4DV7E

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a915g, bound with streptomycin
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
b'DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome/antibiotic
publication title A structural basis for streptomycin resistance
rcsb
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4dv7E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dv7E02
1MX0A 2HK3A 4LF7E 1YYWA 3B78A 1YYKA 1OJ4A 2ZM6E 1N32I 4WUDA 4LFCE 4B3SI 5L3JA 3PYEA 2HFSA 1Z0WA 2UXDE 1XNQI 4DR1E 1NHIA 3PYDA 1FJGI 2B7VA 4YY3E 2E1RA 4DPWA 1IBLE 1KKHA 1MG7A 3B8HA 3P1XA 4HY1A 1ZM2A 3D4JA 3T1YI 1HNZI 3WU4A 1HR0I 1Z59A 2J7KA 1Z0EA 1PIEA 4FWDA 2BM0A 4HXZA 2V34A 4LF6I 2UU9I 2UU9E 1UHZA 1XNRI 1X47A 1IBME 2A2CA 2ZITA 4B3TI 4JI6I 4B3SE 2R42A 2LTSA 3ZM7A 3OTOE 4YY3I 4KHPI 4AQYE 1H74A 2L33A 1FNMA 1Z5BA 1YYOA 2VQEI 2Q2EB 2DB2A 4X8WA 4JI3E 3J7AG 1J5EE 4FWGA 4DV5E 1T4OA 4USMA 1FI4A 1HNXI 1IBKE 4DR7E 1HR0E 4M30A 5GMDA 4ZVIA 5A2QC 1S16A 5A2QQ 1WHNA 2DEIA 3PYGA 4KQVA 4PRVA 1WUUA 2L2MA 3LTOA 4DR1I 2RTXA 1EA6A 4WFTA 4B3TE 4JI6E 4JI5I 4X66I 4JI7E 4JI8E 2KHXA 1K47A 1T4NA 4DPXA 4X62E 5IWAE 4DV2I 2L2NA 3ZKDA 4DV2E 1MU5A 3HULA 1N34I 2DMYA 1IBMI 3ZKBA 1N34E 2ZM6I 1Z0VA 4LF5E 3JAMC 4LF5I 3B82A 3JAMQ 4B3RE 4PRXA 2V2QA 4DV6I 4LF4I 2HK2A 2ZBKB 5CFFE 4DR6E 1ZBTA 1H72C 2V8PA 1FJGE 1HNWI 2VQEE 4Z7YA 4MYTA 3ADGA 4JI0I 3VYYA 4DPYA 1X48A 2L2KB 2F4VE 2LRSA 1KVKA 3J7Yp 5FLXC 2V2ZA 5FLXQ 1N36I 5IWAI 1Z0GA 1RC7A 4X64E 4YHHE 3Q1QA 4X64I 4YHHI 4LF6E 4XTJA 4P52A 2LJHA 4DV1I 1Z0BA 1ZXMA 5BR8E 3QT7A 2B7TA 2X36A 3ZZTA 2LUQA 1PKPA 3OTOI 2B3TB 2UUAE 1HNWE 4DV5I 2UUBI 1XNRE 2OI2A 3ADJA 3C4BA 4NXNI 4B3RI 4GKKE 1B63A 1QZRA 1X49A 4FWHA 4JI1E 4R1FA 4JI1I 4DU7A 3ZZ0A 2LBSB 4DV7I 4FN5A 4OOGC 2AJ4A 4LFBI 4JI3I 1J26A 1STUA 1H7SA 1UEKA 1WHQA 5LMNI 1IBKI 1Z0TA 2UUAI 2E5LI 1N36E 2E5LE 4DUYE 4OX9I 2X7IA 4USKA 4NXME 2LUPB 4Z7CA 4NXMI 4JI2E 3LPSA 1XMQI 4JI2I 2UXCI 4DPTA 2CPNA 2UXCE 1N33E 2UXBE 1N33I 1RR9A 2HKEA 1IBLI 4WUBA 1UILA 4MYUA 4JI7I 1GQEA 5LMUI 3ADLA 4JI4I 3J7AM 4JG4A 4DR5E 1HNZE 1Z0CA 2N3GA 1PVGA 3J80C 2VQFE 2UUBE 3CWVA 2VQFI 4DU8A 2F4VI 4DUZE 4DV0E 4DXLA 3QT8A 4WUCA 4B3ME 1ZXNA 4DUYI 4LF8E 3QT5A 4DV3E 1N0VC 2A2DA 2WW4A 3F0NA 3V2UC 1XMOE 4DR3E 2UXDI 1QU6A 1YZ9A 1J5EI 4LFAI 2RS7A 4LF7I 3WU6A 1RQ0A 3PYFA 4M1KA 4UT4A 2MDRA 1Z5AA 2L3JA 5LL6R 1BKNA 2DEJA 4DKKA 3LNUA 4X62I 1RREA 3H4LA 1NZ0A 2RS6A 1I94I 4WYQB 4I3HA 4X65I 2NUFA 4JV5E 4DV4E 4DPUA 4DV4I 2XEXA 4JI4E 2BV3A 5IT9Q 2RSMA 1KTVA 3J81C 3HTXA 5IT9C 2LTRA 3J81Q 3V5RA 1FKAE 4AQYI 2R3VA 2UUCE 4UTGA 4DR2E 2NUEA 4EMDA 1ZM9A 5GMEA 1N32E 4NXNE 4FW9A 4GKKI 2BM1A 1H7UA 2N3HA 3M6AA 2DIXA 4DR6I 4DR3I 4KHPE 4JYAI 4GKJE 3GONA 4GKJI 4URLA 4LFAE 1NHJA 1NHHA 2HHHI 4DR7I 2NPFA 3LLHA 1Z5CA 1ELOA 1N0UA 2UUCI 1VISA 1I94E 1EKZA 4DV1E 3C4TA 4PU9A 4HYMA 4JI5E 2UXBI 1U2RA 1A6FA 2HKJA 4LF8I 4DR4I 1B62A 4DR4E 2EFGA 1ZM3A 1EI1A 4JI0E 1KIJA 3J80Q 1D6TA 2HHHE 1H73A 2GS8A 4ED4A 2IHR1 4DR2I 4DUZI 1DI2A 2VF3A 3K17A 4B3MI 3WU3A 4DV3I 3K1JA 4OX9E 4K0KI 1XNQE 3T1HI 5BR8I 3ADIA 4P7AA 3VYXA 4JV5I 4LFBE 4X66E 1FWKA 2HFUA 3QT6A 2YT4A 4LF9E 4JI8I 3ZZUA 5LMNE 4LF9I 1HNXE 1XHKA 1FWLA 1S4EA 1ZM4A 2NUGA 2LJPA 4LFCI 1T4LB 4M2ZA 2L3CA 1XMQE 2JVAA 1O0WA 4DV0I 4RPFA 4X65E 2JY9A 4DV6E 4LF4E 2EZ6A 4HACA 5LMUE 4K0KE 4HACB 1XMOI 3T1YE 2CZ9A 3WU5A 2NA2A 3T1HE 2V2VA 4DR5I 4JYAE 1DARA 4DV7E
chains in the Genus database with same CATH superfamily
2EORA 1MX0A 2YTJA 3LMLA 2HK3A 4LF7E 1YYWA 3EPKA 3B78A 2EN7A 5JEAC 1YYKA 1OJ4A 2ZM6E 2YSPA 2K4VA 2YU8A 2O1WA 2VRDA 4OO1D 1RMDA 1N32I 4WUDA 2PO1B 2JE6B 1P42A 4LFCE 4B3SI 2O1TA 4IZJA 2DGCA 5L3JA 5DNYA 4AIDA 1AAYA 2EN1A 4ZYEA 3PYEA 3AUZA 2HFSA 1Z0WA 2UXDE 1XNQI 4DR1E 1NHIA 3PYDA 1FJGI 2YSOA 2B7VA 2YTGA 4YY3E 4ISAA 1EH6A 2EMZA 1L4SA 2E1RA 1QNTA 2EPZA 4DPWA 1IBLE 2LVHA 3MHHC 4N4RB 5A6JA 1KKHA 1BBOA 1HK7A 2H36X 4GZNC 1MG7A 3B8HA 3P1XA 4HY1A 2HGHA 1ZM2A 1JK2A 3D4JA 3T1YI 1YPNA 4MU0A 1HNZI 2LT7A 3UHMA 3WU4A 1HR0I 2EMLA 4O4KA 5JEAF 2RPCA 1Z59A 2J7KA 1Z0EA 1PIEA 3GLLA 4FWDA 2WZOA 2BM0A 4HXZA 2V34A 4LF6I 2UU9I 4OO1C 5ELWA 2UU9E 2EM9A 1UHZA 1GZ6A 1E3HA 1ZR9A 4O5GA 1WXRA 1X47A 1IBME 2A2CA 2EMBA 3M85D 1XNRI 2EMAA 4WSGA 1R6LA 5DNXA 2ZITA 4B3TI 4JI6I 4R2AA 4B3SE 2R42A 2LTSA 4F6NA 3ZM7A 3OTOE 2EOIA 1BB8A 4YY3I 4IZKB 2YTOA 4KHPI 4AQYE 5F3WA 1H74A 3GCMA 1PJTA 2L33A 1FNMA 1Z5BA 1YYOA 2VQEI 2Q2EB 1N3GA 1UDSA 2DB2A 4X8WA 1YFHA 4JI3E 1J5EE 3J7AG 3CDJA 3PS2A 5KL5A 4R2EA 1DQ3A 2EPOA 1T4OA 3HQ1A 4DV5E 4FWGA 4USMA 1FI4A 2EPXA 1HNXI 2PRTA 1IBKE 4DR7E 5IV8B 1HR0E 4M30A 2BA0G 5GMDA 4ZVIA 4BMJA 2EPMX 3M85G 5A2QC 2JOXA 1S16A 4P7DA 2FTXB 5A2QQ 1WHNA 2DEIA 3PYGA 4KQVA 4PRVA 2YTDA 1YSAC 4NHRA 1WUUA 2L2MA 3LTOA 4DR1I 2EMWA 2N8XA 2C37A 1USVA 2RTXA 2YRMA 2Z5EA 1EA6A 4WFTA 1A1LA 1R6MA 3L00A 4B3TE 4JI6E 2PNZB 4JI5I 2C37B 3IWBA 4OZEA 4X66I 3EPLA 4R8OA 2EOFA 4JI7E 4L8NA 2MDGA 4JI8E 2KHXA 1K47A 2I13A 2EMXA 5EKWA 5K36B 1T4NA 5C0XD 1Y60A 2EMKA 2R1FA 2EOQA 2KONA 2NABA 5AASA 2BR2A 2YRKA 4DPXA 4X62E 5IWAE 4DV2I 2M9AA 2L2NA 2NN6D 2BA0D 3ZKDA 2EMGA 4DV2E 2PNLA 4R2QA 5A6BA 3MHSC 4ZYDA 1MU5A 1OYPA 3HULA 1N34I 2EE8A 2DMYA 2PO0B 2EMYA 2RSIA 4DMIA 1N34E 2E72A 3ZKBA 1Z0VA 4LF5E 2ZM6I 1IBMI 3RMPA 3JAMC 4LF5I 1XXEA 3B82A 4MLQA 3JAMQ 5TSEA 4B3RE 4PRXA 2EOOA 2V2QA 2EN2A 4DV6I 4LF4I 4MU1A 1T39A 1B69A 2NN6E 2G7HA 2YTEA 3F6HA 4BBYA 2HK2A 2ZBKB 2ENHA 5CFFE 4DR6E 2E1MA 1ZBTA 5DNLA 1H72C 2DLQA 2V8PA 1FJGE 2ODRD 2CTDA 2O1VA 1LLMC 1HNWI 2VQEE 4Z7YA 2EM2A 4MYTA 3ADGA 2Z5CB 4QNKA 3B4TA 4JI0I 1X3CA 4O43A 3VYYA 3KZYA 5JEAE 4DPYA 2EMCA 2EOXA 5T6JA 1X48A 2MC6A 2L2KB 2F4VE 2LRSA 5KL6A 2JXPA 2M1SA 1KVKA 3J7Yp 4HEIA 5FLXC 2V2ZA 5FLXQ 1N36I 5IWAI 1Z0GA 1YHCA 1RC7A 4X64E 4YHHE 2MKNA 3Q1QA 2WBUA 4X64I 4LF6E 4FW3A 4FW4A 2J7JA 1PJQA 4N3OA 2LJHA 5KL4A 4P52A 4XTJA 2PNMA 4DV1I 1Z0BA 4O24A 4NBQA 1ZXMA 5BR8E 3QT7A 2EQ0A 1UN6B 2JR1A 2YTFA 3EPHA 2V86A 2IOQA 2B7TA 3JTZA 2X36A 2NN6A 2V85A 2K7IA 2PO2B 3IWCA 3F6GA 2V8QB 3ZZTA 2LUQA 2ADRA 1ZAAC 1E3PA 3H1CA 1PKPA 2LMZA 4U3DA 2JOBA 3L7ZB 3OTOI 2RQLA 2BB8A 2B3TB 2UUAE 2YPNA 4BA2A 3KZZA 1HNWE 5JEAA 2AE8A 2YTIA 3EPJA 4P78A 4DV5I 2IERA 2UUBI 1A1KA 1XNRE 2OI2A 3ADJA 2R76A 5AC5A 2EN8A 3C4BA 4IFDA 2V87A 5KL3A 4NXNI 1USUA 4B3RI 4FW5A 5DROA 2YRHA 4BC7A 4GKKE 4M9VC 1B63A 2EM5A 5A69A 1NCSA 3NZKA 5KL2A 1QZRA 1X49A 4FWHA 4JI1E 4R1FA 1P47A 1IMUA 4OO1E 4FW7A 4JI1I 4BHBA 2LBSB 1JK1A 3ZZ0A 4DU7A 4BS9A 4AM3A 4TUGA 4DV7I 4FN5A 4OO1B 2CGEA 2MC5A 4OOGC 2AJ4A 2VF1A 4LFBI 4IJDA 3CDIA 4JI3I 2EN4A 1J26A 1STUA 1H7SA 2ODRC 1UEKA 4RH8A 4QNJA 1WHQA 4IS1C 1Y6ZA 5LMNI 1IBKI 4WXCA 1Z0TA 2EMIA 1Y5YA 2IOPA 2UUAI 2E5LI 2EOJA 1N36E 4IFDC 2E5LE 3QG5C 2YZTA 4X9JA 4F54A 4DUYE 2F8BA 2GQ0A 4OX9I 2X7IA 4LPFA 4USKA 4NXME 1X6EA 4GQUA 2LUPB 5AE1A 2NN6F 2HJJA 2EQ1A 4Z7CA 4NXMI 4JI2E 3LPSA 5JEAD 1XMQI 2EPNA 4JI2I 4IZKA 2BA1G 4IFDE 1MGTA 2WNRA 3PS3A 2CPNA 4DPTA 5C0XF 2PO1A 2UXCE 2UXCI 2EN3A 1N33E 2UXBE 2NN6C 2EOYA 2O1UA 1UBDC 5C0XA 1RR9A 2JP9A 3EQ1A 2EP3A 2HKEA 4WUBA 1IBLI 1UILA 4IFDD 2EOHA 1A1HA 4MYUA 4JI7I 4LCGA 1GQEA 5LMUI 1F2IG 3ADLA 1BBGA 4JI4I 3J7AM 2B9DA 4JG4A 3P3EA 2LCEA 4DR5E 1A1GA 1HNZE 2F1DA 1Z0CA 3BBGA 1OYRA 2N3GA 2Z5CA 2ENCA 1PVGA 3J80C 5IXMB 4MDTA 4LCHA 2VQFE 4F9BB 2UUBE 3CWVA 2JEAB 2VQFI 1AH5A 2EM0A 2EN6A 4DU8A 2I9IA 4DUZE 2C38A 4BA1A 2F4VI 4DV0E 4GEQB 3IWDA 1TF3A 4DXLA 2EJ4A 5AE2A 3QT8A 2ENAA 4LCFA 3BIDA 4WUCA 4B3ME 4Q35B 1A1FA 1ZXNA 4DUYI 3K6QA 4LF8E 3L7ZA 4DV3E 3QT5A 1N0VC 4WX9A 2A2DA 2DMIA 2WW4A 3F0NA 1IQOA 1G2DC 2CG9A 5C0XC 4BCAA 1XMOE 3V2UC 4KWYA 1TN9A 4DR3E 2UXDI 1QU6A 3M99B 1KJKA 2JPAA 1YZ9A 2V89A 1J5EI 4LFAI 2RS7A 4LF7I 2VE7C 3WU6A 3ECRA 2CVEA 5ADZA 1MEYC 4FW6A 1RQ0A 2CT1A 4BC9A 5DRQA 3PYFA 1Y4SA 2EQ3A 2WCC3 2L8TA 2GLIA 3Q6NA 1G2FC 4M1KA 4UT4A 2DSYA 2MDRA 4MLVA 1Z5AA 5LL6R 2L3JA 3DD6A 1WJPA 2ELZA 2EOEA 1BKNA 2DEJA 3P06A 2PNZA 2M7QA 4DKKA 3LNUA 4X62I 3DF6A 1RREA 3H4LA 2ELYA 4F9AB 3PS1A 1NZ0A 2EOZA 4R2PA 4MU3A 2EOMA 2RS6A 2A25A 1I94I 4WYQB 4Q28A 4WPYA 2IESA 4ZYGA 2Z5BA 2JT2A 4R03A 1OYSA 4R2RA 4F9CB 4J3DA 1IQSA 4I3HA 3U1YA 4X65I 2NUFA 3MSWA 4DV4E 4JV5E 3P3CA 4DPUA 1GTKA 2LJUA 4F6MA 4DV4I 5KL7A 4F2JC 2YWQA 1Z1BA 2XEXA 4JI4E 2BV3A 3BF2A 2RSMA 1KTVA 5IT9Q 3J81C 2WBSA 3HTXA 5K36D 4L5NC 5IT9C 5A6KA 4BA2B 2LTRA 3J81Q 4R2SA 5K36C 3V5RA 1YH8A 2JYAA 1FKAE 4AQYI 2CSHA 2C39B 2R3VA 3KWRA 2WP8B 2UUCE 4UTGA 4BHCA 2DLKA 2V88A 4DR2E 3C6MA 2NUEA 4EMDA 2BBGA 1ZM9A 5GMEA 4NZVA 1N32E 4OO1F 4NXNE 4FW9A 3ZOQB 2MKDA 3OMLA 4GKKI 2BM1A 2JWOA 2JE6A 1H7UA 2YTNA 3Q6MA 4OKGA 2N3HA 2DIXA 3M6AA 4DR6I 4DR3I 5A6BD 1WRJA 4KHPE 1X5WA 4JYAI 4GKJE 1UDQA 1VI7A 3GONA 2DRPA 4GKJI 4URLA 1A1JA 4LFAE 1NHJA 2EPRA 4LTYA 5A6AA 2D9HA 2Z5BB 1KYQA 1NHHA 2FV4B 2HHHI 2GO4A 1ZU1A 4M0VA 1TF6A 4DR7I 2PO0A 4U3BA 5EL9A 3GMEA 3K85A 4AIMA 3AV0A 1UDOA 5C0XB 2BR2B 3M7NG 2NPFA 3LLHA 1Z5CA 1ELOA 1N0UA 2UUCI 1VISA 1UDNA 2WNRB 2FGGA 1I94E 1EKZA 1YUIA 2EL4A 4DV1E 3C4TA 4PU9A 1YUJA 1DGCA 4HYMA 4JI5E 2UXBI 1U2RA 2V83A 2EL6A 2M4IA 3C6KA 1A6FA 2HKJA 2NN6B 3U1KA 4FK5C 4IS9A 4LF8I 4DR4I 1B62A 4DR4E 2LO3A 2KOUA 2EPUA 3PRYA 2EFGA 4KZSA 3DJWA 2EPAA 4IFDB 1ZM3A 1T38A 1EI1A 2O3ZA 3THNA 1A1IA 4JI0E 1KIJA 2EOSA 2YTQA 4R2DA 2JEBA 2EPPA 3J80Q 4RHBB 2JEAA 2HHHE 1D6TA 2EMFA 5AE3A 1H73A 2C38B 2GS8A 3M7ND 4ED4A 2IHR1 3THOB 4DR2I 2YTPA 3BGHA 1RHYA 2EPLX 4DUZI 1DI2A 2YU5A 3VK6A 5LLQA 2VF3A 2WP8A 2LV2A 3K17A 2L6MA 1X6FA 3VHTB 5K36E 4B3MI 1EH7A 3WU3A 5AC4A 4YHHI 5DRRA 4DV3I 2BA1D 3K1JA 4WSPA 4OX9E 4IZJB 4K0KI 5FWKA 4LU9A 1SR9A 2WBTA 2J65A 1SFEA 1XNQE 3P3GA 4BA1B 3HPZA 4TUIA 3FIGA 3T1HI 4J8ZA 2EM4A 4OO1A 2Q8UA 5BR8I 2EM6A 3KRNA 3ADIA 3JU0A 4P7AA 5K36F 3UK3C 3VYXA 3TQMA 4JV5I 3HPSA 4LFBE 4X66E 1FWKA 1NEIA 4MQYA 2HFUA 5JEAB 3QT6A 2YT4A 4LF9E 4JI8I 3HKMA 1EH8A 2EWLA 5LMNE 3ZZUA 4LF9I 1HNXE 1XHKA 4IZJD 2GPIA 1FWLA 2HC5A 4WXDA 1S4EA 1ZM4A 2NUGA 2LE2A 2LJPA 4LFCI 3HJCA 1PJSA 1ZBQA 3HXLA 1PDAA 1T4LB 2GHFA 4LOMA 4M2ZA 2L3CA 1XMQE 1X6HA 2JVAA 4ZYHA 1O0WA 1Y4UA 2EM8A 4DV0I 5K36A 4RPFA 2L92A 4X65E 2JY9A 2EL5A 4DV6E 4LF4E 2EZ6A 4R2CA 2EPCA 3P76A 4IFDF 4HACA 1N33I 4I8OA 5C0XE 5LMUE 4K0KE 2PO2A 4HTGA 4MU4A 2EMHA 2EM3A 3H09A 5DRPA 2VESA 4HACB 1XMOI 3T1YE 2EPKX 2CZ9A 2NA2A 3T1HE 2C39A 2GO3A 2V2VA 3WU5A 4JYAE 4DR5I 2EM7A 2JEBB 1DARA 4DV7E
chains in the Genus database with same CATH topology
1MX0A 3LMLA 2HK3A 4LF7E 1YYWA 3B78A 1YYKA 1OJ4A 2ZM6E 2K4VA 2O1WA 1N32I 4WUDA 4LFCE 4B3SI 2O1TA 4IZJA 5L3JA 5DNYA 3PYEA 3AUZA 2HFSA 1Z0WA 2UXDE 1XNQI 4DR1E 1NHIA 3PYDA 1FJGI 2B7VA 4YY3E 2E1RA 4DPWA 1IBLE 1KKHA 1HK7A 2H36X 1MG7A 3B8HA 3P1XA 4HY1A 1ZM2A 3D4JA 3T1YI 1HNZI 3WU4A 1HR0I 1Z59A 2J7KA 1Z0EA 1PIEA 4FWDA 2WZOA 2BM0A 4HXZA 2V34A 4LF6I 2UU9I 2UU9E 1UHZA 1GZ6A 1XNRI 1WXRA 1X47A 1IBME 2A2CA 2ZITA 4B3TI 4JI6I 4B3SE 2R42A 2LTSA 3ZM7A 3OTOE 4YY3I 4IZKB 4KHPI 4AQYE 5F3WA 1H74A 2L33A 1FNMA 1Z5BA 1YYOA 2VQEI 2Q2EB 2DB2A 4X8WA 4JI3E 3J7AG 1J5EE 1DQ3A 4FWGA 3HQ1A 1T4OA 4DV5E 4USMA 1FI4A 1HNXI 1IBKE 4DR7E 1HR0E 4M30A 5GMDA 4ZVIA 4BMJA 5A2QC 1S16A 2JOXA 4P7DA 2FTXB 5A2QQ 1WHNA 2DEIA 3PYGA 4KQVA 4PRVA 1WUUA 2L2MA 3LTOA 4DR1I 1USVA 2RTXA 2Z5EA 1EA6A 4WFTA 4B3TE 4JI6E 4JI5I 3IWBA 4X66I 4R8OA 4JI7E 4L8NA 4JI8E 2KHXA 1K47A 1T4NA 5AASA 2KONA 4DPXA 4X62E 5IWAE 4DV2I 2L2NA 3ZKDA 4DV2E 2PNLA 1MU5A 3HULA 1N34I 2DMYA 4DMIA 3ZKBA 1N34E 1IBMI 2ZM6I 1Z0VA 4LF5E 3RMPA 3JAMC 4LF5I 3B82A 3JAMQ 4B3RE 4PRXA 2V2QA 4DV6I 4LF4I 2G7HA 3F6HA 4BBYA 2HK2A 2ZBKB 5CFFE 4DR6E 2E1MA 1ZBTA 1H72C 2V8PA 1FJGE 2ODRD 2O1VA 1HNWI 2VQEE 4Z7YA 4MYTA 3ADGA 2Z5CB 4JI0I 3VYYA 4DPYA 5T6JA 1X48A 2MC6A 2L2KB 2F4VE 2LRSA 2M1SA 1KVKA 3J7Yp 5FLXC 2V2ZA 5FLXQ 1N36I 5IWAI 1Z0GA 1RC7A 4X64E 4YHHE 3Q1QA 4X64I 4YHHI 4LF6E 4N3OA 4XTJA 4P52A 2LJHA 2PNMA 4DV1I 1Z0BA 1ZXMA 5BR8E 3QT7A 2JR1A 2V86A 2IOQA 2B7TA 3JTZA 2X36A 2V85A 3IWCA 3F6GA 2V8QB 3ZZTA 2LUQA 1PKPA 2LMZA 2JOBA 3OTOI 2B3TB 2UUAE 1HNWE 4P78A 4DV5I 2UUBI 1XNRE 2OI2A 3ADJA 3C4BA 2V87A 4NXNI 1USUA 4B3RI 4BC7A 4GKKE 1B63A 1QZRA 1X49A 4FWHA 4JI1E 4R1FA 4JI1I 4DU7A 3ZZ0A 2LBSB 4BS9A 4TUGA 4DV7I 4FN5A 2CGEA 2MC5A 4OOGC 2AJ4A 2VF1A 4LFBI 4JI3I 1J26A 1STUA 1H7SA 2ODRC 1UEKA 1Y6ZA 1WHQA 5LMNI 1IBKI 1Z0TA 2UUAI 2IOPA 2E5LI 1N36E 2E5LE 2YZTA 4DUYE 4F54A 2GQ0A 2F8BA 4OX9I 2X7IA 4USKA 4NXME 2LUPB 5AE1A 4Z7CA 4NXMI 4JI2E 3LPSA 1XMQI 4JI2I 4IZKA 2UXCI 4DPTA 2CPNA 2UXCE 1N33E 2UXBE 2O1UA 1N33I 1RR9A 2HKEA 1IBLI 4WUBA 1UILA 4MYUA 4JI7I 1GQEA 5LMUI 3ADLA 4JI4I 3J7AM 2B9DA 4JG4A 4DR5E 1HNZE 1Z0CA 2N3GA 2Z5CA 1PVGA 3J80C 2VQFE 4F9BB 2UUBE 3CWVA 2VQFI 4DU8A 2F4VI 4DUZE 4DV0E 4GEQB 3IWDA 4DXLA 3QT8A 5AE2A 4WUCA 4B3ME 1ZXNA 4DUYI 3K6QA 4LF8E 3QT5A 4DV3E 1N0VC 2A2DA 2WW4A 3F0NA 2CG9A 4BCAA 1XMOE 3V2UC 4DR3E 2UXDI 1QU6A 1YZ9A 2V89A 1J5EI 4LFAI 2RS7A 4LF7I 2VE7C 3WU6A 5ADZA 1RQ0A 4BC9A 3PYFA 1Y4SA 3Q6NA 4M1KA 2L8TA 4UT4A 2DSYA 2MDRA 1Z5AA 5LL6R 2L3JA 1BKNA 2DEJA 3P06A 2M7QA 4DKKA 3LNUA 4X62I 3DF6A 1RREA 3H4LA 4F9AB 1NZ0A 2RS6A 1I94I 4WYQB 4Q28A 4WPYA 2Z5BA 4R03A 4F9CB 4I3HA 4X65I 4JV5E 2NUFA 3MSWA 4DV4E 4DPUA 4DV4I 2XEXA 4JI4E 2BV3A 5IT9Q 2RSMA 1KTVA 3J81C 3HTXA 4L5NC 5IT9C 2LTRA 3J81Q 3V5RA 1FKAE 4AQYI 2R3VA 3KWRA 2UUCE 4UTGA 2V88A 4DR2E 2NUEA 4EMDA 1ZM9A 5GMEA 1N32E 4NXNE 4FW9A 3ZOQB 3OMLA 4GKKI 2BM1A 2JWOA 1H7UA 3Q6MA 2N3HA 2DIXA 3M6AA 4DR6I 4DR3I 4KHPE 4JYAI 4GKJE 3GONA 4GKJI 4URLA 4LFAE 1NHJA 4LTYA 2Z5BB 1NHHA 2HHHI 2FV4B 4M0VA 4DR7I 3K85A 3AV0A 2NPFA 3LLHA 1Z5CA 1ELOA 1N0UA 2UUCI 1VISA 2FGGA 1I94E 1EKZA 4DV1E 3C4TA 4PU9A 4HYMA 4JI5E 2UXBI 1U2RA 2V83A 2M4IA 1A6FA 2HKJA 4LF8I 4DR4I 1B62A 4DR4E 2KOUA 3PRYA 2EFGA 4KZSA 3DJWA 1ZM3A 1EI1A 4JI0E 1KIJA 3J80Q 1D6TA 2HHHE 5AE3A 1H73A 2GS8A 4ED4A 2IHR1 4DR2I 4DUZI 1DI2A 2VF3A 3VK6A 3K17A 2L6MA 4B3MI 3WU3A 4DV3I 3K1JA 4WSPA 4OX9E 4IZJB 4K0KI 5FWKA 4LU9A 1SR9A 1XNQE 3HPZA 4TUIA 3FIGA 3T1HI 4J8ZA 5BR8I 3ADIA 3JU0A 4P7AA 3VYXA 4JV5I 3HPSA 4LFBE 4X66E 1FWKA 2HFUA 3QT6A 2YT4A 4LF9E 4JI8I 3ZZUA 5LMNE 2EWLA 4LF9I 1HNXE 1XHKA 4IZJD 1FWLA 1S4EA 1ZM4A 2NUGA 2LE2A 2LJPA 4LFCI 3HJCA 1ZBQA 3HXLA 1T4LB 4M2ZA 2L3CA 1XMQE 2JVAA 1O0WA 1Y4UA 4DV0I 4RPFA 2L92A 4X65E 2JY9A 4DV6E 4LF4E 2EZ6A 4HACA 4I8OA 5LMUE 4K0KE 3H09A 4HACB 1XMOI 3T1YE 2CZ9A 2NA2A 3T1HE 2V2VA 3WU5A 4DR5I 4JYAE 1DARA 4DV7E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MX0 A;  2HK3 A;  4LF7 E;  1YYW A;  3B78 A;  1YYK A;  1OJ4 A;  2ZM6 E;  1N32 I;  4WUD A;  4LFC E;  4B3S I;  5L3J A;  3PYE A;  2HFS A;  1Z0W A;  2UXD E;  1XNQ I;  4DR1 E;  1NHI A;  3PYD A;  1FJG I;  2B7V A;  4YY3 E;  2E1R A;  4DPW A;  1IBL E;  1KKH A;  1MG7 A;  3B8H A;  3P1X A;  4HY1 A;  1ZM2 A;  3D4J A;  3T1Y I;  1HNZ I;  3WU4 A;  1HR0 I;  1Z59 A;  2J7K A;  1Z0E A;  1PIE A;  4FWD A;  2BM0 A;  4HXZ A;  2V34 A;  4LF6 I;  2UU9 I;  2UU9 E;  1UHZ A;  1XNR I;  1X47 A;  1IBM E;  2A2C A;  2ZIT A;  4B3T I;  4JI6 I;  4B3S E;  2R42 A;  2LTS A;  3ZM7 A;  3OTO E;  4YY3 I;  4KHP I;  4AQY E;  1H74 A;  2L33 A;  1FNM A;  1Z5B A;  1YYO A;  2VQE I;  2Q2E B;  2DB2 A;  4X8W A;  4JI3 E;  3J7A G;  1J5E E;  4FWG A;  4DV5 E;  1T4O A;  4USM A;  1FI4 A;  1HNX I;  1IBK E;  4DR7 E;  1HR0 E;  4M30 A;  5GMD A;  4ZVI A;  5A2Q C;  1S16 A;  5A2Q Q;  1WHN A;  2DEI A;  3PYG A;  4KQV A;  4PRV A;  1WUU A;  2L2M A;  3LTO A;  4DR1 I;  2RTX A;  1EA6 A;  4WFT A;  4B3T E;  4JI6 E;  4JI5 I;  4X66 I;  4JI7 E;  4JI8 E;  2KHX A;  1K47 A;  1T4N A;  4DPX A;  4X62 E;  5IWA E;  4DV2 I;  2L2N A;  3ZKD A;  4DV2 E;  1MU5 A;  3HUL A;  1N34 I;  2DMY A;  1IBM I;  3ZKB A;  1N34 E;  2ZM6 I;  1Z0V A;  4LF5 E;  3JAM C;  4LF5 I;  3B82 A;  3JAM Q;  4B3R E;  4PRX A;  2V2Q A;  4DV6 I;  4LF4 I;  2HK2 A;  2ZBK B;  5CFF E;  4DR6 E;  1ZBT A;  1H72 C;  2V8P A;  1FJG E;  1HNW I;  2VQE E;  4Z7Y A;  4MYT A;  3ADG A;  4JI0 I;  3VYY A;  4DPY A;  1X48 A;  2L2K B;  2F4V E;  2LRS A;  1KVK A;  3J7Y p;  5FLX C;  2V2Z A;  5FLX Q;  1N36 I;  5IWA I;  1Z0G A;  1RC7 A;  4X64 E;  4YHH E;  3Q1Q A;  4X64 I;  4YHH I;  4LF6 E;  4XTJ A;  4P52 A;  2LJH A;  4DV1 I;  1Z0B A;  1ZXM A;  5BR8 E;  3QT7 A;  2B7T A;  2X36 A;  3ZZT A;  2LUQ A;  1PKP A;  3OTO I;  2B3T B;  2UUA E;  1HNW E;  4DV5 I;  2UUB I;  1XNR E;  2OI2 A;  3ADJ A;  3C4B A;  4NXN I;  4B3R I;  4GKK E;  1B63 A;  1QZR A;  1X49 A;  4FWH A;  4JI1 E;  4R1F A;  4JI1 I;  4DU7 A;  3ZZ0 A;  2LBS B;  4DV7 I;  4FN5 A;  4OOG C;  2AJ4 A;  4LFB I;  4JI3 I;  1J26 A;  1STU A;  1H7S A;  1UEK A;  1WHQ A;  5LMN I;  1IBK I;  1Z0T A;  2UUA I;  2E5L I;  1N36 E;  2E5L E;  4DUY E;  4OX9 I;  2X7I A;  4USK A;  4NXM E;  2LUP B;  4Z7C A;  4NXM I;  4JI2 E;  3LPS A;  1XMQ I;  4JI2 I;  2UXC I;  4DPT A;  2CPN A;  2UXC E;  1N33 E;  2UXB E;  1N33 I;  1RR9 A;  2HKE A;  1IBL I;  4WUB A;  1UIL A;  4MYU A;  4JI7 I;  1GQE A;  5LMU I;  3ADL A;  4JI4 I;  3J7A M;  4JG4 A;  4DR5 E;  1HNZ E;  1Z0C A;  2N3G A;  1PVG A;  3J80 C;  2VQF E;  2UUB E;  3CWV A;  2VQF I;  4DU8 A;  2F4V I;  4DUZ E;  4DV0 E;  4DXL A;  3QT8 A;  4WUC A;  4B3M E;  1ZXN A;  4DUY I;  4LF8 E;  3QT5 A;  4DV3 E;  1N0V C;  2A2D A;  2WW4 A;  3F0N A;  3V2U C;  1XMO E;  4DR3 E;  2UXD I;  1QU6 A;  1YZ9 A;  1J5E I;  4LFA I;  2RS7 A;  4LF7 I;  3WU6 A;  1RQ0 A;  3PYF A;  4M1K A;  4UT4 A;  2MDR A;  1Z5A A;  2L3J A;  5LL6 R;  1BKN A;  2DEJ A;  4DKK A;  3LNU A;  4X62 I;  1RRE A;  3H4L A;  1NZ0 A;  2RS6 A;  1I94 I;  4WYQ B;  4I3H A;  4X65 I;  2NUF A;  4JV5 E;  4DV4 E;  4DPU A;  4DV4 I;  2XEX A;  4JI4 E;  2BV3 A;  5IT9 Q;  2RSM A;  1KTV A;  3J81 C;  3HTX A;  5IT9 C;  2LTR A;  3J81 Q;  3V5R A;  1FKA E;  4AQY I;  2R3V A;  2UUC E;  4UTG A;  4DR2 E;  2NUE A;  4EMD A;  1ZM9 A;  5GME A;  1N32 E;  4NXN E;  4FW9 A;  4GKK I;  2BM1 A;  1H7U A;  2N3H A;  3M6A A;  2DIX A;  4DR6 I;  4DR3 I;  4KHP E;  4JYA I;  4GKJ E;  3GON A;  4GKJ I;  4URL A;  4LFA E;  1NHJ A;  1NHH A;  2HHH I;  4DR7 I;  2NPF A;  3LLH A;  1Z5C A;  1ELO A;  1N0U A;  2UUC I;  1VIS A;  1I94 E;  1EKZ A;  4DV1 E;  3C4T A;  4PU9 A;  4HYM A;  4JI5 E;  2UXB I;  1U2R A;  1A6F A;  2HKJ A;  4LF8 I;  4DR4 I;  1B62 A;  4DR4 E;  2EFG A;  1ZM3 A;  1EI1 A;  4JI0 E;  1KIJ A;  3J80 Q;  1D6T A;  2HHH E;  1H73 A;  2GS8 A;  4ED4 A;  2IHR 1;  4DR2 I;  4DUZ I;  1DI2 A;  2VF3 A;  3K17 A;  4B3M I;  3WU3 A;  4DV3 I;  3K1J A;  4OX9 E;  4K0K I;  1XNQ E;  3T1H I;  5BR8 I;  3ADI A;  4P7A A;  3VYX A;  4JV5 I;  4LFB E;  4X66 E;  1FWK A;  2HFU A;  3QT6 A;  2YT4 A;  4LF9 E;  4JI8 I;  3ZZU A;  5LMN E;  4LF9 I;  1HNX E;  1XHK A;  1FWL A;  1S4E A;  1ZM4 A;  2NUG A;  2LJP A;  4LFC I;  1T4L B;  4M2Z A;  2L3C A;  1XMQ E;  2JVA A;  1O0W A;  4DV0 I;  4RPF A;  4X65 E;  2JY9 A;  4DV6 E;  4LF4 E;  2EZ6 A;  4HAC A;  5LMU E;  4K0K E;  4HAC B;  1XMO I;  3T1Y E;  2CZ9 A;  3WU5 A;  2NA2 A;  3T1H E;  2V2V A;  4DR5 I;  4JYA E;  1DAR A;  4DV7 E; 
#chains in the Genus database with same CATH topology
 2EOR A;  1MX0 A;  2YTJ A;  3LML A;  2HK3 A;  4LF7 E;  1YYW A;  3EPK A;  3B78 A;  2EN7 A;  5JEA C;  1YYK A;  1OJ4 A;  2ZM6 E;  2YSP A;  2K4V A;  2YU8 A;  2O1W A;  2VRD A;  4OO1 D;  1RMD A;  1N32 I;  4WUD A;  2PO1 B;  2JE6 B;  1P42 A;  4LFC E;  4B3S I;  2O1T A;  4IZJ A;  2DGC A;  5L3J A;  5DNY A;  4AID A;  1AAY A;  2EN1 A;  4ZYE A;  3PYE A;  3AUZ A;  2HFS A;  1Z0W A;  2UXD E;  1XNQ I;  4DR1 E;  1NHI A;  3PYD A;  1FJG I;  2YSO A;  2B7V A;  2YTG A;  4YY3 E;  4ISA A;  1EH6 A;  2EMZ A;  1L4S A;  2E1R A;  1QNT A;  2EPZ A;  4DPW A;  1IBL E;  2LVH A;  3MHH C;  4N4R B;  5A6J A;  1KKH A;  1BBO A;  1HK7 A;  2H36 X;  4GZN C;  1MG7 A;  3B8H A;  3P1X A;  4HY1 A;  2HGH A;  1ZM2 A;  1JK2 A;  3D4J A;  3T1Y I;  1YPN A;  4MU0 A;  1HNZ I;  2LT7 A;  3UHM A;  3WU4 A;  1HR0 I;  2EML A;  4O4K A;  5JEA F;  2RPC A;  1Z59 A;  2J7K A;  1Z0E A;  1PIE A;  3GLL A;  4FWD A;  2WZO A;  2BM0 A;  4HXZ A;  2V34 A;  4LF6 I;  2UU9 I;  4OO1 C;  5ELW A;  2UU9 E;  2EM9 A;  1UHZ A;  1GZ6 A;  1E3H A;  1ZR9 A;  4O5G A;  1WXR A;  1X47 A;  1IBM E;  2A2C A;  2EMB A;  3M85 D;  1XNR I;  2EMA A;  4WSG A;  1R6L A;  5DNX A;  2ZIT A;  4B3T I;  4JI6 I;  4R2A A;  4B3S E;  2R42 A;  2LTS A;  4F6N A;  3ZM7 A;  3OTO E;  2EOI A;  1BB8 A;  4YY3 I;  4IZK B;  2YTO A;  4KHP I;  4AQY E;  5F3W A;  1H74 A;  3GCM A;  1PJT A;  2L33 A;  1FNM A;  1Z5B A;  1YYO A;  2VQE I;  2Q2E B;  1N3G A;  1UDS A;  2DB2 A;  4X8W A;  1YFH A;  4JI3 E;  1J5E E;  3J7A G;  3CDJ A;  3PS2 A;  5KL5 A;  4R2E A;  1DQ3 A;  2EPO A;  1T4O A;  3HQ1 A;  4DV5 E;  4FWG A;  4USM A;  1FI4 A;  2EPX A;  1HNX I;  2PRT A;  1IBK E;  4DR7 E;  5IV8 B;  1HR0 E;  4M30 A;  2BA0 G;  5GMD A;  4ZVI A;  4BMJ A;  2EPM X;  3M85 G;  5A2Q C;  2JOX A;  1S16 A;  4P7D A;  2FTX B;  5A2Q Q;  1WHN A;  2DEI A;  3PYG A;  4KQV A;  4PRV A;  2YTD A;  1YSA C;  4NHR A;  1WUU A;  2L2M A;  3LTO A;  4DR1 I;  2EMW A;  2N8X A;  2C37 A;  1USV A;  2RTX A;  2YRM A;  2Z5E A;  1EA6 A;  4WFT A;  1A1L A;  1R6M A;  3L00 A;  4B3T E;  4JI6 E;  2PNZ B;  4JI5 I;  2C37 B;  3IWB A;  4OZE A;  4X66 I;  3EPL A;  4R8O A;  2EOF A;  4JI7 E;  4L8N A;  2MDG A;  4JI8 E;  2KHX A;  1K47 A;  2I13 A;  2EMX A;  5EKW A;  5K36 B;  1T4N A;  5C0X D;  1Y60 A;  2EMK A;  2R1F A;  2EOQ A;  2KON A;  2NAB A;  5AAS A;  2BR2 A;  2YRK A;  4DPX A;  4X62 E;  5IWA E;  4DV2 I;  2M9A A;  2L2N A;  2NN6 D;  2BA0 D;  3ZKD A;  2EMG A;  4DV2 E;  2PNL A;  4R2Q A;  5A6B A;  3MHS C;  4ZYD A;  1MU5 A;  1OYP A;  3HUL A;  1N34 I;  2EE8 A;  2DMY A;  2PO0 B;  2EMY A;  2RSI A;  4DMI A;  1N34 E;  2E72 A;  3ZKB A;  1Z0V A;  4LF5 E;  2ZM6 I;  1IBM I;  3RMP A;  3JAM C;  4LF5 I;  1XXE A;  3B82 A;  4MLQ A;  3JAM Q;  5TSE A;  4B3R E;  4PRX A;  2EOO A;  2V2Q A;  2EN2 A;  4DV6 I;  4LF4 I;  4MU1 A;  1T39 A;  1B69 A;  2NN6 E;  2G7H A;  2YTE A;  3F6H A;  4BBY A;  2HK2 A;  2ZBK B;  2ENH A;  5CFF E;  4DR6 E;  2E1M A;  1ZBT A;  5DNL A;  1H72 C;  2DLQ A;  2V8P A;  1FJG E;  2ODR D;  2CTD A;  2O1V A;  1LLM C;  1HNW I;  2VQE E;  4Z7Y A;  2EM2 A;  4MYT A;  3ADG A;  2Z5C B;  4QNK A;  3B4T A;  4JI0 I;  1X3C A;  4O43 A;  3VYY A;  3KZY A;  5JEA E;  4DPY A;  2EMC A;  2EOX A;  5T6J A;  1X48 A;  2MC6 A;  2L2K B;  2F4V E;  2LRS A;  5KL6 A;  2JXP A;  2M1S A;  1KVK A;  3J7Y p;  4HEI A;  5FLX C;  2V2Z A;  5FLX Q;  1N36 I;  5IWA I;  1Z0G A;  1YHC A;  1RC7 A;  4X64 E;  4YHH E;  2MKN A;  3Q1Q A;  2WBU A;  4X64 I;  4LF6 E;  4FW3 A;  4FW4 A;  2J7J A;  1PJQ A;  4N3O A;  2LJH A;  5KL4 A;  4P52 A;  4XTJ A;  2PNM A;  4DV1 I;  1Z0B A;  4O24 A;  4NBQ A;  1ZXM A;  5BR8 E;  3QT7 A;  2EQ0 A;  1UN6 B;  2JR1 A;  2YTF A;  3EPH A;  2V86 A;  2IOQ A;  2B7T A;  3JTZ A;  2X36 A;  2NN6 A;  2V85 A;  2K7I A;  2PO2 B;  3IWC A;  3F6G A;  2V8Q B;  3ZZT A;  2LUQ A;  2ADR A;  1ZAA C;  1E3P A;  3H1C A;  1PKP A;  2LMZ A;  4U3D A;  2JOB A;  3L7Z B;  3OTO I;  2RQL A;  2BB8 A;  2B3T B;  2UUA E;  2YPN A;  4BA2 A;  3KZZ A;  1HNW E;  5JEA A;  2AE8 A;  2YTI A;  3EPJ A;  4P78 A;  4DV5 I;  2IER A;  2UUB I;  1A1K A;  1XNR E;  2OI2 A;  3ADJ A;  2R76 A;  5AC5 A;  2EN8 A;  3C4B A;  4IFD A;  2V87 A;  5KL3 A;  4NXN I;  1USU A;  4B3R I;  4FW5 A;  5DRO A;  2YRH A;  4BC7 A;  4GKK E;  4M9V C;  1B63 A;  2EM5 A;  5A69 A;  1NCS A;  3NZK A;  5KL2 A;  1QZR A;  1X49 A;  4FWH A;  4JI1 E;  4R1F A;  1P47 A;  1IMU A;  4OO1 E;  4FW7 A;  4JI1 I;  4BHB A;  2LBS B;  1JK1 A;  3ZZ0 A;  4DU7 A;  4BS9 A;  4AM3 A;  4TUG A;  4DV7 I;  4FN5 A;  4OO1 B;  2CGE A;  2MC5 A;  4OOG C;  2AJ4 A;  2VF1 A;  4LFB I;  4IJD A;  3CDI A;  4JI3 I;  2EN4 A;  1J26 A;  1STU A;  1H7S A;  2ODR C;  1UEK A;  4RH8 A;  4QNJ A;  1WHQ A;  4IS1 C;  1Y6Z A;  5LMN I;  1IBK I;  4WXC A;  1Z0T A;  2EMI A;  1Y5Y A;  2IOP A;  2UUA I;  2E5L I;  2EOJ A;  1N36 E;  4IFD C;  2E5L E;  3QG5 C;  2YZT A;  4X9J A;  4F54 A;  4DUY E;  2F8B A;  2GQ0 A;  4OX9 I;  2X7I A;  4LPF A;  4USK A;  4NXM E;  1X6E A;  4GQU A;  2LUP B;  5AE1 A;  2NN6 F;  2HJJ A;  2EQ1 A;  4Z7C A;  4NXM I;  4JI2 E;  3LPS A;  5JEA D;  1XMQ I;  2EPN A;  4JI2 I;  4IZK A;  2BA1 G;  4IFD E;  1MGT A;  2WNR A;  3PS3 A;  2CPN A;  4DPT A;  5C0X F;  2PO1 A;  2UXC E;  2UXC I;  2EN3 A;  1N33 E;  2UXB E;  2NN6 C;  2EOY A;  2O1U A;  1UBD C;  5C0X A;  1RR9 A;  2JP9 A;  3EQ1 A;  2EP3 A;  2HKE A;  4WUB A;  1IBL I;  1UIL A;  4IFD D;  2EOH A;  1A1H A;  4MYU A;  4JI7 I;  4LCG A;  1GQE A;  5LMU I;  1F2I G;  3ADL A;  1BBG A;  4JI4 I;  3J7A M;  2B9D A;  4JG4 A;  3P3E A;  2LCE A;  4DR5 E;  1A1G A;  1HNZ E;  2F1D A;  1Z0C A;  3BBG A;  1OYR A;  2N3G A;  2Z5C A;  2ENC A;  1PVG A;  3J80 C;  5IXM B;  4MDT A;  4LCH A;  2VQF E;  4F9B B;  2UUB E;  3CWV A;  2JEA B;  2VQF I;  1AH5 A;  2EM0 A;  2EN6 A;  4DU8 A;  2I9I A;  4DUZ E;  2C38 A;  4BA1 A;  2F4V I;  4DV0 E;  4GEQ B;  3IWD A;  1TF3 A;  4DXL A;  2EJ4 A;  5AE2 A;  3QT8 A;  2ENA A;  4LCF A;  3BID A;  4WUC A;  4B3M E;  4Q35 B;  1A1F A;  1ZXN A;  4DUY I;  3K6Q A;  4LF8 E;  3L7Z A;  4DV3 E;  3QT5 A;  1N0V C;  4WX9 A;  2A2D A;  2DMI A;  2WW4 A;  3F0N A;  1IQO A;  1G2D C;  2CG9 A;  5C0X C;  4BCA A;  1XMO E;  3V2U C;  4KWY A;  1TN9 A;  4DR3 E;  2UXD I;  1QU6 A;  3M99 B;  1KJK A;  2JPA A;  1YZ9 A;  2V89 A;  1J5E I;  4LFA I;  2RS7 A;  4LF7 I;  2VE7 C;  3WU6 A;  3ECR A;  2CVE A;  5ADZ A;  1MEY C;  4FW6 A;  1RQ0 A;  2CT1 A;  4BC9 A;  5DRQ A;  3PYF A;  1Y4S A;  2EQ3 A;  2WCC 3;  2L8T A;  2GLI A;  3Q6N A;  1G2F C;  4M1K A;  4UT4 A;  2DSY A;  2MDR A;  4MLV A;  1Z5A A;  5LL6 R;  2L3J A;  3DD6 A;  1WJP A;  2ELZ A;  2EOE A;  1BKN A;  2DEJ A;  3P06 A;  2PNZ A;  2M7Q A;  4DKK A;  3LNU A;  4X62 I;  3DF6 A;  1RRE A;  3H4L A;  2ELY A;  4F9A B;  3PS1 A;  1NZ0 A;  2EOZ A;  4R2P A;  4MU3 A;  2EOM A;  2RS6 A;  2A25 A;  1I94 I;  4WYQ B;  4Q28 A;  4WPY A;  2IES A;  4ZYG A;  2Z5B A;  2JT2 A;  4R03 A;  1OYS A;  4R2R A;  4F9C B;  4J3D A;  1IQS A;  4I3H A;  3U1Y A;  4X65 I;  2NUF A;  3MSW A;  4DV4 E;  4JV5 E;  3P3C A;  4DPU A;  1GTK A;  2LJU A;  4F6M A;  4DV4 I;  5KL7 A;  4F2J C;  2YWQ A;  1Z1B A;  2XEX A;  4JI4 E;  2BV3 A;  3BF2 A;  2RSM A;  1KTV A;  5IT9 Q;  3J81 C;  2WBS A;  3HTX A;  5K36 D;  4L5N C;  5IT9 C;  5A6K A;  4BA2 B;  2LTR A;  3J81 Q;  4R2S A;  5K36 C;  3V5R A;  1YH8 A;  2JYA A;  1FKA E;  4AQY I;  2CSH A;  2C39 B;  2R3V A;  3KWR A;  2WP8 B;  2UUC E;  4UTG A;  4BHC A;  2DLK A;  2V88 A;  4DR2 E;  3C6M A;  2NUE A;  4EMD A;  2BBG A;  1ZM9 A;  5GME A;  4NZV A;  1N32 E;  4OO1 F;  4NXN E;  4FW9 A;  3ZOQ B;  2MKD A;  3OML A;  4GKK I;  2BM1 A;  2JWO A;  2JE6 A;  1H7U A;  2YTN A;  3Q6M A;  4OKG A;  2N3H A;  2DIX A;  3M6A A;  4DR6 I;  4DR3 I;  5A6B D;  1WRJ A;  4KHP E;  1X5W A;  4JYA I;  4GKJ E;  1UDQ A;  1VI7 A;  3GON A;  2DRP A;  4GKJ I;  4URL A;  1A1J A;  4LFA E;  1NHJ A;  2EPR A;  4LTY A;  5A6A A;  2D9H A;  2Z5B B;  1KYQ A;  1NHH A;  2FV4 B;  2HHH I;  2GO4 A;  1ZU1 A;  4M0V A;  1TF6 A;  4DR7 I;  2PO0 A;  4U3B A;  5EL9 A;  3GME A;  3K85 A;  4AIM A;  3AV0 A;  1UDO A;  5C0X B;  2BR2 B;  3M7N G;  2NPF A;  3LLH A;  1Z5C A;  1ELO A;  1N0U A;  2UUC I;  1VIS A;  1UDN A;  2WNR B;  2FGG A;  1I94 E;  1EKZ A;  1YUI A;  2EL4 A;  4DV1 E;  3C4T A;  4PU9 A;  1YUJ A;  1DGC A;  4HYM A;  4JI5 E;  2UXB I;  1U2R A;  2V83 A;  2EL6 A;  2M4I A;  3C6K A;  1A6F A;  2HKJ A;  2NN6 B;  3U1K A;  4FK5 C;  4IS9 A;  4LF8 I;  4DR4 I;  1B62 A;  4DR4 E;  2LO3 A;  2KOU A;  2EPU A;  3PRY A;  2EFG A;  4KZS A;  3DJW A;  2EPA A;  4IFD B;  1ZM3 A;  1T38 A;  1EI1 A;  2O3Z A;  3THN A;  1A1I A;  4JI0 E;  1KIJ A;  2EOS A;  2YTQ A;  4R2D A;  2JEB A;  2EPP A;  3J80 Q;  4RHB B;  2JEA A;  2HHH E;  1D6T A;  2EMF A;  5AE3 A;  1H73 A;  2C38 B;  2GS8 A;  3M7N D;  4ED4 A;  2IHR 1;  3THO B;  4DR2 I;  2YTP A;  3BGH A;  1RHY A;  2EPL X;  4DUZ I;  1DI2 A;  2YU5 A;  3VK6 A;  5LLQ A;  2VF3 A;  2WP8 A;  2LV2 A;  3K17 A;  2L6M A;  1X6F A;  3VHT B;  5K36 E;  4B3M I;  1EH7 A;  3WU3 A;  5AC4 A;  4YHH I;  5DRR A;  4DV3 I;  2BA1 D;  3K1J A;  4WSP A;  4OX9 E;  4IZJ B;  4K0K I;  5FWK A;  4LU9 A;  1SR9 A;  2WBT A;  2J65 A;  1SFE A;  1XNQ E;  3P3G A;  4BA1 B;  3HPZ A;  4TUI A;  3FIG A;  3T1H I;  4J8Z A;  2EM4 A;  4OO1 A;  2Q8U A;  5BR8 I;  2EM6 A;  3KRN A;  3ADI A;  3JU0 A;  4P7A A;  5K36 F;  3UK3 C;  3VYX A;  3TQM A;  4JV5 I;  3HPS A;  4LFB E;  4X66 E;  1FWK A;  1NEI A;  4MQY A;  2HFU A;  5JEA B;  3QT6 A;  2YT4 A;  4LF9 E;  4JI8 I;  3HKM A;  1EH8 A;  2EWL A;  5LMN E;  3ZZU A;  4LF9 I;  1HNX E;  1XHK A;  4IZJ D;  2GPI A;  1FWL A;  2HC5 A;  4WXD A;  1S4E A;  1ZM4 A;  2NUG A;  2LE2 A;  2LJP A;  4LFC I;  3HJC A;  1PJS A;  1ZBQ A;  3HXL A;  1PDA A;  1T4L B;  2GHF A;  4LOM A;  4M2Z A;  2L3C A;  1XMQ E;  1X6H A;  2JVA A;  4ZYH A;  1O0W A;  1Y4U A;  2EM8 A;  4DV0 I;  5K36 A;  4RPF A;  2L92 A;  4X65 E;  2JY9 A;  2EL5 A;  4DV6 E;  4LF4 E;  2EZ6 A;  4R2C A;  2EPC A;  3P76 A;  4IFD F;  4HAC A;  1N33 I;  4I8O A;  5C0X E;  5LMU E;  4K0K E;  2PO2 A;  4HTG A;  4MU4 A;  2EMH A;  2EM3 A;  3H09 A;  5DRP A;  2VES A;  4HAC B;  1XMO I;  3T1Y E;  2EPK X;  2CZ9 A;  2NA2 A;  3T1H E;  2C39 A;  2GO3 A;  2V2V A;  3WU5 A;  4JYA E;  4DR5 I;  2EM7 A;  2JEB B;  1DAR A;  4DV7 E; 
#chains in the Genus database with same CATH homology
 1MX0 A;  3LML A;  2HK3 A;  4LF7 E;  1YYW A;  3B78 A;  1YYK A;  1OJ4 A;  2ZM6 E;  2K4V A;  2O1W A;  1N32 I;  4WUD A;  4LFC E;  4B3S I;  2O1T A;  4IZJ A;  5L3J A;  5DNY A;  3PYE A;  3AUZ A;  2HFS A;  1Z0W A;  2UXD E;  1XNQ I;  4DR1 E;  1NHI A;  3PYD A;  1FJG I;  2B7V A;  4YY3 E;  2E1R A;  4DPW A;  1IBL E;  1KKH A;  1HK7 A;  2H36 X;  1MG7 A;  3B8H A;  3P1X A;  4HY1 A;  1ZM2 A;  3D4J A;  3T1Y I;  1HNZ I;  3WU4 A;  1HR0 I;  1Z59 A;  2J7K A;  1Z0E A;  1PIE A;  4FWD A;  2WZO A;  2BM0 A;  4HXZ A;  2V34 A;  4LF6 I;  2UU9 I;  2UU9 E;  1UHZ A;  1GZ6 A;  1XNR I;  1WXR A;  1X47 A;  1IBM E;  2A2C A;  2ZIT A;  4B3T I;  4JI6 I;  4B3S E;  2R42 A;  2LTS A;  3ZM7 A;  3OTO E;  4YY3 I;  4IZK B;  4KHP I;  4AQY E;  5F3W A;  1H74 A;  2L33 A;  1FNM A;  1Z5B A;  1YYO A;  2VQE I;  2Q2E B;  2DB2 A;  4X8W A;  4JI3 E;  3J7A G;  1J5E E;  1DQ3 A;  4FWG A;  3HQ1 A;  1T4O A;  4DV5 E;  4USM A;  1FI4 A;  1HNX I;  1IBK E;  4DR7 E;  1HR0 E;  4M30 A;  5GMD A;  4ZVI A;  4BMJ A;  5A2Q C;  1S16 A;  2JOX A;  4P7D A;  2FTX B;  5A2Q Q;  1WHN A;  2DEI A;  3PYG A;  4KQV A;  4PRV A;  1WUU A;  2L2M A;  3LTO A;  4DR1 I;  1USV A;  2RTX A;  2Z5E A;  1EA6 A;  4WFT A;  4B3T E;  4JI6 E;  4JI5 I;  3IWB A;  4X66 I;  4R8O A;  4JI7 E;  4L8N A;  4JI8 E;  2KHX A;  1K47 A;  1T4N A;  5AAS A;  2KON A;  4DPX A;  4X62 E;  5IWA E;  4DV2 I;  2L2N A;  3ZKD A;  4DV2 E;  2PNL A;  1MU5 A;  3HUL A;  1N34 I;  2DMY A;  4DMI A;  3ZKB A;  1N34 E;  1IBM I;  2ZM6 I;  1Z0V A;  4LF5 E;  3RMP A;  3JAM C;  4LF5 I;  3B82 A;  3JAM Q;  4B3R E;  4PRX A;  2V2Q A;  4DV6 I;  4LF4 I;  2G7H A;  3F6H A;  4BBY A;  2HK2 A;  2ZBK B;  5CFF E;  4DR6 E;  2E1M A;  1ZBT A;  1H72 C;  2V8P A;  1FJG E;  2ODR D;  2O1V A;  1HNW I;  2VQE E;  4Z7Y A;  4MYT A;  3ADG A;  2Z5C B;  4JI0 I;  3VYY A;  4DPY A;  5T6J A;  1X48 A;  2MC6 A;  2L2K B;  2F4V E;  2LRS A;  2M1S A;  1KVK A;  3J7Y p;  5FLX C;  2V2Z A;  5FLX Q;  1N36 I;  5IWA I;  1Z0G A;  1RC7 A;  4X64 E;  4YHH E;  3Q1Q A;  4X64 I;  4YHH I;  4LF6 E;  4N3O A;  4XTJ A;  4P52 A;  2LJH A;  2PNM A;  4DV1 I;  1Z0B A;  1ZXM A;  5BR8 E;  3QT7 A;  2JR1 A;  2V86 A;  2IOQ A;  2B7T A;  3JTZ A;  2X36 A;  2V85 A;  3IWC A;  3F6G A;  2V8Q B;  3ZZT A;  2LUQ A;  1PKP A;  2LMZ A;  2JOB A;  3OTO I;  2B3T B;  2UUA E;  1HNW E;  4P78 A;  4DV5 I;  2UUB I;  1XNR E;  2OI2 A;  3ADJ A;  3C4B A;  2V87 A;  4NXN I;  1USU A;  4B3R I;  4BC7 A;  4GKK E;  1B63 A;  1QZR A;  1X49 A;  4FWH A;  4JI1 E;  4R1F A;  4JI1 I;  4DU7 A;  3ZZ0 A;  2LBS B;  4BS9 A;  4TUG A;  4DV7 I;  4FN5 A;  2CGE A;  2MC5 A;  4OOG C;  2AJ4 A;  2VF1 A;  4LFB I;  4JI3 I;  1J26 A;  1STU A;  1H7S A;  2ODR C;  1UEK A;  1Y6Z A;  1WHQ A;  5LMN I;  1IBK I;  1Z0T A;  2UUA I;  2IOP A;  2E5L I;  1N36 E;  2E5L E;  2YZT A;  4DUY E;  4F54 A;  2GQ0 A;  2F8B A;  4OX9 I;  2X7I A;  4USK A;  4NXM E;  2LUP B;  5AE1 A;  4Z7C A;  4NXM I;  4JI2 E;  3LPS A;  1XMQ I;  4JI2 I;  4IZK A;  2UXC I;  4DPT A;  2CPN A;  2UXC E;  1N33 E;  2UXB E;  2O1U A;  1N33 I;  1RR9 A;  2HKE A;  1IBL I;  4WUB A;  1UIL A;  4MYU A;  4JI7 I;  1GQE A;  5LMU I;  3ADL A;  4JI4 I;  3J7A M;  2B9D A;  4JG4 A;  4DR5 E;  1HNZ E;  1Z0C A;  2N3G A;  2Z5C A;  1PVG A;  3J80 C;  2VQF E;  4F9B B;  2UUB E;  3CWV A;  2VQF I;  4DU8 A;  2F4V I;  4DUZ E;  4DV0 E;  4GEQ B;  3IWD A;  4DXL A;  3QT8 A;  5AE2 A;  4WUC A;  4B3M E;  1ZXN A;  4DUY I;  3K6Q A;  4LF8 E;  3QT5 A;  4DV3 E;  1N0V C;  2A2D A;  2WW4 A;  3F0N A;  2CG9 A;  4BCA A;  1XMO E;  3V2U C;  4DR3 E;  2UXD I;  1QU6 A;  1YZ9 A;  2V89 A;  1J5E I;  4LFA I;  2RS7 A;  4LF7 I;  2VE7 C;  3WU6 A;  5ADZ A;  1RQ0 A;  4BC9 A;  3PYF A;  1Y4S A;  3Q6N A;  4M1K A;  2L8T A;  4UT4 A;  2DSY A;  2MDR A;  1Z5A A;  5LL6 R;  2L3J A;  1BKN A;  2DEJ A;  3P06 A;  2M7Q A;  4DKK A;  3LNU A;  4X62 I;  3DF6 A;  1RRE A;  3H4L A;  4F9A B;  1NZ0 A;  2RS6 A;  1I94 I;  4WYQ B;  4Q28 A;  4WPY A;  2Z5B A;  4R03 A;  4F9C B;  4I3H A;  4X65 I;  4JV5 E;  2NUF A;  3MSW A;  4DV4 E;  4DPU A;  4DV4 I;  2XEX A;  4JI4 E;  2BV3 A;  5IT9 Q;  2RSM A;  1KTV A;  3J81 C;  3HTX A;  4L5N C;  5IT9 C;  2LTR A;  3J81 Q;  3V5R A;  1FKA E;  4AQY I;  2R3V A;  3KWR A;  2UUC E;  4UTG A;  2V88 A;  4DR2 E;  2NUE A;  4EMD A;  1ZM9 A;  5GME A;  1N32 E;  4NXN E;  4FW9 A;  3ZOQ B;  3OML A;  4GKK I;  2BM1 A;  2JWO A;  1H7U A;  3Q6M A;  2N3H A;  2DIX A;  3M6A A;  4DR6 I;  4DR3 I;  4KHP E;  4JYA I;  4GKJ E;  3GON A;  4GKJ I;  4URL A;  4LFA E;  1NHJ A;  4LTY A;  2Z5B B;  1NHH A;  2HHH I;  2FV4 B;  4M0V A;  4DR7 I;  3K85 A;  3AV0 A;  2NPF A;  3LLH A;  1Z5C A;  1ELO A;  1N0U A;  2UUC I;  1VIS A;  2FGG A;  1I94 E;  1EKZ A;  4DV1 E;  3C4T A;  4PU9 A;  4HYM A;  4JI5 E;  2UXB I;  1U2R A;  2V83 A;  2M4I A;  1A6F A;  2HKJ A;  4LF8 I;  4DR4 I;  1B62 A;  4DR4 E;  2KOU A;  3PRY A;  2EFG A;  4KZS A;  3DJW A;  1ZM3 A;  1EI1 A;  4JI0 E;  1KIJ A;  3J80 Q;  1D6T A;  2HHH E;  5AE3 A;  1H73 A;  2GS8 A;  4ED4 A;  2IHR 1;  4DR2 I;  4DUZ I;  1DI2 A;  2VF3 A;  3VK6 A;  3K17 A;  2L6M A;  4B3M I;  3WU3 A;  4DV3 I;  3K1J A;  4WSP A;  4OX9 E;  4IZJ B;  4K0K I;  5FWK A;  4LU9 A;  1SR9 A;  1XNQ E;  3HPZ A;  4TUI A;  3FIG A;  3T1H I;  4J8Z A;  5BR8 I;  3ADI A;  3JU0 A;  4P7A A;  3VYX A;  4JV5 I;  3HPS A;  4LFB E;  4X66 E;  1FWK A;  2HFU A;  3QT6 A;  2YT4 A;  4LF9 E;  4JI8 I;  3ZZU A;  5LMN E;  2EWL A;  4LF9 I;  1HNX E;  1XHK A;  4IZJ D;  1FWL A;  1S4E A;  1ZM4 A;  2NUG A;  2LE2 A;  2LJP A;  4LFC I;  3HJC A;  1ZBQ A;  3HXL A;  1T4L B;  4M2Z A;  2L3C A;  1XMQ E;  2JVA A;  1O0W A;  1Y4U A;  4DV0 I;  4RPF A;  2L92 A;  4X65 E;  2JY9 A;  4DV6 E;  4LF4 E;  2EZ6 A;  4HAC A;  4I8O A;  5LMU E;  4K0K E;  3H09 A;  4HAC B;  1XMO I;  3T1Y E;  2CZ9 A;  2NA2 A;  3T1H E;  2V2V A;  3WU5 A;  4DR5 I;  4JYA E;  1DAR A;  4DV7 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...