4DV7D

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a915g, bound with streptomycin
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
208
structure length
208
Chain Sequence
GRYIGPVCRLCRREGVKLYLKGERCYSPKCAMERRPYPPGQHGQKRARRPSDYAVRLREKQKLRRIYGISERQFRNLFEEASKKKGVTGSVFLGLLESRLDNVVYRLGFAVSRRQARQLVRHGHITVNGRRVDLPSYRVRPGDEIAVAEKSRNLELIRQNLEAMKGRKVGPWLSLDVEGMKGKFLRLPDREDLALPVNEQLVIEFYSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 57
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00163 Ribosomal_S4 Ribosomal protein S4/S9 N-terminal domain
D PF01479 S4 S4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1050.10 Mainly Alpha Orthogonal Bundle Ribosomal Protein S4 Delta 41; Chain A, domain 1 Ribosomal Protein S4 Delta 41; Chain A, domain 1 4dv7D01
3.10.290.10 Alpha Beta Roll Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A RNA-binding S4 domain 4dv7D02
4LF9D 1I94D 4JYAD 2VQED 4K0KD 4X62D 2UXDD 2E5LD 4B3RD 1C05A 4DUZD 1HR0D 4X64D 4LFBD 4JI7D 1XNQD 4B3MD 3KBGA 4DV1D 2VQFD 1IBLD 4GKJD 4DV4D 2KTLA 4LF8D 4OUDA 2UXBD 4DV7D 4LF6D 4JI6D 4YHHD 1N33D 1FKAD 1DM9A 1KSVA 4DR3D 1HNXD 1N36D 1N34D 5LMND 2UUAD 4NXND 4JI5D 4GKKD 1H3FA 1C06A 1N32D 2UUCD 2K6PA 4DV5D 5IWAD 1KSLA 1VIOA 2ISTA 2UU9D 4DV3D 4OX9D 4KHPD 4DR6D 3DH3A 3T1YD 2F4VD 4JI0D 3HP7A 4DR4D 1KSKA 4JV5D 4DV6D 1P9KA 1IBKD 5LMUD 1XNRD 4DV2D 4DR5D 1IBMD 4LFCD 4LF4D 4JI4D 4JI2D 2JANA 4B3TD 1J5ED 1FJGD 4DR1D 4AQYD 1XMQD 5BR8D 4NXMD 4LGTA 1HNZD 4LF7D 1H3EA 1JH3A 4X65D 1XMOD 4DR7D 2UUBD 4B3SD 4YY3D 4JI1D 4LF5D 4DV0D 4LFAD 3OTOD 4DUYD 4JI8D 4JI3D 2UXCD 2ZM6D 2HHHD 1HNWD 3T1HD 4DR2D 4X66D
chains in the Genus database with same CATH superfamily
4LF9D 1Y8RB 2L3NA 1I94D 4JYAD 5KNLA 2VQED 4K0KD 4X62D 2I1SA 2UXDD 2E5LD 3KYDB 4B3RD 1C05A 4DUZD 1HR0D 4X64D 4LFBD 4JI7D 1XNQD 4B3MD 3KBGA 4DV1D 2NVUB 5A2QE 2VQFD 1IBLD 3J80E 4GKJD 4DV4D 2ZTBA 2KTLA 4LF8D 4OUDA 2UXBD 4DV7D 4LF6D 4JI6D 4YHHD 1N33D 1FKAD 1DM9A 1KSVA 4DR3D 1HNXD 1N36D 1N34D 5LMND 2UUAD 4NXND 1Y8XB 4JI5D 4GKKD 1H3FA 1C06A 1N32D 2UUCD 1Y8QB 2K6PA 4DV5D 5IWAD 1KSLA 5FLXE 5FQ2B 1VIOA 2ISTA 2UU9D 4DV3D 4OX9D 3FN1A 3KYCB 4KHPD 3J7AF 4DR6D 3DH3A 3T1YD 2F4VD 4JI0D 4II3A 3HP7A 4DR4D 1KSKA 4W5VB 4JV5D 4DV6D 4NNJA 1P9KA 1IBKD 5LMUD 1XNRD 4DV2D 4DR5D 1IBMD 4LFCD 3J81E 2LQ7A 4LF4D 4JI4D 4JI2D 3ONGA 2JANA 4B3TD 1J5ED 1FJGD 5IT9E 4DR1D 4AQYD 5LL6S 1XMQD 5BR8D 3CMMA 4NXMD 4LGTA 1HNZD 4LF7D 1H3EA 1JH3A 3ONHA 4X65D 1XMOD 4DR7D 2UUBD 4B3SD 4YY3D 4JI1D 4LF5D 4DV0D 4LFAD 3OTOD 4DUYD 4JI8D 4JI3D 3JAME 2UXCD 4II2A 2ZM6D 2HHHD 1HNWD 3T1HD 4DR2D 4X66D
chains in the Genus database with same CATH topology
4LF9D 2L3NA 1I94D 4JYAD 2VQED 4K0KD 4X62D 2UXDD 2E5LD 4B3RD 1C05A 4DUZD 1HR0D 4X64D 4LFBD 4JI7D 1XNQD 4B3MD 3KBGA 4DV1D 2VQFD 1IBLD 4GKJD 4DV4D 2KTLA 4LF8D 4OUDA 2UXBD 4DV7D 4LF6D 4JI6D 4YHHD 1N33D 1FKAD 1DM9A 1KSVA 4DR3D 1HNXD 1N36D 1N34D 5LMND 2UUAD 4NXND 4JI5D 4GKKD 1H3FA 1C06A 1N32D 2UUCD 2K6PA 4DV5D 5IWAD 1KSLA 1VIOA 2ISTA 2UU9D 4DV3D 4OX9D 4KHPD 4DR6D 3DH3A 3T1YD 2F4VD 4JI0D 3HP7A 4DR4D 1KSKA 4JV5D 4DV6D 1P9KA 1IBKD 5LMUD 1XNRD 4DV2D 4DR5D 1IBMD 4LFCD 4LF4D 4JI4D 4JI2D 2JANA 4B3TD 1J5ED 1FJGD 4DR1D 4AQYD 1XMQD 5BR8D 4NXMD 4LGTA 1HNZD 4LF7D 1H3EA 1JH3A 4X65D 1XMOD 4DR7D 2UUBD 4B3SD 4YY3D 4JI1D 4LF5D 4DV0D 4LFAD 3OTOD 4DUYD 4JI8D 4JI3D 2UXCD 2ZM6D 2HHHD 1HNWD 3T1HD 4DR2D 4X66D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF9 D;  1I94 D;  4JYA D;  2VQE D;  4K0K D;  4X62 D;  2UXD D;  2E5L D;  4B3R D;  1C05 A;  4DUZ D;  1HR0 D;  4X64 D;  4LFB D;  4JI7 D;  1XNQ D;  4B3M D;  3KBG A;  4DV1 D;  2VQF D;  1IBL D;  4GKJ D;  4DV4 D;  2KTL A;  4LF8 D;  4OUD A;  2UXB D;  4DV7 D;  4LF6 D;  4JI6 D;  4YHH D;  1N33 D;  1FKA D;  1DM9 A;  1KSV A;  4DR3 D;  1HNX D;  1N36 D;  1N34 D;  5LMN D;  2UUA D;  4NXN D;  4JI5 D;  4GKK D;  1H3F A;  1C06 A;  1N32 D;  2UUC D;  2K6P A;  4DV5 D;  5IWA D;  1KSL A;  1VIO A;  2IST A;  2UU9 D;  4DV3 D;  4OX9 D;  4KHP D;  4DR6 D;  3DH3 A;  3T1Y D;  2F4V D;  4JI0 D;  3HP7 A;  4DR4 D;  1KSK A;  4JV5 D;  4DV6 D;  1P9K A;  1IBK D;  5LMU D;  1XNR D;  4DV2 D;  4DR5 D;  1IBM D;  4LFC D;  4LF4 D;  4JI4 D;  4JI2 D;  2JAN A;  4B3T D;  1J5E D;  1FJG D;  4DR1 D;  4AQY D;  1XMQ D;  5BR8 D;  4NXM D;  4LGT A;  1HNZ D;  4LF7 D;  1H3E A;  1JH3 A;  4X65 D;  1XMO D;  4DR7 D;  2UUB D;  4B3S D;  4YY3 D;  4JI1 D;  4LF5 D;  4DV0 D;  4LFA D;  3OTO D;  4DUY D;  4JI8 D;  4JI3 D;  2UXC D;  2ZM6 D;  2HHH D;  1HNW D;  3T1H D;  4DR2 D;  4X66 D; 
#chains in the Genus database with same CATH topology
 4LF9 D;  1Y8R B;  2L3N A;  1I94 D;  4JYA D;  5KNL A;  2VQE D;  4K0K D;  4X62 D;  2I1S A;  2UXD D;  2E5L D;  3KYD B;  4B3R D;  1C05 A;  4DUZ D;  1HR0 D;  4X64 D;  4LFB D;  4JI7 D;  1XNQ D;  4B3M D;  3KBG A;  4DV1 D;  2NVU B;  5A2Q E;  2VQF D;  1IBL D;  3J80 E;  4GKJ D;  4DV4 D;  2ZTB A;  2KTL A;  4LF8 D;  4OUD A;  2UXB D;  4DV7 D;  4LF6 D;  4JI6 D;  4YHH D;  1N33 D;  1FKA D;  1DM9 A;  1KSV A;  4DR3 D;  1HNX D;  1N36 D;  1N34 D;  5LMN D;  2UUA D;  4NXN D;  1Y8X B;  4JI5 D;  4GKK D;  1H3F A;  1C06 A;  1N32 D;  2UUC D;  1Y8Q B;  2K6P A;  4DV5 D;  5IWA D;  1KSL A;  5FLX E;  5FQ2 B;  1VIO A;  2IST A;  2UU9 D;  4DV3 D;  4OX9 D;  3FN1 A;  3KYC B;  4KHP D;  3J7A F;  4DR6 D;  3DH3 A;  3T1Y D;  2F4V D;  4JI0 D;  4II3 A;  3HP7 A;  4DR4 D;  1KSK A;  4W5V B;  4JV5 D;  4DV6 D;  4NNJ A;  1P9K A;  1IBK D;  5LMU D;  1XNR D;  4DV2 D;  4DR5 D;  1IBM D;  4LFC D;  3J81 E;  2LQ7 A;  4LF4 D;  4JI4 D;  4JI2 D;  3ONG A;  2JAN A;  4B3T D;  1J5E D;  1FJG D;  5IT9 E;  4DR1 D;  4AQY D;  5LL6 S;  1XMQ D;  5BR8 D;  3CMM A;  4NXM D;  4LGT A;  1HNZ D;  4LF7 D;  1H3E A;  1JH3 A;  3ONH A;  4X65 D;  1XMO D;  4DR7 D;  2UUB D;  4B3S D;  4YY3 D;  4JI1 D;  4LF5 D;  4DV0 D;  4LFA D;  3OTO D;  4DUY D;  4JI8 D;  4JI3 D;  3JAM E;  2UXC D;  4II2 A;  2ZM6 D;  2HHH D;  1HNW D;  3T1H D;  4DR2 D;  4X66 D; 
#chains in the Genus database with same CATH homology
 4LF9 D;  2L3N A;  1I94 D;  4JYA D;  2VQE D;  4K0K D;  4X62 D;  2UXD D;  2E5L D;  4B3R D;  1C05 A;  4DUZ D;  1HR0 D;  4X64 D;  4LFB D;  4JI7 D;  1XNQ D;  4B3M D;  3KBG A;  4DV1 D;  2VQF D;  1IBL D;  4GKJ D;  4DV4 D;  2KTL A;  4LF8 D;  4OUD A;  2UXB D;  4DV7 D;  4LF6 D;  4JI6 D;  4YHH D;  1N33 D;  1FKA D;  1DM9 A;  1KSV A;  4DR3 D;  1HNX D;  1N36 D;  1N34 D;  5LMN D;  2UUA D;  4NXN D;  4JI5 D;  4GKK D;  1H3F A;  1C06 A;  1N32 D;  2UUC D;  2K6P A;  4DV5 D;  5IWA D;  1KSL A;  1VIO A;  2IST A;  2UU9 D;  4DV3 D;  4OX9 D;  4KHP D;  4DR6 D;  3DH3 A;  3T1Y D;  2F4V D;  4JI0 D;  3HP7 A;  4DR4 D;  1KSK A;  4JV5 D;  4DV6 D;  1P9K A;  1IBK D;  5LMU D;  1XNR D;  4DV2 D;  4DR5 D;  1IBM D;  4LFC D;  4LF4 D;  4JI4 D;  4JI2 D;  2JAN A;  4B3T D;  1J5E D;  1FJG D;  4DR1 D;  4AQY D;  1XMQ D;  5BR8 D;  4NXM D;  4LGT A;  1HNZ D;  4LF7 D;  1H3E A;  1JH3 A;  4X65 D;  1XMO D;  4DR7 D;  2UUB D;  4B3S D;  4YY3 D;  4JI1 D;  4LF5 D;  4DV0 D;  4LFA D;  3OTO D;  4DUY D;  4JI8 D;  4JI3 D;  2UXC D;  2ZM6 D;  2HHH D;  1HNW D;  3T1H D;  4DR2 D;  4X66 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...