4DV7E

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a915g, bound with streptomycin
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
b'DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4dv7E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dv7E02
1S16A 2L3JA 4MYUA 3ZZ0A 4DV6I 2LBSB 4B3RI 3LPSA 2DB2A 4X64E 3T1YE 2MDRA 3J80C 2L2NA 1I94I 4LF7E 2R42A 5A2QQ 1FWKA 4YHHE 2UXBI 3QT8A 2GS8A 1N32I 2V2QA 5CFFE 4GKKE 1Z59A 1XMQI 4JYAE 1IBLE 4JI8E 2VF3A 5GMDA 4JI2E 1HNXI 1PKPA 2UU9E 4JI3I 3ZZUA 4DR6I 5LMUE 2NUFA 4JI5E 2UXDE 1XNQE 4RPFA 3HTXA 1DARA 5LMNE 1KKHA 4PRXA 4ZVIA 2L2KB 1T4LB 4JI6E 1ZM4A 4HACA 2BV3A 4DR3E 1HR0E 1KIJA 1A6FA 3P1XA 1YYOA 1EKZA 4NXMI 1EI1A 2BM0A 5L3JA 4DU8A 2WW4A 4KHPE 4PU9A 4LF9E 2ZITA 3WU3A 2X7IA 1QU6A 1H7UA 3WU5A 2JY9A 4X66E 1RR9A 4WUBA 4DR4E 3WU4A 2YT4A 1DI2A 4X64I 2V2ZA 3T1YI 1N0UA 1H73A 1FNMA 2E1RA 1UEKA 1WUUA 4YHHI 3ADIA 2RTXA 4LF4E 4DUYI 4DPXA 3QT5A 2HHHI 1QZRA 4JYAI 1HNZI 1IBLI 4JI8I 1D6TA 3JAMC 4JI2I 1X49A 2V8PA 3J7AG 2LJHA 4M1KA 1IBKE 3T1HE 1U2RA 2B3TB 3J7Yp 4B3SE 4GKJE 1FI4A 2UU9I 1N33E 2HK3A 5FLXQ 5LMUI 4LFBE 2DEIA 2UXDI 4JI1E 2EFGA 1XNQI 2VQEE 1ZXMA 4B3TE 5LMNI 1J5EI 4DV0E 4LF8I 3PYFA 1T4NA 5GMEA 2B7VA 1HR0I 2ZBKB 2HFUA 4P52A 1H74A 2DEJA 1XMOE 2RSMA 4Z7YA 1N34E 2X36A 5BR8E 3PYEA 4HXZA 4OX9E 4KHPI 2OI2A 4X62E 4LF9I 4WYQB 4LF6E 2LUQA 4LF5E 4JI4I 1FKAE 2UUCE 4AQYE 4DXLA 1MU5A 2N3GA 1EA6A 1ELOA 1Z0TA 4DPUA 4DR7I 3QT6A 1NHJA 4X66I 4DV5E 4DR4I 1Z0VA 1PIEA 3ADGA 4DV7E 4HY1A 4LF4I 2UUBI 4JI0E 3B82A 4DR1I 1Z0WA 3V5RA 1S4EA 4LFCI 1H7SA 1IBKI 1FJGE 3T1HI 4B3SI 2DMYA 3K1JA 5IWAI 5IT9C 4GKJI 2F4VE 3ADLA 4X65I 4XTJA 2IHR1 2KHXA 3LNUA 4JI1I 3ZM7A 2VQEI 1RREA 4B3TI 2EZ6A 1BKNA 4FN5A 2VQFE 1NHHA 3GONA 2R3VA 3J7AM 2ZM6E 1T4OA 5BR8I 4LF6I 3C4BA 3HULA 2LUPB 4AQYI 4EMDA 2NUGA 3V2UC 1MX0A 4LF7I 3ZKBA 4YY3E 1HNWE 2A2CA 4DV5I 1VISA 1ZM9A 4DV7I 4GKKI 2BM1A 3JAMQ 2L2MA 4JI0I 3PYGA 4DUZE 1N32E 1J26A 4JI5I 4WFTA 1Z0EA 4LFAE 4FWHA 4ED4A 1FJGI 1ZM2A 2F4VI 4JI7E 1HNXE 2HFSA 4JI6I 2XEXA 4DR2E 4DR3I 1X47A 3H4LA 2VQFI 3K17A 4JG4A 1Z0GA 3PYDA 3OTOE 2LJPA 3J81C 4M30A 1PVGA 3F0NA 2ZM6I 4DV2E 4DPTA 1GQEA 1WHNA 4UT4A 1XHKA 3J80Q 2AJ4A 4X8WA 1N36E 4R1FA 2LRSA 1K47A 4JV5E 4YY3I 1HNWI 4DV4E 2UXCE 4USKA 1RQ0A 1IBME 2V2VA 4DPYA 2LTSA 4DV3E 5A2QC 1OJ4A 4Z7CA 2L3CA 4DR5E 4WUDA 4K0KE 1KVKA 4OOGC 2L33A 4DUYE 2CZ9A 1Z0BA 4NXNE 4DUZI 4DV1E 1N33I 4B3ME 5IT9Q 2HHHE 4LFBI 4URLA 1NZ0A 2N3HA 4LFAI 1HNZE 2E5LE 3D4JA 3QT7A 4DU7A 4MYTA 4JI7I 2UUAE 2DIXA 1YYWA 4DV0I 1MG7A 4DR2I 1UHZA 4PRVA 4WUCA 1B62A 4HACB 1XNRE 2A2DA 1J5EE 3LTOA 5LL6R 3ZZTA 4LF8E 4HYMA 1XMOI 3OTOI 1N34I 4USMA 2CPNA 4M2ZA 4OX9I 4X62I 1RC7A 3C4TA 4LF5I 2UUCI 1STUA 4DV2I 1O0WA 4P7AA 4DV6E 1NHIA 2V34A 2HKJA 1ZXNA 4B3RE 1X48A 4FWGA 1N36I 4JI4E 2J7KA 4JV5I 1Z0CA 2HK2A 1I94E 3B78A 1Z5AA 4DV4I 2UXCI 1N0VC 1ZBTA 4DR7E 2NUEA 2UXBE 1IBMI 3WU6A 1YYKA 4DV3I 4UTGA 4DKKA 2NPFA 1XMQE 4DR5I 2LTRA 4K0KI 3LLHA 2UUBE 2JVAA 4I3HA 4NXNI 2HKEA 4DV1I 1WHQA 1YZ9A 4FW9A 4B3MI 3B8HA 4DR1E 4JI3E 1FWLA 4DR6E 2B7TA 2E5LI 3M6AA 4LFCE 3Q1QA 3ADJA 2UUAI 5FLXC 5IWAE 1ZM3A 4KQVA 1B63A 4X65E 2RS6A 2Q2EB 2RS7A 1H72C 2NA2A 3VYYA 1UILA 3J81Q 1Z5CA 1XNRI 3VYXA 3ZKDA 4DPWA 4NXME 3CWVA 4FWDA 1KTVA 1Z5BA
chains in the Genus database with same CATH superfamily
1ZAAC 2GLIA 4ISAA 1DGCA 2NN6F 1S16A 2ELYA 5AASA 2L3JA 3M7ND 4MYUA 3ZZ0A 4NHRA 1QNTA 4DV6I 2LBSB 2V87A 1B69A 3EPHA 2EOYA 2WCC3 2DSYA 5T6JA 2VESA 2CG9A 2EPLX 4B3RI 3LPSA 5AE2A 3K6QA 3HPSA 2UUCE 4BA2A 2FV4B 1WRJA 4FK5C 2JEAA 2DB2A 1UDNA 2Q8UA 2BA1D 4OO1D 4X64E 2LE2A 5K36C 4R2QA 1GZ6A 3T1YE 2ELZA 2MDRA 2L2NA 3J80C 1I94I 4LF7E 2CVEA 2R42A 3Q6MA 2YWQA 4OO1E 5A2QQ 1A1JA 1FWKA 4YHHE 2GQ0A 3MSWA 4P78A 2UXBI 4P7DA 2EP3A 3QT8A 4IZKB 4AIMA 2RPCA 2GS8A 4MU0A 2EL6A 2YTEA 5KL3A 2EQ1A 2JYAA 1UBDC 4BA1B 2V2QA 1N32I 5CFFE 4GKKE 1Z59A 5TSEA 1XMQI 4JYAE 1IMUA 1IBLE 4JI8E 2VF3A 5GMDA 4JI2E 1USUA 2HGHA 2EOOA 1HNXI 1PKPA 2DLQA 2UU9E 2JE6A 4JI3I 2EM0A 3ZZUA 4DR6I 5LMUE 2MKNA 2GHFA 2NUFA 4JI5E 3HJCA 5AE3A 2F1DA 2JOXA 2IOQA 3GCMA 2UXDE 1XNQE 2YTIA 4RPFA 1G2FC 2Z5BB 2YZTA 3HTXA 4R2RA 1DARA 4NBQA 5LMNE 1KKHA 4PRXA 4ZVIA 3AUZA 2L2KB 1E3HA 5C0XE 1T4LB 4JI6E 3AV0A 2EWLA 1ZM4A 4HACA 2BA1G 4FW6A 2BV3A 2EN3A 4X9JA 2YTGA 4DR3E 4J3DA 2PNZA 1HR0E 2GPIA 2IERA 2PO2A 1KIJA 1A6FA 3P1XA 4NZVA 1YYOA 1RHYA 2LJUA 2NN6E 1EKZA 2O3ZA 4NXMI 1EI1A 2BM0A 5L3JA 4DU8A 2WW4A 4F2JC 2LV2A 5A6BD 4KHPE 3KZZA 1A1KA 2EMLA 3KZYA 2O1VA 4LF9E 4PU9A 2ZITA 3WU3A 4IFDD 3C6MA 5KL2A 2PO0B 2JEBB 2X7IA 2EN2A 5K36A 1QU6A 2EN8A 2RSIA 1YUIA 2O1WA 1IQOA 2EMBA 2EM8A 1H7UA 3ECRA 3WU5A 2F8BA 1PJQA 2JY9A 4OO1B 5KL5A 4X66E 1RR9A 4WUBA 1BBGA 4DR4E 2I13A 2EM9A 3WU4A 2YT4A 1DI2A 5FWKA 4X64I 2EPNA 3UK3C 2V2ZA 3T1YI 1N0UA 2L6MA 3M99B 4BMJA 1H73A 4BHBA 1FNMA 2E1RA 1UEKA 4Q28A 1WUUA 2IESA 4FW7A 4N3OA 4YHHI 3THNA 2EPMX 2C37A 3ADIA 5C0XA 2RTXA 4LF4E 4DUYI 4HTGA 4R03A 1BBOA 4DPXA 3QT5A 2HHHI 1QZRA 2EOMA 3VHTB 4JYAI 1HNZI 2EMHA 2MKDA 3PS3A 4JI8I 1IBLI 1D6TA 3JAMC 4JI2I 1X49A 3J7AG 2FTXB 2LJHA 2V8PA 4M1KA 1X3CA 4OKGA 1IBKE 3T1HE 1U2RA 2NN6A 5JEAD 2B3TB 1PJSA 3J7Yp 4B3SE 1NEIA 4GKJE 1FI4A 2UU9I 2EMZA 1N33E 2LMZA 2HK3A 5FLXQ 5LMUI 2ODRC 4LFBE 4IZJD 2DEIA 4BCAA 3MHSC 2NABA 4OO1F 2UXDI 4JI1E 2EFGA 1XNQI 2VQEE 2M1SA 1ZXMA 4B3TE 3IWBA 5LMNI 2K7IA 4BC7A 2BA0D 1J5EI 4DV0E 2C39A 4LF8I 4R2PA 2WBUA 3PYFA 1T4NA 4LOMA 5GMEA 4KZSA 2FGGA 2B7VA 2JWOA 5KL4A 1UDQA 1HR0I 1Y5YA 2WNRB 2ZBKB 2HFUA 4P52A 4M9VC 2KONA 1H74A 2DEJA 1XMOE 4R2EA 2RSMA 4O4KA 1N34E 4Z7YA 2N8XA 2EMIA 2X36A 5BR8E 4FW5A 3M85D 3PYEA 4HXZA 4OX9E 4KHPI 2EQ0A 2AE8A 4X62E 2OI2A 4LF9I 4WYQB 4LF6E 2LUQA 4LF5E 2YTJA 4JI4I 5AE1A 1FKAE 2JP9A 2R76A 1EH7A 3TQMA 3BBGA 4AQYE 2WBTA 4F9BB 2I9IA 1MU5A 2N3GA 1EA6A 2GO3A 3H1CA 2M9AA 1ELOA 1OYPA 1XXEA 1Z0TA 4U3DA 5DNYA 4DPUA 5DRPA 2EMFA 2EN6A 4LPFA 2EPRA 1WXRA 2EOJA 4DR7I 3QT6A 2YPNA 1NHJA 2V85A 2LT7A 2C38B 4F9AB 4DV5E 1TN9A 5DRQA 4X66I 4DR4I 2YTFA 5KL6A 1Z0VA 2EMGA 1PIEA 2BA0G 3UHMA 3ADGA 1UN6B 4DV7E 4IZKA 2PO1B 2EN4A 1HK7A 2DMIA 4HY1A 2D9HA 4BA1A 5C0XC 1ZBQA 4LF4I 2UUBI 2JOBA 2EMWA 1VI7A 4JI0E 3EPJA 3PRYA 3B82A 4FW4A 2YTOA 4DR1I 2EPOA 3M7NG 1Z0WA 3V5RA 1S4EA 4BC9A 3M85G 1DQ3A 2YSOA 2YRHA 2EOSA 4GZNC 4O24A 1H7SA 1ZU1A 1FJGE 4BBYA 4LFCI 3IWDA 5IXMB 2NN6C 2DMYA 2EN1A 1A1LA 3K1JA 4B3SI 2YTPA 5IT9C 3NZKA 2L8TA 2F4VE 4BS9A 5A69A 5IWAI 4GKJI 3ADLA 2PNMA 2Z5CB 4X65I 4XTJA 2Z5BA 2IHR1 2KHXA 3LNUA 2MC5A 4JI1I 3ZM7A 3F6GA 3IWCA 2VQEI 4MQYA 1RREA 3L7ZB 2M7QA 4B3TI 2EZ6A 5K36D 1BKNA 4O43A 2VQFE 1NHHA 2BBGA 4FN5A 3GONA 3RMPA 2PNLA 2R3VA 2O1TA 3THOB 2EM6A 1T39A 4IFDE 1TF6A 4I8OA 1Y4UA 2V89A 2J7JA 4WXDA 1X6EA 3J7AM 2ZM6E 1SR9A 4WSPA 1T4OA 5C0XD 1LLMC 1NCSA 2VRDA 2PO0A 2ENAA 5BR8I 2JEBA 2V8QB 2EPCA 1A1HA 2EL4A 4ZYHA 5EKWA 4TUGA 4LF6I 1YPNA 1YFHA 2CT1A 3C4BA 2ENCA 4IS9A 3ZOQB 3HULA 3BF2A 2BR2B 4J8ZA 3EPLA 2LUPB 4EMDA 2NUGA 4AQYI 1YH8A 4QNKA 1MX0A 3V2UC 2EPUA 4OO1A 4LF7I 1UDOA 3H09A 2EMXA 2HJJA 4LU9A 3JU0A 5LLQA 2EM5A 4YY3E 1HNWE 2A2CA 3ZKBA 2MC6A 4DV5I 2O1UA 1VISA 1X6FA 2WP8B 1ZM9A 1YUJA 2EJ4A 1R6LA 4N4RB 4DV7I 4GKKI 5JEAE 2BM1A 4KWYA 2H36X 1PJTA 2YU8A 2R1FA 2ADRA 3JAMQ 4IFDB 2EM2A 2L2MA 4JI0I 3P06A 1JK1A 3PYGA 3EPKA 4L8NA 1Y6ZA 4DUZE 1G2DC 1YHCA 4LCHA 1N32E 1SFEA 1J26A 4JI5I 4WFTA 1Z0EA 4LFAE 2GO4A 4FWHA 2KOUA 3GLLA 4ED4A 1FJGI 1ZM2A 3KWRA 4AM3A 2F4VI 4JI7E 1YSAC 1HNXE 2DRPA 2HFSA 2CTDA 1A1GA 3DD6A 4JI6I 2XEXA 1MGTA 1EH6A 4DR2E 4F6MA 2IOPA 4F9CB 5DROA 4DR3I 5KL7A 5K36F 2EM3A 1X47A 2VF1A 5EL9A 4WXCA 4R8OA 1OYRA 3H4LA 2VQFI 1P47A 2LO3A 2WNRA 2EMYA 3K17A 4JG4A 2PRTA 1Z0GA 2YTNA 3PYDA 4IFDF 3OTOE 2LJPA 3J81C 3PS1A 1EH8A 3F6HA 1KJKA 4M30A 1PVGA 5JEAB 3L00A 4HEIA 4F54A 3F0NA 2ZM6I 2JXPA 4DV2E 2E1MA 1Y60A 4IZJB 4DPTA 4F6NA 1GQEA 5DNLA 1WHNA 4UT4A 1XHKA 3J80Q 1TF3A 2EPAA 1X6HA 2LVHA 4R2AA 1RMDA 2CSHA 2ODRD 2AJ4A 3VK6A 4X8WA 1T38A 1N36E 4R1FA 2LRSA 2B9DA 1K47A 2C38A 4L5NC 4JV5E 4OO1C 1X5WA 4BA2B 4AIDA 4WX9A 4OZEA 1KYQA 4YY3I 3BIDA 1HNWI 2EORA 4DV4E 2UXCE 4USKA 5A6KA 4TUIA 2YRKA 3PS2A 1RQ0A 1IBME 2V2VA 2EMCA 4DPYA 2LTSA 2PO1A 4DV3E 4GEQB 4ZYDA 5JEAF 3P3CA 5A2QC 1OJ4A 4Z7CA 5IV8B 3GMEA 2L3CA 4DR5E 4WUDA 2WBSA 4K0KE 3LMLA 4ZYEA 1E3PA 2JR1A 1PDAA 2VE7C 4OOGC 1KVKA 2EPZA 2L33A 1A1FA 4DUYE 2CZ9A 2WZOA 5ELWA 1Z0BA 4NXNE 4DUZI 4DV1E 1N33I 4B3ME 2EOEA 1OYSA 2K4VA 1WJPA 5IT9Q 4IFDC 2HHHE 2L92A 4URLA 4LFBI 4ZYGA 1NZ0A 2N3HA 4LFAI 1HNZE 2ENHA 2E5LE 2Z5CA 3D4JA 2EOIA 1Y4SA 2CGEA 2JPAA 5K36E 4LCFA 2EL5A 2JE6B 5AC4A 3CDIA 3QT7A 4MYTA 4DU7A 4JI7I 2UUAE 3P3EA 2YU5A 2DIXA 4O5GA 4IS1C 1YYWA 3L7ZA 4DV0I 1MG7A 4DR2I 1F2IG 1UHZA 2YRMA 2DGCA 4PRVA 1AH5A 2LCEA 1USVA 4WUCA 2V86A 3DJWA 2EPKX 2V83A 1B62A 2EM4A 4HACB 3T1HI 1XNRE 2A2DA 4MDTA 2PNZB 1J5EE 3LTOA 5LL6R 1MEYC 3ZZTA 4LF8E 3P76A 4HYMA 1XMOI 2PO2B 4M0VA 3OTOI 4MLQA 2A25A 4USMA 1N34I 2CPNA 2EPPA 3B4TA 4RHBB 4M2ZA 4OX9I 1Z1BA 2YTDA 3QG5C 4X62I 1RC7A 2EM7A 5DNXA 2E72A 2DLKA 2EQ3A 4R2CA 3C4TA 4LF5I 3HXLA 3KRNA 3OMLA 5JEAC 2UUCI 1STUA 4DV2I 1O0WA 4P7AA 1UDSA 4DV6E 2BB8A 2NN6D 3BGHA 2EOZA 3HPZA 2BR2A 2EMAA 1AAYA 1NHIA 2V34A 4GQUA 2HKJA 1ZXNA 4B3RE 1X48A 4FWGA 1N36I 5K36B 5AC5A 5A6AA 2EOQA 3DF6A 4MLVA 4JI4E 1ZR9A 2J7KA 3HKMA 3U1YA 4JV5I 2WP8A 1Z0CA 4IJDA 2HK2A 1A1IA 2MDGA 1I94E 3B78A 1Z5AA 4DXLA 4DV4I 2UXCI 1N0VC 1ZBTA 4DR7E 2NUEA 2UXBE 1IBMI 4U3BA 3WU6A 1YYKA 4WPYA 3P3GA 3Q6NA 4QNJA 4DV3I 4UTGA 3C6KA 5A6BA 4RH8A 4DKKA 2C37B 4IFDA 5C0XB 1GTKA 2EMKA 1JK2A 5A6JA 2NPFA 1XMQE 3CDJA 4DR5I 2LTRA 3EQ1A 2EPXA 4K0KI 3LLHA 2UUBE 2JVAA 2J65A 4DMIA 4I3HA 4NXNI 5F3WA 2HKEA 1WHQA 1YZ9A 4FW9A 1L4SA 4DV1I 2RQLA 3B8HA 4B3MI 4DR1E 4JI3E 1FWLA 4DR6E 2B7TA 4LTYA 2NN6B 2JEAB 2E5LI 4Q35B 3M6AA 5DRRA 4LFCE 2EOXA 2JT2A 2EOHA 3Q1QA 4BHCA 4R2DA 2G7HA 3ADJA 2UUAI 2EOFA 5FLXC 5IWAE 1ZM3A 4KQVA 2V88A 3HQ1A 5ADZA 2Z5EA 2HC5A 1B63A 3U1KA 4WSGA 4X65E 3K85A 2RS6A 2Q2EB 4MU3A 2RS7A 4R2SA 3JTZA 3MHHC 2NA2A 2YSPA 3VYYA 1H72C 1UILA 2EN7A 4LCGA 1BB8A 3J81Q 1N3GA 2YTQA 1Z5CA 2C39B 5C0XF 1XNRI 3VYXA 3FIGA 1P42A 2EE8A 3ZKDA 5JEAA 1IQSA 4DPWA 4MU1A 4NXME 2M4IA 1IBKI 1R6MA 3CWVA 4FWDA 4FW3A 4MU4A 4IZJA 1KTVA 1Z5BA
chains in the Genus database with same CATH topology
1S16A 5AASA 2L3JA 4MYUA 3ZZ0A 4DV6I 2LBSB 2V87A 2DSYA 5T6JA 2CG9A 4B3RI 3LPSA 5AE2A 3K6QA 3HPSA 2FV4B 2DB2A 4X64E 2LE2A 1GZ6A 3T1YE 2MDRA 3J80C 2L2NA 1I94I 4LF7E 2R42A 3Q6MA 5A2QQ 1FWKA 4YHHE 2GQ0A 3MSWA 4P78A 2UXBI 4P7DA 3QT8A 4IZKB 2GS8A 1N32I 2V2QA 5CFFE 4GKKE 1Z59A 1XMQI 4JYAE 1IBLE 4JI8E 2VF3A 5GMDA 4JI2E 1USUA 1HNXI 1PKPA 2UU9E 4JI3I 3ZZUA 4DR6I 5LMUE 2NUFA 4JI5E 3HJCA 5AE3A 2JOXA 2IOQA 2UXDE 1XNQE 4RPFA 2Z5BB 2YZTA 3HTXA 1DARA 5LMNE 1KKHA 4PRXA 4ZVIA 3AUZA 2L2KB 1T4LB 4JI6E 3AV0A 2EWLA 1ZM4A 4HACA 2BV3A 4DR3E 1HR0E 1KIJA 1A6FA 3P1XA 1YYOA 1EKZA 4NXMI 1EI1A 2BM0A 5L3JA 4DU8A 2WW4A 4KHPE 2O1VA 4PU9A 4LF9E 2ZITA 3WU3A 2X7IA 1QU6A 2O1WA 1H7UA 3WU5A 2F8BA 2JY9A 4X66E 1RR9A 4WUBA 4DR4E 3WU4A 2YT4A 1DI2A 5FWKA 4X64I 2V2ZA 3T1YI 1N0UA 2L6MA 1H73A 4BMJA 1FNMA 2E1RA 1UEKA 4Q28A 1WUUA 4N3OA 4YHHI 3ADIA 2RTXA 4LF4E 4DUYI 4R03A 4DPXA 3QT5A 2HHHI 1QZRA 4JYAI 1HNZI 1IBLI 4JI8I 1D6TA 3JAMC 4JI2I 1X49A 3J7AG 2FTXB 2LJHA 2V8PA 4M1KA 1IBKE 3T1HE 1U2RA 2B3TB 3J7Yp 4B3SE 4GKJE 1FI4A 2UU9I 1N33E 2LMZA 2HK3A 5FLXQ 5LMUI 2ODRC 4LFBE 4IZJD 2DEIA 4BCAA 2UXDI 4JI1E 2EFGA 1XNQI 2VQEE 2M1SA 1ZXMA 4B3TE 3IWBA 5LMNI 4BC7A 1J5EI 4DV0E 4LF8I 3PYFA 1T4NA 5GMEA 4KZSA 2FGGA 2B7VA 2JWOA 1HR0I 2ZBKB 2HFUA 4P52A 2KONA 1H74A 2DEJA 1XMOE 2RSMA 4Z7YA 1N34E 2X36A 5BR8E 3PYEA 4HXZA 4OX9E 4KHPI 2OI2A 4X62E 4LF9I 4WYQB 4LF6E 2LUQA 4LF5E 4JI4I 5AE1A 1FKAE 2UUCE 4AQYE 4DXLA 4F9BB 1MU5A 2N3GA 1EA6A 1ELOA 1Z0TA 5DNYA 4DPUA 1WXRA 4DR7I 3QT6A 1NHJA 2V85A 4X66I 4F9AB 4DV5E 4DR4I 1Z0VA 1PIEA 3ADGA 4DV7E 4IZKA 1HK7A 4HY1A 4LF4I 1ZBQA 2UUBI 2JOBA 4JI0E 3PRYA 3B82A 4DR1I 1Z0WA 3V5RA 1S4EA 4BC9A 1DQ3A 4LFCI 1H7SA 1IBKI 1FJGE 4BBYA 3T1HI 3IWDA 4B3SI 2DMYA 3K1JA 5IT9C 5IWAI 4GKJI 2L8TA 2F4VE 4BS9A 3ADLA 2PNMA 2Z5CB 4X65I 4XTJA 2Z5BA 2IHR1 2KHXA 3LNUA 2MC5A 4JI1I 3ZM7A 3F6GA 3IWCA 2VQEI 1RREA 2M7QA 4B3TI 2EZ6A 1BKNA 2VQFE 1NHHA 4FN5A 3GONA 3RMPA 2PNLA 2R3VA 2O1TA 4I8OA 1Y4UA 2V89A 3J7AM 2ZM6E 4WSPA 1SR9A 1T4OA 5BR8I 2V8QB 4TUGA 4LF6I 3C4BA 3ZOQB 3HULA 4J8ZA 2LUPB 4AQYI 4EMDA 2NUGA 3V2UC 1MX0A 4LF7I 3H09A 3ZKBA 3JU0A 4LU9A 4YY3E 1HNWE 2A2CA 2MC6A 4DV5I 2O1UA 1VISA 1ZM9A 4DV7I 4GKKI 2BM1A 2H36X 3JAMQ 2L2MA 4JI0I 3P06A 3PYGA 4L8NA 1Y6ZA 4DUZE 1N32E 1J26A 4JI5I 4WFTA 1Z0EA 4LFAE 4FWHA 2KOUA 4ED4A 1FJGI 1ZM2A 3KWRA 2F4VI 4JI7E 1HNXE 2HFSA 4JI6I 2XEXA 4DR2E 2IOPA 4F9CB 4DR3I 1X47A 2VF1A 4R8OA 3H4LA 2VQFI 3K17A 4JG4A 1Z0GA 3PYDA 3OTOE 2LJPA 3J81C 3F6HA 4M30A 1PVGA 4F54A 3F0NA 2ZM6I 4DV2E 2E1MA 4IZJB 4DPTA 1GQEA 1WHNA 4UT4A 1XHKA 3J80Q 2ODRD 2AJ4A 3VK6A 4X8WA 1N36E 4R1FA 2LRSA 2B9DA 1K47A 4L5NC 4JV5E 4YY3I 1HNWI 4DV4E 2UXCE 4USKA 4TUIA 1RQ0A 1IBME 2V2VA 4DPYA 2LTSA 4DV3E 4GEQB 5A2QC 1OJ4A 4Z7CA 2L3CA 4DR5E 4WUDA 4K0KE 3LMLA 1KVKA 2JR1A 2VE7C 4OOGC 2L33A 4DUYE 2CZ9A 2WZOA 1Z0BA 4NXNE 4DUZI 4DV1E 1N33I 4B3ME 2K4VA 5IT9Q 2HHHE 2L92A 4URLA 4LFBI 1NZ0A 2N3HA 4LFAI 1HNZE 2E5LE 2Z5CA 3D4JA 1Y4SA 2CGEA 3QT7A 4DU7A 4MYTA 4JI7I 2UUAE 2DIXA 1YYWA 4DV0I 1MG7A 4DR2I 1UHZA 4PRVA 1USVA 4WUCA 2V86A 3DJWA 2V83A 1B62A 4HACB 1XNRE 2A2DA 1J5EE 3LTOA 5LL6R 3ZZTA 4LF8E 4HYMA 1XMOI 4M0VA 3OTOI 1N34I 4USMA 2CPNA 4M2ZA 4OX9I 4X62I 1RC7A 3C4TA 4LF5I 3HXLA 3OMLA 2UUCI 1STUA 4DV2I 1O0WA 4P7AA 4DV6E 3HPZA 1NHIA 2V34A 2HKJA 1ZXNA 4B3RE 1X48A 4FWGA 1N36I 3DF6A 4JI4E 2J7KA 4JV5I 1Z0CA 2HK2A 1I94E 3B78A 1Z5AA 4DV4I 2UXCI 1N0VC 1ZBTA 4DR7E 2NUEA 2UXBE 1IBMI 3WU6A 1YYKA 4WPYA 3Q6NA 4DV3I 4UTGA 4DKKA 2NPFA 1XMQE 4DR5I 2LTRA 4K0KI 3LLHA 2UUBE 2JVAA 4DMIA 4I3HA 4NXNI 5F3WA 2HKEA 1WHQA 1YZ9A 4FW9A 4DV1I 4B3MI 3B8HA 4DR1E 4JI3E 1FWLA 4DR6E 2B7TA 4LTYA 2E5LI 3M6AA 4LFCE 3Q1QA 2G7HA 3ADJA 2UUAI 5FLXC 5IWAE 1ZM3A 4KQVA 2V88A 3HQ1A 5ADZA 2Z5EA 1B63A 4X65E 3K85A 2RS6A 2Q2EB 2RS7A 3JTZA 1H72C 2NA2A 3VYYA 1UILA 3J81Q 1Z5CA 1XNRI 3VYXA 3FIGA 3ZKDA 4DPWA 4NXME 2M4IA 3CWVA 4FWDA 4IZJA 1KTVA 1Z5BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S16 A;  2L3J A;  4MYU A;  3ZZ0 A;  4DV6 I;  2LBS B;  4B3R I;  3LPS A;  2DB2 A;  4X64 E;  3T1Y E;  2MDR A;  3J80 C;  2L2N A;  1I94 I;  4LF7 E;  2R42 A;  5A2Q Q;  1FWK A;  4YHH E;  2UXB I;  3QT8 A;  2GS8 A;  1N32 I;  2V2Q A;  5CFF E;  4GKK E;  1Z59 A;  1XMQ I;  4JYA E;  1IBL E;  4JI8 E;  2VF3 A;  5GMD A;  4JI2 E;  1HNX I;  1PKP A;  2UU9 E;  4JI3 I;  3ZZU A;  4DR6 I;  5LMU E;  2NUF A;  4JI5 E;  2UXD E;  1XNQ E;  4RPF A;  3HTX A;  1DAR A;  5LMN E;  1KKH A;  4PRX A;  4ZVI A;  2L2K B;  1T4L B;  4JI6 E;  1ZM4 A;  4HAC A;  2BV3 A;  4DR3 E;  1HR0 E;  1KIJ A;  1A6F A;  3P1X A;  1YYO A;  1EKZ A;  4NXM I;  1EI1 A;  2BM0 A;  5L3J A;  4DU8 A;  2WW4 A;  4KHP E;  4PU9 A;  4LF9 E;  2ZIT A;  3WU3 A;  2X7I A;  1QU6 A;  1H7U A;  3WU5 A;  2JY9 A;  4X66 E;  1RR9 A;  4WUB A;  4DR4 E;  3WU4 A;  2YT4 A;  1DI2 A;  4X64 I;  2V2Z A;  3T1Y I;  1N0U A;  1H73 A;  1FNM A;  2E1R A;  1UEK A;  1WUU A;  4YHH I;  3ADI A;  2RTX A;  4LF4 E;  4DUY I;  4DPX A;  3QT5 A;  2HHH I;  1QZR A;  4JYA I;  1HNZ I;  1IBL I;  4JI8 I;  1D6T A;  3JAM C;  4JI2 I;  1X49 A;  2V8P A;  3J7A G;  2LJH A;  4M1K A;  1IBK E;  3T1H E;  1U2R A;  2B3T B;  3J7Y p;  4B3S E;  4GKJ E;  1FI4 A;  2UU9 I;  1N33 E;  2HK3 A;  5FLX Q;  5LMU I;  4LFB E;  2DEI A;  2UXD I;  4JI1 E;  2EFG A;  1XNQ I;  2VQE E;  1ZXM A;  4B3T E;  5LMN I;  1J5E I;  4DV0 E;  4LF8 I;  3PYF A;  1T4N A;  5GME A;  2B7V A;  1HR0 I;  2ZBK B;  2HFU A;  4P52 A;  1H74 A;  2DEJ A;  1XMO E;  2RSM A;  4Z7Y A;  1N34 E;  2X36 A;  5BR8 E;  3PYE A;  4HXZ A;  4OX9 E;  4KHP I;  2OI2 A;  4X62 E;  4LF9 I;  4WYQ B;  4LF6 E;  2LUQ A;  4LF5 E;  4JI4 I;  1FKA E;  2UUC E;  4AQY E;  4DXL A;  1MU5 A;  2N3G A;  1EA6 A;  1ELO A;  1Z0T A;  4DPU A;  4DR7 I;  3QT6 A;  1NHJ A;  4X66 I;  4DV5 E;  4DR4 I;  1Z0V A;  1PIE A;  3ADG A;  4DV7 E;  4HY1 A;  4LF4 I;  2UUB I;  4JI0 E;  3B82 A;  4DR1 I;  1Z0W A;  3V5R A;  1S4E A;  4LFC I;  1H7S A;  1IBK I;  1FJG E;  3T1H I;  4B3S I;  2DMY A;  3K1J A;  5IWA I;  5IT9 C;  4GKJ I;  2F4V E;  3ADL A;  4X65 I;  4XTJ A;  2IHR 1;  2KHX A;  3LNU A;  4JI1 I;  3ZM7 A;  2VQE I;  1RRE A;  4B3T I;  2EZ6 A;  1BKN A;  4FN5 A;  2VQF E;  1NHH A;  3GON A;  2R3V A;  3J7A M;  2ZM6 E;  1T4O A;  5BR8 I;  4LF6 I;  3C4B A;  3HUL A;  2LUP B;  4AQY I;  4EMD A;  2NUG A;  3V2U C;  1MX0 A;  4LF7 I;  3ZKB A;  4YY3 E;  1HNW E;  2A2C A;  4DV5 I;  1VIS A;  1ZM9 A;  4DV7 I;  4GKK I;  2BM1 A;  3JAM Q;  2L2M A;  4JI0 I;  3PYG A;  4DUZ E;  1N32 E;  1J26 A;  4JI5 I;  4WFT A;  1Z0E A;  4LFA E;  4FWH A;  4ED4 A;  1FJG I;  1ZM2 A;  2F4V I;  4JI7 E;  1HNX E;  2HFS A;  4JI6 I;  2XEX A;  4DR2 E;  4DR3 I;  1X47 A;  3H4L A;  2VQF I;  3K17 A;  4JG4 A;  1Z0G A;  3PYD A;  3OTO E;  2LJP A;  3J81 C;  4M30 A;  1PVG A;  3F0N A;  2ZM6 I;  4DV2 E;  4DPT A;  1GQE A;  1WHN A;  4UT4 A;  1XHK A;  3J80 Q;  2AJ4 A;  4X8W A;  1N36 E;  4R1F A;  2LRS A;  1K47 A;  4JV5 E;  4YY3 I;  1HNW I;  4DV4 E;  2UXC E;  4USK A;  1RQ0 A;  1IBM E;  2V2V A;  4DPY A;  2LTS A;  4DV3 E;  5A2Q C;  1OJ4 A;  4Z7C A;  2L3C A;  4DR5 E;  4WUD A;  4K0K E;  1KVK A;  4OOG C;  2L33 A;  4DUY E;  2CZ9 A;  1Z0B A;  4NXN E;  4DUZ I;  4DV1 E;  1N33 I;  4B3M E;  5IT9 Q;  2HHH E;  4LFB I;  4URL A;  1NZ0 A;  2N3H A;  4LFA I;  1HNZ E;  2E5L E;  3D4J A;  3QT7 A;  4DU7 A;  4MYT A;  4JI7 I;  2UUA E;  2DIX A;  1YYW A;  4DV0 I;  1MG7 A;  4DR2 I;  1UHZ A;  4PRV A;  4WUC A;  1B62 A;  4HAC B;  1XNR E;  2A2D A;  1J5E E;  3LTO A;  5LL6 R;  3ZZT A;  4LF8 E;  4HYM A;  1XMO I;  3OTO I;  1N34 I;  4USM A;  2CPN A;  4M2Z A;  4OX9 I;  4X62 I;  1RC7 A;  3C4T A;  4LF5 I;  2UUC I;  1STU A;  4DV2 I;  1O0W A;  4P7A A;  4DV6 E;  1NHI A;  2V34 A;  2HKJ A;  1ZXN A;  4B3R E;  1X48 A;  4FWG A;  1N36 I;  4JI4 E;  2J7K A;  4JV5 I;  1Z0C A;  2HK2 A;  1I94 E;  3B78 A;  1Z5A A;  4DV4 I;  2UXC I;  1N0V C;  1ZBT A;  4DR7 E;  2NUE A;  2UXB E;  1IBM I;  3WU6 A;  1YYK A;  4DV3 I;  4UTG A;  4DKK A;  2NPF A;  1XMQ E;  4DR5 I;  2LTR A;  4K0K I;  3LLH A;  2UUB E;  2JVA A;  4I3H A;  4NXN I;  2HKE A;  4DV1 I;  1WHQ A;  1YZ9 A;  4FW9 A;  4B3M I;  3B8H A;  4DR1 E;  4JI3 E;  1FWL A;  4DR6 E;  2B7T A;  2E5L I;  3M6A A;  4LFC E;  3Q1Q A;  3ADJ A;  2UUA I;  5FLX C;  5IWA E;  1ZM3 A;  4KQV A;  1B63 A;  4X65 E;  2RS6 A;  2Q2E B;  2RS7 A;  1H72 C;  2NA2 A;  3VYY A;  1UIL A;  3J81 Q;  1Z5C A;  1XNR I;  3VYX A;  3ZKD A;  4DPW A;  4NXM E;  3CWV A;  4FWD A;  1KTV A;  1Z5B A; 
#chains in the Genus database with same CATH topology
 1ZAA C;  2GLI A;  4ISA A;  1DGC A;  2NN6 F;  1S16 A;  2ELY A;  5AAS A;  2L3J A;  3M7N D;  4MYU A;  3ZZ0 A;  4NHR A;  1QNT A;  4DV6 I;  2LBS B;  2V87 A;  1B69 A;  3EPH A;  2EOY A;  2WCC 3;  2DSY A;  5T6J A;  2VES A;  2CG9 A;  2EPL X;  4B3R I;  3LPS A;  5AE2 A;  3K6Q A;  3HPS A;  2UUC E;  4BA2 A;  2FV4 B;  1WRJ A;  4FK5 C;  2JEA A;  2DB2 A;  1UDN A;  2Q8U A;  2BA1 D;  4OO1 D;  4X64 E;  2LE2 A;  5K36 C;  4R2Q A;  1GZ6 A;  3T1Y E;  2ELZ A;  2MDR A;  2L2N A;  3J80 C;  1I94 I;  4LF7 E;  2CVE A;  2R42 A;  3Q6M A;  2YWQ A;  4OO1 E;  5A2Q Q;  1A1J A;  1FWK A;  4YHH E;  2GQ0 A;  3MSW A;  4P78 A;  2UXB I;  4P7D A;  2EP3 A;  3QT8 A;  4IZK B;  4AIM A;  2RPC A;  2GS8 A;  4MU0 A;  2EL6 A;  2YTE A;  5KL3 A;  2EQ1 A;  2JYA A;  1UBD C;  4BA1 B;  2V2Q A;  1N32 I;  5CFF E;  4GKK E;  1Z59 A;  5TSE A;  1XMQ I;  4JYA E;  1IMU A;  1IBL E;  4JI8 E;  2VF3 A;  5GMD A;  4JI2 E;  1USU A;  2HGH A;  2EOO A;  1HNX I;  1PKP A;  2DLQ A;  2UU9 E;  2JE6 A;  4JI3 I;  2EM0 A;  3ZZU A;  4DR6 I;  5LMU E;  2MKN A;  2GHF A;  2NUF A;  4JI5 E;  3HJC A;  5AE3 A;  2F1D A;  2JOX A;  2IOQ A;  3GCM A;  2UXD E;  1XNQ E;  2YTI A;  4RPF A;  1G2F C;  2Z5B B;  2YZT A;  3HTX A;  4R2R A;  1DAR A;  4NBQ A;  5LMN E;  1KKH A;  4PRX A;  4ZVI A;  3AUZ A;  2L2K B;  1E3H A;  5C0X E;  1T4L B;  4JI6 E;  3AV0 A;  2EWL A;  1ZM4 A;  4HAC A;  2BA1 G;  4FW6 A;  2BV3 A;  2EN3 A;  4X9J A;  2YTG A;  4DR3 E;  4J3D A;  2PNZ A;  1HR0 E;  2GPI A;  2IER A;  2PO2 A;  1KIJ A;  1A6F A;  3P1X A;  4NZV A;  1YYO A;  1RHY A;  2LJU A;  2NN6 E;  1EKZ A;  2O3Z A;  4NXM I;  1EI1 A;  2BM0 A;  5L3J A;  4DU8 A;  2WW4 A;  4F2J C;  2LV2 A;  5A6B D;  4KHP E;  3KZZ A;  1A1K A;  2EML A;  3KZY A;  2O1V A;  4LF9 E;  4PU9 A;  2ZIT A;  3WU3 A;  4IFD D;  3C6M A;  5KL2 A;  2PO0 B;  2JEB B;  2X7I A;  2EN2 A;  5K36 A;  1QU6 A;  2EN8 A;  2RSI A;  1YUI A;  2O1W A;  1IQO A;  2EMB A;  2EM8 A;  1H7U A;  3ECR A;  3WU5 A;  2F8B A;  1PJQ A;  2JY9 A;  4OO1 B;  5KL5 A;  4X66 E;  1RR9 A;  4WUB A;  1BBG A;  4DR4 E;  2I13 A;  2EM9 A;  3WU4 A;  2YT4 A;  1DI2 A;  5FWK A;  4X64 I;  2EPN A;  3UK3 C;  2V2Z A;  3T1Y I;  1N0U A;  2L6M A;  3M99 B;  4BMJ A;  1H73 A;  4BHB A;  1FNM A;  2E1R A;  1UEK A;  4Q28 A;  1WUU A;  2IES A;  4FW7 A;  4N3O A;  4YHH I;  3THN A;  2EPM X;  2C37 A;  3ADI A;  5C0X A;  2RTX A;  4LF4 E;  4DUY I;  4HTG A;  4R03 A;  1BBO A;  4DPX A;  3QT5 A;  2HHH I;  1QZR A;  2EOM A;  3VHT B;  4JYA I;  1HNZ I;  2EMH A;  2MKD A;  3PS3 A;  4JI8 I;  1IBL I;  1D6T A;  3JAM C;  4JI2 I;  1X49 A;  3J7A G;  2FTX B;  2LJH A;  2V8P A;  4M1K A;  1X3C A;  4OKG A;  1IBK E;  3T1H E;  1U2R A;  2NN6 A;  5JEA D;  2B3T B;  1PJS A;  3J7Y p;  4B3S E;  1NEI A;  4GKJ E;  1FI4 A;  2UU9 I;  2EMZ A;  1N33 E;  2LMZ A;  2HK3 A;  5FLX Q;  5LMU I;  2ODR C;  4LFB E;  4IZJ D;  2DEI A;  4BCA A;  3MHS C;  2NAB A;  4OO1 F;  2UXD I;  4JI1 E;  2EFG A;  1XNQ I;  2VQE E;  2M1S A;  1ZXM A;  4B3T E;  3IWB A;  5LMN I;  2K7I A;  4BC7 A;  2BA0 D;  1J5E I;  4DV0 E;  2C39 A;  4LF8 I;  4R2P A;  2WBU A;  3PYF A;  1T4N A;  4LOM A;  5GME A;  4KZS A;  2FGG A;  2B7V A;  2JWO A;  5KL4 A;  1UDQ A;  1HR0 I;  1Y5Y A;  2WNR B;  2ZBK B;  2HFU A;  4P52 A;  4M9V C;  2KON A;  1H74 A;  2DEJ A;  1XMO E;  4R2E A;  2RSM A;  4O4K A;  1N34 E;  4Z7Y A;  2N8X A;  2EMI A;  2X36 A;  5BR8 E;  4FW5 A;  3M85 D;  3PYE A;  4HXZ A;  4OX9 E;  4KHP I;  2EQ0 A;  2AE8 A;  4X62 E;  2OI2 A;  4LF9 I;  4WYQ B;  4LF6 E;  2LUQ A;  4LF5 E;  2YTJ A;  4JI4 I;  5AE1 A;  1FKA E;  2JP9 A;  2R76 A;  1EH7 A;  3TQM A;  3BBG A;  4AQY E;  2WBT A;  4F9B B;  2I9I A;  1MU5 A;  2N3G A;  1EA6 A;  2GO3 A;  3H1C A;  2M9A A;  1ELO A;  1OYP A;  1XXE A;  1Z0T A;  4U3D A;  5DNY A;  4DPU A;  5DRP A;  2EMF A;  2EN6 A;  4LPF A;  2EPR A;  1WXR A;  2EOJ A;  4DR7 I;  3QT6 A;  2YPN A;  1NHJ A;  2V85 A;  2LT7 A;  2C38 B;  4F9A B;  4DV5 E;  1TN9 A;  5DRQ A;  4X66 I;  4DR4 I;  2YTF A;  5KL6 A;  1Z0V A;  2EMG A;  1PIE A;  2BA0 G;  3UHM A;  3ADG A;  1UN6 B;  4DV7 E;  4IZK A;  2PO1 B;  2EN4 A;  1HK7 A;  2DMI A;  4HY1 A;  2D9H A;  4BA1 A;  5C0X C;  1ZBQ A;  4LF4 I;  2UUB I;  2JOB A;  2EMW A;  1VI7 A;  4JI0 E;  3EPJ A;  3PRY A;  3B82 A;  4FW4 A;  2YTO A;  4DR1 I;  2EPO A;  3M7N G;  1Z0W A;  3V5R A;  1S4E A;  4BC9 A;  3M85 G;  1DQ3 A;  2YSO A;  2YRH A;  2EOS A;  4GZN C;  4O24 A;  1H7S A;  1ZU1 A;  1FJG E;  4BBY A;  4LFC I;  3IWD A;  5IXM B;  2NN6 C;  2DMY A;  2EN1 A;  1A1L A;  3K1J A;  4B3S I;  2YTP A;  5IT9 C;  3NZK A;  2L8T A;  2F4V E;  4BS9 A;  5A69 A;  5IWA I;  4GKJ I;  3ADL A;  2PNM A;  2Z5C B;  4X65 I;  4XTJ A;  2Z5B A;  2IHR 1;  2KHX A;  3LNU A;  2MC5 A;  4JI1 I;  3ZM7 A;  3F6G A;  3IWC A;  2VQE I;  4MQY A;  1RRE A;  3L7Z B;  2M7Q A;  4B3T I;  2EZ6 A;  5K36 D;  1BKN A;  4O43 A;  2VQF E;  1NHH A;  2BBG A;  4FN5 A;  3GON A;  3RMP A;  2PNL A;  2R3V A;  2O1T A;  3THO B;  2EM6 A;  1T39 A;  4IFD E;  1TF6 A;  4I8O A;  1Y4U A;  2V89 A;  2J7J A;  4WXD A;  1X6E A;  3J7A M;  2ZM6 E;  1SR9 A;  4WSP A;  1T4O A;  5C0X D;  1LLM C;  1NCS A;  2VRD A;  2PO0 A;  2ENA A;  5BR8 I;  2JEB A;  2V8Q B;  2EPC A;  1A1H A;  2EL4 A;  4ZYH A;  5EKW A;  4TUG A;  4LF6 I;  1YPN A;  1YFH A;  2CT1 A;  3C4B A;  2ENC A;  4IS9 A;  3ZOQ B;  3HUL A;  3BF2 A;  2BR2 B;  4J8Z A;  3EPL A;  2LUP B;  4EMD A;  2NUG A;  4AQY I;  1YH8 A;  4QNK A;  1MX0 A;  3V2U C;  2EPU A;  4OO1 A;  4LF7 I;  1UDO A;  3H09 A;  2EMX A;  2HJJ A;  4LU9 A;  3JU0 A;  5LLQ A;  2EM5 A;  4YY3 E;  1HNW E;  2A2C A;  3ZKB A;  2MC6 A;  4DV5 I;  2O1U A;  1VIS A;  1X6F A;  2WP8 B;  1ZM9 A;  1YUJ A;  2EJ4 A;  1R6L A;  4N4R B;  4DV7 I;  4GKK I;  5JEA E;  2BM1 A;  4KWY A;  2H36 X;  1PJT A;  2YU8 A;  2R1F A;  2ADR A;  3JAM Q;  4IFD B;  2EM2 A;  2L2M A;  4JI0 I;  3P06 A;  1JK1 A;  3PYG A;  3EPK A;  4L8N A;  1Y6Z A;  4DUZ E;  1G2D C;  1YHC A;  4LCH A;  1N32 E;  1SFE A;  1J26 A;  4JI5 I;  4WFT A;  1Z0E A;  4LFA E;  2GO4 A;  4FWH A;  2KOU A;  3GLL A;  4ED4 A;  1FJG I;  1ZM2 A;  3KWR A;  4AM3 A;  2F4V I;  4JI7 E;  1YSA C;  1HNX E;  2DRP A;  2HFS A;  2CTD A;  1A1G A;  3DD6 A;  4JI6 I;  2XEX A;  1MGT A;  1EH6 A;  4DR2 E;  4F6M A;  2IOP A;  4F9C B;  5DRO A;  4DR3 I;  5KL7 A;  5K36 F;  2EM3 A;  1X47 A;  2VF1 A;  5EL9 A;  4WXC A;  4R8O A;  1OYR A;  3H4L A;  2VQF I;  1P47 A;  2LO3 A;  2WNR A;  2EMY A;  3K17 A;  4JG4 A;  2PRT A;  1Z0G A;  2YTN A;  3PYD A;  4IFD F;  3OTO E;  2LJP A;  3J81 C;  3PS1 A;  1EH8 A;  3F6H A;  1KJK A;  4M30 A;  1PVG A;  5JEA B;  3L00 A;  4HEI A;  4F54 A;  3F0N A;  2ZM6 I;  2JXP A;  4DV2 E;  2E1M A;  1Y60 A;  4IZJ B;  4DPT A;  4F6N A;  1GQE A;  5DNL A;  1WHN A;  4UT4 A;  1XHK A;  3J80 Q;  1TF3 A;  2EPA A;  1X6H A;  2LVH A;  4R2A A;  1RMD A;  2CSH A;  2ODR D;  2AJ4 A;  3VK6 A;  4X8W A;  1T38 A;  1N36 E;  4R1F A;  2LRS A;  2B9D A;  1K47 A;  2C38 A;  4L5N C;  4JV5 E;  4OO1 C;  1X5W A;  4BA2 B;  4AID A;  4WX9 A;  4OZE A;  1KYQ A;  4YY3 I;  3BID A;  1HNW I;  2EOR A;  4DV4 E;  2UXC E;  4USK A;  5A6K A;  4TUI A;  2YRK A;  3PS2 A;  1RQ0 A;  1IBM E;  2V2V A;  2EMC A;  4DPY A;  2LTS A;  2PO1 A;  4DV3 E;  4GEQ B;  4ZYD A;  5JEA F;  3P3C A;  5A2Q C;  1OJ4 A;  4Z7C A;  5IV8 B;  3GME A;  2L3C A;  4DR5 E;  4WUD A;  2WBS A;  4K0K E;  3LML A;  4ZYE A;  1E3P A;  2JR1 A;  1PDA A;  2VE7 C;  4OOG C;  1KVK A;  2EPZ A;  2L33 A;  1A1F A;  4DUY E;  2CZ9 A;  2WZO A;  5ELW A;  1Z0B A;  4NXN E;  4DUZ I;  4DV1 E;  1N33 I;  4B3M E;  2EOE A;  1OYS A;  2K4V A;  1WJP A;  5IT9 Q;  4IFD C;  2HHH E;  2L92 A;  4URL A;  4LFB I;  4ZYG A;  1NZ0 A;  2N3H A;  4LFA I;  1HNZ E;  2ENH A;  2E5L E;  2Z5C A;  3D4J A;  2EOI A;  1Y4S A;  2CGE A;  2JPA A;  5K36 E;  4LCF A;  2EL5 A;  2JE6 B;  5AC4 A;  3CDI A;  3QT7 A;  4MYT A;  4DU7 A;  4JI7 I;  2UUA E;  3P3E A;  2YU5 A;  2DIX A;  4O5G A;  4IS1 C;  1YYW A;  3L7Z A;  4DV0 I;  1MG7 A;  4DR2 I;  1F2I G;  1UHZ A;  2YRM A;  2DGC A;  4PRV A;  1AH5 A;  2LCE A;  1USV A;  4WUC A;  2V86 A;  3DJW A;  2EPK X;  2V83 A;  1B62 A;  2EM4 A;  4HAC B;  3T1H I;  1XNR E;  2A2D A;  4MDT A;  2PNZ B;  1J5E E;  3LTO A;  5LL6 R;  1MEY C;  3ZZT A;  4LF8 E;  3P76 A;  4HYM A;  1XMO I;  2PO2 B;  4M0V A;  3OTO I;  4MLQ A;  2A25 A;  4USM A;  1N34 I;  2CPN A;  2EPP A;  3B4T A;  4RHB B;  4M2Z A;  4OX9 I;  1Z1B A;  2YTD A;  3QG5 C;  4X62 I;  1RC7 A;  2EM7 A;  5DNX A;  2E72 A;  2DLK A;  2EQ3 A;  4R2C A;  3C4T A;  4LF5 I;  3HXL A;  3KRN A;  3OML A;  5JEA C;  2UUC I;  1STU A;  4DV2 I;  1O0W A;  4P7A A;  1UDS A;  4DV6 E;  2BB8 A;  2NN6 D;  3BGH A;  2EOZ A;  3HPZ A;  2BR2 A;  2EMA A;  1AAY A;  1NHI A;  2V34 A;  4GQU A;  2HKJ A;  1ZXN A;  4B3R E;  1X48 A;  4FWG A;  1N36 I;  5K36 B;  5AC5 A;  5A6A A;  2EOQ A;  3DF6 A;  4MLV A;  4JI4 E;  1ZR9 A;  2J7K A;  3HKM A;  3U1Y A;  4JV5 I;  2WP8 A;  1Z0C A;  4IJD A;  2HK2 A;  1A1I A;  2MDG A;  1I94 E;  3B78 A;  1Z5A A;  4DXL A;  4DV4 I;  2UXC I;  1N0V C;  1ZBT A;  4DR7 E;  2NUE A;  2UXB E;  1IBM I;  4U3B A;  3WU6 A;  1YYK A;  4WPY A;  3P3G A;  3Q6N A;  4QNJ A;  4DV3 I;  4UTG A;  3C6K A;  5A6B A;  4RH8 A;  4DKK A;  2C37 B;  4IFD A;  5C0X B;  1GTK A;  2EMK A;  1JK2 A;  5A6J A;  2NPF A;  1XMQ E;  3CDJ A;  4DR5 I;  2LTR A;  3EQ1 A;  2EPX A;  4K0K I;  3LLH A;  2UUB E;  2JVA A;  2J65 A;  4DMI A;  4I3H A;  4NXN I;  5F3W A;  2HKE A;  1WHQ A;  1YZ9 A;  4FW9 A;  1L4S A;  4DV1 I;  2RQL A;  3B8H A;  4B3M I;  4DR1 E;  4JI3 E;  1FWL A;  4DR6 E;  2B7T A;  4LTY A;  2NN6 B;  2JEA B;  2E5L I;  4Q35 B;  3M6A A;  5DRR A;  4LFC E;  2EOX A;  2JT2 A;  2EOH A;  3Q1Q A;  4BHC A;  4R2D A;  2G7H A;  3ADJ A;  2UUA I;  2EOF A;  5FLX C;  5IWA E;  1ZM3 A;  4KQV A;  2V88 A;  3HQ1 A;  5ADZ A;  2Z5E A;  2HC5 A;  1B63 A;  3U1K A;  4WSG A;  4X65 E;  3K85 A;  2RS6 A;  2Q2E B;  4MU3 A;  2RS7 A;  4R2S A;  3JTZ A;  3MHH C;  2NA2 A;  2YSP A;  3VYY A;  1H72 C;  1UIL A;  2EN7 A;  4LCG A;  1BB8 A;  3J81 Q;  1N3G A;  2YTQ A;  1Z5C A;  2C39 B;  5C0X F;  1XNR I;  3VYX A;  3FIG A;  1P42 A;  2EE8 A;  3ZKD A;  5JEA A;  1IQS A;  4DPW A;  4MU1 A;  4NXM E;  2M4I A;  1IBK I;  1R6M A;  3CWV A;  4FWD A;  4FW3 A;  4MU4 A;  4IZJ A;  1KTV A;  1Z5B A; 
#chains in the Genus database with same CATH homology
 1S16 A;  5AAS A;  2L3J A;  4MYU A;  3ZZ0 A;  4DV6 I;  2LBS B;  2V87 A;  2DSY A;  5T6J A;  2CG9 A;  4B3R I;  3LPS A;  5AE2 A;  3K6Q A;  3HPS A;  2FV4 B;  2DB2 A;  4X64 E;  2LE2 A;  1GZ6 A;  3T1Y E;  2MDR A;  3J80 C;  2L2N A;  1I94 I;  4LF7 E;  2R42 A;  3Q6M A;  5A2Q Q;  1FWK A;  4YHH E;  2GQ0 A;  3MSW A;  4P78 A;  2UXB I;  4P7D A;  3QT8 A;  4IZK B;  2GS8 A;  1N32 I;  2V2Q A;  5CFF E;  4GKK E;  1Z59 A;  1XMQ I;  4JYA E;  1IBL E;  4JI8 E;  2VF3 A;  5GMD A;  4JI2 E;  1USU A;  1HNX I;  1PKP A;  2UU9 E;  4JI3 I;  3ZZU A;  4DR6 I;  5LMU E;  2NUF A;  4JI5 E;  3HJC A;  5AE3 A;  2JOX A;  2IOQ A;  2UXD E;  1XNQ E;  4RPF A;  2Z5B B;  2YZT A;  3HTX A;  1DAR A;  5LMN E;  1KKH A;  4PRX A;  4ZVI A;  3AUZ A;  2L2K B;  1T4L B;  4JI6 E;  3AV0 A;  2EWL A;  1ZM4 A;  4HAC A;  2BV3 A;  4DR3 E;  1HR0 E;  1KIJ A;  1A6F A;  3P1X A;  1YYO A;  1EKZ A;  4NXM I;  1EI1 A;  2BM0 A;  5L3J A;  4DU8 A;  2WW4 A;  4KHP E;  2O1V A;  4PU9 A;  4LF9 E;  2ZIT A;  3WU3 A;  2X7I A;  1QU6 A;  2O1W A;  1H7U A;  3WU5 A;  2F8B A;  2JY9 A;  4X66 E;  1RR9 A;  4WUB A;  4DR4 E;  3WU4 A;  2YT4 A;  1DI2 A;  5FWK A;  4X64 I;  2V2Z A;  3T1Y I;  1N0U A;  2L6M A;  1H73 A;  4BMJ A;  1FNM A;  2E1R A;  1UEK A;  4Q28 A;  1WUU A;  4N3O A;  4YHH I;  3ADI A;  2RTX A;  4LF4 E;  4DUY I;  4R03 A;  4DPX A;  3QT5 A;  2HHH I;  1QZR A;  4JYA I;  1HNZ I;  1IBL I;  4JI8 I;  1D6T A;  3JAM C;  4JI2 I;  1X49 A;  3J7A G;  2FTX B;  2LJH A;  2V8P A;  4M1K A;  1IBK E;  3T1H E;  1U2R A;  2B3T B;  3J7Y p;  4B3S E;  4GKJ E;  1FI4 A;  2UU9 I;  1N33 E;  2LMZ A;  2HK3 A;  5FLX Q;  5LMU I;  2ODR C;  4LFB E;  4IZJ D;  2DEI A;  4BCA A;  2UXD I;  4JI1 E;  2EFG A;  1XNQ I;  2VQE E;  2M1S A;  1ZXM A;  4B3T E;  3IWB A;  5LMN I;  4BC7 A;  1J5E I;  4DV0 E;  4LF8 I;  3PYF A;  1T4N A;  5GME A;  4KZS A;  2FGG A;  2B7V A;  2JWO A;  1HR0 I;  2ZBK B;  2HFU A;  4P52 A;  2KON A;  1H74 A;  2DEJ A;  1XMO E;  2RSM A;  4Z7Y A;  1N34 E;  2X36 A;  5BR8 E;  3PYE A;  4HXZ A;  4OX9 E;  4KHP I;  2OI2 A;  4X62 E;  4LF9 I;  4WYQ B;  4LF6 E;  2LUQ A;  4LF5 E;  4JI4 I;  5AE1 A;  1FKA E;  2UUC E;  4AQY E;  4DXL A;  4F9B B;  1MU5 A;  2N3G A;  1EA6 A;  1ELO A;  1Z0T A;  5DNY A;  4DPU A;  1WXR A;  4DR7 I;  3QT6 A;  1NHJ A;  2V85 A;  4X66 I;  4F9A B;  4DV5 E;  4DR4 I;  1Z0V A;  1PIE A;  3ADG A;  4DV7 E;  4IZK A;  1HK7 A;  4HY1 A;  4LF4 I;  1ZBQ A;  2UUB I;  2JOB A;  4JI0 E;  3PRY A;  3B82 A;  4DR1 I;  1Z0W A;  3V5R A;  1S4E A;  4BC9 A;  1DQ3 A;  4LFC I;  1H7S A;  1IBK I;  1FJG E;  4BBY A;  3T1H I;  3IWD A;  4B3S I;  2DMY A;  3K1J A;  5IT9 C;  5IWA I;  4GKJ I;  2L8T A;  2F4V E;  4BS9 A;  3ADL A;  2PNM A;  2Z5C B;  4X65 I;  4XTJ A;  2Z5B A;  2IHR 1;  2KHX A;  3LNU A;  2MC5 A;  4JI1 I;  3ZM7 A;  3F6G A;  3IWC A;  2VQE I;  1RRE A;  2M7Q A;  4B3T I;  2EZ6 A;  1BKN A;  2VQF E;  1NHH A;  4FN5 A;  3GON A;  3RMP A;  2PNL A;  2R3V A;  2O1T A;  4I8O A;  1Y4U A;  2V89 A;  3J7A M;  2ZM6 E;  4WSP A;  1SR9 A;  1T4O A;  5BR8 I;  2V8Q B;  4TUG A;  4LF6 I;  3C4B A;  3ZOQ B;  3HUL A;  4J8Z A;  2LUP B;  4AQY I;  4EMD A;  2NUG A;  3V2U C;  1MX0 A;  4LF7 I;  3H09 A;  3ZKB A;  3JU0 A;  4LU9 A;  4YY3 E;  1HNW E;  2A2C A;  2MC6 A;  4DV5 I;  2O1U A;  1VIS A;  1ZM9 A;  4DV7 I;  4GKK I;  2BM1 A;  2H36 X;  3JAM Q;  2L2M A;  4JI0 I;  3P06 A;  3PYG A;  4L8N A;  1Y6Z A;  4DUZ E;  1N32 E;  1J26 A;  4JI5 I;  4WFT A;  1Z0E A;  4LFA E;  4FWH A;  2KOU A;  4ED4 A;  1FJG I;  1ZM2 A;  3KWR A;  2F4V I;  4JI7 E;  1HNX E;  2HFS A;  4JI6 I;  2XEX A;  4DR2 E;  2IOP A;  4F9C B;  4DR3 I;  1X47 A;  2VF1 A;  4R8O A;  3H4L A;  2VQF I;  3K17 A;  4JG4 A;  1Z0G A;  3PYD A;  3OTO E;  2LJP A;  3J81 C;  3F6H A;  4M30 A;  1PVG A;  4F54 A;  3F0N A;  2ZM6 I;  4DV2 E;  2E1M A;  4IZJ B;  4DPT A;  1GQE A;  1WHN A;  4UT4 A;  1XHK A;  3J80 Q;  2ODR D;  2AJ4 A;  3VK6 A;  4X8W A;  1N36 E;  4R1F A;  2LRS A;  2B9D A;  1K47 A;  4L5N C;  4JV5 E;  4YY3 I;  1HNW I;  4DV4 E;  2UXC E;  4USK A;  4TUI A;  1RQ0 A;  1IBM E;  2V2V A;  4DPY A;  2LTS A;  4DV3 E;  4GEQ B;  5A2Q C;  1OJ4 A;  4Z7C A;  2L3C A;  4DR5 E;  4WUD A;  4K0K E;  3LML A;  1KVK A;  2JR1 A;  2VE7 C;  4OOG C;  2L33 A;  4DUY E;  2CZ9 A;  2WZO A;  1Z0B A;  4NXN E;  4DUZ I;  4DV1 E;  1N33 I;  4B3M E;  2K4V A;  5IT9 Q;  2HHH E;  2L92 A;  4URL A;  4LFB I;  1NZ0 A;  2N3H A;  4LFA I;  1HNZ E;  2E5L E;  2Z5C A;  3D4J A;  1Y4S A;  2CGE A;  3QT7 A;  4DU7 A;  4MYT A;  4JI7 I;  2UUA E;  2DIX A;  1YYW A;  4DV0 I;  1MG7 A;  4DR2 I;  1UHZ A;  4PRV A;  1USV A;  4WUC A;  2V86 A;  3DJW A;  2V83 A;  1B62 A;  4HAC B;  1XNR E;  2A2D A;  1J5E E;  3LTO A;  5LL6 R;  3ZZT A;  4LF8 E;  4HYM A;  1XMO I;  4M0V A;  3OTO I;  1N34 I;  4USM A;  2CPN A;  4M2Z A;  4OX9 I;  4X62 I;  1RC7 A;  3C4T A;  4LF5 I;  3HXL A;  3OML A;  2UUC I;  1STU A;  4DV2 I;  1O0W A;  4P7A A;  4DV6 E;  3HPZ A;  1NHI A;  2V34 A;  2HKJ A;  1ZXN A;  4B3R E;  1X48 A;  4FWG A;  1N36 I;  3DF6 A;  4JI4 E;  2J7K A;  4JV5 I;  1Z0C A;  2HK2 A;  1I94 E;  3B78 A;  1Z5A A;  4DV4 I;  2UXC I;  1N0V C;  1ZBT A;  4DR7 E;  2NUE A;  2UXB E;  1IBM I;  3WU6 A;  1YYK A;  4WPY A;  3Q6N A;  4DV3 I;  4UTG A;  4DKK A;  2NPF A;  1XMQ E;  4DR5 I;  2LTR A;  4K0K I;  3LLH A;  2UUB E;  2JVA A;  4DMI A;  4I3H A;  4NXN I;  5F3W A;  2HKE A;  1WHQ A;  1YZ9 A;  4FW9 A;  4DV1 I;  4B3M I;  3B8H A;  4DR1 E;  4JI3 E;  1FWL A;  4DR6 E;  2B7T A;  4LTY A;  2E5L I;  3M6A A;  4LFC E;  3Q1Q A;  2G7H A;  3ADJ A;  2UUA I;  5FLX C;  5IWA E;  1ZM3 A;  4KQV A;  2V88 A;  3HQ1 A;  5ADZ A;  2Z5E A;  1B63 A;  4X65 E;  3K85 A;  2RS6 A;  2Q2E B;  2RS7 A;  3JTZ A;  1H72 C;  2NA2 A;  3VYY A;  1UIL A;  3J81 Q;  1Z5C A;  1XNR I;  3VYX A;  3FIG A;  3ZKD A;  4DPW A;  4NXM E;  2M4I A;  3CWV A;  4FWD A;  4IZJ A;  1KTV A;  1Z5B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...