2BG9C 3PUZF 3IA3A 3ZJ1A 5HYAA 5HXEA 1FJGT 1O3XA 2CXFA 2YU2A 1XNQT 4L9IA 2Y6XA 4NUVA 4ZS2A 4DR7T 4AKIA 3H37A 2V7MA 2OLTA 2CMRA 2XQ4A 3AXJA 5KXJA 2X9YA 4GYRA 4X1IE 5GONE 2JIWA 5AQGB 3RIUA 1J5ET 5FY7A 4UR9A 3RPUA 4ERRA 1KEYA 1U5PA 2NOXA 4O4HE 4JI5T 5JTGA 2UUCT 3OPCA 4ADZA 2Z6EA 5DQVA 4CXWA 1MIYA 2JQHA 2YN6A 1E2AA 3ANWB 3RKOA 5ABFB 2H89A 1IBKT 3CKDA 1UCUA 3FBLA 3AB3B 3P4SA 5AQIB 4O8SA 2WU2A 4FJOA 4TWDA 5DQWA 2DWGA 5JDGA 3NBXX 2K24A 1E1HB 2A9UA 4KHZF 4EYYR 4C90A 4HFIA 2WZHA 5LG4A 4ANJA 3QK6A 3I0OA 3UQ4A 2I59A 5IHYA 2BS3A 4KMCA 5ABHA 2UUAT 5LHIB 3ZC1A 2CEAA 4QXBB 1XMOT 3FBZA 3ZT6A 3FXEB 3B5MA 3KV5A 5AQHB 1MMAA 4YHJA 4A5XA 3CWZB 3TLSA 3AEDA 4EOZB 3OTOT 1UK5A 3N9MA 4N78D 4PJNA 1D0YA 5KDMC 5IUXA 2IMLA 2FJAA 3NRXA 4X64T 3ETVA 3AE3A 4UV8B 2V5DA 1MIWA 2YK0A 3ETUA 3KVBA 3PDYA 4NUUA 4YLHA 5FXXA 1QSDA 2LM9A 2H88A 1SHZC 2WB5A 1V9DA 2ODUA 3UULA 4GKKT 2XJ7A 2CBJA 4JI0T 4QWNB 1R8IA 4UELA 5E0OA 5FNVE 1WCRA 4AISA 4XBFB 2M6IA 2E9XD 3HKDE 4MBQA 3UU6A 2H7OA 3CX7B 3NKZA 5F5WA 2BS2A 2DI4A 4IE7A 4B3ST 1M62A 3K3NA 5LGTB 4U2ZA 2ES0A 4EGWA 2EHOD 2VQET 3RYHE 4HFEA 5HAXA 3ZYMA 4EYUA 4F6RC 4IDZA 3MZKB 4K0KT 5L4EA 4IDOA 5IYZE 3KDSE 4L5GA 3AEBA 2Y8DA 3PU8A 3SS1A 3T1YT 2BKOA 1UX5A 2NTXA 3HI2A 4UIGA 4ZS3A 4MFRA 5AQTB 3ZCJA 2ODVA 5ETWA 5J2TE 2NWBA 1L0VA 4ILUA 2FBWA 2LOPA 4HWCA 2BG9A 5AFUL 5JH7E 2KLQA 3SOLA 4IE6A 5JDQA 3RC8A 5AQUB 3RQWA 4TWHA 5LP6E 4H9NC 3EAMA 3L09A 1VCTA 5BR8T 4CQIA 2KSRA 4GYSA 1HNZT 1T8BA 3FZHB 4HFHA 3GN5A 4IDPA 4OHFA 4H9SE 4WZXA 3A8YC 2QRXA 4EEBA 3WAJA 1OWAA 3QOFA 5FYMA 4DV6T 3OBVE 1KNRA 4OK0A 5AQJB 4YFSA 4X65T 2XQ6A 5LXTE 1SA0E 4PJLA 2B76A 2BDEA 3PUSA 3PU3A 3TKLB 3PUYF 3RYCE 1HR0T 5JRCA 1FEWA 2J1DG 1FIOA 5JDLA 3H3MA 3C4ZA 3PTRB 4IDQA 1FMVA 3U3IA 5EZYE 3ZKRA 3HKEE 2JRKA 1W0BA 4HEAA 4AKRB 4LFCT 2YOEA 3LSVA 3O9XA 2BBJA 1XDPA 4DMWA 5C8YE 2UUBT 5LCYA 1ZEEA 2V1DB 2H7VC 2YEVC 1IJ6A 3HL6A 2XSBA 3LK42 3Q9DA 2V5CA 4HFBA 3CVRA 4ZI3C 3AAAB 2LOSA 3B13A 3E08A 3U78A 4OFZA 3JAFA 4U72A 2XSAA 3RKGA 2D2SA 4AIUA 3MXZA 3ZT7A 2PTFA 2RA1A 2R6GF 4UF0A 3E22E 4PJJA 1I94T 4WBOA 3AEEA 2WDQA 3RRWA 1KK7A 3D0TA 1HG5A 3A5XA 4GK0E 4QX8B 3PURA 2WS3A 4TZ4C 4U31A 5FXWA 4HGAA 4CXYA 4JI4T 1HF8A 2HN2A 2YDQA 4IREA 4OX9T 3JCFA 3AA0B 4Z91A 2D9DA 3MK7C 2ZM8A 3KV9A 4HFCA 5EK4A 2IHR1 5HWYA 4GK5E 1SE7A 2CHOA 1J1JA 4PNIA 4JLEA 2DLRA 3FXDB 3N9LA 3OJAA 5HXHA 2V7LA 1MIVA 3RRCA 2JMKA 1IBLT 3PUGA 2IUBA 3UTKA 3FZKB 3ESLA 5HEUA 2M67A 3P4QA 4X20E 5LJMA 3AVRA 1LKXA 3OYXA 2IIUA 3UUXB 1X9BA 1N36T 3UQ7A 1KNZA 4LFBT 2CLYC 4P09A 5L3CB 4YJ3E 2BVLA 3L3PA 1H7CA 2J47A 2X67A 3LG7A 3RIFA 4JEHB 3W15B 4NIQA 1JNZA 3ZC0A 3IBPA 2V7JA 2G0UA 2BS4A 2EHOB 2XTLA 3UU8A 5L3GB 4DUZT 4LF7T 2XM2A 3UUNA 2CE7A 2JJ9A 3M3ZB 4ZOLE 1HX8A 3EDVA 2Q9QC 2Y48B 4EZ4A 2ACZA 2ZLYA 4PFPA 1US7B 2AE9A 2Q9QD 2WMNA 3RIUC 5IWAT 1WR0A 2WU5A 2W4XA 2PFVA 5FKYA 3SWHA 4KUMB 2E2AA 4CN4A 3RI5A 3N9PA 1N34T 3ONJA 2LHNA 2LSIA 4U7YA 3AE7A 3RHWA 3CX8B 3OVUA 4Q25A 4UV9B 2PG8A 2FJBA 3HKCE 3C4XA 3KINB 3JC6C 3OYZA 4YSZA 1UURA 4DBQA 2W66A 2XZEA 3ZCIA 4LMJA 5FVLA 5LB7B 3GWHA 3V5SA 3ZYKA 2V6YA 2VKOA 4IDNA 3KBTA 3VRAA 3ZMZB 2X9HA 2XQAA 1KFYA 2LSYA 4O4LE 2F4VT 2XHEB 3F2EA 1HNXT 4U7IA 2BZBA 1OEDB 5JREA 1CHUA 2EHOA 4HWHA 4CN6A 3TLTA 1YW0A 4BJMA 1KF6A 2E9XB 2JQQA 3ABVA 2E9XC 3C98B 4HN9A 5CFBA 4WW0A 2JQ9A 2K9AA 5JR9C 5CGMA 3FHNA 3LK2B 3T8OA 1IAPA 4DR1T 4DV1T 4TWFA 1OEDC 2WDRA 2X0LB 2NTYA 5F8PA 3RGLA 2ZM2A 5LOVE 1NAFA 5HWXA 4HE8A 5AQMB 4U33A 2VWAA 3E0ZA 4XAXB 2BKNA 4ILCA 3G06A 3BK9A 2BVMA 3EUHA 3ZSTA 2LSGA 3FZFB 3RYIE 1ZHCA 3PUAA 2VKHA 4PK5A 3DTOA 4BA9A 3C64A 4NXNT 1I6ZA 4O4IE 3AA1B 3VKHA 4ZI2D 5HXSA 3TLWA 1MMNA 2ZM0A 4A98A 2LSKA 1W9RA 3N9QA 4YSXA 3RLFF 2W2UA 4IE4A 4DV4T 3DJBA 4DV3T 4ZXLA 4BJNA 4IE0A 1D1CA 4CN1A 4KX6A 3UUMA 3H3AA 5JDMA 1NWMX 3Q5WA 4KP3C 4EEDA 1UGOA 1Y64B 1HNWT 4ZI2C 2WM9A 3C51A 4P1NA 2Q9QB 3ZPOA 2VL8A 3PJAJ 4ZEYA 5AQPB 4HWFA 3C4WA 2W00A 3N9NA 5HCMA 4MALA 2X0HA 2HHHT 3JAEA 4B3MT 2MPKA 3HA4A 3ZMUB 2EHOC 1W0AA 2AXDS 2KZ7B 3B57A 5J1GA 4IIJE 1BR0A 1WR6A 2MAWA 2X9WA 1NENA 2X0YA 2VVNA 3EDUA 5L3EB 2WY2A 2HPLA 2KWHA 1BR1A 2X9XA 3L39A 2N2NA 2CLYB 2A3DA 3CX6B 2YDSA 2E8IA 1MMDA 1IZNB 2CXLA 2NR4A 2SPCA 3SFDA 2X51A 3K3QC 5FL1A 3LJCA 4DV5T 4CZZB 5CA1E 1D0XA 4CI1B 4G63A 2UU9T 4LF9T 2FJDA 5M4YA 5LA6E 5L3DB 4CI2B 2Q9QA 3L8RA 2H3RA 4O2AE 1UX4A 1D1BA 2K3WA 3AECA 2WDVA 3RX6A 4YTNA 1QLBA 2DNXA 2MYSA 3I9YA 2E5VA 3EVYA 2N1GA 1LVFA 2KT9A 3PUWF 3PE0A 1LVKA 5C2TA 2K5BB 2FJEA 3F31A 5DABA 5C3JA 2V8SV 2XASB 2VURA 3O1HA 4YHHT 4H9PC 4TUYE 4TV9E 1WYCA 4WYVA 1T72A 1U4QA 1D1AA 3QC9A 2LRKA 4AQYT 5AQKB 4YJ2E 1IBMT 1HS7A 2I6HA 5ABFA 4GKJT 5LNKA 2XQ8A 4A56A 2A2FX 2YINA 4QH5A 4HFVA 5CA0E 5JVDE 3AA7B 5J0ZA 1T98A 1BR2A 4PAGA 5EK3A 3GN5B 3Q5EA 3S4UA 2RPAA 2XAQB 1ZV4X 5KX5E 1VRBA 1YXRA 2LRLA 4DV0T 5LYJE 5L2LA 2JQKA 4LMKA 5FY0A 3ONXA 3TLVA 2IDOB 3AXJB 5A1LA 5ABEA 1Z8UA 4LF4T 1VOMA 3SRZA 3UU5A 4HTEA 4HWDA 1VCSA 3CQGB 1WLXA 4X1KE 4I0UA 3UT5E 4A97A 1XDOA 3FZLB 3ZMVB 3BQKA 4JUYA 2W67A 1YD8G 3ZSSA 4QX7B 5TAOA 1YQ4A 3VHLA 2BKPA 1YKHB 2HH7A 4YTMA 2XQ5A 4PW8A 4B6XA 2WAUA 5LBQB 1HFAA 2A72A 2J4GA 3C50A 3FB2A 5FY1A 5LMUT 1T7SA 1G73A 1XMQT 4K0UA 2XUEA 3ZJ2A 5LMNT 4JI8T 3EABA 2XQ7A 5AQSB 4HWIB 4HFDA 5KMGP 4X66T 3MA9A 2CWYA 2KNDA 5AQLB 1JNRA 3AAIA 4DV2T 3CMLA 3LBXB 1MNDA 5BMVE 2D5UA 2OV9A 2HPJA 3A7MA 3IF8B 4IL9A 2PJQA 3N2KE 4NPPA 4C91A 2VKDA 2KMFA 4H9RC 4PJMA 2M6BA 3ZLIA 1ZP0A 3AEAA 1HX1B 2V7IA 2NW8A 3Q5DA 2HN1A 3VRBA 1KNPA 3ZYLA 1HTJF 2LM2A 1J5WA 2RP4A 3AVSA 3KFWX 3PJAA 4PFOA 3FZMB 4UVBB 3UU4A 4DNDA 4UEMA 5JR9A 5L3BB 5LGUB 2BBHA 2V7KA 4AI6A 3ZEFB 2VKJA 2IC6A 1GQEA 4JV5T 2MTQA 4I43B 2CHNA 2W61A 5H6QB 2CPTA 4TNVA 2L9QA 5FP3A 3AE9A 4JYAT 2QGSA 2DCFA 1S35A 2C5KT 5AQOB 5JDFA 5AQNB 2QA7A 3DP7A 4E7SA 4TNWA 2VL0A 4O2BE 5FL0A 2WWVA 3EI0A 3F57A 3NZPA 3Q2MA 4MLKA 2V6YB 3VR9A 3NVOA 2XAJB 4QH4A 2LE8A 2PBIA 2NP9A 5JDNA 2V26A 2XAFB 5HEOA 3ONLC 3ZN1B 2DL1A 1WRDA 4BAYB 4DUYT 1EZ3A 1XNRT 4X62T 4NXMT 4KHPT 3CK6A 2IW5B 4CXXA 3PUQA 4AQFC 4DV7T 3AA6B 3WI3A 3IHRA 3I1AA 3P8CD 2WP9A 5CB4E 2WCAA 2UXNB 4KI0F 1MMGA 2LSJA 3Q5XA 3X1DA 3O1IA 5LGNB 2LHRA 4H9QC 1W09A 4YSYA 2L8KA 1XWMA 4P0BA 4ZZCA 3RF1A 3AE4A 2WBLA 2YKSA 2C5IT 3NZQA 2WQYA 2WWUA 1S94A 3O1JA 3P4PA 1IJ5A 3HKBE 2QYWA 5ABGA 4YT0A 3RH3A 3MJXA 3UUBA 4ISTA 4U2YA 3ZMSB 3CQCB 1WFDA 3GA8A 2XPKA 4FI5A 4JBWF 4QH1A 4QHOA 2XQ9A 3WAKA 4EV6A 2WSSV 3P4WA 4V1Av 4ILAA 1WYBA 5HEJA 3TLUA 4ZI3D 2UXCT 2LKGA 2MOZA 4LFAT 2IC9A 4IGUA 5JRCB 5LHGB 2VK9A 5L3FB 2W62A 2UXBT 1DU2A 4AQGA 3P4RA 4OYKA 5H6RB 2ACXA 3K3OA 5FVKA 2XM1A 4GOUA 3NWIA 3N9OA 4PK6A 5LHHB 2CXDA 3KV4A 2C5JA 1G8XA 2BG9E 2BG9B 5AQVB 4U74A 5HEHA 4WBNE 5CJ5A 4H63V 3ANWA 2C0SA 4YXDA 2UXDT 5FXZA 3ZMTB 3VU7H 1OEDE 4H63H 4QXHB
chains in the Genus database with same CATH topology
4LF6T 4DUZT 2UUAT 4YY3T 1XMOT 4JI3T 4DV0T 4LF4T 3OTOT 4DR6T 4LF7T 5IWAT 4X64T 1N34T 4DR3T 1N32T 5LMUT 1XMQT 4GKKT 5LMNT 4JI8T 2E5LT 4JI0T 4X66T 4B3TT 4DV2T 2F4VT 4B3ST 1HNXT 2VQET 4DR2T 1N33T 4B3RT 4K0KT 3T1YT 4DV1T 4JV5T 4DR1T 4JYAT 3T1HT 2VQFT 2ZM6T 4NXNT 4JI2T 5BR8T 1HNZT 4JI1T 4DV4T 4DV6T 4X65T 4JI6T 4DUYT 4DR5T 1XNRT 4X62T 4NXMT 4KHPT 1HR0T 4JI7T 4DV7T 1HNWT 4DV3T 4LF8T 4LFCT 2HHHT 4B3MT 2UUBT 4LF5T 4DR4T 1I94T 4DV5T 4LF9T 2UU9T 1FJGT 1XNQT 4JI4T 2UXCT 4DR7T 4LFAT 4OX9T 1J5ET 2UXBT 4JI5T 2UUCT 4YHHT 1IBKT 4AQYT 1IBLT 1IBMT 1N36T 4GKJT 4LFBT 2UXDT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF6 T;  4DUZ T;  2UUA T;  4YY3 T;  1XMO T;  4JI3 T;  4DV0 T;  4LF4 T;  3OTO T;  4DR6 T;  4LF7 T;  5IWA T;  4X64 T;  1N34 T;  4DR3 T;  1N32 T;  5LMU T;  1XMQ T;  4GKK T;  5LMN T;  4JI8 T;  2E5L T;  4JI0 T;  4X66 T;  4B3T T;  4DV2 T;  2F4V T;  4B3S T;  1HNX T;  2VQE T;  4DR2 T;  1N33 T;  4B3R T;  4K0K T;  3T1Y T;  4DV1 T;  4JV5 T;  4DR1 T;  4JYA T;  3T1H T;  2VQF T;  2ZM6 T;  4NXN T;  4JI2 T;  5BR8 T;  1HNZ T;  4JI1 T;  4DV4 T;  4DV6 T;  4X65 T;  4JI6 T;  4DUY T;  4DR5 T;  1XNR T;  4X62 T;  4NXM T;  4KHP T;  1HR0 T;  4JI7 T;  4DV7 T;  1HNW T;  4DV3 T;  4LF8 T;  4LFC T;  2HHH T;  4B3M T;  2UUB T;  4LF5 T;  4DR4 T;  1I94 T;  4DV5 T;  4LF9 T;  2UU9 T;  1FJG T;  1XNQ T;  4JI4 T;  2UXC T;  4DR7 T;  4LFA T;  4OX9 T;  1J5E T;  2UXB T;  4JI5 T;  2UUC T;  4YHH T;  1IBK T;  4AQY T;  1IBL T;  1IBM T;  1N36 T;  4GKJ T;  4LFB T;  2UXD T; 
#chains in the Genus database with same CATH topology
 4JEU B;  2MBG A;  4DID B;  2CWO A;  3UU3 A;  5AQF B;  4LF6 T;  2QVA A;  4HKA A;  4AKL A;  3QUJ A;  4P0A A;  4I4T E;  1OED A;  5ADX L;  5HCJ A;  4YY3 T;  3I9W A;  4ISS A;  2DWK A;  2W0G A;  4JI3 T;  3UFE A;  4ZHQ E;  5LJN A;  2WZI A;  1ZOY A;  2LT3 A;  3IEE A;  2I0M A;  5LBM A;  1HG2 A;  3CPZ A;  4DVD A;  4DR6 T;  3R84 B;  1ZKE A;  4CI3 B;  3ZN0 B;  5JR9 B;  2XAH B;  4DR3 T;  1MNE A;  2P9B A;  3K1S A;  4UF0 B;  1BR4 A;  3KVA A;  1N32 T;  5HEG A;  2X66 A;  3NRY A;  4QXC B;  3AE1 A;  3LFM A;  2FUP A;  4O4J E;  3SFE A;  1OXZ A;  2E5L T;  4KBM B;  4AKH A;  4AKG A;  3JC6 D;  2IAK A;  1YQ3 A;  2NW7 A;  4B3T T;  4EXT A;  1N33 T;  1X79 A;  5EK2 A;  1HCI A;  2YDR A;  4IHJ E;  4M1P A;  4ILB A;  5J2U E;  4AQF A;  2YU1 A;  1AJ3 A;  2GK9 A;  3BQL A;  3RIA A;  2CCQ A;  2WMO A;  3LBX A;  3MAC A;  3LDQ B;  1Z0P A;  4E7Z A;  2LKH A;  4UVA B;  2LJL A;  4UVC B;  3QB5 K;  4ASK A;  3K8P C;  1E7P A;  3M65 A;  4XZC A;  4DR2 T;  2VAS A;  1NEK A;  3BQI A;  4B3R T;  5FXV A;  3R6N A;  1XZY A;  3AAE B;  3N2O A;  3UFG A;  3N2G E;  1FMW A;  1Y01 A;  2DHR A;  3AE8 A;  3O4X E;  4IT4 A;  5AQQ B;  3EHZ A;  3PV0 F;  4Z8X A;  4G2A A;  5L4H A;  3P50 A;  2W63 A;  4F8H A;  4PK4 A;  2VVS A;  2UXX B;  2XY8 B;  3P7I A;  4J2C A;  5FMN A;  3GMI A;  2ZMA A;  2NW9 A;  3VR8 A;  2K48 A;  1D0Z A;  2B1E A;  4DMV A;  4EIW A;  4X5T A;  3ZT5 A;  3J7Y q;  2VQF T;  3T1H T;  3CIR A;  2ZM6 T;  4ZZB A;  3PUX F;  3MKD A;  4MHC A;  4JI2 T;  2JMH A;  5DJQ C;  4IE5 A;  4Z90 A;  5JQG E;  5LG3 A;  4U3C A;  2JPF A;  4JI1 T;  5HXR A;  2E9X A;  3RYF E;  2L3L A;  3AE6 A;  4X1Y E;  2VB6 A;  4EAH A;  4OYJ A;  4COF A;  3LK3 B;  2LLY A;  3AEF A;  1CUN A;  3KBU A;  3PUV F;  4QKN A;  2OA5 A;  3RC3 A;  4JI6 T;  1B7T A;  4DR5 T;  4L0R A;  4TX5 A;  3AEG A;  2XAG B;  3I0Q A;  4I50 E;  4I55 E;  3HR0 A;  4AXP A;  4YTP A;  4JI7 T;  4GIW A;  2CM0 A;  2LEH A;  4DO0 A;  1M7K A;  2KIN B;  4IL4 A;  2XQY A;  4LF8 T;  2CBI A;  2CA5 A;  2J62 A;  2V6X A;  4LML A;  5JDH A;  4ZI7 E;  2KWI B;  5AQR B;  1QUU A;  2KXP B;  2XQ3 A;  3JAD A;  3OKQ A;  3KV6 A;  3RQU A;  3QB5 A;  1LRZ A;  3QNU A;  1UUS A;  2X68 A;  3AE5 A;  3CQX C;  3N5L A;  3AE2 A;  4WNK A;  5HXC A;  2D0U A;  2CRB A;  4H9O C;  2D0T A;  1SUM B;  4DBR A;  3VKG A;  5F3J A;  3J9X 1;  5L47 A;  1YKE B;  4LF5 T;  4DR4 T;  4TV8 E;  2N9D A;  4TN7 B;  3V5U A;  4UXN B;  4EZH A;  4EB6 E;  2BG9 C;  3PUZ F;  3IA3 A;  3ZJ1 A;  5HYA A;  5HXE A;  1FJG T;  1O3X A;  2CXF A;  2YU2 A;  1XNQ T;  4L9I A;  2Y6X A;  4NUV A;  4ZS2 A;  4DR7 T;  4AKI A;  3H37 A;  2V7M A;  2OLT A;  2CMR A;  2XQ4 A;  3AXJ A;  5KXJ A;  2X9Y A;  4GYR A;  4X1I E;  5GON E;  2JIW A;  5AQG B;  3RIU A;  1J5E T;  5FY7 A;  4UR9 A;  3RPU A;  4ERR A;  1KEY A;  1U5P A;  2NOX A;  4O4H E;  4JI5 T;  5JTG A;  2UUC T;  3OPC A;  4ADZ A;  2Z6E A;  5DQV A;  4CXW A;  1MIY A;  2JQH A;  2YN6 A;  1E2A A;  3ANW B;  3RKO A;  5ABF B;  2H89 A;  1IBK T;  3CKD A;  1UCU A;  3FBL A;  3AB3 B;  3P4S A;  5AQI B;  4O8S A;  2WU2 A;  4FJO A;  4TWD A;  5DQW A;  2DWG A;  5JDG A;  3NBX X;  2K24 A;  1E1H B;  2A9U A;  4KHZ F;  4EYY R;  4C90 A;  4HFI A;  2WZH A;  5LG4 A;  4ANJ A;  3QK6 A;  3I0O A;  3UQ4 A;  2I59 A;  5IHY A;  2BS3 A;  4KMC A;  5ABH A;  2UUA T;  5LHI B;  3ZC1 A;  2CEA A;  4QXB B;  1XMO T;  3FBZ A;  3ZT6 A;  3FXE B;  3B5M A;  3KV5 A;  5AQH B;  1MMA A;  4YHJ A;  4A5X A;  3CWZ B;  3TLS A;  3AED A;  4EOZ B;  3OTO T;  1UK5 A;  3N9M A;  4N78 D;  4PJN A;  1D0Y A;  5KDM C;  5IUX A;  2IML A;  2FJA A;  3NRX A;  4X64 T;  3ETV A;  3AE3 A;  4UV8 B;  2V5D A;  1MIW A;  2YK0 A;  3ETU A;  3KVB A;  3PDY A;  4NUU A;  4YLH A;  5FXX A;  1QSD A;  2LM9 A;  2H88 A;  1SHZ C;  2WB5 A;  1V9D A;  2ODU A;  3UUL A;  4GKK T;  2XJ7 A;  2CBJ A;  4JI0 T;  4QWN B;  1R8I A;  4UEL A;  5E0O A;  5FNV E;  1WCR A;  4AIS A;  4XBF B;  2M6I A;  2E9X D;  3HKD E;  4MBQ A;  3UU6 A;  2H7O A;  3CX7 B;  3NKZ A;  5F5W A;  2BS2 A;  2DI4 A;  4IE7 A;  4B3S T;  1M62 A;  3K3N A;  5LGT B;  4U2Z A;  2ES0 A;  4EGW A;  2EHO D;  2VQE T;  3RYH E;  4HFE A;  5HAX A;  3ZYM A;  4EYU A;  4F6R C;  4IDZ A;  3MZK B;  4K0K T;  5L4E A;  4IDO A;  5IYZ E;  3KDS E;  4L5G A;  3AEB A;  2Y8D A;  3PU8 A;  3SS1 A;  3T1Y T;  2BKO A;  1UX5 A;  2NTX A;  3HI2 A;  4UIG A;  4ZS3 A;  4MFR A;  5AQT B;  3ZCJ A;  2ODV A;  5ETW A;  5J2T E;  2NWB A;  1L0V A;  4ILU A;  2FBW A;  2LOP A;  4HWC A;  2BG9 A;  5AFU L;  5JH7 E;  2KLQ A;  3SOL A;  4IE6 A;  5JDQ A;  3RC8 A;  5AQU B;  3RQW A;  4TWH A;  5LP6 E;  4H9N C;  3EAM A;  3L09 A;  1VCT A;  5BR8 T;  4CQI A;  2KSR A;  4GYS A;  1HNZ T;  1T8B A;  3FZH B;  4HFH A;  3GN5 A;  4IDP A;  4OHF A;  4H9S E;  4WZX A;  3A8Y C;  2QRX A;  4EEB A;  3WAJ A;  1OWA A;  3QOF A;  5FYM A;  4DV6 T;  3OBV E;  1KNR A;  4OK0 A;  5AQJ B;  4YFS A;  4X65 T;  2XQ6 A;  5LXT E;  1SA0 E;  4PJL A;  2B76 A;  2BDE A;  3PUS A;  3PU3 A;  3TKL B;  3PUY F;  3RYC E;  1HR0 T;  5JRC A;  1FEW A;  2J1D G;  1FIO A;  5JDL A;  3H3M A;  3C4Z A;  3PTR B;  4IDQ A;  1FMV A;  3U3I A;  5EZY E;  3ZKR A;  3HKE E;  2JRK A;  1W0B A;  4HEA A;  4AKR B;  4LFC T;  2YOE A;  3LSV A;  3O9X A;  2BBJ A;  1XDP A;  4DMW A;  5C8Y E;  2UUB T;  5LCY A;  1ZEE A;  2V1D B;  2H7V C;  2YEV C;  1IJ6 A;  3HL6 A;  2XSB A;  3LK4 2;  3Q9D A;  2V5C A;  4HFB A;  3CVR A;  4ZI3 C;  3AAA B;  2LOS A;  3B13 A;  3E08 A;  3U78 A;  4OFZ A;  3JAF A;  4U72 A;  2XSA A;  3RKG A;  2D2S A;  4AIU A;  3MXZ A;  3ZT7 A;  2PTF A;  2RA1 A;  2R6G F;  4UF0 A;  3E22 E;  4PJJ A;  1I94 T;  4WBO A;  3AEE A;  2WDQ A;  3RRW A;  1KK7 A;  3D0T A;  1HG5 A;  3A5X A;  4GK0 E;  4QX8 B;  3PUR A;  2WS3 A;  4TZ4 C;  4U31 A;  5FXW A;  4HGA A;  4CXY A;  4JI4 T;  1HF8 A;  2HN2 A;  2YDQ A;  4IRE A;  4OX9 T;  3JCF A;  3AA0 B;  4Z91 A;  2D9D A;  3MK7 C;  2ZM8 A;  3KV9 A;  4HFC A;  5EK4 A;  2IHR 1;  5HWY A;  4GK5 E;  1SE7 A;  2CHO A;  1J1J A;  4PNI A;  4JLE A;  2DLR A;  3FXD B;  3N9L A;  3OJA A;  5HXH A;  2V7L A;  1MIV A;  3RRC A;  2JMK A;  1IBL T;  3PUG A;  2IUB A;  3UTK A;  3FZK B;  3ESL A;  5HEU A;  2M67 A;  3P4Q A;  4X20 E;  5LJM A;  3AVR A;  1LKX A;  3OYX A;  2IIU A;  3UUX B;  1X9B A;  1N36 T;  3UQ7 A;  1KNZ A;  4LFB T;  2CLY C;  4P09 A;  5L3C B;  4YJ3 E;  2BVL A;  3L3P A;  1H7C A;  2J47 A;  2X67 A;  3LG7 A;  3RIF A;  4JEH B;  3W15 B;  4NIQ A;  1JNZ A;  3ZC0 A;  3IBP A;  2V7J A;  2G0U A;  2BS4 A;  2EHO B;  2XTL A;  3UU8 A;  5L3G B;  4DUZ T;  4LF7 T;  2XM2 A;  3UUN A;  2CE7 A;  2JJ9 A;  3M3Z B;  4ZOL E;  1HX8 A;  3EDV A;  2Q9Q C;  2Y48 B;  4EZ4 A;  2ACZ A;  2ZLY A;  4PFP A;  1US7 B;  2AE9 A;  2Q9Q D;  2WMN A;  3RIU C;  5IWA T;  1WR0 A;  2WU5 A;  2W4X A;  2PFV A;  5FKY A;  3SWH A;  4KUM B;  2E2A A;  4CN4 A;  3RI5 A;  3N9P A;  1N34 T;  3ONJ A;  2LHN A;  2LSI A;  4U7Y A;  3AE7 A;  3RHW A;  3CX8 B;  3OVU A;  4Q25 A;  4UV9 B;  2PG8 A;  2FJB A;  3HKC E;  3C4X A;  3KIN B;  3JC6 C;  3OYZ A;  4YSZ A;  1UUR A;  4DBQ A;  2W66 A;  2XZE A;  3ZCI A;  4LMJ A;  5FVL A;  5LB7 B;  3GWH A;  3V5S A;  3ZYK A;  2V6Y A;  2VKO A;  4IDN A;  3KBT A;  3VRA A;  3ZMZ B;  2X9H A;  2XQA A;  1KFY A;  2LSY A;  4O4L E;  2F4V T;  2XHE B;  3F2E A;  1HNX T;  4U7I A;  2BZB A;  1OED B;  5JRE A;  1CHU A;  2EHO A;  4HWH A;  4CN6 A;  3TLT A;  1YW0 A;  4BJM A;  1KF6 A;  2E9X B;  2JQQ A;  3ABV A;  2E9X C;  3C98 B;  4HN9 A;  5CFB A;  4WW0 A;  2JQ9 A;  2K9A A;  5JR9 C;  5CGM A;  3FHN A;  3LK2 B;  3T8O A;  1IAP A;  4DR1 T;  4DV1 T;  4TWF A;  1OED C;  2WDR A;  2X0L B;  2NTY A;  5F8P A;  3RGL A;  2ZM2 A;  5LOV E;  1NAF A;  5HWX A;  4HE8 A;  5AQM B;  4U33 A;  2VWA A;  3E0Z A;  4XAX B;  2BKN A;  4ILC A;  3G06 A;  3BK9 A;  2BVM A;  3EUH A;  3ZST A;  2LSG A;  3FZF B;  3RYI E;  1ZHC A;  3PUA A;  2VKH A;  4PK5 A;  3DTO A;  4BA9 A;  3C64 A;  4NXN T;  1I6Z A;  4O4I E;  3AA1 B;  3VKH A;  4ZI2 D;  5HXS A;  3TLW A;  1MMN A;  2ZM0 A;  4A98 A;  2LSK A;  1W9R A;  3N9Q A;  4YSX A;  3RLF F;  2W2U A;  4IE4 A;  4DV4 T;  3DJB A;  4DV3 T;  4ZXL A;  4BJN A;  4IE0 A;  1D1C A;  4CN1 A;  4KX6 A;  3UUM A;  3H3A A;  5JDM A;  1NWM X;  3Q5W A;  4KP3 C;  4EED A;  1UGO A;  1Y64 B;  1HNW T;  4ZI2 C;  2WM9 A;  3C51 A;  4P1N A;  2Q9Q B;  3ZPO A;  2VL8 A;  3PJA J;  4ZEY A;  5AQP B;  4HWF A;  3C4W A;  2W00 A;  3N9N A;  5HCM A;  4MAL A;  2X0H A;  2HHH T;  3JAE A;  4B3M T;  2MPK A;  3HA4 A;  3ZMU B;  2EHO C;  1W0A A;  2AXD S;  2KZ7 B;  3B57 A;  5J1G A;  4IIJ E;  1BR0 A;  1WR6 A;  2MAW A;  2X9W A;  1NEN A;  2X0Y A;  2VVN A;  3EDU A;  5L3E B;  2WY2 A;  2HPL A;  2KWH A;  1BR1 A;  2X9X A;  3L39 A;  2N2N A;  2CLY B;  2A3D A;  3CX6 B;  2YDS A;  2E8I A;  1MMD A;  1IZN B;  2CXL A;  2NR4 A;  2SPC A;  3SFD A;  2X51 A;  3K3Q C;  5FL1 A;  3LJC A;  4DV5 T;  4CZZ B;  5CA1 E;  1D0X A;  4CI1 B;  4G63 A;  2UU9 T;  4LF9 T;  2FJD A;  5M4Y A;  5LA6 E;  5L3D B;  4CI2 B;  2Q9Q A;  3L8R A;  2H3R A;  4O2A E;  1UX4 A;  1D1B A;  2K3W A;  3AEC A;  2WDV A;  3RX6 A;  4YTN A;  1QLB A;  2DNX A;  2MYS A;  3I9Y A;  2E5V A;  3EVY A;  2N1G A;  1LVF A;  2KT9 A;  3PUW F;  3PE0 A;  1LVK A;  5C2T A;  2K5B B;  2FJE A;  3F31 A;  5DAB A;  5C3J A;  2V8S V;  2XAS B;  2VUR A;  3O1H A;  4YHH T;  4H9P C;  4TUY E;  4TV9 E;  1WYC A;  4WYV A;  1T72 A;  1U4Q A;  1D1A A;  3QC9 A;  2LRK A;  4AQY T;  5AQK B;  4YJ2 E;  1IBM T;  1HS7 A;  2I6H A;  5ABF A;  4GKJ T;  5LNK A;  2XQ8 A;  4A56 A;  2A2F X;  2YIN A;  4QH5 A;  4HFV A;  5CA0 E;  5JVD E;  3AA7 B;  5J0Z A;  1T98 A;  1BR2 A;  4PAG A;  5EK3 A;  3GN5 B;  3Q5E A;  3S4U A;  2RPA A;  2XAQ B;  1ZV4 X;  5KX5 E;  1VRB A;  1YXR A;  2LRL A;  4DV0 T;  5LYJ E;  5L2L A;  2JQK A;  4LMK A;  5FY0 A;  3ONX A;  3TLV A;  2IDO B;  3AXJ B;  5A1L A;  5ABE A;  1Z8U A;  4LF4 T;  1VOM A;  3SRZ A;  3UU5 A;  4HTE A;  4HWD A;  1VCS A;  3CQG B;  1WLX A;  4X1K E;  4I0U A;  3UT5 E;  4A97 A;  1XDO A;  3FZL B;  3ZMV B;  3BQK A;  4JUY A;  2W67 A;  1YD8 G;  3ZSS A;  4QX7 B;  5TAO A;  1YQ4 A;  3VHL A;  2BKP A;  1YKH B;  2HH7 A;  4YTM A;  2XQ5 A;  4PW8 A;  4B6X A;  2WAU A;  5LBQ B;  1HFA A;  2A72 A;  2J4G A;  3C50 A;  3FB2 A;  5FY1 A;  5LMU T;  1T7S A;  1G73 A;  1XMQ T;  4K0U A;  2XUE A;  3ZJ2 A;  5LMN T;  4JI8 T;  3EAB A;  2XQ7 A;  5AQS B;  4HWI B;  4HFD A;  5KMG P;  4X66 T;  3MA9 A;  2CWY A;  2KND A;  5AQL B;  1JNR A;  3AAI A;  4DV2 T;  3CML A;  3LBX B;  1MND A;  5BMV E;  2D5U A;  2OV9 A;  2HPJ A;  3A7M A;  3IF8 B;  4IL9 A;  2PJQ A;  3N2K E;  4NPP A;  4C91 A;  2VKD A;  2KMF A;  4H9R C;  4PJM A;  2M6B A;  3ZLI A;  1ZP0 A;  3AEA A;  1HX1 B;  2V7I A;  2NW8 A;  3Q5D A;  2HN1 A;  3VRB A;  1KNP A;  3ZYL A;  1HTJ F;  2LM2 A;  1J5W A;  2RP4 A;  3AVS A;  3KFW X;  3PJA A;  4PFO A;  3FZM B;  4UVB B;  3UU4 A;  4DND A;  4UEM A;  5JR9 A;  5L3B B;  5LGU B;  2BBH A;  2V7K A;  4AI6 A;  3ZEF B;  2VKJ A;  2IC6 A;  1GQE A;  4JV5 T;  2MTQ A;  4I43 B;  2CHN A;  2W61 A;  5H6Q B;  2CPT A;  4TNV A;  2L9Q A;  5FP3 A;  3AE9 A;  4JYA T;  2QGS A;  2DCF A;  1S35 A;  2C5K T;  5AQO B;  5JDF A;  5AQN B;  2QA7 A;  3DP7 A;  4E7S A;  4TNW A;  2VL0 A;  4O2B E;  5FL0 A;  2WWV A;  3EI0 A;  3F57 A;  3NZP A;  3Q2M A;  4MLK A;  2V6Y B;  3VR9 A;  3NVO A;  2XAJ B;  4QH4 A;  2LE8 A;  2PBI A;  2NP9 A;  5JDN A;  2V26 A;  2XAF B;  5HEO A;  3ONL C;  3ZN1 B;  2DL1 A;  1WRD A;  4BAY B;  4DUY T;  1EZ3 A;  1XNR T;  4X62 T;  4NXM T;  4KHP T;  3CK6 A;  2IW5 B;  4CXX A;  3PUQ A;  4AQF C;  4DV7 T;  3AA6 B;  3WI3 A;  3IHR A;  3I1A A;  3P8C D;  2WP9 A;  5CB4 E;  2WCA A;  2UXN B;  4KI0 F;  1MMG A;  2LSJ A;  3Q5X A;  3X1D A;  3O1I A;  5LGN B;  2LHR A;  4H9Q C;  1W09 A;  4YSY A;  2L8K A;  1XWM A;  4P0B A;  4ZZC A;  3RF1 A;  3AE4 A;  2WBL A;  2YKS A;  2C5I T;  3NZQ A;  2WQY A;  2WWU A;  1S94 A;  3O1J A;  3P4P A;  1IJ5 A;  3HKB E;  2QYW A;  5ABG A;  4YT0 A;  3RH3 A;  3MJX A;  3UUB A;  4IST A;  4U2Y A;  3ZMS B;  3CQC B;  1WFD A;  3GA8 A;  2XPK A;  4FI5 A;  4JBW F;  4QH1 A;  4QHO A;  2XQ9 A;  3WAK A;  4EV6 A;  2WSS V;  3P4W A;  4V1A v;  4ILA A;  1WYB A;  5HEJ A;  3TLU A;  4ZI3 D;  2UXC T;  2LKG A;  2MOZ A;  4LFA T;  2IC9 A;  4IGU A;  5JRC B;  5LHG B;  2VK9 A;  5L3F B;  2W62 A;  2UXB T;  1DU2 A;  4AQG A;  3P4R A;  4OYK A;  5H6R B;  2ACX A;  3K3O A;  5FVK A;  2XM1 A;  4GOU A;  3NWI A;  3N9O A;  4PK6 A;  5LHH B;  2CXD A;  3KV4 A;  2C5J A;  1G8X A;  2BG9 E;  2BG9 B;  5AQV B;  4U74 A;  5HEH A;  4WBN E;  5CJ5 A;  4H63 V;  3ANW A;  2C0S A;  4YXD A;  2UXD T;  5FXZ A;  3ZMT B;  3VU7 H;  1OED E;  4H63 H;  4QXH B; 
#chains in the Genus database with same CATH homology
 4LF6 T;  4DUZ T;  2UUA T;  4YY3 T;  1XMO T;  4JI3 T;  4DV0 T;  4LF4 T;  3OTO T;  4DR6 T;  4LF7 T;  5IWA T;  4X64 T;  1N34 T;  4DR3 T;  1N32 T;  5LMU T;  1XMQ T;  4GKK T;  5LMN T;  4JI8 T;  2E5L T;  4JI0 T;  4X66 T;  4B3T T;  4DV2 T;  2F4V T;  4B3S T;  1HNX T;  2VQE T;  4DR2 T;  1N33 T;  4B3R T;  4K0K T;  3T1Y T;  4DV1 T;  4JV5 T;  4DR1 T;  4JYA T;  3T1H T;  2VQF T;  2ZM6 T;  4NXN T;  4JI2 T;  5BR8 T;  1HNZ T;  4JI1 T;  4DV4 T;  4DV6 T;  4X65 T;  4JI6 T;  4DUY T;  4DR5 T;  1XNR T;  4X62 T;  4NXM T;  4KHP T;  1HR0 T;  4JI7 T;  4DV7 T;  1HNW T;  4DV3 T;  4LF8 T;  4LFC T;  2HHH T;  4B3M T;  2UUB T;  4LF5 T;  4DR4 T;  1I94 T;  4DV5 T;  4LF9 T;  2UU9 T;  1FJG T;  1XNQ T;  4JI4 T;  2UXC T;  4DR7 T;  4LFA T;  4OX9 T;  1J5E T;  2UXB T;  4JI5 T;  2UUC T;  4YHH T;  1IBK T;  4AQY T;  1IBL T;  1IBM T;  1N36 T;  4GKJ T;  4LFB T;  2UXD T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...