4DV7E

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a915g, bound with streptomycin
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4dv7E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dv7E02
4JI1E 3LLHA 2V34A 5LMNE 1HNZI 4DUYI 2L33A 4DU8A 4LF7I 4B3TE 1J5EE 2EZ6A 1FWKA 2VQFE 4JI3E 4B3RI 4WUCA 1YZ9A 2ZITA 3C4BA 3QT6A 4JI0E 1N33I 2JVAA 4NXNI 2J7KA 2A2DA 2B3TB 2LTRA 3LNUA 3QT5A 4HACB 4MYUA 4Z7CA 1Z59A 4JI4I 3C4TA 2UUBI 2XEXA 4M1KA 2X7IA 4YY3I 2GS8A 4DR6I 4X64I 4JI8E 2LTSA 4B3ME 1XMQE 1KTVA 2UXBI 3F0NA 1ZXNA 5IT9C 2E5LI 1NHJA 1N32E 4GKKE 4NXME 3GONA 4DV1I 1Z0BA 3ZZUA 1FNMA 3WU6A 4X65I 1EKZA 4LFAE 4DR5I 4WYQB 3B78A 4HACA 2UUCI 4LF4I 2UXDI 1ZM3A 1VISA 2HKEA 1N0VC 4WFTA 2RS7A 1T4OA 2WW4A 4ED4A 1BKNA 1H7SA 3OTOI 4DV7E 4DR3E 4DV4E 2LRSA 1H7UA 4DUZI 1Z0EA 4WUDA 3T1YI 1HNWI 1MG7A 1Z5BA 3Q1QA 4FWHA 4LFCE 3WU5A 4DPWA 1B62A 3PYFA 1XNQE 4WUBA 1PVGA 4LF8I 4UT4A 2E1RA 1IBME 4KHPE 1N0UA 1Z0TA 1XNRE 2F4VI 4YHHE 1IBLE 4DV3I 4DV6E 2L2NA 3ADJA 3CWVA 2DMYA 4DV0E 2HKJA 2HHHI 1ZM2A 1I94I 1YYKA 1Z0VA 3D4JA 4AQYE 1N36E 2MDRA 3PYGA 4JI1I 4X66E 1Z0GA 4LF6E 2UU9I 1X49A 1X48A 4JI6E 2N3GA 4B3SE 4OOGC 3VYXA 3QT7A 4B3TI 2ZM6I 5IWAE 2VQFI 1UHZA 1EA6A 2DEIA 3M6AA 3QT8A 3J7Yp 4ZVIA 1RR9A 5FLXC 4JV5E 1HNZE 1IBKI 4DUYE 3WU4A 2UUAI 1HNXI 2Q2EB 1Z5CA 2DB2A 4LF7E 4JYAI 3H4LA 1J26A 3B82A 4P7AA 4JI5I 1RREA 2BV3A 4DR1I 1HR0I 2B7TA 2X36A 4B3RE 1S4EA 4JI7E 5A2QC 1QZRA 5BR8E 3P1XA 1Z0WA 4K0KE 4DV5I 1KIJA 4JI8I 1N33E 2VQEE 1MU5A 4NXNE 1ZBTA 3ZM7A 1RC7A 2L2KB 4JI4E 4DXLA 1N32I 4GKJI 2UUBE 4DPYA 4NXMI 3JAMC 4YY3E 3PYEA 1FKAE 4LF5I 4X64E 2NUGA 4DPXA 4X8WA 1ELOA 4KQVA 5IT9Q 3K17A 1B63A 2V2ZA 2LJHA 2HK2A 4JI2E 4LFBI 4HXZA 3JAMQ 1FJGI 4XTJA 4URLA 4DV1E 4DV7I 2R42A 3PYDA 4DR7I 1EI1A 4DR3I 4JG4A 1WHNA 4X65E 4PU9A 1DARA 1H72C 4LF4E 2HK3A 4M2ZA 4DKKA 2UXDE 1ZXMA 3ADLA 5L3JA 4M30A 4OX9E 2UXCE 4X62I 4MYTA 1UEKA 1XNQI 3J81C 5LMUI 3OTOE 4DR4I 1IBMI 1OJ4A 1XNRI 3HULA 1KVKA 2LUPB 4DUZE 1KKHA 3T1YE 1X47A 4FWDA 1N34E 1A6FA 3WU3A 2BM0A 2OI2A 1WHQA 5LL6R 4DR2I 4DV2I 1K47A 2R3VA 3T1HE 1XMOI 4LF8E 2V2QA 1S16A 4HYMA 4AQYI 1N36I 3J80C 2CZ9A 1T4NA 5LMNI 4DV3E 3ZZTA 4B3SI 2NA2A 4PRVA 1DI2A 1ZM4A 1ZM9A 1J5EI 2B7VA 3B8HA 5IWAI 2HHHE 4JI3I 1MX0A 1I94E 4I3HA 4FW9A 1GQEA 1STUA 4LF9E 4UTGA 2BM1A 1NZ0A 4JI0I 2LUQA 2L2MA 2UU9E 4JV5I 3ZZ0A 3LPSA 2HFSA 2DIXA 3ZKBA 3ADIA 3VYYA 2LBSB 2RSMA 2ZM6E 2RTXA 3HTXA 5FLXQ 4JI7I 3ZKDA 5BR8I 4K0KI 2HFUA 1H74A 3V2UC 2KHXA 2VQEI 1Z5AA 4B3MI 1IBKE 2L3JA 3J7AM 1XMQI 2V2VA 1O0WA 2UUAE 1HNXE 2NUFA 2EFGA 5A2QQ 4JYAE 4JI5E 4GKKI 4DR1E 4FN5A 1HR0E 2AJ4A 1YYWA 4DR6E 4LFAI 4DV5E 1Z0CA 2CPNA 5GMDA 1PIEA 1H73A 1NHHA 2RS6A 4HY1A 4JI2I 2LJPA 4EMDA 2UXBE 2IHR1 2E5LE 1FI4A 4GKJE 4USKA 2ZBKB 2VF3A 4RPFA 4USMA 4DPUA 4DV4I 4LF5E 4FWGA 4DR5E 2UUCE 1U2RA 2YT4A 4DPTA 4LFBE 4P52A 1RQ0A 4LFCI 1FJGE 4OX9I 2A2CA 2UXCI 2N3HA 5CFFE 2NPFA 3V5RA 4DR7E 3LTOA 4KHPI 2JY9A 4YHHI 1IBLI 1HNWE 2NUEA 1N34I 5GMEA 4DV6I 1FWLA 3J81Q 4X62E 4PRXA 4DU7A 4DV0I 2L3CA 2DEJA 3T1HI 3ADGA 5LMUE 4DR4E 1NHIA 3J7AG 2F4VE 4X66I 4LF6I 4JI6I 1D6TA 1WUUA 1UILA 4R1FA 4Z7YA 4DR2E 4DV2E 3K1JA 1YYOA 1T4LB 1XHKA 3J80Q 1XMOE 1PKPA 4LF9I 2V8PA 1QU6A
chains in the Genus database with same CATH superfamily
4JI1E 3LLHA 2V34A 1X5WA 4HTGA 1DGCA 2MDGA 5LMNE 4ZYHA 4FK5C 1HNZI 2PO1B 4DUYI 2Q8UA 2GQ0A 1X6EA 2L33A 4O5GA 2EPRA 5FWKA 2EN6A 3GMEA 4BA2A 1Y6ZA 4DU8A 4LF7I 4B3TE 1J5EE 2EZ6A 1FWKA 1MEYC 2BA0G 4L8NA 2YTJA 5A6KA 2EPLX 2ODRD 2VQFE 2EMAA 4JI3E 2CG9A 4F9BB 4B3RI 4ZYEA 2YSPA 2RQLA 4WUCA 2E1MA 1YZ9A 1YUJA 1WRJA 2ZITA 3C4BA 3QT6A 2EOQA 4P78A 4J8ZA 5JEAE 2YTQA 5AC4A 2WCC3 4JI0E 2MKNA 4ZYDA 1N3GA 1N33I 2EOIA 2YPNA 4IFDF 3BIDA 2JVAA 2O3ZA 4OO1C 3BF2A 4NXNI 2J7KA 2B3TB 2LTRA 2A2DA 3LNUA 2EOHA 3QT5A 4HACB 4MYUA 2EP3A 1QNTA 5DRRA 4Z7CA 1NCSA 2EOEA 1Z59A 2V89A 4Q35B 5F3WA 4NBQA 3KZZA 4JI4I 3C4TA 3M85G 3THOB 4J3DA 2UUBI 4M0VA 2XEXA 4IFDE 1RHYA 4M1KA 2X7IA 4YY3I 3IWBA 2GS8A 5C0XD 3UK3C 4DR6I 2YTEA 4X64I 1OYPA 4R2SA 2LO3A 2EWLA 4FW6A 4LPFA 3F6GA 2PO1A 2EL5A 2F1DA 4JI8E 4ISAA 4MLQA 3CDJA 2LTSA 4B3ME 5K36C 5A6AA 2EMWA 2ELYA 1AH5A 2EPPA 1XMQE 3KZYA 3ECRA 5LLQA 1KTVA 2UXBI 2CT1A 3F0NA 4LU9A 5IT9C 2JP9A 2LJUA 1ZXNA 5C0XB 1NHJA 1N32E 2E5LI 2V88A 3M99B 4GKKE 4NXME 3GONA 5ELWA 2JE6A 4DV1I 1Z0BA 4F6MA 3ZZUA 4LTYA 1FNMA 2VESA 3WU6A 4X65I 2M9AA 1EKZA 2EMGA 4LFAE 2I13A 2PNZB 4DR5I 4WYQB 3B78A 2LCEA 4R2EA 4R2DA 4HACA 4ZYGA 2UUCI 4LF4I 2EQ1A 2EL4A 1YUIA 1G2DC 2UXDI 2NN6C 2BB8A 2Z5BB 1ZM3A 4IZJD 1VISA 2HKEA 4GQUA 1WJPA 2EMFA 4WFTA 1N0VC 2RS7A 1T4OA 1EH6A 2EN2A 2JOXA 1F2IG 1A1LA 2WW4A 1OYRA 4ED4A 1BKNA 1H7SA 3AV0A 3OTOI 2M7QA 4DV7E 2WBTA 1AAYA 2DLKA 4DR3E 4DV4E 2VE7C 2LRSA 1E3PA 1H7UA 3P3GA 2PO0B 1NEIA 3HPSA 2BR2B 1IMUA 3THNA 2EOYA 2EN8A 4DUZI 2WZOA 3PS2A 3Q6MA 1Z0EA 4WUDA 3T1YI 1HNWI 2O1UA 5JEAD 1MG7A 3K85A 1Z5BA 3Q1QA 4KZSA 4FWHA 4LFCE 4F6NA 3WU5A 4DPWA 4BA2B 1YFHA 1XNQE 1B62A 3PYFA 2EM8A 4WUBA 1PVGA 4LF8I 4OO1F 2NABA 3F6HA 3PS1A 4UT4A 2E1RA 1IBME 4KHPE 3JTZA 4DPYA 1N0UA 5JEAB 1Z0TA 1XNRE 2F4VI 4BBYA 4YHHE 1IBLE 2Z5BA 4DV3I 2EMHA 4DV6E 1UDSA 4OO1E 1B69A 1KYQA 1PJQA 2L2NA 3ADJA 3CWVA 2EPAA 2DMYA 2L8TA 4WX9A 4DV0E 2HKJA 2HHHI 1ZM2A 1I94I 2EMZA 1YYKA 2LMZA 1Z0VA 2JWOA 2BR2A 5K36F 5AE2A 3D4JA 4AQYE 1N36E 3M7ND 2MDRA 3PYGA 4JI1I 2EOFA 4X66E 1Z0GA 4BCAA 4LF6E 2UU9I 4NXMI 1X49A 1X48A 2ODRC 4JI6E 4LCGA 1JK2A 2N3GA 4B3SE 2CVEA 4R2PA 4OOGC 3B4TA 1GZ6A 4BMJA 1EH8A 3VYXA 5K36E 3QT7A 1R6LA 2FGGA 4B3TI 3KRNA 5DNLA 2ZM6I 5IWAE 4R8OA 2VQFI 5JEAA 1UHZA 1EA6A 1E3HA 2DEIA 4HEIA 3M6AA 4FW4A 2BA1G 3QT8A 3J7Yp 4ZVIA 1RR9A 2YRHA 5FLXC 2C38B 2CGEA 1T38A 2JE6B 2NN6F 5DNXA 2JEAA 4JV5E 3P3EA 1TF6A 3VK6A 3MHSC 1HNZE 3BBGA 1IBKI 2BBGA 2YWQA 2ENCA 2EPMX 4DUYE 4IFDA 3WU4A 2UUAI 1HNXI 1USVA 2Q2EB 1Z5CA 2DB2A 4LF7E 2K4VA 2NN6E 1ZAAC 4BC9A 1Y4UA 1J26A 3B82A 3H4LA 4P7AA 4JI5I 4JYAI 1RREA 2BV3A 4DR1I 1HR0I 2B7TA 2X36A 1LLMC 4B3RE 4FW5A 4IJDA 2JYAA 2PRTA 2KONA 1S4EA 4JI7E 5A2QC 1USUA 1QZRA 2YTFA 3JU0A 5BR8E 3P1XA 1Z0WA 4K0KE 4DV5I 2E72A 2EOSA 1KIJA 4JI8I 1N33E 4U3BA 1YSAC 1X6FA 2VQEE 1MU5A 1MGTA 4NXNE 2JPAA 2O1WA 2LE2A 2V8QB 2AE8A 1ZBTA 4IZKB 3ZM7A 2MC5A 1RC7A 2EE8A 2JOBA 2L2KB 2EM3A 2YTPA 4JI4E 4DXLA 4GKJI 3EPLA 1N32I 2FTXB 2VRDA 2EQ3A 2N8XA 3H09A 5TSEA 2UUBE 1YPNA 3IWDA 2C38A 2J65A 2YU8A 3JAMC 5KL3A 4YY3E 3PS3A 3GLLA 2EPZA 4MU1A 3PYEA 2EPNA 1FKAE 5DRQA 4LF5I 4X64E 2NUGA 4DPXA 5ADZA 4LOMA 4X8WA 4P7DA 4R2RA 1BB8A 1ELOA 4BHCA 2HJJA 1TN9A 4KQVA 2IERA 1B63A 2V2ZA 3FIGA 3K17A 2LJHA 3HJCA 4OKGA 4OO1B 2HK2A 4JI2E 4LFBI 2EMXA 3M7NG 2L92A 4HXZA 3JAMQ 1FJGI 1IQSA 3IWCA 4XTJA 2YRMA 4TUIA 2EMCA 5A69A 1KJKA 4URLA 3MSWA 4RH8A 4DV1E 2GLIA 4DV7I 2R42A 2R76A 3PYDA 4DR7I 1EI1A 4DR3I 2DRPA 4JG4A 2EM9A 5AE3A 1WHNA 4X65E 2JT2A 4PU9A 1DARA 1H72C 1P42A 4I8OA 4IZKA 4LF4E 4F54A 2ENHA 5KL4A 4M2ZA 3EPHA 2HK3A 4DKKA 2UXDE 5AC5A 2LVHA 4MU3A 1ZXMA 3ADLA 5AASA 1Z1BA 5L3JA 2EQ0A 4M30A 4OX9E 2UXCE 3NZKA 4X62I 4MYTA 2EMKA 2VF1A 2YU5A 2ELZA 1UEKA 1XNQI 3J81C 1BBGA 5LMUI 3OTOE 4DR4I 4X9JA 5DRPA 1IBMI 1UBDC 4MU0A 1OJ4A 3C6MA 2KOUA 1XNRI 5A6BD 3HULA 4BS9A 4IFDD 5C0XF 2GO3A 4OO1A 1KVKA 1SFEA 2EM2A 1EH7A 2LUPB 3H1CA 4DUZE 1KKHA 2MKDA 3T1YE 4RHBB 1X47A 2JEAB 4KWYA 2A25A 4FWDA 1N34E 1A6FA 1OYSA 2BM0A 3WU3A 2NN6B 3HQ1A 2F8BA 2OI2A 1WHQA 2L6MA 5LL6R 5KL2A 1ZU1A 4NZVA 4IS9A 4DV2I 5C0XE 2GPIA 4DR2I 3L7ZA 4IFDB 3QG5C 1K47A 2Z5EA 2R3VA 4AIDA 3T1HE 4DMIA 1XMOI 4LF8E 2YRKA 2V2QA 3LMLA 1S16A 2C39B 4HYMA 4AQYI 1N36I 4R2CA 3J80C 1A1KA 1UN6B 3Q6NA 5K36A 2CZ9A 1L4SA 4R2AA 1T4NA 5LMNI 4DV3E 3ZZTA 4B3SI 4IS1C 2DSYA 2JXPA 2NA2A 3DF6A 1DI2A 1ZM4A 4PRVA 1VI7A 2EOOA 2Z5CA 1P47A 1ZM9A 2YTGA 4F9CB 1Y5YA 1J5EI 2B7VA 3B8HA 5IWAI 2V86A 2HHHE 4JI3I 4WSGA 3UHMA 1MX0A 4QNJA 1I94E 2EM5A 4I3HA 4FW9A 1GQEA 1STUA 4LF9E 4UTGA 2BM1A 1X3CA 1NZ0A 2EMLA 4JI0I 2L2MA 2EPUA 2JR1A 2LUQA 2UU9E 4M9VC 2EM6A 4JV5I 2WBSA 1X6HA 3ZZ0A 2NN6A 3LPSA 2HFSA 3AUZA 3HXLA 3EPKA 2DIXA 5A6BA 3ZKBA 3P06A 3ADIA 1Y4SA 2EM7A 5JEAF 3VYYA 5C0XC 2HGHA 2V87A 1TF3A 4MLVA 2LBSB 2RSMA 2WP8B 4N3OA 2ZM6E 2RSIA 2C39A 2RTXA 2PNMA 3HTXA 5FLXQ 2EPKX 2ENAA 3DD6A 2C37B 4JI7I 2M1SA 3ZKDA 3TQMA 5BR8I 1ZBQA 2EM4A 4K0KI 1Y60A 2HFUA 3U1YA 2EOMA 1A1IA 1H74A 2PO2B 2DMIA 5DROA 3V2UC 2KHXA 2B9DA 1A1JA 2VQEI 1Z5AA 4B3MI 4WXDA 1IBKE 2L3JA 4BHBA 3J7AM 1XMQI 2V2VA 1O0WA 2UUAE 1HNXE 2NUFA 2LV2A 2EFGA 5KL7A 5A2QQ 4JYAE 3OMLA 4JI5E 4WXCA 1UDNA 4GKKI 4DR1E 1IQOA 4WPYA 1HR0E 2AJ4A 4FN5A 2EOZA 4OO1D 2IOQA 3K6QA 2JEBB 1YH8A 3ZOQB 4F9AB 4O24A 1UDOA 4O43A 2EPCA 1YYWA 1WXRA 5A6JA 4DR6E 3EQ1A 5IXMB 3RMPA 2PNLA 4LFAI 5IT9Q 4DV5E 1Z0CA 2CPNA 2V85A 5GMDA 4BC7A 1PIEA 1H73A 1NHHA 1UDQA 2RS6A 2I9IA 2CSHA 1T39A 4HY1A 4O4KA 3VHTB 2WP8A 4LCHA 2J7JA 4JI2I 1JK1A 2LJPA 1RMDA 2EOJA 2UXBE 4EMDA 2WNRB 2YTDA 2YZTA 2IHR1 2C37A 3BGHA 2E5LE 2EOXA 1FI4A 4GKJE 2CTDA 4WSPA 4USKA 2ZBKB 5EKWA 2VF3A 1XXEA 4RPFA 4Q28A 5K36D 2K7IA 4NHRA 4MDTA 5JEAC 4USMA 2YTOA 2PO2A 2EPXA 3L7ZB 3P3CA 4DPUA 3L00A 4DV4I 4LF5E 4U3DA 3U1KA 2EN7A 2R1FA 4FWGA 4DR5E 2EN4A 2EL6A 2BA0D 1DQ3A 2UUCE 4MQYA 4L5NC 4N4RB 3MHHC 5KL5A 1U2RA 2BA1D 2DLQA 2YT4A 4DPTA 2O1VA 5K36B 4LCFA 5T6JA 4LFBE 4P52A 3KWRA 1PDAA 1RQ0A 4BA1B 4IFDC 2V83A 4LFCI 1FJGE 2JEBA 2A2CA 3PRYA 4OX9I 2UXCI 2Z5CB 2EM0A 2N3HA 5KL6A 2IOPA 2G7HA 5CFFE 2WBUA 2EMBA 3GCMA 2NPFA 3V5RA 2NN6D 4DR7E 2MC6A 3LTOA 1SR9A 2EMYA 4TUGA 4KHPI 4IZJB 3HPZA 4QNKA 2EN1A 5DNYA 2JY9A 1A1GA 4YHHI 3M85D 1IBLI 3CDIA 5IV8B 3C6KA 1HK7A 2WNRA 5C0XA 1HNWE 1PJSA 2NUEA 1N34I 1PJTA 5GMEA 4DV6I 1FWLA 2YSOA 2D9HA 3J81Q 1GTKA 4GEQB 4AM3A 2RPCA 2M4IA 4X62E 4PRXA 4DU7A 4DV0I 2L3CA 2DEJA 2EN3A 3T1HI 1ZR9A 2PNZA 3ADGA 5LMUE 2GHFA 4DR4E 2EJ4A 1R6MA 1NHIA 3EPJA 4GZNC 3J7AG 2IESA 1G2FC 2F4VE 3DJWA 1BBOA 1YHCA 2ADRA 4X66I 4LF6I 1A1HA 2EMIA 2YTIA 4R03A 4F2JC 2DGCA 4JI6I 1D6TA 4BA1A 1WUUA 1UILA 4R1FA 4Z7YA 2LT7A 3P76A 4AIMA 5AE1A 4DR2E 4DV2E 3K1JA 1YYOA 4FW3A 4R2QA 1T4LB 2YTNA 2O1TA 4IZJA 1XHKA 5EL9A 2GO4A 2PO0A 3J80Q 1XMOE 1PKPA 3HKMA 4LF9I 4OZEA 2FV4B 4FW7A 2HC5A 2V8PA 1QU6A 4MU4A 2EPOA 2H36X 1A1FA 2EORA
chains in the Genus database with same CATH topology
4JI1E 3LLHA 2V34A 5LMNE 1HNZI 4DUYI 2GQ0A 2L33A 5FWKA 1Y6ZA 4DU8A 4LF7I 4B3TE 1J5EE 2EZ6A 1FWKA 4L8NA 2VQFE 2ODRD 4JI3E 2CG9A 4B3RI 4F9BB 4WUCA 2E1MA 1YZ9A 2ZITA 3C4BA 3QT6A 4P78A 4J8ZA 4JI0E 1N33I 2JVAA 4NXNI 2J7KA 2B3TB 2LTRA 2A2DA 3LNUA 3QT5A 4HACB 4MYUA 4Z7CA 1Z59A 2V89A 5F3WA 4JI4I 3C4TA 2UUBI 4M0VA 2XEXA 4M1KA 2X7IA 4YY3I 3IWBA 2GS8A 4DR6I 4X64I 2EWLA 3F6GA 4JI8E 2LTSA 4B3ME 1XMQE 1KTVA 2UXBI 3F0NA 4LU9A 5IT9C 1ZXNA 2E5LI 1NHJA 1N32E 2V88A 4GKKE 4NXME 3GONA 4DV1I 1Z0BA 3ZZUA 4LTYA 1FNMA 3WU6A 4X65I 1EKZA 4LFAE 4DR5I 4WYQB 3B78A 4HACA 2UUCI 4LF4I 2UXDI 2Z5BB 1ZM3A 4IZJD 1VISA 2HKEA 1N0VC 4WFTA 2RS7A 1T4OA 2JOXA 2WW4A 4ED4A 1BKNA 1H7SA 3AV0A 3OTOI 2M7QA 4DV7E 4DR3E 4DV4E 2VE7C 2LRSA 1H7UA 3HPSA 4DUZI 2WZOA 3Q6MA 1Z0EA 4WUDA 3T1YI 1HNWI 2O1UA 1MG7A 3K85A 1Z5BA 3Q1QA 4KZSA 4FWHA 4LFCE 3WU5A 4DPWA 1B62A 1XNQE 3PYFA 4WUBA 1PVGA 4LF8I 3F6HA 4UT4A 2E1RA 1IBME 4KHPE 3JTZA 1N0UA 1Z0TA 1XNRE 2F4VI 4BBYA 4YHHE 1IBLE 2Z5BA 4DV3I 4DV6E 2L2NA 3ADJA 3CWVA 2DMYA 2L8TA 4DV0E 2HKJA 2HHHI 1ZM2A 1I94I 1YYKA 2LMZA 1Z0VA 2JWOA 5AE2A 3D4JA 4AQYE 1N36E 2MDRA 3PYGA 4JI1I 4X66E 1Z0GA 4BCAA 4LF6E 2UU9I 1X49A 1X48A 2ODRC 4JI6E 2N3GA 4B3SE 4OOGC 1GZ6A 4BMJA 3VYXA 3QT7A 2FGGA 4B3TI 2ZM6I 5IWAE 4R8OA 2VQFI 1UHZA 1EA6A 2DEIA 3M6AA 3QT8A 3J7Yp 4ZVIA 1RR9A 2CGEA 5FLXC 4JV5E 3VK6A 1HNZE 1IBKI 4DUYE 3WU4A 2UUAI 1HNXI 1USVA 2Q2EB 1Z5CA 2DB2A 4LF7E 2K4VA 1Y4UA 4BC9A 3H4LA 1J26A 3B82A 4P7AA 4JI5I 4JYAI 1RREA 2BV3A 4DR1I 1HR0I 2B7TA 2X36A 4B3RE 2KONA 1S4EA 4JI7E 5A2QC 1USUA 1QZRA 3JU0A 5BR8E 3P1XA 1Z0WA 4K0KE 4DV5I 1KIJA 4JI8I 1N33E 2VQEE 1MU5A 4NXNE 2O1WA 2LE2A 2V8QB 1ZBTA 4IZKB 3ZM7A 2MC5A 1RC7A 2JOBA 2L2KB 4JI4E 4DXLA 1N32I 4GKJI 2FTXB 2UUBE 4DPYA 4NXMI 3H09A 3IWDA 3JAMC 4YY3E 3PYEA 1FKAE 4LF5I 4X64E 2NUGA 4DPXA 5ADZA 4X8WA 4P7DA 1ELOA 4KQVA 5IT9Q 3K17A 1B63A 2V2ZA 3FIGA 2LJHA 3HJCA 2HK2A 4JI2E 4LFBI 2L92A 4HXZA 3JAMQ 1FJGI 3IWCA 4XTJA 4TUIA 4URLA 3MSWA 4DV1E 4DV7I 2R42A 3PYDA 4DR7I 1EI1A 4DR3I 4JG4A 5AE3A 1WHNA 4X65E 4PU9A 1DARA 1H72C 4I8OA 4IZKA 4LF4E 4F54A 2HK3A 4M2ZA 4DKKA 2UXDE 1ZXMA 3ADLA 5AASA 5L3JA 4M30A 4OX9E 2UXCE 4X62I 4MYTA 2VF1A 1UEKA 1XNQI 3J81C 5LMUI 3OTOE 4DR4I 1IBMI 1OJ4A 2KOUA 1XNRI 3HULA 4BS9A 1KVKA 2LUPB 4DUZE 1KKHA 3T1YE 1X47A 4FWDA 1N34E 1A6FA 3WU3A 2BM0A 3HQ1A 2F8BA 2OI2A 1WHQA 2L6MA 5LL6R 4DR2I 4DV2I 1K47A 2Z5EA 2R3VA 3T1HE 4DMIA 1XMOI 4LF8E 2V2QA 3LMLA 1S16A 4HYMA 4AQYI 1N36I 3J80C 3Q6NA 2CZ9A 1T4NA 5LMNI 4DV3E 3ZZTA 4B3SI 2DSYA 2NA2A 3DF6A 1DI2A 1ZM4A 4PRVA 2Z5CA 1ZM9A 4F9CB 1J5EI 2B7VA 3B8HA 5IWAI 2V86A 2HHHE 4JI3I 1MX0A 1I94E 4I3HA 4FW9A 1GQEA 1STUA 4LF9E 4UTGA 2BM1A 1NZ0A 4JI0I 2LUQA 2L2MA 2JR1A 2UU9E 4JV5I 3ZZ0A 3LPSA 2HFSA 3AUZA 3HXLA 2DIXA 3ZKBA 3P06A 3ADIA 1Y4SA 3VYYA 2V87A 2LBSB 2RSMA 4N3OA 2ZM6E 2RTXA 2PNMA 3HTXA 5FLXQ 4JI7I 2M1SA 3ZKDA 5BR8I 1ZBQA 4K0KI 2HFUA 1H74A 3V2UC 2KHXA 2B9DA 2VQEI 1Z5AA 4B3MI 1IBKE 2L3JA 3J7AM 1XMQI 2V2VA 1O0WA 2UUAE 1HNXE 2NUFA 2EFGA 5A2QQ 4JYAE 3OMLA 4JI5E 4GKKI 4DR1E 4FN5A 4WPYA 1HR0E 2AJ4A 2IOQA 3K6QA 3ZOQB 4F9AB 1YYWA 1WXRA 4DR6E 4LFAI 3RMPA 2PNLA 4DV5E 1Z0CA 2CPNA 2V85A 5GMDA 4BC7A 1PIEA 1H73A 1NHHA 2RS6A 4HY1A 4JI2I 2LJPA 4EMDA 2UXBE 2YZTA 2IHR1 1FI4A 2E5LE 4GKJE 4WSPA 4USKA 2ZBKB 2VF3A 4RPFA 4Q28A 4USMA 4DPUA 4DV4I 4LF5E 4FWGA 4DR5E 1DQ3A 2UUCE 4L5NC 1U2RA 2YT4A 4DPTA 2O1VA 5T6JA 4LFBE 4P52A 3KWRA 1RQ0A 2V83A 4LFCI 1FJGE 4OX9I 2A2CA 3PRYA 2UXCI 2Z5CB 2N3HA 2IOPA 2G7HA 5CFFE 2NPFA 3V5RA 4DR7E 2MC6A 3LTOA 1SR9A 4TUGA 4KHPI 4IZJB 3HPZA 5DNYA 2JY9A 4YHHI 1IBLI 1HK7A 1HNWE 2NUEA 1N34I 5GMEA 4DV6I 1FWLA 3J81Q 4GEQB 2M4IA 4X62E 4PRXA 4DU7A 4DV0I 2L3CA 2DEJA 3T1HI 3ADGA 5LMUE 4DR4E 1NHIA 3J7AG 2F4VE 3DJWA 4X66I 4LF6I 4R03A 4JI6I 1D6TA 1WUUA 1UILA 4R1FA 4Z7YA 5AE1A 4DR2E 4DV2E 3K1JA 1YYOA 1T4LB 2O1TA 4IZJA 1XHKA 3J80Q 1XMOE 1PKPA 4LF9I 2FV4B 2V8PA 1QU6A 2H36X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI1 E;  3LLH A;  2V34 A;  5LMN E;  1HNZ I;  4DUY I;  2L33 A;  4DU8 A;  4LF7 I;  4B3T E;  1J5E E;  2EZ6 A;  1FWK A;  2VQF E;  4JI3 E;  4B3R I;  4WUC A;  1YZ9 A;  2ZIT A;  3C4B A;  3QT6 A;  4JI0 E;  1N33 I;  2JVA A;  4NXN I;  2J7K A;  2A2D A;  2B3T B;  2LTR A;  3LNU A;  3QT5 A;  4HAC B;  4MYU A;  4Z7C A;  1Z59 A;  4JI4 I;  3C4T A;  2UUB I;  2XEX A;  4M1K A;  2X7I A;  4YY3 I;  2GS8 A;  4DR6 I;  4X64 I;  4JI8 E;  2LTS A;  4B3M E;  1XMQ E;  1KTV A;  2UXB I;  3F0N A;  1ZXN A;  5IT9 C;  2E5L I;  1NHJ A;  1N32 E;  4GKK E;  4NXM E;  3GON A;  4DV1 I;  1Z0B A;  3ZZU A;  1FNM A;  3WU6 A;  4X65 I;  1EKZ A;  4LFA E;  4DR5 I;  4WYQ B;  3B78 A;  4HAC A;  2UUC I;  4LF4 I;  2UXD I;  1ZM3 A;  1VIS A;  2HKE A;  1N0V C;  4WFT A;  2RS7 A;  1T4O A;  2WW4 A;  4ED4 A;  1BKN A;  1H7S A;  3OTO I;  4DV7 E;  4DR3 E;  4DV4 E;  2LRS A;  1H7U A;  4DUZ I;  1Z0E A;  4WUD A;  3T1Y I;  1HNW I;  1MG7 A;  1Z5B A;  3Q1Q A;  4FWH A;  4LFC E;  3WU5 A;  4DPW A;  1B62 A;  3PYF A;  1XNQ E;  4WUB A;  1PVG A;  4LF8 I;  4UT4 A;  2E1R A;  1IBM E;  4KHP E;  1N0U A;  1Z0T A;  1XNR E;  2F4V I;  4YHH E;  1IBL E;  4DV3 I;  4DV6 E;  2L2N A;  3ADJ A;  3CWV A;  2DMY A;  4DV0 E;  2HKJ A;  2HHH I;  1ZM2 A;  1I94 I;  1YYK A;  1Z0V A;  3D4J A;  4AQY E;  1N36 E;  2MDR A;  3PYG A;  4JI1 I;  4X66 E;  1Z0G A;  4LF6 E;  2UU9 I;  1X49 A;  1X48 A;  4JI6 E;  2N3G A;  4B3S E;  4OOG C;  3VYX A;  3QT7 A;  4B3T I;  2ZM6 I;  5IWA E;  2VQF I;  1UHZ A;  1EA6 A;  2DEI A;  3M6A A;  3QT8 A;  3J7Y p;  4ZVI A;  1RR9 A;  5FLX C;  4JV5 E;  1HNZ E;  1IBK I;  4DUY E;  3WU4 A;  2UUA I;  1HNX I;  2Q2E B;  1Z5C A;  2DB2 A;  4LF7 E;  4JYA I;  3H4L A;  1J26 A;  3B82 A;  4P7A A;  4JI5 I;  1RRE A;  2BV3 A;  4DR1 I;  1HR0 I;  2B7T A;  2X36 A;  4B3R E;  1S4E A;  4JI7 E;  5A2Q C;  1QZR A;  5BR8 E;  3P1X A;  1Z0W A;  4K0K E;  4DV5 I;  1KIJ A;  4JI8 I;  1N33 E;  2VQE E;  1MU5 A;  4NXN E;  1ZBT A;  3ZM7 A;  1RC7 A;  2L2K B;  4JI4 E;  4DXL A;  1N32 I;  4GKJ I;  2UUB E;  4DPY A;  4NXM I;  3JAM C;  4YY3 E;  3PYE A;  1FKA E;  4LF5 I;  4X64 E;  2NUG A;  4DPX A;  4X8W A;  1ELO A;  4KQV A;  5IT9 Q;  3K17 A;  1B63 A;  2V2Z A;  2LJH A;  2HK2 A;  4JI2 E;  4LFB I;  4HXZ A;  3JAM Q;  1FJG I;  4XTJ A;  4URL A;  4DV1 E;  4DV7 I;  2R42 A;  3PYD A;  4DR7 I;  1EI1 A;  4DR3 I;  4JG4 A;  1WHN A;  4X65 E;  4PU9 A;  1DAR A;  1H72 C;  4LF4 E;  2HK3 A;  4M2Z A;  4DKK A;  2UXD E;  1ZXM A;  3ADL A;  5L3J A;  4M30 A;  4OX9 E;  2UXC E;  4X62 I;  4MYT A;  1UEK A;  1XNQ I;  3J81 C;  5LMU I;  3OTO E;  4DR4 I;  1IBM I;  1OJ4 A;  1XNR I;  3HUL A;  1KVK A;  2LUP B;  4DUZ E;  1KKH A;  3T1Y E;  1X47 A;  4FWD A;  1N34 E;  1A6F A;  3WU3 A;  2BM0 A;  2OI2 A;  1WHQ A;  5LL6 R;  4DR2 I;  4DV2 I;  1K47 A;  2R3V A;  3T1H E;  1XMO I;  4LF8 E;  2V2Q A;  1S16 A;  4HYM A;  4AQY I;  1N36 I;  3J80 C;  2CZ9 A;  1T4N A;  5LMN I;  4DV3 E;  3ZZT A;  4B3S I;  2NA2 A;  4PRV A;  1DI2 A;  1ZM4 A;  1ZM9 A;  1J5E I;  2B7V A;  3B8H A;  5IWA I;  2HHH E;  4JI3 I;  1MX0 A;  1I94 E;  4I3H A;  4FW9 A;  1GQE A;  1STU A;  4LF9 E;  4UTG A;  2BM1 A;  1NZ0 A;  4JI0 I;  2LUQ A;  2L2M A;  2UU9 E;  4JV5 I;  3ZZ0 A;  3LPS A;  2HFS A;  2DIX A;  3ZKB A;  3ADI A;  3VYY A;  2LBS B;  2RSM A;  2ZM6 E;  2RTX A;  3HTX A;  5FLX Q;  4JI7 I;  3ZKD A;  5BR8 I;  4K0K I;  2HFU A;  1H74 A;  3V2U C;  2KHX A;  2VQE I;  1Z5A A;  4B3M I;  1IBK E;  2L3J A;  3J7A M;  1XMQ I;  2V2V A;  1O0W A;  2UUA E;  1HNX E;  2NUF A;  2EFG A;  5A2Q Q;  4JYA E;  4JI5 E;  4GKK I;  4DR1 E;  4FN5 A;  1HR0 E;  2AJ4 A;  1YYW A;  4DR6 E;  4LFA I;  4DV5 E;  1Z0C A;  2CPN A;  5GMD A;  1PIE A;  1H73 A;  1NHH A;  2RS6 A;  4HY1 A;  4JI2 I;  2LJP A;  4EMD A;  2UXB E;  2IHR 1;  2E5L E;  1FI4 A;  4GKJ E;  4USK A;  2ZBK B;  2VF3 A;  4RPF A;  4USM A;  4DPU A;  4DV4 I;  4LF5 E;  4FWG A;  4DR5 E;  2UUC E;  1U2R A;  2YT4 A;  4DPT A;  4LFB E;  4P52 A;  1RQ0 A;  4LFC I;  1FJG E;  4OX9 I;  2A2C A;  2UXC I;  2N3H A;  5CFF E;  2NPF A;  3V5R A;  4DR7 E;  3LTO A;  4KHP I;  2JY9 A;  4YHH I;  1IBL I;  1HNW E;  2NUE A;  1N34 I;  5GME A;  4DV6 I;  1FWL A;  3J81 Q;  4X62 E;  4PRX A;  4DU7 A;  4DV0 I;  2L3C A;  2DEJ A;  3T1H I;  3ADG A;  5LMU E;  4DR4 E;  1NHI A;  3J7A G;  2F4V E;  4X66 I;  4LF6 I;  4JI6 I;  1D6T A;  1WUU A;  1UIL A;  4R1F A;  4Z7Y A;  4DR2 E;  4DV2 E;  3K1J A;  1YYO A;  1T4L B;  1XHK A;  3J80 Q;  1XMO E;  1PKP A;  4LF9 I;  2V8P A;  1QU6 A; 
#chains in the Genus database with same CATH topology
 4JI1 E;  3LLH A;  2V34 A;  1X5W A;  4HTG A;  1DGC A;  2MDG A;  5LMN E;  4ZYH A;  4FK5 C;  1HNZ I;  2PO1 B;  4DUY I;  2Q8U A;  2GQ0 A;  1X6E A;  2L33 A;  4O5G A;  2EPR A;  5FWK A;  2EN6 A;  3GME A;  4BA2 A;  1Y6Z A;  4DU8 A;  4LF7 I;  4B3T E;  1J5E E;  2EZ6 A;  1FWK A;  1MEY C;  2BA0 G;  4L8N A;  2YTJ A;  5A6K A;  2EPL X;  2ODR D;  2VQF E;  2EMA A;  4JI3 E;  2CG9 A;  4F9B B;  4B3R I;  4ZYE A;  2YSP A;  2RQL A;  4WUC A;  2E1M A;  1YZ9 A;  1YUJ A;  1WRJ A;  2ZIT A;  3C4B A;  3QT6 A;  2EOQ A;  4P78 A;  4J8Z A;  5JEA E;  2YTQ A;  5AC4 A;  2WCC 3;  4JI0 E;  2MKN A;  4ZYD A;  1N3G A;  1N33 I;  2EOI A;  2YPN A;  4IFD F;  3BID A;  2JVA A;  2O3Z A;  4OO1 C;  3BF2 A;  4NXN I;  2J7K A;  2B3T B;  2LTR A;  2A2D A;  3LNU A;  2EOH A;  3QT5 A;  4HAC B;  4MYU A;  2EP3 A;  1QNT A;  5DRR A;  4Z7C A;  1NCS A;  2EOE A;  1Z59 A;  2V89 A;  4Q35 B;  5F3W A;  4NBQ A;  3KZZ A;  4JI4 I;  3C4T A;  3M85 G;  3THO B;  4J3D A;  2UUB I;  4M0V A;  2XEX A;  4IFD E;  1RHY A;  4M1K A;  2X7I A;  4YY3 I;  3IWB A;  2GS8 A;  5C0X D;  3UK3 C;  4DR6 I;  2YTE A;  4X64 I;  1OYP A;  4R2S A;  2LO3 A;  2EWL A;  4FW6 A;  4LPF A;  3F6G A;  2PO1 A;  2EL5 A;  2F1D A;  4JI8 E;  4ISA A;  4MLQ A;  3CDJ A;  2LTS A;  4B3M E;  5K36 C;  5A6A A;  2EMW A;  2ELY A;  1AH5 A;  2EPP A;  1XMQ E;  3KZY A;  3ECR A;  5LLQ A;  1KTV A;  2UXB I;  2CT1 A;  3F0N A;  4LU9 A;  5IT9 C;  2JP9 A;  2LJU A;  1ZXN A;  5C0X B;  1NHJ A;  1N32 E;  2E5L I;  2V88 A;  3M99 B;  4GKK E;  4NXM E;  3GON A;  5ELW A;  2JE6 A;  4DV1 I;  1Z0B A;  4F6M A;  3ZZU A;  4LTY A;  1FNM A;  2VES A;  3WU6 A;  4X65 I;  2M9A A;  1EKZ A;  2EMG A;  4LFA E;  2I13 A;  2PNZ B;  4DR5 I;  4WYQ B;  3B78 A;  2LCE A;  4R2E A;  4R2D A;  4HAC A;  4ZYG A;  2UUC I;  4LF4 I;  2EQ1 A;  2EL4 A;  1YUI A;  1G2D C;  2UXD I;  2NN6 C;  2BB8 A;  2Z5B B;  1ZM3 A;  4IZJ D;  1VIS A;  2HKE A;  4GQU A;  1WJP A;  2EMF A;  4WFT A;  1N0V C;  2RS7 A;  1T4O A;  1EH6 A;  2EN2 A;  2JOX A;  1F2I G;  1A1L A;  2WW4 A;  1OYR A;  4ED4 A;  1BKN A;  1H7S A;  3AV0 A;  3OTO I;  2M7Q A;  4DV7 E;  2WBT A;  1AAY A;  2DLK A;  4DR3 E;  4DV4 E;  2VE7 C;  2LRS A;  1E3P A;  1H7U A;  3P3G A;  2PO0 B;  1NEI A;  3HPS A;  2BR2 B;  1IMU A;  3THN A;  2EOY A;  2EN8 A;  4DUZ I;  2WZO A;  3PS2 A;  3Q6M A;  1Z0E A;  4WUD A;  3T1Y I;  1HNW I;  2O1U A;  5JEA D;  1MG7 A;  3K85 A;  1Z5B A;  3Q1Q A;  4KZS A;  4FWH A;  4LFC E;  4F6N A;  3WU5 A;  4DPW A;  4BA2 B;  1YFH A;  1XNQ E;  1B62 A;  3PYF A;  2EM8 A;  4WUB A;  1PVG A;  4LF8 I;  4OO1 F;  2NAB A;  3F6H A;  3PS1 A;  4UT4 A;  2E1R A;  1IBM E;  4KHP E;  3JTZ A;  4DPY A;  1N0U A;  5JEA B;  1Z0T A;  1XNR E;  2F4V I;  4BBY A;  4YHH E;  1IBL E;  2Z5B A;  4DV3 I;  2EMH A;  4DV6 E;  1UDS A;  4OO1 E;  1B69 A;  1KYQ A;  1PJQ A;  2L2N A;  3ADJ A;  3CWV A;  2EPA A;  2DMY A;  2L8T A;  4WX9 A;  4DV0 E;  2HKJ A;  2HHH I;  1ZM2 A;  1I94 I;  2EMZ A;  1YYK A;  2LMZ A;  1Z0V A;  2JWO A;  2BR2 A;  5K36 F;  5AE2 A;  3D4J A;  4AQY E;  1N36 E;  3M7N D;  2MDR A;  3PYG A;  4JI1 I;  2EOF A;  4X66 E;  1Z0G A;  4BCA A;  4LF6 E;  2UU9 I;  4NXM I;  1X49 A;  1X48 A;  2ODR C;  4JI6 E;  4LCG A;  1JK2 A;  2N3G A;  4B3S E;  2CVE A;  4R2P A;  4OOG C;  3B4T A;  1GZ6 A;  4BMJ A;  1EH8 A;  3VYX A;  5K36 E;  3QT7 A;  1R6L A;  2FGG A;  4B3T I;  3KRN A;  5DNL A;  2ZM6 I;  5IWA E;  4R8O A;  2VQF I;  5JEA A;  1UHZ A;  1EA6 A;  1E3H A;  2DEI A;  4HEI A;  3M6A A;  4FW4 A;  2BA1 G;  3QT8 A;  3J7Y p;  4ZVI A;  1RR9 A;  2YRH A;  5FLX C;  2C38 B;  2CGE A;  1T38 A;  2JE6 B;  2NN6 F;  5DNX A;  2JEA A;  4JV5 E;  3P3E A;  1TF6 A;  3VK6 A;  3MHS C;  1HNZ E;  3BBG A;  1IBK I;  2BBG A;  2YWQ A;  2ENC A;  2EPM X;  4DUY E;  4IFD A;  3WU4 A;  2UUA I;  1HNX I;  1USV A;  2Q2E B;  1Z5C A;  2DB2 A;  4LF7 E;  2K4V A;  2NN6 E;  1ZAA C;  4BC9 A;  1Y4U A;  1J26 A;  3B82 A;  3H4L A;  4P7A A;  4JI5 I;  4JYA I;  1RRE A;  2BV3 A;  4DR1 I;  1HR0 I;  2B7T A;  2X36 A;  1LLM C;  4B3R E;  4FW5 A;  4IJD A;  2JYA A;  2PRT A;  2KON A;  1S4E A;  4JI7 E;  5A2Q C;  1USU A;  1QZR A;  2YTF A;  3JU0 A;  5BR8 E;  3P1X A;  1Z0W A;  4K0K E;  4DV5 I;  2E72 A;  2EOS A;  1KIJ A;  4JI8 I;  1N33 E;  4U3B A;  1YSA C;  1X6F A;  2VQE E;  1MU5 A;  1MGT A;  4NXN E;  2JPA A;  2O1W A;  2LE2 A;  2V8Q B;  2AE8 A;  1ZBT A;  4IZK B;  3ZM7 A;  2MC5 A;  1RC7 A;  2EE8 A;  2JOB A;  2L2K B;  2EM3 A;  2YTP A;  4JI4 E;  4DXL A;  4GKJ I;  3EPL A;  1N32 I;  2FTX B;  2VRD A;  2EQ3 A;  2N8X A;  3H09 A;  5TSE A;  2UUB E;  1YPN A;  3IWD A;  2C38 A;  2J65 A;  2YU8 A;  3JAM C;  5KL3 A;  4YY3 E;  3PS3 A;  3GLL A;  2EPZ A;  4MU1 A;  3PYE A;  2EPN A;  1FKA E;  5DRQ A;  4LF5 I;  4X64 E;  2NUG A;  4DPX A;  5ADZ A;  4LOM A;  4X8W A;  4P7D A;  4R2R A;  1BB8 A;  1ELO A;  4BHC A;  2HJJ A;  1TN9 A;  4KQV A;  2IER A;  1B63 A;  2V2Z A;  3FIG A;  3K17 A;  2LJH A;  3HJC A;  4OKG A;  4OO1 B;  2HK2 A;  4JI2 E;  4LFB I;  2EMX A;  3M7N G;  2L92 A;  4HXZ A;  3JAM Q;  1FJG I;  1IQS A;  3IWC A;  4XTJ A;  2YRM A;  4TUI A;  2EMC A;  5A69 A;  1KJK A;  4URL A;  3MSW A;  4RH8 A;  4DV1 E;  2GLI A;  4DV7 I;  2R42 A;  2R76 A;  3PYD A;  4DR7 I;  1EI1 A;  4DR3 I;  2DRP A;  4JG4 A;  2EM9 A;  5AE3 A;  1WHN A;  4X65 E;  2JT2 A;  4PU9 A;  1DAR A;  1H72 C;  1P42 A;  4I8O A;  4IZK A;  4LF4 E;  4F54 A;  2ENH A;  5KL4 A;  4M2Z A;  3EPH A;  2HK3 A;  4DKK A;  2UXD E;  5AC5 A;  2LVH A;  4MU3 A;  1ZXM A;  3ADL A;  5AAS A;  1Z1B A;  5L3J A;  2EQ0 A;  4M30 A;  4OX9 E;  2UXC E;  3NZK A;  4X62 I;  4MYT A;  2EMK A;  2VF1 A;  2YU5 A;  2ELZ A;  1UEK A;  1XNQ I;  3J81 C;  1BBG A;  5LMU I;  3OTO E;  4DR4 I;  4X9J A;  5DRP A;  1IBM I;  1UBD C;  4MU0 A;  1OJ4 A;  3C6M A;  2KOU A;  1XNR I;  5A6B D;  3HUL A;  4BS9 A;  4IFD D;  5C0X F;  2GO3 A;  4OO1 A;  1KVK A;  1SFE A;  2EM2 A;  1EH7 A;  2LUP B;  3H1C A;  4DUZ E;  1KKH A;  2MKD A;  3T1Y E;  4RHB B;  1X47 A;  2JEA B;  4KWY A;  2A25 A;  4FWD A;  1N34 E;  1A6F A;  1OYS A;  2BM0 A;  3WU3 A;  2NN6 B;  3HQ1 A;  2F8B A;  2OI2 A;  1WHQ A;  2L6M A;  5LL6 R;  5KL2 A;  1ZU1 A;  4NZV A;  4IS9 A;  4DV2 I;  5C0X E;  2GPI A;  4DR2 I;  3L7Z A;  4IFD B;  3QG5 C;  1K47 A;  2Z5E A;  2R3V A;  4AID A;  3T1H E;  4DMI A;  1XMO I;  4LF8 E;  2YRK A;  2V2Q A;  3LML A;  1S16 A;  2C39 B;  4HYM A;  4AQY I;  1N36 I;  4R2C A;  3J80 C;  1A1K A;  1UN6 B;  3Q6N A;  5K36 A;  2CZ9 A;  1L4S A;  4R2A A;  1T4N A;  5LMN I;  4DV3 E;  3ZZT A;  4B3S I;  4IS1 C;  2DSY A;  2JXP A;  2NA2 A;  3DF6 A;  1DI2 A;  1ZM4 A;  4PRV A;  1VI7 A;  2EOO A;  2Z5C A;  1P47 A;  1ZM9 A;  2YTG A;  4F9C B;  1Y5Y A;  1J5E I;  2B7V A;  3B8H A;  5IWA I;  2V86 A;  2HHH E;  4JI3 I;  4WSG A;  3UHM A;  1MX0 A;  4QNJ A;  1I94 E;  2EM5 A;  4I3H A;  4FW9 A;  1GQE A;  1STU A;  4LF9 E;  4UTG A;  2BM1 A;  1X3C A;  1NZ0 A;  2EML A;  4JI0 I;  2L2M A;  2EPU A;  2JR1 A;  2LUQ A;  2UU9 E;  4M9V C;  2EM6 A;  4JV5 I;  2WBS A;  1X6H A;  3ZZ0 A;  2NN6 A;  3LPS A;  2HFS A;  3AUZ A;  3HXL A;  3EPK A;  2DIX A;  5A6B A;  3ZKB A;  3P06 A;  3ADI A;  1Y4S A;  2EM7 A;  5JEA F;  3VYY A;  5C0X C;  2HGH A;  2V87 A;  1TF3 A;  4MLV A;  2LBS B;  2RSM A;  2WP8 B;  4N3O A;  2ZM6 E;  2RSI A;  2C39 A;  2RTX A;  2PNM A;  3HTX A;  5FLX Q;  2EPK X;  2ENA A;  3DD6 A;  2C37 B;  4JI7 I;  2M1S A;  3ZKD A;  3TQM A;  5BR8 I;  1ZBQ A;  2EM4 A;  4K0K I;  1Y60 A;  2HFU A;  3U1Y A;  2EOM A;  1A1I A;  1H74 A;  2PO2 B;  2DMI A;  5DRO A;  3V2U C;  2KHX A;  2B9D A;  1A1J A;  2VQE I;  1Z5A A;  4B3M I;  4WXD A;  1IBK E;  2L3J A;  4BHB A;  3J7A M;  1XMQ I;  2V2V A;  1O0W A;  2UUA E;  1HNX E;  2NUF A;  2LV2 A;  2EFG A;  5KL7 A;  5A2Q Q;  4JYA E;  3OML A;  4JI5 E;  4WXC A;  1UDN A;  4GKK I;  4DR1 E;  1IQO A;  4WPY A;  1HR0 E;  2AJ4 A;  4FN5 A;  2EOZ A;  4OO1 D;  2IOQ A;  3K6Q A;  2JEB B;  1YH8 A;  3ZOQ B;  4F9A B;  4O24 A;  1UDO A;  4O43 A;  2EPC A;  1YYW A;  1WXR A;  5A6J A;  4DR6 E;  3EQ1 A;  5IXM B;  3RMP A;  2PNL A;  4LFA I;  5IT9 Q;  4DV5 E;  1Z0C A;  2CPN A;  2V85 A;  5GMD A;  4BC7 A;  1PIE A;  1H73 A;  1NHH A;  1UDQ A;  2RS6 A;  2I9I A;  2CSH A;  1T39 A;  4HY1 A;  4O4K A;  3VHT B;  2WP8 A;  4LCH A;  2J7J A;  4JI2 I;  1JK1 A;  2LJP A;  1RMD A;  2EOJ A;  2UXB E;  4EMD A;  2WNR B;  2YTD A;  2YZT A;  2IHR 1;  2C37 A;  3BGH A;  2E5L E;  2EOX A;  1FI4 A;  4GKJ E;  2CTD A;  4WSP A;  4USK A;  2ZBK B;  5EKW A;  2VF3 A;  1XXE A;  4RPF A;  4Q28 A;  5K36 D;  2K7I A;  4NHR A;  4MDT A;  5JEA C;  4USM A;  2YTO A;  2PO2 A;  2EPX A;  3L7Z B;  3P3C A;  4DPU A;  3L00 A;  4DV4 I;  4LF5 E;  4U3D A;  3U1K A;  2EN7 A;  2R1F A;  4FWG A;  4DR5 E;  2EN4 A;  2EL6 A;  2BA0 D;  1DQ3 A;  2UUC E;  4MQY A;  4L5N C;  4N4R B;  3MHH C;  5KL5 A;  1U2R A;  2BA1 D;  2DLQ A;  2YT4 A;  4DPT A;  2O1V A;  5K36 B;  4LCF A;  5T6J A;  4LFB E;  4P52 A;  3KWR A;  1PDA A;  1RQ0 A;  4BA1 B;  4IFD C;  2V83 A;  4LFC I;  1FJG E;  2JEB A;  2A2C A;  3PRY A;  4OX9 I;  2UXC I;  2Z5C B;  2EM0 A;  2N3H A;  5KL6 A;  2IOP A;  2G7H A;  5CFF E;  2WBU A;  2EMB A;  3GCM A;  2NPF A;  3V5R A;  2NN6 D;  4DR7 E;  2MC6 A;  3LTO A;  1SR9 A;  2EMY A;  4TUG A;  4KHP I;  4IZJ B;  3HPZ A;  4QNK A;  2EN1 A;  5DNY A;  2JY9 A;  1A1G A;  4YHH I;  3M85 D;  1IBL I;  3CDI A;  5IV8 B;  3C6K A;  1HK7 A;  2WNR A;  5C0X A;  1HNW E;  1PJS A;  2NUE A;  1N34 I;  1PJT A;  5GME A;  4DV6 I;  1FWL A;  2YSO A;  2D9H A;  3J81 Q;  1GTK A;  4GEQ B;  4AM3 A;  2RPC A;  2M4I A;  4X62 E;  4PRX A;  4DU7 A;  4DV0 I;  2L3C A;  2DEJ A;  2EN3 A;  3T1H I;  1ZR9 A;  2PNZ A;  3ADG A;  5LMU E;  2GHF A;  4DR4 E;  2EJ4 A;  1R6M A;  1NHI A;  3EPJ A;  4GZN C;  3J7A G;  2IES A;  1G2F C;  2F4V E;  3DJW A;  1BBO A;  1YHC A;  2ADR A;  4X66 I;  4LF6 I;  1A1H A;  2EMI A;  2YTI A;  4R03 A;  4F2J C;  2DGC A;  4JI6 I;  1D6T A;  4BA1 A;  1WUU A;  1UIL A;  4R1F A;  4Z7Y A;  2LT7 A;  3P76 A;  4AIM A;  5AE1 A;  4DR2 E;  4DV2 E;  3K1J A;  1YYO A;  4FW3 A;  4R2Q A;  1T4L B;  2YTN A;  2O1T A;  4IZJ A;  1XHK A;  5EL9 A;  2GO4 A;  2PO0 A;  3J80 Q;  1XMO E;  1PKP A;  3HKM A;  4LF9 I;  4OZE A;  2FV4 B;  4FW7 A;  2HC5 A;  2V8P A;  1QU6 A;  4MU4 A;  2EPO A;  2H36 X;  1A1F A;  2EOR A; 
#chains in the Genus database with same CATH homology
 4JI1 E;  3LLH A;  2V34 A;  5LMN E;  1HNZ I;  4DUY I;  2GQ0 A;  2L33 A;  5FWK A;  1Y6Z A;  4DU8 A;  4LF7 I;  4B3T E;  1J5E E;  2EZ6 A;  1FWK A;  4L8N A;  2VQF E;  2ODR D;  4JI3 E;  2CG9 A;  4B3R I;  4F9B B;  4WUC A;  2E1M A;  1YZ9 A;  2ZIT A;  3C4B A;  3QT6 A;  4P78 A;  4J8Z A;  4JI0 E;  1N33 I;  2JVA A;  4NXN I;  2J7K A;  2B3T B;  2LTR A;  2A2D A;  3LNU A;  3QT5 A;  4HAC B;  4MYU A;  4Z7C A;  1Z59 A;  2V89 A;  5F3W A;  4JI4 I;  3C4T A;  2UUB I;  4M0V A;  2XEX A;  4M1K A;  2X7I A;  4YY3 I;  3IWB A;  2GS8 A;  4DR6 I;  4X64 I;  2EWL A;  3F6G A;  4JI8 E;  2LTS A;  4B3M E;  1XMQ E;  1KTV A;  2UXB I;  3F0N A;  4LU9 A;  5IT9 C;  1ZXN A;  2E5L I;  1NHJ A;  1N32 E;  2V88 A;  4GKK E;  4NXM E;  3GON A;  4DV1 I;  1Z0B A;  3ZZU A;  4LTY A;  1FNM A;  3WU6 A;  4X65 I;  1EKZ A;  4LFA E;  4DR5 I;  4WYQ B;  3B78 A;  4HAC A;  2UUC I;  4LF4 I;  2UXD I;  2Z5B B;  1ZM3 A;  4IZJ D;  1VIS A;  2HKE A;  1N0V C;  4WFT A;  2RS7 A;  1T4O A;  2JOX A;  2WW4 A;  4ED4 A;  1BKN A;  1H7S A;  3AV0 A;  3OTO I;  2M7Q A;  4DV7 E;  4DR3 E;  4DV4 E;  2VE7 C;  2LRS A;  1H7U A;  3HPS A;  4DUZ I;  2WZO A;  3Q6M A;  1Z0E A;  4WUD A;  3T1Y I;  1HNW I;  2O1U A;  1MG7 A;  3K85 A;  1Z5B A;  3Q1Q A;  4KZS A;  4FWH A;  4LFC E;  3WU5 A;  4DPW A;  1B62 A;  1XNQ E;  3PYF A;  4WUB A;  1PVG A;  4LF8 I;  3F6H A;  4UT4 A;  2E1R A;  1IBM E;  4KHP E;  3JTZ A;  1N0U A;  1Z0T A;  1XNR E;  2F4V I;  4BBY A;  4YHH E;  1IBL E;  2Z5B A;  4DV3 I;  4DV6 E;  2L2N A;  3ADJ A;  3CWV A;  2DMY A;  2L8T A;  4DV0 E;  2HKJ A;  2HHH I;  1ZM2 A;  1I94 I;  1YYK A;  2LMZ A;  1Z0V A;  2JWO A;  5AE2 A;  3D4J A;  4AQY E;  1N36 E;  2MDR A;  3PYG A;  4JI1 I;  4X66 E;  1Z0G A;  4BCA A;  4LF6 E;  2UU9 I;  1X49 A;  1X48 A;  2ODR C;  4JI6 E;  2N3G A;  4B3S E;  4OOG C;  1GZ6 A;  4BMJ A;  3VYX A;  3QT7 A;  2FGG A;  4B3T I;  2ZM6 I;  5IWA E;  4R8O A;  2VQF I;  1UHZ A;  1EA6 A;  2DEI A;  3M6A A;  3QT8 A;  3J7Y p;  4ZVI A;  1RR9 A;  2CGE A;  5FLX C;  4JV5 E;  3VK6 A;  1HNZ E;  1IBK I;  4DUY E;  3WU4 A;  2UUA I;  1HNX I;  1USV A;  2Q2E B;  1Z5C A;  2DB2 A;  4LF7 E;  2K4V A;  1Y4U A;  4BC9 A;  3H4L A;  1J26 A;  3B82 A;  4P7A A;  4JI5 I;  4JYA I;  1RRE A;  2BV3 A;  4DR1 I;  1HR0 I;  2B7T A;  2X36 A;  4B3R E;  2KON A;  1S4E A;  4JI7 E;  5A2Q C;  1USU A;  1QZR A;  3JU0 A;  5BR8 E;  3P1X A;  1Z0W A;  4K0K E;  4DV5 I;  1KIJ A;  4JI8 I;  1N33 E;  2VQE E;  1MU5 A;  4NXN E;  2O1W A;  2LE2 A;  2V8Q B;  1ZBT A;  4IZK B;  3ZM7 A;  2MC5 A;  1RC7 A;  2JOB A;  2L2K B;  4JI4 E;  4DXL A;  1N32 I;  4GKJ I;  2FTX B;  2UUB E;  4DPY A;  4NXM I;  3H09 A;  3IWD A;  3JAM C;  4YY3 E;  3PYE A;  1FKA E;  4LF5 I;  4X64 E;  2NUG A;  4DPX A;  5ADZ A;  4X8W A;  4P7D A;  1ELO A;  4KQV A;  5IT9 Q;  3K17 A;  1B63 A;  2V2Z A;  3FIG A;  2LJH A;  3HJC A;  2HK2 A;  4JI2 E;  4LFB I;  2L92 A;  4HXZ A;  3JAM Q;  1FJG I;  3IWC A;  4XTJ A;  4TUI A;  4URL A;  3MSW A;  4DV1 E;  4DV7 I;  2R42 A;  3PYD A;  4DR7 I;  1EI1 A;  4DR3 I;  4JG4 A;  5AE3 A;  1WHN A;  4X65 E;  4PU9 A;  1DAR A;  1H72 C;  4I8O A;  4IZK A;  4LF4 E;  4F54 A;  2HK3 A;  4M2Z A;  4DKK A;  2UXD E;  1ZXM A;  3ADL A;  5AAS A;  5L3J A;  4M30 A;  4OX9 E;  2UXC E;  4X62 I;  4MYT A;  2VF1 A;  1UEK A;  1XNQ I;  3J81 C;  5LMU I;  3OTO E;  4DR4 I;  1IBM I;  1OJ4 A;  2KOU A;  1XNR I;  3HUL A;  4BS9 A;  1KVK A;  2LUP B;  4DUZ E;  1KKH A;  3T1Y E;  1X47 A;  4FWD A;  1N34 E;  1A6F A;  3WU3 A;  2BM0 A;  3HQ1 A;  2F8B A;  2OI2 A;  1WHQ A;  2L6M A;  5LL6 R;  4DR2 I;  4DV2 I;  1K47 A;  2Z5E A;  2R3V A;  3T1H E;  4DMI A;  1XMO I;  4LF8 E;  2V2Q A;  3LML A;  1S16 A;  4HYM A;  4AQY I;  1N36 I;  3J80 C;  3Q6N A;  2CZ9 A;  1T4N A;  5LMN I;  4DV3 E;  3ZZT A;  4B3S I;  2DSY A;  2NA2 A;  3DF6 A;  1DI2 A;  1ZM4 A;  4PRV A;  2Z5C A;  1ZM9 A;  4F9C B;  1J5E I;  2B7V A;  3B8H A;  5IWA I;  2V86 A;  2HHH E;  4JI3 I;  1MX0 A;  1I94 E;  4I3H A;  4FW9 A;  1GQE A;  1STU A;  4LF9 E;  4UTG A;  2BM1 A;  1NZ0 A;  4JI0 I;  2LUQ A;  2L2M A;  2JR1 A;  2UU9 E;  4JV5 I;  3ZZ0 A;  3LPS A;  2HFS A;  3AUZ A;  3HXL A;  2DIX A;  3ZKB A;  3P06 A;  3ADI A;  1Y4S A;  3VYY A;  2V87 A;  2LBS B;  2RSM A;  4N3O A;  2ZM6 E;  2RTX A;  2PNM A;  3HTX A;  5FLX Q;  4JI7 I;  2M1S A;  3ZKD A;  5BR8 I;  1ZBQ A;  4K0K I;  2HFU A;  1H74 A;  3V2U C;  2KHX A;  2B9D A;  2VQE I;  1Z5A A;  4B3M I;  1IBK E;  2L3J A;  3J7A M;  1XMQ I;  2V2V A;  1O0W A;  2UUA E;  1HNX E;  2NUF A;  2EFG A;  5A2Q Q;  4JYA E;  3OML A;  4JI5 E;  4GKK I;  4DR1 E;  4FN5 A;  4WPY A;  1HR0 E;  2AJ4 A;  2IOQ A;  3K6Q A;  3ZOQ B;  4F9A B;  1YYW A;  1WXR A;  4DR6 E;  4LFA I;  3RMP A;  2PNL A;  4DV5 E;  1Z0C A;  2CPN A;  2V85 A;  5GMD A;  4BC7 A;  1PIE A;  1H73 A;  1NHH A;  2RS6 A;  4HY1 A;  4JI2 I;  2LJP A;  4EMD A;  2UXB E;  2YZT A;  2IHR 1;  1FI4 A;  2E5L E;  4GKJ E;  4WSP A;  4USK A;  2ZBK B;  2VF3 A;  4RPF A;  4Q28 A;  4USM A;  4DPU A;  4DV4 I;  4LF5 E;  4FWG A;  4DR5 E;  1DQ3 A;  2UUC E;  4L5N C;  1U2R A;  2YT4 A;  4DPT A;  2O1V A;  5T6J A;  4LFB E;  4P52 A;  3KWR A;  1RQ0 A;  2V83 A;  4LFC I;  1FJG E;  4OX9 I;  2A2C A;  3PRY A;  2UXC I;  2Z5C B;  2N3H A;  2IOP A;  2G7H A;  5CFF E;  2NPF A;  3V5R A;  4DR7 E;  2MC6 A;  3LTO A;  1SR9 A;  4TUG A;  4KHP I;  4IZJ B;  3HPZ A;  5DNY A;  2JY9 A;  4YHH I;  1IBL I;  1HK7 A;  1HNW E;  2NUE A;  1N34 I;  5GME A;  4DV6 I;  1FWL A;  3J81 Q;  4GEQ B;  2M4I A;  4X62 E;  4PRX A;  4DU7 A;  4DV0 I;  2L3C A;  2DEJ A;  3T1H I;  3ADG A;  5LMU E;  4DR4 E;  1NHI A;  3J7A G;  2F4V E;  3DJW A;  4X66 I;  4LF6 I;  4R03 A;  4JI6 I;  1D6T A;  1WUU A;  1UIL A;  4R1F A;  4Z7Y A;  5AE1 A;  4DR2 E;  4DV2 E;  3K1J A;  1YYO A;  1T4L B;  2O1T A;  4IZJ A;  1XHK A;  3J80 Q;  1XMO E;  1PKP A;  4LF9 I;  2FV4 B;  2V8P A;  1QU6 A;  2H36 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...