4DV7L

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a915g, bound with streptomycin
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 13
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dv7L00
1UE5A 4LWCA 2IHFA 5BR8Q 5IYBG 4A3KH 1YNXA 2VQFL 2ZTDA 1U5KA 1N9WA 5C4XH 1L1OC 4BBRG 3RLNA 5HGQA 2F3IA 1VQMA 2F4VQ 4LUVA 4P71A 1VQHA 4HJ7A 4A76A 4DR4Q 4HJ8A 3L0OA 3F2DA 1KXLA 1V9PA 3KJPA 4HJ5A 2AKWB 3J80i 4IPCA 3UE0A 4DV2Q 1XNQQ 4JI4Q 2PI2E 1X6OA 2UUAL 2Q2IA 2YU9H 4A3DH 4IOCA 2KHJA 5IP9G 3HKZE 2K5NA 4C3HH 1PHJA 4HJAA 2IHEA 4BBSH 4NPSA 2EQSA 3TRZA 1JE5A 3OYYA 1UE7A 2I0QA 2HIVA 3KOJA 1N8RC 4DR1L 1SE8A 5FJ8H 5E7NA 1EQQA 4AIMA 1EFWA 4JOIA 4DR3Q 3VDYA 4JI8Q 1YZ6A 5LMUL 2BH2A 4P72A 1SFOH 4YCUA 1X55A 1HNWL 4A3MG 4DV1L 1HZBA 1WFQA 3AYHB 4B3SQ 1X65A 2BH8A 4YCWA 2QEXA 1VQCA 2R6GA 3EIVA 1XNRQ 1VQGA 2MFIA 1Y14B 1VQLA 1VQFA 3I4OA 3HOYH 4OWXB 5LMNW 2NVYH 2VQFQ 3U50C 3ULJA 1YHAA 3PO2G 3U4VA 4LFBL 3TREA 2D0OA 3KYHC 1MJEA 1FGUA 1KRSA 1RL2A 2IX0A 2ZM6L 3H15A 4OWWB 2ID0A 3K80C 3J81j 2B63G 5C0XI 3W5OA 5GADC 1XJVA 1PH3A 4LF5L 1TWHH 3OTOL 1YHQA 2UUAQ 2NN6I 2HHHQ 2VUMG 2WB1G 2R93H 1EWIA 4L5TA 5LMNL 1QUQA 4JYAL 1YIJA 1P8LA 2XGTA 3KDFB 2E2IH 3EBEA 2CQOA 2XTIA 3STBD 4BA1I 4DR1Q 1YJ9A 3D31A 1JJ2A 2JA7H 5FLMG 4OWTB 2JA5G 3GTQH 4TVAB 3BJUA 4YHHQ 3CPWA 1C9OA 3PUYA 1CSPA 5LMUQ 1BKBA 4B3MQ 1E7ZA 5GAHC 4A4IA 4R4IA 4R1JA 2H5XA 1HNWQ 2MO0A 4POFA 4PZ8A 1K9MC 3S17H 1KHIA 4GKJL 3F1ZA 5ELNA 4DV6L 1QVFA 3S1MH 2OWOA 3GTOH 3GTKH 5IYCH 1VQ9A 4OX9L 1PH9A 4BXXG 1XTDA 4LFBQ 4DPGA 4GOPB 1PH2A 2JA6H 2YTYA 4PMWA 4KHPL 4NXML 2VL6A 2LSSA 1A62A 5C0XJ 5J3BA 4FDBA 2ZM6Q 2LXKA 1IBLQ 3L2PA 1G291 2RF4A 4GN5A 3NELA 4YWLA 4LFAL 2K50A 4P75A 2IT1A 3PF5A 4DV5Q 2GVAA 3PSIA 1OXTA 2RHQB 1NE3A 1TWCH 3F2CA 3ICEA 5GAGC 5K36G 4QGUA 4DUYQ 4A93G 1I6HH 2WB1E 2PNHA 5BR8L 3GTMH 3GO5A 1X9NA 3HOWG 1D7QA 4QQBX 3MEFA 3K8AA 1VQ7A 3M4PA 4UY8C 3PV0A 4A3IG 1YITA 1JMCA 1MIUA 3S14H 3HOXG 1FVIA 4A3EH 4DR4L 4J15A 1BBWA 4LW1A 1WI5A 1XPUA 1KL9A 3PUVA 4DV2L 1L2FA 3GTGH 1H95A 1HJPA 1L1OB 2ZJRA 4B3RQ 4A3LH 1SN8A 1VQIA 1YVCA 5M3FG 4HIMA 1X54A 1Y1VG 2KCTA 3PO3H 4DR6L 4GKJQ 1PVOA 3SGIA 3ZJYC 3CC2A 2NVQH 1NBWA 3J80c 3PIOA 1J5EL 2K14A 2B3GA 2Q2UA 1VQ4A 1OXVA 4KHPQ 3STBC 2CWAA 1WCMG 1YI2A 4C3IH 4A3FH 4RMFA 4IFDG 2PQAA 2PMZE 1Q7YC 4JI8L 1D8LA 1MJCA 4UP7A 1Y1WG 2K5VA 2WFWA 2IY5B 1P16A 4GNXA 4LFAQ 4B3SL 4DR2L 4DV3Q 1PA6A 4JV5L 1C7YA 1N32L 2JJQA 1I3QH 1XNRL 3I2ZA 2N3SA 2E8GA 4HIKA 3CW2C 2K4KA 1K73C 1YEZA 4A3JG 4JI0L 3M4OH 2NZHA 1VQAA 4L5QA 3JAMi 2ZTCA 2NZOA 4IPHA 1HR0W 1VQNA 2N49A 3GTLH 3NBHB 4PG3A 1XPRA 1S40A 1ASYA 4BY1G 2Q2HA 3UDIA 3DM3A 4GS3A 1BVSA 3B6YA 3TEHB 4AYBG 4DV0Q 2MO1A 3CD6A 2HHHL 3HOZH 2BA0A 3DLLA 2WAQG 4DR6Q 2NVTH 1UE1A 1I94L 1LTLA 2JK8A 3HFZB 3CCUA 1J5EQ 2CKZB 2R92G 4JOIC 1NTGA 3KF6A 1TWFH 5M3MG 2Y0SE 1HR0L 5IT9c 2N78A 4YHHL 5HY6A 3I4MH 1NJIC 1OXUA 1PYSB 4B3ML 5C44H 1HZCA 5M5YH 1VQ8A 1CKNA 3GDEA 3RR5A 3AEVA 3HOVG 4DR2Q 4JV5Q 4MNOA 1EYGA 2Q2TA 1N32Q 4DK6C 3AFPA 2JA8H 1L0WA 1BBUA 2R7ZH 3ER0A 3H0GH 4JI2Q 4OONA 4YWMA 5IP7G 1V1QA 1QVGA 1Q8KA 4X64L 1VQJA 4YCVA 4JI0Q 4A3CG 2YYZA 3JC66 1ASZA 2AMCB 3L7ZC 2OTLA 4A3BG 1K83H 1X3FA 1PH4A 3HKSA 4BXXH 3OW2A 1LYLA 1Q86C 1IBLL 4A3GH 5IYDH 2JEBI 3BU2A 5DLQE 1GKHA 3KF8B 1KAWA 4NB3A 1CKMA 1OXXK 4QL5A 4R4CA 4DV5L 3LGJA 4AYBE 2ASBA 4A3KG 1CSQA 1E3PA 4DUYL 1PYBA 3G6EA 2F52A 1SMXA 4KLKA 4MTNA 4R4QA 4JI1L 2B29A 1I94Q 3I4NH 4PZ7A 1K8AC 4LFCL 1IBKQ 1J6QA 1SRUA 4IPDA 1LM0A 5GAEC 1KIXA 1PH8A 3CF5A 1SR3A 5C3EH 1HR0Q 1PH6A 1G51A 2C35B 1IXRA 1YHBA 2HT1A 2YTXA 1FL0A 2RHSB 2DUDA 4B3RL 3CCMA 5JEAJ 3GTPH 1B70B 1KRTA 3S15H 3CP0A 4BBSG 1KD1C 2JQOA 4Y52H 3PUWA 5IY0A 3CCSA 2HQLA 1W2BA 1QZGA 3CCQA 5GQOA 1Z47A 3UDXA 5FJ8G 4EX5A 3G4SA 5M3FH 1TXYA 1EUJA 3A74A 3FKIH 4X64Q 5JJLA 4LF4L 4GN3B 4GLVB 1VQBA 3E9IA 3M85A 1NMGA 1UEBA 1UE6A 3HOUH 4LNQA 3PF4A 1N33Q 4DV3L 3HOYG 3A0JA 1OXSC 5M5XH 1XMQL 1GD7A 4JI1Q 4JI6L 1IBML 4C3JH 2K52A 1I5FA 4LFCQ 1CKOA 2A8VA 5JJKA 2OTJA 3K81C 5ELOA 3J81i 3A5ZB 2K75A 1K8GA 5IYBH 2Z6KA 4HIDA 4BBRH 5AJ3Q 1JJGA 1WOCA 4LF8L 1VQ5A 4YY3L 4JBJA 4DK3C 4DV0L 4O0AA 2L15A 2UXCL 2R93G 1X3GA 2A1AA 4JC0A 3JAMc 3J7A5 2KENA 1WJJA 2DGYA 4RG1A 2CFMA 4IJLA 5IE8A 4DR7L 2MNAA 3F8TA 3KDFA 2MQHA 2JA7G 2IX1A 1SROA 3KLWA 4KHZA 2VS1A 2AWNA 4JG2A 5IP9H 2D62A 3S2HH 2GVBA 3CCJA 4LF4Q 2AHOB 5C0XG 2EXDA 2KCMA 4GNXC 4DR5Q 4LUOA 4ALPA 5H1SE 4X62L 4L5RC 2NN6G 3W1BA 1I50H 4LF6L 4K0KL 2R7FA 3PUXA 1E22A 1FJGL 3EN2A 2HIXA 1HZAA 3GD7A 1HH2P 1QVCA 1PFSA 4BY7G 4GLXA 1X56A 1EIFA 2VY3A 1XMQQ 3HKZG 4A3MH 2E5LL 2JA6G 4JI6Q 1EOVA 1Q82C 1IBMQ 2NVXH 4GOPA 4JI2L 2I5MX 4IPGA 2ZJPA 3CCRA 2JA9A 3PUZA 1CUKA 1O7IA 1VQDA 5IWAL 3E0EA 4DNIA 3J7ZC 1PH5A 3PO2H 4LUZA 3TS2A 4OO1G 3KFUA 3CCLA 4GN4B 2UXBL 3IRBA 1VQPA 2UXDQ 1X3EA 4DV4L 4NXNQ 4A3CH 4LF8Q 4JI3Q 1U0LA 4YY3Q 2UXCQ 3T1HQ 1GO3E 3T1YL 2ZJQA 1IL2A 4R4TA 1UWVA 5FLXc 3ULPA 2B63H 1E24A 4DR7Q 4UP8A 4AQYL 1Q12A 4X6AH 4POGA 4JBWA 2ES2A 3A5UA 1IBKL 3W1GA 4AH6A 2VUMH 1VQEA 4A3EG 4DAMA 4DUZL 1QUQB 2R7DA 4Y7NH 1Q1BA 2LXJA 1GVPA 4JI7Q 4A3LG 1L1OA 1A63A 4X62Q 4LF6Q 1VQKA 1N36L 3H3VI 3K0XA 5M5WH 5FLMH 2JA5H 1FJGQ 1HNXL 3PO3G 4K0KQ 1AE3A 1HNZQ 1OTCA 1XMOQ 2OQKA 2UUCL 2UUBL 1EQRA 1M1KC 3CC7A 3M4QA 2E5LQ 3TQYA 3Q8DA 1K0RA 4WJ3M 4HIOA 3G48A 4X65Q 4A3FG 1VQOA 2ZTEA 4XIGS 3RN5A 1HZ9A 3S2DH 5IWAQ 1JT8A 2GN5A 1LUZA 3FHWA 2UXBQ 3CMEA 2VZAA 3F2BA 4DV4Q 4B3TQ 3H3VH 1E1OA 3UDGA 1N33L 2KBNA 1A0IA 3BZKA 3I55A 3CAMA 4JI5L 3T1YQ 1C0AA 1AE2A 4LF7L 1VCIA 4QIWE 2WAQE 5C4XG 4AQYQ 3CXCA 1PH1A 3S1QH 3PGZA 4P74A 2D0PA 5C4JH 4LF9L 1E1TA 4DUZQ 1JB7A 2JE6I 4A93H 2PI2A 4JBMA 3HOWH 5GROA 4R4OA 1Q81C 4O2DA 4XTCS 2CWPA 4PZ6A 5AJ3L 2CCZA 1IYJB 3AQQA 3HOZG 1W3SA 2ALYB 4H02A 4A3IH 1N36Q 1A8VA 3ULLA 1R9TH 3HOXH 4A3DG 1HNXQ 4IFDI 1AH9A 3K7UC 3J81c 1DGSA 2OQ0A 3M7NA 4C2MH 2UUCQ 2UUBQ 3TS0A 3S16H 2AWOA 1SLJA 1NY4A 3D0FA 1JJCB 1K3RA 3CQZH 1PH7A 3UDFA 3RZDH 1Y1VH 2YV5A 4OXPA 3I4MG 3RZOH 2A19A 2UU9L 3MXNB 4X66L 5C44G 4DR5L 3M3YH 2VNUD 3RLFA 1YBYA 2I5HA 1Z9FA 3GTJH 1WCMH 4ME3A 2PQAB 1YJNA 4APVA 3S24A 1KQSA 2JA8G 4JI5Q 4OO1I 1Y1WH 4DV1Q 4DV7L 4UP9A 4HJ9A 4LF7Q 4GKKL 4GNXB 2R7ZG 3H0GG 3WWVA 4DKAC 4IO9A 1B8AA 4QJFA 1Q1EA 3CCVA 1MKHA 2Z6KC 1T9HA 1VS0A 4LF9Q 4BY7H 4P73A 3AFQA 3RNUA 3E9HA 2FXQA 4MZ9A 5IYDG 4A3GG 4GLAC 2QA4A 1KC8C 2UXDL 4A3JH 3UE1A 2VQEL 4IFDJ 4NXNL 3FP9A 2OCEA 4JI3L 4YWKA 4TQUS 3S1NH 5JEAG 2N8NA 1EIYB 3T1HL 4LF5Q 1YJWA 3OTOQ 1S72A 1N34L 4BY1H 3I4NG 1TWAH 5JJIA 3CPFA 2BA1A 1RIPA 2JEAI 4A75A 1Q46A 5LMNQ 4JYAQ 5C3EG 3BZCA 1IZ6A 1WYDA 1M90C 2K5HA 2QGQA 4JCVE 4JBKA 4JI7L 3CC4A 3U58A 2F4VL 3NEMA 3U4ZA 1TWGH 2UU9Q 4L5SA 4X66Q 3KF6B 1VQ6A 2R92H 2E2JH 4KI0A 3CCEA 3G71A 2WP8J 4QY7A 5M3MH 3NENA 1B7YB 1XNQL 2EIFA 3K7AH 4JI4L 4WJ4A 1HNZL 2Z0SA 4UPAA 4GOPC 4DV7Q 3ERSX 5IYCG 3S1RH 1CKNB 1XMOL 4GKKQ 4IOAA 3PIPA 3HOVH 3FKIG 1QZHA 5EAYA 4DV6Q 2KHIA 4X65L 4OX9Q 3RLOA 2VW9A 3I7FA 2ATWA 3HOUG 3KJOA 2Y0SG 3I56A 5IP7H 4NXMQ 1XPOA 2RCNA 1GM5A 2VQEQ 4DR3L 4B3TL 3RN2A 4BA2I 2V1CC 3M9BA 4A3BH 1G6PA 4IJHA 2I5LX 1S3OA 3PCOB 2YTVA 1N34Q 1V43A 2E2HH 4EQ5A 4DAYB 1NMFA 1PV4A 3CMAA
chains in the Genus database with same CATH superfamily
3NWTA 3QOJA 1WCMB 2VQFL 4HN7A 1N9WA 5C4XH 4HJ7A 1WTOA 3S1MB 4DR4Q 2K7VA 1C48A 1PXUA 4IPCA 3UE0A 1XNQQ 2Q2IA 4A3DH 4A3JB 2F0MA 1STGA 3HKZE 2XSCA 1UUPA 1OO9B 2EQSA 3TRZA 1JE5A 2XRQD 3KOJA 1PFBA 4UDUC 4IQZA 5FJ8H 5IGFA 3LWEA 5EGTA 1EFWA 4DR3Q 2F0GA 1GUSA 1VDZA 4JI8Q 3GTMB 5LMUL 1SFOH 4EGVA 1WFQA 4B3SQ 2AQ1B 1VQCA 2BDOA 3V2TA 2QF7A 2E2JB 1VQLA 1VQFA 5M3MB 4RA8A 5LMNW 2EVBA 1QNUA 3K5OA 3ULJA 3U4VA 1RCVD 3TREA 2D0OA 5DEHA 5I9PA 4ZYSA 3S1RB 2F0HA 2EJFC 1PRTC 5F2DA 3PO3B 1MGSA 2ID0A 3NQIA 1QG7A 3W5OA 3OTOL 1YHQA 3QOLA 4ZAIA 3EBEA 1JJ2A 2JA7H 1XX8A 4OWTB 4CHTB 4TVAB 1O78A 1GOZA 4YHHQ 3Q23A 1CSPA 2D2CC 5GAHC 5C4XB 3J81E 4IUQA 4PZ8A 1D6EC 1TIID 1Z6HA 1KHIA 3S17H 4GKJL 4DV6L 2ICIA 3RD4A 5IYCH 1XTDA 4DPGA 4GOPB 1TY2A 2WKCA 4KHPL 1F9SA 5C3WA 4A3DB 5C0XJ 5J3BA 2X6LA 3DM1A 3NTHA 2NBFA 1G291 3L2PA 1IBLQ 1Y8OB 1AFPA 3NELA 1SMYD 4P75A 3PF5A 1DM0B 1WTXA 4DV5Q 5COYA 1HPCA 2F0WA 4QGUA 4KY5A 3I4MB 2F0DA 4A93G 3HOWG 3VYTA 1D7QA 1SFOB 2C5CA 1WTVA 3K8AA 2F0NA 1EQTA 3M4PA 2N88A 5BN3A 1YITA 2JN4A 1IHZA 1SNCA 4KKUA 3TP8A 1F77A 1A3VA 3PUVA 2PPBC 2R7ZB 2E74C 1B44D 3QB3A 1VQIA 2F4IA 1PVOA 5D3DA 2BDNA 3MXPA 3O13A 2Q2UA 5CV7A 4EVOA 1SNMA 4MTKA 3STBC 1B50A 4C3IH 2PMZE 2A74C 2K5VA 2WFWA 3FVQA 4FYDA 1P16A 2RQXA 4LFAQ 4JV5L 1X3PA 2JA7B 2P5ZX 1XNRL 3VR2A 5C3EB 4H7BA 1S4ZA 2K4KA 1I4HA 3KK7A 3M4OH 4L5QA 1MBYA 3NBHB 1S40A 2WINB 1XPRA 1ASYA 2Q2HA 1ET6A 3H3VC 1BVSA 4DV0Q 2MO1A 1PRTB 1SE3A 1W6KA 2AQ3B 4JOIC 1EFID 1TWFH 2KHSA 2XNAC 3E0JA 2B2YA 1HR0L 2N78A 5IIFA 1PYSB 4RHSA 5C44H 2A6HC 3HOVG 3MA2B 1N32Q 1A3TA 1CZWA 4I7ZC 2RA4A 4IALA 4JI0Q 2AMCB 1X3FA 1LYLA 1E2ZA 2RSNA 4A3GH 3N6RA 5IYDH 4KY7A 4WFN3 1BCPC 1VMCA 5DLQE 2KUMA 1KAWA 4FXGC 1JCKB 3X3NA 4AYBE 4C3IB 2KCCA 2O2LD 4NW2A 1CHPD 1LT4D 4R4QA 5ELEA 5G3LF 1J9OA 3NE5B 3DWPA 4FNFA 1SRUA 4IPDA 1FNWA 5C5LA 1KIXA 1PH6A 5FK9C 2JXMB 1FL0A 2RHSB 2DUDA 4B3RL 3CCMA 5JEAJ 3M4OB 1B70B 1KRTA 4BBSG 4Y52H 3CCSA 3PO2B 1ZXTA 3PIO3 3UDXA 5E1FA 4Q5VA 5J1ZA 4CDDC 3BDLA 4X3UA 3HG9A 5JJLA 1HA6A 3QJYA 1JC7A 4K5VA 1VQBA 3M85A 1UEBA 4EQPA 3HOUH 2HCCA 3SK8A 1U4LA 1S5ED 5EBDA 1N33Q 2WB1B 4N8FA 1TWFB 3A0JA 4RKLA 1SE4A 4JK1C 3I72A 5KYLA 1HUMA 2KCNA 2A68C 4LFCQ 5C44B 1CKOA 2RKSA 3K81C 2K75A 4CGYB 3A8IE 5IYBH 1HA5A 5CMDA 1HQRD 4H44C 2K32A 5AJ3Q 3J7YW 4FF4A 1JJGA 4ID6A 4JBJA 1AZPA 4DK3C 4O0AA 2L15A 1Y69U 1PZJD 4ODGA 4DR7L 2CFMA 2MP1A 4IJLA 3F8TA 2MQHA 4A3GB 3KLWA 2NYZD 2VS1A 3VR5A 1FNUA 3MXGA 1STAA 1PFNA 2OXPA 2D62A 2GVBA 4LF4Q 1BNZA 1FD7D 1SNOA 1DOMA 2EXDA 2KCMA 5C0XG 3IAYA 4FO2A 4XXEA 2EE1A 2FMCA 3PUXA 1LTBD 1U4PA 1QVCA 4QCLA 3K0YA 4A3MH 4JW0A 4JI6Q 1IBMQ 4GOPA 1K28A 2I5MX 4IPGA 3CCRA 1RODA 2K03A 3PUZA 3URYA 1O7IA 2ZXRA 4OO1G 2UXBL 3NP8A 3IRBA 1VQPA 4A3CH 4LF8Q 3S9WA 4YY3Q 3D6CA 3NTKA 1CA5A 3T1HQ 1B4OA 4ULLA 3NWSA 3OW7A 1IL2A 5FLXc 2B63H 4DF7A 2B2UA 4V190 4X6AH 3HOUB 1BCPB 4IUUA 1JB3A 3W1GA 1PMRA 4ZUIA 3I70A 5FO7B 2R3ZA 1A63A 1LACA 2EYHA 5KNCA 1DYQA 1VQKA 3DWQA 2JA5H 2CH4W 4NP5A 1AE3A 1HNZQ 4QF4A 4N8X1 3I8ZA 2UUCL 2UUBL 1EQRA 2ENBA 3CC7A 3Q8DA 3G48A 4X65Q 2F03A 1QILA 4XIGS 3DWAA 4ZCKA 2VZAA 4MHEA 2KBNA 4JI5L 1C0AA 1AE2A 2L1BA 4QIWE 1IYUA 4P74A 5C3XA 1D5XC 1M8AA 5M9OA 3NBHA 5GROA 1STBA 3L9AX 4O2DA 1F2MA 2CWPA 4XTCS 4A3MB 4PZ6A 2CCZA 3HOZG 2ALYB 3OMGA 4A3IH 1N36Q 4MIUA 1R9TH 1JQYD 1DGSA 2OQ0A 4Q0FA 3S16H 2AWOA 2CVRA 1JJCB 4G57A 3UDFA 3RZDH 4OIKA 2B2WA 4OXPA 1ZEQX 4KTAA 2B63B 1LTSD 1EWHA 4X66L 4DR5L 2VNUD 1ESFA 5A35A 3GTJH 1SAPA 4ME3A 2PQAB 3S24A 2K5DA 2F0PA 2K6AA 4HJ9A 4UP9A 2PZTA 3H0GG 3BDCA 2EYFA 3AU7A 2DY7A 2JA5B 2Z6KC 2EJGC 3JAML 1KABA 2FXQA 1SXTA 4GLAC 5CV4A 2QA4A 2VQEL 1SSOA 2EOTA 3HGBA 3S1NH 5JEAG 2N8NA 1RD9D 1D5MC 1YNJD 3OTOQ 1N34L 1AW7A 4BY1H 1TWAH 3ND8A 1O7LA 3CPFA 2JEAI 4G7OC 3OSOA 4P2CB 3CC4A 3U58A 2F4VL 3NEMA 3TP6A 2R92H 5ELBA 3CCEA 3G71A 2EIFA 1XMOL 4IOAA 2MGSA 1A2TA 4RGOS 1KAAA 2ZT9C 4DV6Q 1QZHA 1QE6A 3SHLA 4A3IB 1R9TB 3I7FA 3IL8A 4KY6A 5IP7H 1XPOA 3S16B 4I65A 1NR2A 2NTSA 4B3TL 3M9BA 4QUFA 4IJHA 2I5LX 2FINB 4R9WA 2AUJD 3CKIB 3GTQB 1UE5A 2L55A 1PRTF 3GTJB 2IHFA 1YNXA 1B3AA 1U5KA 4M8AA 1L1OC 3EROA 1VQMA 2KEEA 3L0OA 1MI2A 2A69C 3EVQA 1JORA 3GTKB 2CQAA 2ICEC 2F0KA 4C3HH 3S1NB 1D1KA 2I0QA 4S3SA 4RWSC 4BY1B 4DR1L 1SE8A 1TWAB 5JVH3 1EQQA 1CTMA 4JOIA 1EWCA 1YZ6A 2WAQB 2RDGA 1HNWL 4F8MA 4DV1L 3P7JA 2BH8A 2VXWA 3W2DA 1XNRQ 2R92B 3P75A 1NUCA 1PTOD 3HOYH 3KLSX 4LFBL 2O4XA 3RUZA 3KYHC 2L4NA 4CKEA 5D3IB 2ZM6L 3H15A 2L5TA 3J81j 2J4XA 1EZ6A 1PH3A 5GADC 1XJVA 4LF5L 1TWHH 4K5WA 2EY2A 5CC4A 2UUAQ 1NNXA 4A3FB 1TY0A 4L5TA 5FKAC 5LMNL 5IGGA 4G4KA 4PV1C 4ZKBB 3KDFB 3L3OC 2E2IH 2EJMA 2XTIA 2CHBD 3D31A 4PNYA 2IX3A 1DOLA 1V8QA 5FLMG 3K5MA 1BKBA 1EY6A 4A4IA 4R4IA 3PIP3 4POFA 1V1PB 1G91A 4OGQC 3F1ZA 3OOCA 1QVFA 3S1MH 5IOCA 1S5DD 1EQVA 3GTOH 4OX9L 1PH9A 4K6DA 2YTYA 4PMWA 1GJXA 3D4WA 4NXML 2VL6A 1A62A 4ILWA 2E76C 2LXKA 1EZ8A 4GN5A 3IKJA 3PSIA 3ICEA 4N9PA 3GTMH 3GO5A 4QQBX 2JSOA 2SDFA 4Z9CB 5CV6A 1VQ7A 4UY8C 3C46A 1I4QA 3HOXG 4A3EH 1BBWA 3D3RA 1F2LA 3HOYB 3G7LA 4EQNA 1CT1D 3GTGH 5ELFA 1HJPA 4H13C 1L1OB 1H9KA 4B3RQ 4A3LH 2LS01 1YVCA 1LV9A 2CH4A 5M3FG 4HIMA 2KCTA 3PO3H 1JOKA 3MAQA 3CC2A 2NVQH 4KJNA 3LX0A 4OL7A 3PIOA 3MVVA 1I4RA 2Z6BA 3CHBD 4PMBA 1SDFA 1WCMG 2NB0A 3M7GA 2PQAA 4CKCA 1D8LA 4DK0A 4DAVA 1Y1WG 3TN2A 3I4NB 2E2IB 3UI2A 1PA6A 1L0YB 1C7YA 1CK1A 1Q8IA 1RF2D 1EU4A 1H9SB 2NZ1D 3I2ZA 2N3SA 1ICFB 5CBAE 2KECA 1YEZA 4A3JG 5C4HA 1K73C 2X6GA 1ENCA 1BCPF 2NZHA 2ZTCA 1R4PB 3GTLH 1SEBD 3ITPA 3GTOB 1Y8PB 2QCPX 3HRZC 4AYBG 5CBEE 1SMYC 4DR6Q 3K6OA 3T56B 2HDLA 1LT3D 2G9DA 1UE1A 3BYTB 1O7YA 1LTLA 3HFZB 4LK1C 1J5EQ 3SE0A 2CKZB 5M3MG 1CHQD 2FMMA 4CDCC 5HY6A 5KRUA 3I4MH 1SJHD 1CQFA 1HZCA 2O5IC 1VQ8A 3GDEA 3RR5A 1PFMA 4DR2Q 4DXFA 1EYGA 1KDCA 4A3EB 4XDXA 1JE4A 1BBUA 2R7ZH 1EOTA 3ER0A 3GTGB 4X64L 2YYZA 1TS2A 4ZQ3A 2OTLA 1K83H 4DU9A 3HKSA 3OW2A 2NVQB 3BU2A 3TDQA 3KF8B 1CKMA 3A7AB 2B2WC 3VA7A 1SYBA 3G6EA 2F52A 1IW7D 1T5XD 4MTNA 4JI1L 1I94Q 4LJZC 1YNNC 4TRDA 3Q24A 1J6QA 4B08A 3K57A 1WTQA 4CJ1B 5C3EH 1H9MA 1Z7TA 4C1NI 4DN4M 3GTPH 3OIQA 1G6ZA 4LAAA 3PUWA 4ZK9B 3GTLB 3RMHA 1BR9A 1QZGA 3DMUA 2MJ8A 5FJ8G 2XVSA 3FDTA 1WD0A 1I6VC 1UE6A 3NTIA 2R61A 1O80A 4DV3L 4CDFC 2EYPA 1GD7A 2JYOA 4C3JH 2K52A 1I5FA 1FNVA 5JJKA 3BS1A 2Q8TA 3K5NA 3BZDB 2OTJA 1HFNA 1GUGA 2G5DA 1ZKOA 5ELOA 1SE2A 4TKOB 1U4RA 1LTGD 2Z6KA 2MPMA 4BBRH 3J80L 1VQ5A 2I07B 2PO4A 4RCNA 4IUTA 2A1AA 3JAMc 1K83B 3PMFA 5EQ0A 1SJED 2MNAA 3KDFA 2EYLA 2IX1A 2L11A 3QO2A 2JA7G 1RDPD 5IP9H 3V05A 5C4ZA 1AEXA 4DR5Q 3C2PA 4LUOA 4ALPA 5H1SE 1SNQA 1LTAD 1PDQA 2A6ED 3W1BA 4X62L 4G7ZC 4L5RC 1V1PA 4K0KL 1FJGL 1SYCA 1HZAA 2HIXA 4E6IA 3GD7A 4R8NA 4A93B 5EPKA 1IKLA 1PFSA 3JAME 4GLXA 1X56A 4BY7G 1EIFA 1XMQQ 2K28A 2NVXH 3K58A 2ZJPA 1CUKA 4IN3A 3GTPB 5IWAL 3E0EA 4DNIA 3VR4A 4LUZA 3PO2H 3TS2A 1UAPA 1X3EA 2SNSA 2QDBA 3F2UA 2UXCQ 1Q90A 3V96A 5IT9L 3RZOB 1UWVA 5EJWA 4AQYL 3M3YB 4POGA 1K8OA 3A5UA 2VUMH 1VQEA 5JPMC 4DAMA 4Y7NH 4YIJA 3R2IA 5IGCA 5JAVA 2C9OA 1GHJA 4H0LC 1L1OA 4C3JB 4LF6Q 3H3VI 4B9XA 1HNXL 1XMOQ 1HTLD 5JOBA 2E5LQ 4BBRB 2LMCB 1K0RA 4WJ3M 4WRDA 4HIOA 4C3IG 2DN8A 3RN5A 4FVMA 4OIJA 1EU3A 3A54A 1EY4A 3F2BA 4DV4Q 4B3TQ 3H3VH 1E1OA 3BZKA 1H9SA 3I55A 3T1YQ 4LF7L 3KBGA 1PH1A 1KLUD 3C1EA 1BDOA 4RHRA 5K36H 5C4JH 4LF9L 3KLSA 2B2VC 4DUZQ 2JE6I 2PI2A 4JBMA 4DAPA 1Q81C 2TSSA 1WVLA 4C56C 2NVXB 1W3SA 1HTPA 3SXHA 3ERQA 4IFDI 1STNA 3NBIA 1SLJA 3LWUA 2D5DA 2L9HA 1PH7A 1Y1VH 2YV5A 2KQ3A 3MFGA 3FRPB 2UU9L 5C44G 3A8JE 1YBYA 2I5HA 5C6AA 3LNNA 4ZLTF 2VUMB 2FFKB 4IFDH 2F0EA 4Y7NB 4OO1I 4EQOA 2PZUA 4DV1Q 1TVXA 1II3A 3WWVA 4IO9A 4QJFA 1Q1EA 4KD4A 3CCVA 4K8IA 1MKHA 1NR4A 1T9HA 1VS0A 1LABA 1T5EA 4P73A 3AFQA 1BOSA 3E9HA 4MZ9A 5IYDG 1E0BA 4FF2A 1CM9A 4A3GG 1KC8C 2YU9B 3A55A 4ZRZA 3KF8A 3N52A 4BBSB 4TQUS 5DNFA 4K5XA 3FMCA 1EEFD 4OO1H 4LF5Q 1BXTA 1C4QA 3HP3A 2A73B 5JJIA 4U68A 5LMNQ 2F1MA 1WYDA 1M90C 2K5HA 4JCVE 4JI7L 2SEBD 3OWFA 3U4ZA 1TWGH 4L5SA 2B8FA 1VQ6A 4DA2A 2XWJB 4QY7A 5C4JB 2HCIA 4HAEA 2A6HD 1XNQL 3K7AH 4WJ4A 1BF4A 4UPAA 4DV7Q 3MC0B 5JVG3 2F0IA 4GKKQ 3PIPA 2GA4B 4IZ8A 4L63B 2DJGC 4OX9Q 3RLOA 2XWBB 3W3AA 5EKIA 3HOUG 2Y0SG 4KN7C 5FO8B 4NXMQ 3J7AV 3BDOA 2RCNA 1GM5A 4DR3L 1HXYD 3DXJC 3RN2A 1Y1VB 4A3BH 2CW0C 2H1EA 1PZKD 3PCOB 3P1HA 2YTVA 1V43A 2E2HH 4EQ5A 4DAYB 1NMFA 4CDEC 1PV4A 1UEAB 3CMAA 1WTRA 4NDXA 5IYBG 4A3KH 2ZTDA 4DNTB 3RLNA 5HGQA 2F3IA 4LUVA 4HJ8A 1V9PA 4KV6A 3KJPA 2AKWB 5J39A 4JI4Q 5FLXE 4IOCA 5CYUA 3Q6SA 4R8IA 4GZYC 2K5NA 4DGZA 4JVZA 1UE7A 1N8RC 2EYMA 5E7NA 1TWCB 5I6YA 4HCEA 3TZDA 2BH2A 4P72A 2HQEA 5HURA 4A3MG 3NSWA 1X65A 1TWGB 2R6GA 3GP7A 1VQGA 2F0FA 3QG1A 1D5ZC 1Y14B 1GUNA 2Q8IB 3TSSA 1ZYRC 2NVYH 3J81L 2VQFQ 3K7AB 1YHAA 1Q3LA 2F0LA 3I4LA 1FGUA 3D8GA 1RL2A 2IX0A 4OWWB 4DK1A 5CV5A 3K80C 2F0UA 5ISRA 2B63G 1JWUD 2NN6I 2R93H 1EWIA 2KA7A 4JYAL 1KNEA 4A3BB 2IPKD 1P8LA 2CQOA 1YJ9A 2E2HB 3QIAA 5DAUA 3FPPA 2JA5G 3GTQH 3BJUA 3CPWA 3PUYA 5BN5A 5EKKA 4A3KB 5LMUQ 1PLFA 4R1JA 2MO0A 2NN6H 1E2WA 1K9MC 4V0BA 5ELNA 5E3FA 1H9JA 2OWOA 3GTKH 1VQ9A 4BXXG 2JA6H 4HSPA 1EY7A 2PQEA 1K8MA 2RF4A 4LFAL 1LTID 3H09A 2RHQB 1NE3A 3EFXD 5GAGC 3P20A 1I6HH 2WB1E 2PNHA 5BR8L 2F3WA 2Z9HA 2L12A 2HD3A 3MEFA 5M5YB 5C5MA 4A3IG 1FVIA 4J15A 1WI5A 4DNRB 5DM63 1XPUA 3EQLC 2NVYB 1KLGD 1KL9A 4DV2L 3H0GB 5I2YA 1TS5A 1SN8A 2BE5D 4GKJQ 2F0TA 1MSGA 3CU7A 3SGIA 3ZJYC 1NBWA 2IWHA 3X3MA 3J80c 1LLRD 1W6JA 2B3GA 5FOBB 1OXVA 4KHPQ 2CWAA 1YI2A 4HSVA 4A3FH 2NUCA 2R93B 1BBXC 1Q7YC 1WTHA 1EY9A 4DV3Q 1N32L 2JJQA 1I3QH 2A5HA 1TR5A 2DJFC 1VMPA 4JI0L 5E4XA 3S15B 4IUNA 3JAMi 2NZOA 2N49A 2Z4IA 4PG3A 4KD3A 1ICWA 4BY1G 3HKZB 2JA6B 3R2TA 3B6YA 3CD6A 2HHHL 4HTHA 3BVGA 1F9PA 3DLLA 2WAQG 2H4OA 4PQXA 3CCUA 1XWEA 2R92G 4G7HC 4FP5D 2Y0SE 5M5XB 5IT9c 1I6HB 4KN4C 1XTCD 1OXUA 1E2VA 4BWGB 5A2QL 1VF7A 1NJIC 4B3ML 3BVMA 2KOLA 4JV5Q 2RCFA 4DK6C 1WTWA 2JA8H 4O42A 3A8KE 5IP7G 4OONA 4YWMA 2SNMA 1Q8KA 1JOOA 1ESRA 4U673 2IW3A 3L7ZC 1G2SA 1PH4A 5G3LD 5IT9E 2ZXOA 2HUGA 1DXMA 1Q86C 4QUCA 1HRJA 4RGTA 4KMUC 1GKHA 4DAYA 4R4CA 1OXXK 4QL5A 4CJ2C 3LGJA 2ASBA 1EY5A 4HCSA 1E3PA 1KDBA 1PYBA 4DUYL 1S5CD 1SMXA 2B29A 3I4NH 4PZ7A 1K8AC 4LFCL 1H9RA 1I3QB 5GAEC 1PH8A 3CF5A 1HR0Q 1EYCA 2B2VA 1G51A 1PTOB 1IXRA 1YHBA 2C35B 2HT1A 2F0OA 2YTXA 2K01A 2B39A 4C3HG 1U9RA 3CCQA 1ENFA 1Z47A 4EX5A 5M3FH 2F0SA 3A74A 1EUJA 3FKIH 1I4GA 2BOSA 1TS4A 4ZKCB 4LF4L 1F2ZA 3MFYA 4GLVB 3G6JB 2VB3X 1NMGA 3PF4A 4K2KA 1EY0A 1U4MA 4MN3A 3HOYG 4NMZA 2K04A 2RSOA 1OXSC 1SNDA 2EY5A 3WOEA 4JI6L 1IBML 4K14A 2QW7A 3A5ZB 4QB4A 1EYAA 2JA8B 3T16A 2EY6A 4FXKC 4HIDA 1WOCA 2A69D 1LT5D 3CRKC 4LF8L 3E3XA 3D4RA 4YY3L 1STEA 1X3GA 1QB5D 3BYYB 3J7A5 1ENAA 2KENA 2DGYA 4RG1A 1BUVT 1IW7C 2PMZB 4KHZA 4JG2A 1A15A 3S2HH 3CCJA 2AHOB 2ZXPA 4GNXC 3NXWA 2R7FA 1HQMC 3EN2A 3TBIB 2J0TD 3H94A 5L37A 3NPPA 4TSSA 4JI2L 3AMUA 2JA9A 5EBCA 5J22A 4C2MB 4ZUJA 4GN4B 2KEDA 2KVMA 5M3FB 1MD2D 2K1BA 1U0LA 3FKIB 4WORA 1GO3E 1ONLA 3ULPA 3HZXA 4DR7Q 2WACA 1Q12A 3VR6A 1IBKL 2EYJA 4A3EG 1QUQB 2R7DA 2LXJA 1Y1WB 4JI7Q 1QNKA 4F88A 2M2LA 4A3LG 3PO3G 1N36L 2FHTA 1Y8NB 4J6HA 2OQKA 1M1KC 4RGMA 3TQYA 5KYIA 2ZTEA 3SK5A 1HZ9A 1JT8A 1LUZA 2GN5A 2F0VA 3FHWA 2UXBQ 4AYBB 2BCOA 1D2BA 2A6EC 3UDGA 4HMJA 1HFGA 2B2TC 2HDMA 1TT2A 3S2HB 3VR3A 2WAQE 5C4XG 3S1QH 1JWSD 1WTPA 3IFDA 1GXDC 1JB7A 4A93H 3HOWH 1GHKA 3OMCA 4H02A 4A3DG 1A8VA 3ULLA 1EYDA 4X3TA 4I7AA 3J81c 2IL8A 2RDHA 1TKWB 4RAUC 3BG3A 1F2YA 2UUBQ 2UUCQ 2E75C 1NY4A 2TMPA 1K3RA 3CQZH 1EL0A 2EPBA 1AZQA 3VYUA 3I4MG 3RZOH 1V1OA 5LHY1 3MXNB 5T1IA 3M3YH 3RLFA 1DOKA 5I6WA 1KQSA 3EA6A 2OEOA 4JI5Q 4XQQA 4GNXB 4XYOA 2R7ZG 5KEEA 4KHVA 5DM73 3TMEA 4BY7H 4KJOA 3SR1A 1DD2A 3TZUA 2UXDL 3WOFA 3UE1A 4IFDJ 4NXNL 4JI3L 4YWKA 1EIYB 2L0CA 4L6TB 1S72A 5IGBA 4OELB 3D4DA 4A75A 5CORA 1Q46A 5CR3A 4JYAQ 5C3EG 3BZCA 1IZ6A 2PW5A 4JBKA 2LKVA 4M1UB 4FXDA 4X66Q 3KF6B 3S1QB 4KI0A 1S5FD 2NTTA 1JOQA 3NENA 1B7YB 4BS9A 3SEBA 4L8JA 2EXZA 1RHPA 3HOWB 5IYCG 1CKNB 3HOVH 1L0XB 3ND9A 4CBVA 1NCVA 4JPBW 2VW9A 2RDFA 3FPUB 1PRTD 3I56A 2VQEQ 3CRLC 3CQZB 4BA2I 4QMGA 1G6PA 2V4DA 1A2UA 1JWMD 1S3OA 1N34Q 4C3JG 1KDAA 4LWCA 3GQBA 4PMCA 1YNND 5BR8Q 5KNDA 2EZVA 4BBRG 2F4VQ 4P71A 1VQHA 3S17B 4A76A 1KXLA 3F2DA 4HJ5A 4BY7B 3J80i 4DV2Q 2PI2E 1X6OA 2M00A 2UUAL 2I46A 3R93A 2EDGA 5ELCA 2YU9H 2KHJA 4K2LA 2LY7A 5IP9G 1PHJA 4HJAA 2IHEA 4BBSH 4NPSA 3OYYA 5TSSA 5T1GA 2HIVA 1B53A 5JPNC 2O5JC 4AIMA 3VDYA 4QIWB 1AP0A 2EY1A 1JR0D 2JP1A 1K0SA 4B9WA 4YCUA 1X55A 2E2DC 4KKTA 1HZBA 3AYHB 1RKNA 4C1NK 4YCWA 2QEXA 3EIVA 2MFIA 1K3BC 4IURA 3I4OA 4OWXB 3U50C 3I3CA 3PO2G 5IGDA 3H6MA 3GV3A 1MJEA 3K59A 3HOVB 1KRSA 3KLRA 5D14A 5C0XI 4ME5A 1PTOF 1TU2B 3SK6A 5BN4A 1NAPA 1ML0D 2J7ZA 2HHHQ 2DNEA 2VUMG 2WB1G 5E4WC 1QUQA 3TP7A 1YIJA 1TQOA 2XGTA 5A2QE 3STBD 4DR1Q 4BA1I 3T13A 1C9OA 1B2TA 5C0XH 4B3MQ 1E7ZA 1HNWQ 2H5XA 4CKBA 1AN8A 1I4PA 1GUTA 3GV6A 5LL6X 1GUOA 2Z1CA 2KJXA 4LFBQ 1FYCA 1PH2A 3FEWX 3OHXC 3EJIA 3NUCA 2LSSA 2ZM6Q 4FDBA 3MTSA 4XQNA 1SYFA 4YWLA 1RTNA 2K50A 2IT1A 4HMIA 2GVAA 3F2CA 1OXTA 5K36G 1TWCH 3ZYYX 1DONA 4DUYQ 2RBMA 1ILPA 1X9NA 2WIIB 1RTOA 3I73A 3PV0A 1JMCA 3S14H 1MIUA 4DR4L 4LW1A 1L2FA 3C3LA 2ZJRA 1KNAA 1X54A 1Y1VG 4DR6L 3D6WA 3E6ZX 1VF5C 3T51B 3Q0AA 4O1NA 2F3VA 1CQVA 1SYDA 1J5EL 2K14A 1VQ4A 3MXNA 5CV8A 4RFBA 1LO5D 4IFDG 4RMFA 4JI8L 1MJCA 4UP7A 1IL8A 1BCPD 4KKSA 2IY5B 4GNXA 4B3SL 1F9QA 4DR2L 2K33A 2E8GA 2PW7A 4HIKA 3CW2C 1PYWD 1VQAA 4X3SA 1VQNA 4IPHA 1HR0W 3C1FA 1QJOA 4XT1B 3UDIA 4F7XA 2OT2A 3DM3A 3QR8A 4GS3A 3TEHB 1YNJC 3HOZH 2BA0A 1LTTD 2NVTH 1I94L 2DNCA 2Y0SB 2JK8A 1NTGA 3KF6A 2OF1A 3PQIA 5FO9B 4KK7A 3SK4A 3MEHA 4YHHL 1A6XA 5M5YH 1CKNA 3AEVA 4MNOA 2Q8RE 2Q2TA 1EIGA 2BE5C 3S14B 1GUWA 3AFPA 1XXGA 1BQQT 1L0WA 2A68D 5I2XA 3H0GH 4JI2Q 1QVGA 1S5BD 1V1QA 1VQJA 4YCVA 3HEJA 4A3CG 3JC66 1ASZA 1CA6A 4A3BG 3VYSA 3I90A 3HS0C 4BXXH 3KBXA 1IBLL 2JEBI 2AUKA 4NB3A 3R3OA 4DV5L 4A3KG 1CSQA 5JEAH 2SOBA 2FJ2A 2AQ2B 2B2TA 1IYVA 4F87A 1H95A 3AB9A 4KLKA 2QDLA 5I4DA 1IBKQ 1QWYA 2PZWA 1LM0A 1SR3A 2K05A 4OEMB 1SYGA 4RGNA 4FF1A 1B9NA 3OWEB 1X32A 5CV9A 5I9OA 3S15H 3CP0A 3QWNA 1KD1C 2JQOA 5IY0A 2HQLA 3MHBA 1W2BA 4IUPA 5GQOA 2VB2X 4J8QA 2Z4HA 3G4SA 1TXYA 4X64Q 3HOZB 4DXGA 2DY8A 4XQJA 4DFAA 4GN3B 3E9IA 2NVTB 1EY8A 2Z8LA 4LNQA 2CW0D 1BO0A 5M5XH 1XMQL 1ET9A 1PTOC 4JI1Q 3T4AC 2A8VA 3J81i 1STYA 1K8GA 3VYRA 2PCFB 2MUYA 2F0JA 5KGUA 3U9SA 2R93G 4DV0L 2UXCL 4JC0A 1D1IA 4RCOA 1WJJA 5IE8A 3MZ5A 1B9MA 1SROA 2WKDA 4RKBA 2AWNA 3SDZA 4RH6A 1QCBD 1G8ZD 2NN6G 4LF6L 1I50H 5EKLA 1E22A 1CFMA 3MWYW 1HH2P 2VY3A 1NSNS 1PTOH 3HKZG 2E5LL 2JA6G 1EOVA 1Q82C 2QKIC 1ZYRD 3J80E 2G9HD 1M4VA 5K5PA 1VQDA 3R8BA 1XYIA 3T53B 3VA5A 3J7ZC 1PH5A 2UXDQ 3KFUA 3CCLA 2F0QA 4DV4L 4NXNQ 3RZDB 1X3QA 4JI3Q 1EIHA 3T1YL 4HR7B 2ZJQA 4R4TA 4CJ0B 1E24A 3NHHA 1CI3M 4UP8A 4JBWA 2ES2A 2B2YC 4AH6A 4UHVA 4HEDA 4DUZL 1ILQA 1Q1BA 1HHVA 1GVPA 1F9RA 1DJRD 5D65A 2WV6D 1JICA 4X62Q 2IJ0A 4K0KQ 3K0XA 4IUVA 5M5WH 5FLMH 1FJGQ 2EYOA 1FR3A 1C8CA 1OTCA 3M4QA 3KUPA 5ELDA 2N55A 5AFWA 4A3FG 1VQOA 4OHJA 2PNRC 1CZGA 3NQTA 2XRSD 4K6LA 2PYKA 5IWAQ 3S2DH 1QOHA 1B1ZA 5HGTA 3CMEA 1R4QB 3A7LA 1N33L 1A0IA 3MXUA 3CAMA 2B8GA 3DHQA 1VCIA 1A3UA 2RVLA 4AQYQ 3OIPA 3CXCA 3IFTA 3PGZA 1I50B 1J8IA 1KTKA 2D0PA 1E1TA 2M9VA 3DUZA 4FF3A 4J1MA 1SNPA 4R4OA 4UAIA 3U9OA 5AJ3L 3K5LA 1IYJB 3AQQA 4K8JA 4LMQD 2QILA 3H91A 3HOXH 1HNXQ 1IKMA 1AH9A 3K7UC 4X3KA 1FGBD 2K5WA 3M7NA 4C2MH 1SYEA 3TS0A 4XT3B 3D0FA 3OPOA 3Q22A 1O7ZA 5IODA 5EPLA 2X69A 4ABNA 3TP5A 2A19A 1HUNA 2XIWA 5KNBA 1Z9FA 1WCMH 3ONAB 3WDNA 4APVA 1YJNA 2JA8G 5IGEA 1Y1WH 4DV7L 4LF7Q 1LTRD 1UNSA 4GKKL 1MSHA 1STHA 4DKAC 3DEPA 3BVZA 1B8AA 1LT6D 5M5WB 4LF9Q 3E5SA 1B3QA 2MHVA 3RNUA 4A3JH 3A56A 3FP9A 2OCEA 4C3HB 3SVMA 4N9TA 3T1HL 1YJWA 4WJWA 3S2DB 3I4NG 3M4YA 3J7AF 2BA1A 1RIPA 1DZ1A 2QGQA 1DCZA 2UU9Q 2D9UA 2E2JH 4NKLA 5JJZA 2WP8J 5M3MH 1SBBB 3I91A 5CGKA 4JI4L 1HNZL 2Z0SA 2ATWA 4GOPC 3ERSX 3S1RH 1EEID 2NWGA 3FKIG 1RJTA 5EAYA 5EPJA 5KIXA 2KHIA 4X65L 3HOXB 3NK9A 1TS3A 2QEJC 1WD1A 5FLXL 1TWHB 3KJOA 1G2TA 2LFNA 1HCZA 2K5QA 2V1CC 5LL6S 2B2UC 3DEOA 5NUCA 4XYQA 2XN9C 1I4XA 1MHWC 1PZID
chains in the Genus database with same CATH topology
1UE5A 4LWCA 2IHFA 5BR8Q 5IYBG 4A3KH 1YNXA 2VQFL 2ZTDA 1U5KA 1N9WA 5C4XH 1L1OC 4BBRG 3RLNA 5HGQA 2F3IA 1VQMA 2F4VQ 4LUVA 4P71A 1VQHA 4HJ7A 4A76A 4DR4Q 4HJ8A 3L0OA 3F2DA 1KXLA 1V9PA 3KJPA 4HJ5A 2AKWB 3J80i 4IPCA 3UE0A 4DV2Q 1XNQQ 4JI4Q 2PI2E 1X6OA 2UUAL 2Q2IA 2YU9H 4A3DH 4IOCA 2KHJA 5IP9G 3HKZE 2K5NA 4C3HH 1PHJA 4HJAA 2IHEA 4BBSH 4NPSA 2EQSA 3TRZA 1JE5A 3OYYA 1UE7A 2I0QA 2HIVA 3KOJA 1N8RC 4DR1L 1SE8A 5FJ8H 5E7NA 1EQQA 4AIMA 1EFWA 4JOIA 4DR3Q 3VDYA 4JI8Q 1YZ6A 5LMUL 2BH2A 4P72A 1SFOH 4YCUA 1X55A 1HNWL 4A3MG 4DV1L 1HZBA 1WFQA 3AYHB 4B3SQ 1X65A 2BH8A 4YCWA 2QEXA 1VQCA 2R6GA 3EIVA 1XNRQ 1VQGA 2MFIA 1Y14B 1VQLA 1VQFA 3I4OA 3HOYH 4OWXB 5LMNW 2NVYH 2VQFQ 3U50C 3ULJA 1YHAA 3PO2G 3U4VA 4LFBL 3TREA 2D0OA 3KYHC 1MJEA 1FGUA 1KRSA 1RL2A 2IX0A 2ZM6L 3H15A 4OWWB 2ID0A 3K80C 3J81j 2B63G 5C0XI 3W5OA 5GADC 1XJVA 1PH3A 4LF5L 1TWHH 3OTOL 1YHQA 2UUAQ 2NN6I 2HHHQ 2VUMG 2WB1G 2R93H 1EWIA 4L5TA 5LMNL 1QUQA 4JYAL 1YIJA 1P8LA 2XGTA 3KDFB 2E2IH 3EBEA 2CQOA 2XTIA 3STBD 4BA1I 4DR1Q 1YJ9A 3D31A 1JJ2A 2JA7H 5FLMG 4OWTB 2JA5G 3GTQH 4TVAB 3BJUA 4YHHQ 3CPWA 1C9OA 3PUYA 1CSPA 5LMUQ 1BKBA 4B3MQ 1E7ZA 5GAHC 4A4IA 4R4IA 4R1JA 2H5XA 1HNWQ 2MO0A 4POFA 4PZ8A 1K9MC 3S17H 1KHIA 4GKJL 3F1ZA 5ELNA 4DV6L 1QVFA 3S1MH 2OWOA 3GTOH 3GTKH 5IYCH 1VQ9A 4OX9L 1PH9A 4BXXG 1XTDA 4LFBQ 4DPGA 4GOPB 1PH2A 2JA6H 2YTYA 4PMWA 4KHPL 4NXML 2VL6A 2LSSA 1A62A 5C0XJ 5J3BA 4FDBA 2ZM6Q 2LXKA 1IBLQ 3L2PA 1G291 2RF4A 4GN5A 3NELA 4YWLA 4LFAL 2K50A 4P75A 2IT1A 3PF5A 4DV5Q 2GVAA 3PSIA 1OXTA 2RHQB 1NE3A 1TWCH 3F2CA 3ICEA 5GAGC 5K36G 4QGUA 4DUYQ 4A93G 1I6HH 2WB1E 2PNHA 5BR8L 3GTMH 3GO5A 1X9NA 3HOWG 1D7QA 4QQBX 3MEFA 3K8AA 1VQ7A 3M4PA 4UY8C 3PV0A 4A3IG 1YITA 1JMCA 1MIUA 3S14H 3HOXG 1FVIA 4A3EH 4DR4L 4J15A 1BBWA 4LW1A 1WI5A 1XPUA 1KL9A 3PUVA 4DV2L 1L2FA 3GTGH 1H95A 1HJPA 1L1OB 2ZJRA 4B3RQ 4A3LH 1SN8A 1VQIA 1YVCA 5M3FG 4HIMA 1X54A 1Y1VG 2KCTA 3PO3H 4DR6L 4GKJQ 1PVOA 3SGIA 3ZJYC 3CC2A 2NVQH 1NBWA 3J80c 3PIOA 1J5EL 2K14A 2B3GA 2Q2UA 1VQ4A 1OXVA 4KHPQ 3STBC 2CWAA 1WCMG 1YI2A 4C3IH 4A3FH 4RMFA 4IFDG 2PQAA 2PMZE 1Q7YC 4JI8L 1D8LA 1MJCA 4UP7A 1Y1WG 2K5VA 2WFWA 2IY5B 1P16A 4GNXA 4LFAQ 4B3SL 4DR2L 4DV3Q 1PA6A 4JV5L 1C7YA 1N32L 2JJQA 1I3QH 1XNRL 3I2ZA 2N3SA 2E8GA 4HIKA 3CW2C 2K4KA 1K73C 1YEZA 4A3JG 4JI0L 3M4OH 2NZHA 1VQAA 4L5QA 3JAMi 2ZTCA 2NZOA 4IPHA 1HR0W 1VQNA 2N49A 3GTLH 3NBHB 4PG3A 1XPRA 1S40A 1ASYA 4BY1G 2Q2HA 3UDIA 3DM3A 4GS3A 1BVSA 3B6YA 3TEHB 4AYBG 4DV0Q 2MO1A 3CD6A 2HHHL 3HOZH 2BA0A 3DLLA 2WAQG 4DR6Q 2NVTH 1UE1A 1I94L 1LTLA 2JK8A 3HFZB 3CCUA 1J5EQ 2CKZB 2R92G 4JOIC 1NTGA 3KF6A 1TWFH 5M3MG 2Y0SE 1HR0L 5IT9c 2N78A 4YHHL 5HY6A 3I4MH 1NJIC 1OXUA 1PYSB 4B3ML 5C44H 1HZCA 5M5YH 1VQ8A 1CKNA 3GDEA 3RR5A 3AEVA 3HOVG 4DR2Q 4JV5Q 4MNOA 1EYGA 2Q2TA 1N32Q 4DK6C 3AFPA 2JA8H 1L0WA 1BBUA 2R7ZH 3ER0A 3H0GH 4JI2Q 4OONA 4YWMA 5IP7G 1V1QA 1QVGA 1Q8KA 4X64L 1VQJA 4YCVA 4JI0Q 4A3CG 2YYZA 3JC66 1ASZA 2AMCB 3L7ZC 2OTLA 4A3BG 1K83H 1X3FA 1PH4A 3HKSA 4BXXH 3OW2A 1LYLA 1Q86C 1IBLL 4A3GH 5IYDH 2JEBI 3BU2A 5DLQE 1GKHA 3KF8B 1KAWA 4NB3A 1CKMA 1OXXK 4QL5A 4R4CA 4DV5L 3LGJA 4AYBE 2ASBA 4A3KG 1CSQA 1E3PA 4DUYL 1PYBA 3G6EA 2F52A 1SMXA 4KLKA 4MTNA 4R4QA 4JI1L 2B29A 1I94Q 3I4NH 4PZ7A 1K8AC 4LFCL 1IBKQ 1J6QA 1SRUA 4IPDA 1LM0A 5GAEC 1KIXA 1PH8A 3CF5A 1SR3A 5C3EH 1HR0Q 1PH6A 1G51A 2C35B 1IXRA 1YHBA 2HT1A 2YTXA 1FL0A 2RHSB 2DUDA 4B3RL 3CCMA 5JEAJ 3GTPH 1B70B 1KRTA 3S15H 3CP0A 4BBSG 1KD1C 2JQOA 4Y52H 3PUWA 5IY0A 3CCSA 2HQLA 1W2BA 1QZGA 3CCQA 5GQOA 1Z47A 3UDXA 5FJ8G 4EX5A 3G4SA 5M3FH 1TXYA 1EUJA 3A74A 3FKIH 4X64Q 5JJLA 4LF4L 4GN3B 4GLVB 1VQBA 3E9IA 3M85A 1NMGA 1UEBA 1UE6A 3HOUH 4LNQA 3PF4A 1N33Q 4DV3L 3HOYG 3A0JA 1OXSC 5M5XH 1XMQL 1GD7A 4JI1Q 4JI6L 1IBML 4C3JH 2K52A 1I5FA 4LFCQ 1CKOA 2A8VA 5JJKA 2OTJA 3K81C 5ELOA 3J81i 3A5ZB 2K75A 1K8GA 5IYBH 2Z6KA 4HIDA 4BBRH 5AJ3Q 1JJGA 1WOCA 4LF8L 1VQ5A 4YY3L 4JBJA 4DK3C 4DV0L 4O0AA 2L15A 2UXCL 2R93G 1X3GA 2A1AA 4JC0A 3JAMc 3J7A5 2KENA 1WJJA 2DGYA 4RG1A 2CFMA 4IJLA 5IE8A 4DR7L 2MNAA 3F8TA 3KDFA 2MQHA 2JA7G 2IX1A 1SROA 3KLWA 4KHZA 2VS1A 2AWNA 4JG2A 5IP9H 2D62A 3S2HH 2GVBA 3CCJA 4LF4Q 2AHOB 5C0XG 2EXDA 2KCMA 4GNXC 4DR5Q 4LUOA 4ALPA 5H1SE 4X62L 4L5RC 2NN6G 3W1BA 1I50H 4LF6L 4K0KL 2R7FA 3PUXA 1E22A 1FJGL 3EN2A 2HIXA 1HZAA 3GD7A 1HH2P 1QVCA 1PFSA 4BY7G 4GLXA 1X56A 1EIFA 2VY3A 1XMQQ 3HKZG 4A3MH 2E5LL 2JA6G 4JI6Q 1EOVA 1Q82C 1IBMQ 2NVXH 4GOPA 4JI2L 2I5MX 4IPGA 2ZJPA 3CCRA 2JA9A 3PUZA 1CUKA 1O7IA 1VQDA 5IWAL 3E0EA 4DNIA 3J7ZC 1PH5A 3PO2H 4LUZA 3TS2A 4OO1G 3KFUA 3CCLA 4GN4B 2UXBL 3IRBA 1VQPA 2UXDQ 1X3EA 4DV4L 4NXNQ 4A3CH 4LF8Q 4JI3Q 1U0LA 4YY3Q 2UXCQ 3T1HQ 1GO3E 3T1YL 2ZJQA 1IL2A 4R4TA 1UWVA 5FLXc 3ULPA 2B63H 1E24A 4DR7Q 4UP8A 4AQYL 1Q12A 4X6AH 4POGA 4JBWA 2ES2A 3A5UA 1IBKL 3W1GA 4AH6A 2VUMH 1VQEA 4A3EG 4DAMA 4DUZL 1QUQB 2R7DA 4Y7NH 1Q1BA 2LXJA 1GVPA 4JI7Q 4A3LG 1L1OA 1A63A 4X62Q 4LF6Q 1VQKA 1N36L 3H3VI 3K0XA 5M5WH 5FLMH 2JA5H 1FJGQ 1HNXL 3PO3G 4K0KQ 1AE3A 1HNZQ 1OTCA 1XMOQ 2OQKA 2UUCL 2UUBL 1EQRA 1M1KC 3CC7A 3M4QA 2E5LQ 3TQYA 3Q8DA 1K0RA 4WJ3M 4HIOA 3G48A 4X65Q 4A3FG 1VQOA 2ZTEA 4XIGS 3RN5A 1HZ9A 3S2DH 5IWAQ 1JT8A 2GN5A 1LUZA 3FHWA 2UXBQ 3CMEA 2VZAA 3F2BA 4DV4Q 4B3TQ 3H3VH 1E1OA 3UDGA 1N33L 2KBNA 1A0IA 3BZKA 3I55A 3CAMA 4JI5L 3T1YQ 1C0AA 1AE2A 4LF7L 1VCIA 4QIWE 2WAQE 5C4XG 4AQYQ 3CXCA 1PH1A 3S1QH 3PGZA 4P74A 2D0PA 5C4JH 4LF9L 1E1TA 4DUZQ 1JB7A 2JE6I 4A93H 2PI2A 4JBMA 3HOWH 5GROA 4R4OA 1Q81C 4O2DA 4XTCS 2CWPA 4PZ6A 5AJ3L 2CCZA 1IYJB 3AQQA 3HOZG 1W3SA 2ALYB 4H02A 4A3IH 1N36Q 1A8VA 3ULLA 1R9TH 3HOXH 4A3DG 1HNXQ 4IFDI 1AH9A 3K7UC 3J81c 1DGSA 2OQ0A 3M7NA 4C2MH 2UUCQ 2UUBQ 3TS0A 3S16H 2AWOA 1SLJA 1NY4A 3D0FA 1JJCB 1K3RA 3CQZH 1PH7A 3UDFA 3RZDH 1Y1VH 2YV5A 4OXPA 3I4MG 3RZOH 2A19A 2UU9L 3MXNB 4X66L 5C44G 4DR5L 3M3YH 2VNUD 3RLFA 1YBYA 2I5HA 1Z9FA 3GTJH 1WCMH 4ME3A 2PQAB 1YJNA 4APVA 3S24A 1KQSA 2JA8G 4JI5Q 4OO1I 1Y1WH 4DV1Q 4DV7L 4UP9A 4HJ9A 4LF7Q 4GKKL 4GNXB 2R7ZG 3H0GG 3WWVA 4DKAC 4IO9A 1B8AA 4QJFA 1Q1EA 3CCVA 1MKHA 2Z6KC 1T9HA 1VS0A 4LF9Q 4BY7H 4P73A 3AFQA 3RNUA 3E9HA 2FXQA 4MZ9A 5IYDG 4A3GG 4GLAC 2QA4A 1KC8C 2UXDL 4A3JH 3UE1A 2VQEL 4IFDJ 4NXNL 3FP9A 2OCEA 4JI3L 4YWKA 4TQUS 3S1NH 5JEAG 2N8NA 1EIYB 3T1HL 4LF5Q 1YJWA 3OTOQ 1S72A 1N34L 4BY1H 3I4NG 1TWAH 5JJIA 3CPFA 2BA1A 1RIPA 2JEAI 4A75A 1Q46A 5LMNQ 4JYAQ 5C3EG 3BZCA 1IZ6A 1WYDA 1M90C 2K5HA 2QGQA 4JCVE 4JBKA 4JI7L 3CC4A 3U58A 2F4VL 3NEMA 3U4ZA 1TWGH 2UU9Q 4L5SA 4X66Q 3KF6B 1VQ6A 2R92H 2E2JH 4KI0A 3CCEA 3G71A 2WP8J 4QY7A 5M3MH 3NENA 1B7YB 1XNQL 2EIFA 3K7AH 4JI4L 4WJ4A 1HNZL 2Z0SA 4UPAA 4GOPC 4DV7Q 3ERSX 5IYCG 3S1RH 1CKNB 1XMOL 4GKKQ 4IOAA 3PIPA 3HOVH 3FKIG 1QZHA 5EAYA 4DV6Q 2KHIA 4X65L 4OX9Q 3RLOA 2VW9A 3I7FA 2ATWA 3HOUG 3KJOA 2Y0SG 3I56A 5IP7H 4NXMQ 1XPOA 2RCNA 1GM5A 2VQEQ 4DR3L 4B3TL 3RN2A 4BA2I 2V1CC 3M9BA 4A3BH 1G6PA 4IJHA 2I5LX 1S3OA 3PCOB 2YTVA 1N34Q 1V43A 2E2HH 4EQ5A 4DAYB 1NMFA 1PV4A 3CMAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UE5 A;  4LWC A;  2IHF A;  5BR8 Q;  5IYB G;  4A3K H;  1YNX A;  2VQF L;  2ZTD A;  1U5K A;  1N9W A;  5C4X H;  1L1O C;  4BBR G;  3RLN A;  5HGQ A;  2F3I A;  1VQM A;  2F4V Q;  4LUV A;  4P71 A;  1VQH A;  4HJ7 A;  4A76 A;  4DR4 Q;  4HJ8 A;  3L0O A;  3F2D A;  1KXL A;  1V9P A;  3KJP A;  4HJ5 A;  2AKW B;  3J80 i;  4IPC A;  3UE0 A;  4DV2 Q;  1XNQ Q;  4JI4 Q;  2PI2 E;  1X6O A;  2UUA L;  2Q2I A;  2YU9 H;  4A3D H;  4IOC A;  2KHJ A;  5IP9 G;  3HKZ E;  2K5N A;  4C3H H;  1PHJ A;  4HJA A;  2IHE A;  4BBS H;  4NPS A;  2EQS A;  3TRZ A;  1JE5 A;  3OYY A;  1UE7 A;  2I0Q A;  2HIV A;  3KOJ A;  1N8R C;  4DR1 L;  1SE8 A;  5FJ8 H;  5E7N A;  1EQQ A;  4AIM A;  1EFW A;  4JOI A;  4DR3 Q;  3VDY A;  4JI8 Q;  1YZ6 A;  5LMU L;  2BH2 A;  4P72 A;  1SFO H;  4YCU A;  1X55 A;  1HNW L;  4A3M G;  4DV1 L;  1HZB A;  1WFQ A;  3AYH B;  4B3S Q;  1X65 A;  2BH8 A;  4YCW A;  2QEX A;  1VQC A;  2R6G A;  3EIV A;  1XNR Q;  1VQG A;  2MFI A;  1Y14 B;  1VQL A;  1VQF A;  3I4O A;  3HOY H;  4OWX B;  5LMN W;  2NVY H;  2VQF Q;  3U50 C;  3ULJ A;  1YHA A;  3PO2 G;  3U4V A;  4LFB L;  3TRE A;  2D0O A;  3KYH C;  1MJE A;  1FGU A;  1KRS A;  1RL2 A;  2IX0 A;  2ZM6 L;  3H15 A;  4OWW B;  2ID0 A;  3K80 C;  3J81 j;  2B63 G;  5C0X I;  3W5O A;  5GAD C;  1XJV A;  1PH3 A;  4LF5 L;  1TWH H;  3OTO L;  1YHQ A;  2UUA Q;  2NN6 I;  2HHH Q;  2VUM G;  2WB1 G;  2R93 H;  1EWI A;  4L5T A;  5LMN L;  1QUQ A;  4JYA L;  1YIJ A;  1P8L A;  2XGT A;  3KDF B;  2E2I H;  3EBE A;  2CQO A;  2XTI A;  3STB D;  4BA1 I;  4DR1 Q;  1YJ9 A;  3D31 A;  1JJ2 A;  2JA7 H;  5FLM G;  4OWT B;  2JA5 G;  3GTQ H;  4TVA B;  3BJU A;  4YHH Q;  3CPW A;  1C9O A;  3PUY A;  1CSP A;  5LMU Q;  1BKB A;  4B3M Q;  1E7Z A;  5GAH C;  4A4I A;  4R4I A;  4R1J A;  2H5X A;  1HNW Q;  2MO0 A;  4POF A;  4PZ8 A;  1K9M C;  3S17 H;  1KHI A;  4GKJ L;  3F1Z A;  5ELN A;  4DV6 L;  1QVF A;  3S1M H;  2OWO A;  3GTO H;  3GTK H;  5IYC H;  1VQ9 A;  4OX9 L;  1PH9 A;  4BXX G;  1XTD A;  4LFB Q;  4DPG A;  4GOP B;  1PH2 A;  2JA6 H;  2YTY A;  4PMW A;  4KHP L;  4NXM L;  2VL6 A;  2LSS A;  1A62 A;  5C0X J;  5J3B A;  4FDB A;  2ZM6 Q;  2LXK A;  1IBL Q;  3L2P A;  1G29 1;  2RF4 A;  4GN5 A;  3NEL A;  4YWL A;  4LFA L;  2K50 A;  4P75 A;  2IT1 A;  3PF5 A;  4DV5 Q;  2GVA A;  3PSI A;  1OXT A;  2RHQ B;  1NE3 A;  1TWC H;  3F2C A;  3ICE A;  5GAG C;  5K36 G;  4QGU A;  4DUY Q;  4A93 G;  1I6H H;  2WB1 E;  2PNH A;  5BR8 L;  3GTM H;  3GO5 A;  1X9N A;  3HOW G;  1D7Q A;  4QQB X;  3MEF A;  3K8A A;  1VQ7 A;  3M4P A;  4UY8 C;  3PV0 A;  4A3I G;  1YIT A;  1JMC A;  1MIU A;  3S14 H;  3HOX G;  1FVI A;  4A3E H;  4DR4 L;  4J15 A;  1BBW A;  4LW1 A;  1WI5 A;  1XPU A;  1KL9 A;  3PUV A;  4DV2 L;  1L2F A;  3GTG H;  1H95 A;  1HJP A;  1L1O B;  2ZJR A;  4B3R Q;  4A3L H;  1SN8 A;  1VQI A;  1YVC A;  5M3F G;  4HIM A;  1X54 A;  1Y1V G;  2KCT A;  3PO3 H;  4DR6 L;  4GKJ Q;  1PVO A;  3SGI A;  3ZJY C;  3CC2 A;  2NVQ H;  1NBW A;  3J80 c;  3PIO A;  1J5E L;  2K14 A;  2B3G A;  2Q2U A;  1VQ4 A;  1OXV A;  4KHP Q;  3STB C;  2CWA A;  1WCM G;  1YI2 A;  4C3I H;  4A3F H;  4RMF A;  4IFD G;  2PQA A;  2PMZ E;  1Q7Y C;  4JI8 L;  1D8L A;  1MJC A;  4UP7 A;  1Y1W G;  2K5V A;  2WFW A;  2IY5 B;  1P16 A;  4GNX A;  4LFA Q;  4B3S L;  4DR2 L;  4DV3 Q;  1PA6 A;  4JV5 L;  1C7Y A;  1N32 L;  2JJQ A;  1I3Q H;  1XNR L;  3I2Z A;  2N3S A;  2E8G A;  4HIK A;  3CW2 C;  2K4K A;  1K73 C;  1YEZ A;  4A3J G;  4JI0 L;  3M4O H;  2NZH A;  1VQA A;  4L5Q A;  3JAM i;  2ZTC A;  2NZO A;  4IPH A;  1HR0 W;  1VQN A;  2N49 A;  3GTL H;  3NBH B;  4PG3 A;  1XPR A;  1S40 A;  1ASY A;  4BY1 G;  2Q2H A;  3UDI A;  3DM3 A;  4GS3 A;  1BVS A;  3B6Y A;  3TEH B;  4AYB G;  4DV0 Q;  2MO1 A;  3CD6 A;  2HHH L;  3HOZ H;  2BA0 A;  3DLL A;  2WAQ G;  4DR6 Q;  2NVT H;  1UE1 A;  1I94 L;  1LTL A;  2JK8 A;  3HFZ B;  3CCU A;  1J5E Q;  2CKZ B;  2R92 G;  4JOI C;  1NTG A;  3KF6 A;  1TWF H;  5M3M G;  2Y0S E;  1HR0 L;  5IT9 c;  2N78 A;  4YHH L;  5HY6 A;  3I4M H;  1NJI C;  1OXU A;  1PYS B;  4B3M L;  5C44 H;  1HZC A;  5M5Y H;  1VQ8 A;  1CKN A;  3GDE A;  3RR5 A;  3AEV A;  3HOV G;  4DR2 Q;  4JV5 Q;  4MNO A;  1EYG A;  2Q2T A;  1N32 Q;  4DK6 C;  3AFP A;  2JA8 H;  1L0W A;  1BBU A;  2R7Z H;  3ER0 A;  3H0G H;  4JI2 Q;  4OON A;  4YWM A;  5IP7 G;  1V1Q A;  1QVG A;  1Q8K A;  4X64 L;  1VQJ A;  4YCV A;  4JI0 Q;  4A3C G;  2YYZ A;  3JC6 6;  1ASZ A;  2AMC B;  3L7Z C;  2OTL A;  4A3B G;  1K83 H;  1X3F A;  1PH4 A;  3HKS A;  4BXX H;  3OW2 A;  1LYL A;  1Q86 C;  1IBL L;  4A3G H;  5IYD H;  2JEB I;  3BU2 A;  5DLQ E;  1GKH A;  3KF8 B;  1KAW A;  4NB3 A;  1CKM A;  1OXX K;  4QL5 A;  4R4C A;  4DV5 L;  3LGJ A;  4AYB E;  2ASB A;  4A3K G;  1CSQ A;  1E3P A;  4DUY L;  1PYB A;  3G6E A;  2F52 A;  1SMX A;  4KLK A;  4MTN A;  4R4Q A;  4JI1 L;  2B29 A;  1I94 Q;  3I4N H;  4PZ7 A;  1K8A C;  4LFC L;  1IBK Q;  1J6Q A;  1SRU A;  4IPD A;  1LM0 A;  5GAE C;  1KIX A;  1PH8 A;  3CF5 A;  1SR3 A;  5C3E H;  1HR0 Q;  1PH6 A;  1G51 A;  2C35 B;  1IXR A;  1YHB A;  2HT1 A;  2YTX A;  1FL0 A;  2RHS B;  2DUD A;  4B3R L;  3CCM A;  5JEA J;  3GTP H;  1B70 B;  1KRT A;  3S15 H;  3CP0 A;  4BBS G;  1KD1 C;  2JQO A;  4Y52 H;  3PUW A;  5IY0 A;  3CCS A;  2HQL A;  1W2B A;  1QZG A;  3CCQ A;  5GQO A;  1Z47 A;  3UDX A;  5FJ8 G;  4EX5 A;  3G4S A;  5M3F H;  1TXY A;  1EUJ A;  3A74 A;  3FKI H;  4X64 Q;  5JJL A;  4LF4 L;  4GN3 B;  4GLV B;  1VQB A;  3E9I A;  3M85 A;  1NMG A;  1UEB A;  1UE6 A;  3HOU H;  4LNQ A;  3PF4 A;  1N33 Q;  4DV3 L;  3HOY G;  3A0J A;  1OXS C;  5M5X H;  1XMQ L;  1GD7 A;  4JI1 Q;  4JI6 L;  1IBM L;  4C3J H;  2K52 A;  1I5F A;  4LFC Q;  1CKO A;  2A8V A;  5JJK A;  2OTJ A;  3K81 C;  5ELO A;  3J81 i;  3A5Z B;  2K75 A;  1K8G A;  5IYB H;  2Z6K A;  4HID A;  4BBR H;  5AJ3 Q;  1JJG A;  1WOC A;  4LF8 L;  1VQ5 A;  4YY3 L;  4JBJ A;  4DK3 C;  4DV0 L;  4O0A A;  2L15 A;  2UXC L;  2R93 G;  1X3G A;  2A1A A;  4JC0 A;  3JAM c;  3J7A 5;  2KEN A;  1WJJ A;  2DGY A;  4RG1 A;  2CFM A;  4IJL A;  5IE8 A;  4DR7 L;  2MNA A;  3F8T A;  3KDF A;  2MQH A;  2JA7 G;  2IX1 A;  1SRO A;  3KLW A;  4KHZ A;  2VS1 A;  2AWN A;  4JG2 A;  5IP9 H;  2D62 A;  3S2H H;  2GVB A;  3CCJ A;  4LF4 Q;  2AHO B;  5C0X G;  2EXD A;  2KCM A;  4GNX C;  4DR5 Q;  4LUO A;  4ALP A;  5H1S E;  4X62 L;  4L5R C;  2NN6 G;  3W1B A;  1I50 H;  4LF6 L;  4K0K L;  2R7F A;  3PUX A;  1E22 A;  1FJG L;  3EN2 A;  2HIX A;  1HZA A;  3GD7 A;  1HH2 P;  1QVC A;  1PFS A;  4BY7 G;  4GLX A;  1X56 A;  1EIF A;  2VY3 A;  1XMQ Q;  3HKZ G;  4A3M H;  2E5L L;  2JA6 G;  4JI6 Q;  1EOV A;  1Q82 C;  1IBM Q;  2NVX H;  4GOP A;  4JI2 L;  2I5M X;  4IPG A;  2ZJP A;  3CCR A;  2JA9 A;  3PUZ A;  1CUK A;  1O7I A;  1VQD A;  5IWA L;  3E0E A;  4DNI A;  3J7Z C;  1PH5 A;  3PO2 H;  4LUZ A;  3TS2 A;  4OO1 G;  3KFU A;  3CCL A;  4GN4 B;  2UXB L;  3IRB A;  1VQP A;  2UXD Q;  1X3E A;  4DV4 L;  4NXN Q;  4A3C H;  4LF8 Q;  4JI3 Q;  1U0L A;  4YY3 Q;  2UXC Q;  3T1H Q;  1GO3 E;  3T1Y L;  2ZJQ A;  1IL2 A;  4R4T A;  1UWV A;  5FLX c;  3ULP A;  2B63 H;  1E24 A;  4DR7 Q;  4UP8 A;  4AQY L;  1Q12 A;  4X6A H;  4POG A;  4JBW A;  2ES2 A;  3A5U A;  1IBK L;  3W1G A;  4AH6 A;  2VUM H;  1VQE A;  4A3E G;  4DAM A;  4DUZ L;  1QUQ B;  2R7D A;  4Y7N H;  1Q1B A;  2LXJ A;  1GVP A;  4JI7 Q;  4A3L G;  1L1O A;  1A63 A;  4X62 Q;  4LF6 Q;  1VQK A;  1N36 L;  3H3V I;  3K0X A;  5M5W H;  5FLM H;  2JA5 H;  1FJG Q;  1HNX L;  3PO3 G;  4K0K Q;  1AE3 A;  1HNZ Q;  1OTC A;  1XMO Q;  2OQK A;  2UUC L;  2UUB L;  1EQR A;  1M1K C;  3CC7 A;  3M4Q A;  2E5L Q;  3TQY A;  3Q8D A;  1K0R A;  4WJ3 M;  4HIO A;  3G48 A;  4X65 Q;  4A3F G;  1VQO A;  2ZTE A;  4XIG S;  3RN5 A;  1HZ9 A;  3S2D H;  5IWA Q;  1JT8 A;  2GN5 A;  1LUZ A;  3FHW A;  2UXB Q;  3CME A;  2VZA A;  3F2B A;  4DV4 Q;  4B3T Q;  3H3V H;  1E1O A;  3UDG A;  1N33 L;  2KBN A;  1A0I A;  3BZK A;  3I55 A;  3CAM A;  4JI5 L;  3T1Y Q;  1C0A A;  1AE2 A;  4LF7 L;  1VCI A;  4QIW E;  2WAQ E;  5C4X G;  4AQY Q;  3CXC A;  1PH1 A;  3S1Q H;  3PGZ A;  4P74 A;  2D0P A;  5C4J H;  4LF9 L;  1E1T A;  4DUZ Q;  1JB7 A;  2JE6 I;  4A93 H;  2PI2 A;  4JBM A;  3HOW H;  5GRO A;  4R4O A;  1Q81 C;  4O2D A;  4XTC S;  2CWP A;  4PZ6 A;  5AJ3 L;  2CCZ A;  1IYJ B;  3AQQ A;  3HOZ G;  1W3S A;  2ALY B;  4H02 A;  4A3I H;  1N36 Q;  1A8V A;  3ULL A;  1R9T H;  3HOX H;  4A3D G;  1HNX Q;  4IFD I;  1AH9 A;  3K7U C;  3J81 c;  1DGS A;  2OQ0 A;  3M7N A;  4C2M H;  2UUC Q;  2UUB Q;  3TS0 A;  3S16 H;  2AWO A;  1SLJ A;  1NY4 A;  3D0F A;  1JJC B;  1K3R A;  3CQZ H;  1PH7 A;  3UDF A;  3RZD H;  1Y1V H;  2YV5 A;  4OXP A;  3I4M G;  3RZO H;  2A19 A;  2UU9 L;  3MXN B;  4X66 L;  5C44 G;  4DR5 L;  3M3Y H;  2VNU D;  3RLF A;  1YBY A;  2I5H A;  1Z9F A;  3GTJ H;  1WCM H;  4ME3 A;  2PQA B;  1YJN A;  4APV A;  3S24 A;  1KQS A;  2JA8 G;  4JI5 Q;  4OO1 I;  1Y1W H;  4DV1 Q;  4DV7 L;  4UP9 A;  4HJ9 A;  4LF7 Q;  4GKK L;  4GNX B;  2R7Z G;  3H0G G;  3WWV A;  4DKA C;  4IO9 A;  1B8A A;  4QJF A;  1Q1E A;  3CCV A;  1MKH A;  2Z6K C;  1T9H A;  1VS0 A;  4LF9 Q;  4BY7 H;  4P73 A;  3AFQ A;  3RNU A;  3E9H A;  2FXQ A;  4MZ9 A;  5IYD G;  4A3G G;  4GLA C;  2QA4 A;  1KC8 C;  2UXD L;  4A3J H;  3UE1 A;  2VQE L;  4IFD J;  4NXN L;  3FP9 A;  2OCE A;  4JI3 L;  4YWK A;  4TQU S;  3S1N H;  5JEA G;  2N8N A;  1EIY B;  3T1H L;  4LF5 Q;  1YJW A;  3OTO Q;  1S72 A;  1N34 L;  4BY1 H;  3I4N G;  1TWA H;  5JJI A;  3CPF A;  2BA1 A;  1RIP A;  2JEA I;  4A75 A;  1Q46 A;  5LMN Q;  4JYA Q;  5C3E G;  3BZC A;  1IZ6 A;  1WYD A;  1M90 C;  2K5H A;  2QGQ A;  4JCV E;  4JBK A;  4JI7 L;  3CC4 A;  3U58 A;  2F4V L;  3NEM A;  3U4Z A;  1TWG H;  2UU9 Q;  4L5S A;  4X66 Q;  3KF6 B;  1VQ6 A;  2R92 H;  2E2J H;  4KI0 A;  3CCE A;  3G71 A;  2WP8 J;  4QY7 A;  5M3M H;  3NEN A;  1B7Y B;  1XNQ L;  2EIF A;  3K7A H;  4JI4 L;  4WJ4 A;  1HNZ L;  2Z0S A;  4UPA A;  4GOP C;  4DV7 Q;  3ERS X;  5IYC G;  3S1R H;  1CKN B;  1XMO L;  4GKK Q;  4IOA A;  3PIP A;  3HOV H;  3FKI G;  1QZH A;  5EAY A;  4DV6 Q;  2KHI A;  4X65 L;  4OX9 Q;  3RLO A;  2VW9 A;  3I7F A;  2ATW A;  3HOU G;  3KJO A;  2Y0S G;  3I56 A;  5IP7 H;  4NXM Q;  1XPO A;  2RCN A;  1GM5 A;  2VQE Q;  4DR3 L;  4B3T L;  3RN2 A;  4BA2 I;  2V1C C;  3M9B A;  4A3B H;  1G6P A;  4IJH A;  2I5L X;  1S3O A;  3PCO B;  2YTV A;  1N34 Q;  1V43 A;  2E2H H;  4EQ5 A;  4DAY B;  1NMF A;  1PV4 A;  3CMA A; 
#chains in the Genus database with same CATH topology
 3NWT A;  3QOJ A;  1WCM B;  2VQF L;  4HN7 A;  1N9W A;  5C4X H;  4HJ7 A;  1WTO A;  3S1M B;  4DR4 Q;  2K7V A;  1C48 A;  1PXU A;  4IPC A;  3UE0 A;  1XNQ Q;  2Q2I A;  4A3D H;  4A3J B;  2F0M A;  1STG A;  3HKZ E;  2XSC A;  1UUP A;  1OO9 B;  2EQS A;  3TRZ A;  1JE5 A;  2XRQ D;  3KOJ A;  1PFB A;  4UDU C;  4IQZ A;  5FJ8 H;  5IGF A;  3LWE A;  5EGT A;  1EFW A;  4DR3 Q;  2F0G A;  1GUS A;  1VDZ A;  4JI8 Q;  3GTM B;  5LMU L;  1SFO H;  4EGV A;  1WFQ A;  4B3S Q;  2AQ1 B;  1VQC A;  2BDO A;  3V2T A;  2QF7 A;  2E2J B;  1VQL A;  1VQF A;  5M3M B;  4RA8 A;  5LMN W;  2EVB A;  1QNU A;  3K5O A;  3ULJ A;  3U4V A;  1RCV D;  3TRE A;  2D0O A;  5DEH A;  5I9P A;  4ZYS A;  3S1R B;  2F0H A;  2EJF C;  1PRT C;  5F2D A;  3PO3 B;  1MGS A;  2ID0 A;  3NQI A;  1QG7 A;  3W5O A;  3OTO L;  1YHQ A;  3QOL A;  4ZAI A;  3EBE A;  1JJ2 A;  2JA7 H;  1XX8 A;  4OWT B;  4CHT B;  4TVA B;  1O78 A;  1GOZ A;  4YHH Q;  3Q23 A;  1CSP A;  2D2C C;  5GAH C;  5C4X B;  3J81 E;  4IUQ A;  4PZ8 A;  1D6E C;  1TII D;  1Z6H A;  1KHI A;  3S17 H;  4GKJ L;  4DV6 L;  2ICI A;  3RD4 A;  5IYC H;  1XTD A;  4DPG A;  4GOP B;  1TY2 A;  2WKC A;  4KHP L;  1F9S A;  5C3W A;  4A3D B;  5C0X J;  5J3B A;  2X6L A;  3DM1 A;  3NTH A;  2NBF A;  1G29 1;  3L2P A;  1IBL Q;  1Y8O B;  1AFP A;  3NEL A;  1SMY D;  4P75 A;  3PF5 A;  1DM0 B;  1WTX A;  4DV5 Q;  5COY A;  1HPC A;  2F0W A;  4QGU A;  4KY5 A;  3I4M B;  2F0D A;  4A93 G;  3HOW G;  3VYT A;  1D7Q A;  1SFO B;  2C5C A;  1WTV A;  3K8A A;  2F0N A;  1EQT A;  3M4P A;  2N88 A;  5BN3 A;  1YIT A;  2JN4 A;  1IHZ A;  1SNC A;  4KKU A;  3TP8 A;  1F77 A;  1A3V A;  3PUV A;  2PPB C;  2R7Z B;  2E74 C;  1B44 D;  3QB3 A;  1VQI A;  2F4I A;  1PVO A;  5D3D A;  2BDN A;  3MXP A;  3O13 A;  2Q2U A;  5CV7 A;  4EVO A;  1SNM A;  4MTK A;  3STB C;  1B50 A;  4C3I H;  2PMZ E;  2A74 C;  2K5V A;  2WFW A;  3FVQ A;  4FYD A;  1P16 A;  2RQX A;  4LFA Q;  4JV5 L;  1X3P A;  2JA7 B;  2P5Z X;  1XNR L;  3VR2 A;  5C3E B;  4H7B A;  1S4Z A;  2K4K A;  1I4H A;  3KK7 A;  3M4O H;  4L5Q A;  1MBY A;  3NBH B;  1S40 A;  2WIN B;  1XPR A;  1ASY A;  2Q2H A;  1ET6 A;  3H3V C;  1BVS A;  4DV0 Q;  2MO1 A;  1PRT B;  1SE3 A;  1W6K A;  2AQ3 B;  4JOI C;  1EFI D;  1TWF H;  2KHS A;  2XNA C;  3E0J A;  2B2Y A;  1HR0 L;  2N78 A;  5IIF A;  1PYS B;  4RHS A;  5C44 H;  2A6H C;  3HOV G;  3MA2 B;  1N32 Q;  1A3T A;  1CZW A;  4I7Z C;  2RA4 A;  4IAL A;  4JI0 Q;  2AMC B;  1X3F A;  1LYL A;  1E2Z A;  2RSN A;  4A3G H;  3N6R A;  5IYD H;  4KY7 A;  4WFN 3;  1BCP C;  1VMC A;  5DLQ E;  2KUM A;  1KAW A;  4FXG C;  1JCK B;  3X3N A;  4AYB E;  4C3I B;  2KCC A;  2O2L D;  4NW2 A;  1CHP D;  1LT4 D;  4R4Q A;  5ELE A;  5G3L F;  1J9O A;  3NE5 B;  3DWP A;  4FNF A;  1SRU A;  4IPD A;  1FNW A;  5C5L A;  1KIX A;  1PH6 A;  5FK9 C;  2JXM B;  1FL0 A;  2RHS B;  2DUD A;  4B3R L;  3CCM A;  5JEA J;  3M4O B;  1B70 B;  1KRT A;  4BBS G;  4Y52 H;  3CCS A;  3PO2 B;  1ZXT A;  3PIO 3;  3UDX A;  5E1F A;  4Q5V A;  5J1Z A;  4CDD C;  3BDL A;  4X3U A;  3HG9 A;  5JJL A;  1HA6 A;  3QJY A;  1JC7 A;  4K5V A;  1VQB A;  3M85 A;  1UEB A;  4EQP A;  3HOU H;  2HCC A;  3SK8 A;  1U4L A;  1S5E D;  5EBD A;  1N33 Q;  2WB1 B;  4N8F A;  1TWF B;  3A0J A;  4RKL A;  1SE4 A;  4JK1 C;  3I72 A;  5KYL A;  1HUM A;  2KCN A;  2A68 C;  4LFC Q;  5C44 B;  1CKO A;  2RKS A;  3K81 C;  2K75 A;  4CGY B;  3A8I E;  5IYB H;  1HA5 A;  5CMD A;  1HQR D;  4H44 C;  2K32 A;  5AJ3 Q;  3J7Y W;  4FF4 A;  1JJG A;  4ID6 A;  4JBJ A;  1AZP A;  4DK3 C;  4O0A A;  2L15 A;  1Y69 U;  1PZJ D;  4ODG A;  4DR7 L;  2CFM A;  2MP1 A;  4IJL A;  3F8T A;  2MQH A;  4A3G B;  3KLW A;  2NYZ D;  2VS1 A;  3VR5 A;  1FNU A;  3MXG A;  1STA A;  1PFN A;  2OXP A;  2D62 A;  2GVB A;  4LF4 Q;  1BNZ A;  1FD7 D;  1SNO A;  1DOM A;  2EXD A;  2KCM A;  5C0X G;  3IAY A;  4FO2 A;  4XXE A;  2EE1 A;  2FMC A;  3PUX A;  1LTB D;  1U4P A;  1QVC A;  4QCL A;  3K0Y A;  4A3M H;  4JW0 A;  4JI6 Q;  1IBM Q;  4GOP A;  1K28 A;  2I5M X;  4IPG A;  3CCR A;  1ROD A;  2K03 A;  3PUZ A;  3URY A;  1O7I A;  2ZXR A;  4OO1 G;  2UXB L;  3NP8 A;  3IRB A;  1VQP A;  4A3C H;  4LF8 Q;  3S9W A;  4YY3 Q;  3D6C A;  3NTK A;  1CA5 A;  3T1H Q;  1B4O A;  4ULL A;  3NWS A;  3OW7 A;  1IL2 A;  5FLX c;  2B63 H;  4DF7 A;  2B2U A;  4V19 0;  4X6A H;  3HOU B;  1BCP B;  4IUU A;  1JB3 A;  3W1G A;  1PMR A;  4ZUI A;  3I70 A;  5FO7 B;  2R3Z A;  1A63 A;  1LAC A;  2EYH A;  5KNC A;  1DYQ A;  1VQK A;  3DWQ A;  2JA5 H;  2CH4 W;  4NP5 A;  1AE3 A;  1HNZ Q;  4QF4 A;  4N8X 1;  3I8Z A;  2UUC L;  2UUB L;  1EQR A;  2ENB A;  3CC7 A;  3Q8D A;  3G48 A;  4X65 Q;  2F03 A;  1QIL A;  4XIG S;  3DWA A;  4ZCK A;  2VZA A;  4MHE A;  2KBN A;  4JI5 L;  1C0A A;  1AE2 A;  2L1B A;  4QIW E;  1IYU A;  4P74 A;  5C3X A;  1D5X C;  1M8A A;  5M9O A;  3NBH A;  5GRO A;  1STB A;  3L9A X;  4O2D A;  1F2M A;  2CWP A;  4XTC S;  4A3M B;  4PZ6 A;  2CCZ A;  3HOZ G;  2ALY B;  3OMG A;  4A3I H;  1N36 Q;  4MIU A;  1R9T H;  1JQY D;  1DGS A;  2OQ0 A;  4Q0F A;  3S16 H;  2AWO A;  2CVR A;  1JJC B;  4G57 A;  3UDF A;  3RZD H;  4OIK A;  2B2W A;  4OXP A;  1ZEQ X;  4KTA A;  2B63 B;  1LTS D;  1EWH A;  4X66 L;  4DR5 L;  2VNU D;  1ESF A;  5A35 A;  3GTJ H;  1SAP A;  4ME3 A;  2PQA B;  3S24 A;  2K5D A;  2F0P A;  2K6A A;  4HJ9 A;  4UP9 A;  2PZT A;  3H0G G;  3BDC A;  2EYF A;  3AU7 A;  2DY7 A;  2JA5 B;  2Z6K C;  2EJG C;  3JAM L;  1KAB A;  2FXQ A;  1SXT A;  4GLA C;  5CV4 A;  2QA4 A;  2VQE L;  1SSO A;  2EOT A;  3HGB A;  3S1N H;  5JEA G;  2N8N A;  1RD9 D;  1D5M C;  1YNJ D;  3OTO Q;  1N34 L;  1AW7 A;  4BY1 H;  1TWA H;  3ND8 A;  1O7L A;  3CPF A;  2JEA I;  4G7O C;  3OSO A;  4P2C B;  3CC4 A;  3U58 A;  2F4V L;  3NEM A;  3TP6 A;  2R92 H;  5ELB A;  3CCE A;  3G71 A;  2EIF A;  1XMO L;  4IOA A;  2MGS A;  1A2T A;  4RGO S;  1KAA A;  2ZT9 C;  4DV6 Q;  1QZH A;  1QE6 A;  3SHL A;  4A3I B;  1R9T B;  3I7F A;  3IL8 A;  4KY6 A;  5IP7 H;  1XPO A;  3S16 B;  4I65 A;  1NR2 A;  2NTS A;  4B3T L;  3M9B A;  4QUF A;  4IJH A;  2I5L X;  2FIN B;  4R9W A;  2AUJ D;  3CKI B;  3GTQ B;  1UE5 A;  2L55 A;  1PRT F;  3GTJ B;  2IHF A;  1YNX A;  1B3A A;  1U5K A;  4M8A A;  1L1O C;  3ERO A;  1VQM A;  2KEE A;  3L0O A;  1MI2 A;  2A69 C;  3EVQ A;  1JOR A;  3GTK B;  2CQA A;  2ICE C;  2F0K A;  4C3H H;  3S1N B;  1D1K A;  2I0Q A;  4S3S A;  4RWS C;  4BY1 B;  4DR1 L;  1SE8 A;  1TWA B;  5JVH 3;  1EQQ A;  1CTM A;  4JOI A;  1EWC A;  1YZ6 A;  2WAQ B;  2RDG A;  1HNW L;  4F8M A;  4DV1 L;  3P7J A;  2BH8 A;  2VXW A;  3W2D A;  1XNR Q;  2R92 B;  3P75 A;  1NUC A;  1PTO D;  3HOY H;  3KLS X;  4LFB L;  2O4X A;  3RUZ A;  3KYH C;  2L4N A;  4CKE A;  5D3I B;  2ZM6 L;  3H15 A;  2L5T A;  3J81 j;  2J4X A;  1EZ6 A;  1PH3 A;  5GAD C;  1XJV A;  4LF5 L;  1TWH H;  4K5W A;  2EY2 A;  5CC4 A;  2UUA Q;  1NNX A;  4A3F B;  1TY0 A;  4L5T A;  5FKA C;  5LMN L;  5IGG A;  4G4K A;  4PV1 C;  4ZKB B;  3KDF B;  3L3O C;  2E2I H;  2EJM A;  2XTI A;  2CHB D;  3D31 A;  4PNY A;  2IX3 A;  1DOL A;  1V8Q A;  5FLM G;  3K5M A;  1BKB A;  1EY6 A;  4A4I A;  4R4I A;  3PIP 3;  4POF A;  1V1P B;  1G91 A;  4OGQ C;  3F1Z A;  3OOC A;  1QVF A;  3S1M H;  5IOC A;  1S5D D;  1EQV A;  3GTO H;  4OX9 L;  1PH9 A;  4K6D A;  2YTY A;  4PMW A;  1GJX A;  3D4W A;  4NXM L;  2VL6 A;  1A62 A;  4ILW A;  2E76 C;  2LXK A;  1EZ8 A;  4GN5 A;  3IKJ A;  3PSI A;  3ICE A;  4N9P A;  3GTM H;  3GO5 A;  4QQB X;  2JSO A;  2SDF A;  4Z9C B;  5CV6 A;  1VQ7 A;  4UY8 C;  3C46 A;  1I4Q A;  3HOX G;  4A3E H;  1BBW A;  3D3R A;  1F2L A;  3HOY B;  3G7L A;  4EQN A;  1CT1 D;  3GTG H;  5ELF A;  1HJP A;  4H13 C;  1L1O B;  1H9K A;  4B3R Q;  4A3L H;  2LS0 1;  1YVC A;  1LV9 A;  2CH4 A;  5M3F G;  4HIM A;  2KCT A;  3PO3 H;  1JOK A;  3MAQ A;  3CC2 A;  2NVQ H;  4KJN A;  3LX0 A;  4OL7 A;  3PIO A;  3MVV A;  1I4R A;  2Z6B A;  3CHB D;  4PMB A;  1SDF A;  1WCM G;  2NB0 A;  3M7G A;  2PQA A;  4CKC A;  1D8L A;  4DK0 A;  4DAV A;  1Y1W G;  3TN2 A;  3I4N B;  2E2I B;  3UI2 A;  1PA6 A;  1L0Y B;  1C7Y A;  1CK1 A;  1Q8I A;  1RF2 D;  1EU4 A;  1H9S B;  2NZ1 D;  3I2Z A;  2N3S A;  1ICF B;  5CBA E;  2KEC A;  1YEZ A;  4A3J G;  5C4H A;  1K73 C;  2X6G A;  1ENC A;  1BCP F;  2NZH A;  2ZTC A;  1R4P B;  3GTL H;  1SEB D;  3ITP A;  3GTO B;  1Y8P B;  2QCP X;  3HRZ C;  4AYB G;  5CBE E;  1SMY C;  4DR6 Q;  3K6O A;  3T56 B;  2HDL A;  1LT3 D;  2G9D A;  1UE1 A;  3BYT B;  1O7Y A;  1LTL A;  3HFZ B;  4LK1 C;  1J5E Q;  3SE0 A;  2CKZ B;  5M3M G;  1CHQ D;  2FMM A;  4CDC C;  5HY6 A;  5KRU A;  3I4M H;  1SJH D;  1CQF A;  1HZC A;  2O5I C;  1VQ8 A;  3GDE A;  3RR5 A;  1PFM A;  4DR2 Q;  4DXF A;  1EYG A;  1KDC A;  4A3E B;  4XDX A;  1JE4 A;  1BBU A;  2R7Z H;  1EOT A;  3ER0 A;  3GTG B;  4X64 L;  2YYZ A;  1TS2 A;  4ZQ3 A;  2OTL A;  1K83 H;  4DU9 A;  3HKS A;  3OW2 A;  2NVQ B;  3BU2 A;  3TDQ A;  3KF8 B;  1CKM A;  3A7A B;  2B2W C;  3VA7 A;  1SYB A;  3G6E A;  2F52 A;  1IW7 D;  1T5X D;  4MTN A;  4JI1 L;  1I94 Q;  4LJZ C;  1YNN C;  4TRD A;  3Q24 A;  1J6Q A;  4B08 A;  3K57 A;  1WTQ A;  4CJ1 B;  5C3E H;  1H9M A;  1Z7T A;  4C1N I;  4DN4 M;  3GTP H;  3OIQ A;  1G6Z A;  4LAA A;  3PUW A;  4ZK9 B;  3GTL B;  3RMH A;  1BR9 A;  1QZG A;  3DMU A;  2MJ8 A;  5FJ8 G;  2XVS A;  3FDT A;  1WD0 A;  1I6V C;  1UE6 A;  3NTI A;  2R61 A;  1O80 A;  4DV3 L;  4CDF C;  2EYP A;  1GD7 A;  2JYO A;  4C3J H;  2K52 A;  1I5F A;  1FNV A;  5JJK A;  3BS1 A;  2Q8T A;  3K5N A;  3BZD B;  2OTJ A;  1HFN A;  1GUG A;  2G5D A;  1ZKO A;  5ELO A;  1SE2 A;  4TKO B;  1U4R A;  1LTG D;  2Z6K A;  2MPM A;  4BBR H;  3J80 L;  1VQ5 A;  2I07 B;  2PO4 A;  4RCN A;  4IUT A;  2A1A A;  3JAM c;  1K83 B;  3PMF A;  5EQ0 A;  1SJE D;  2MNA A;  3KDF A;  2EYL A;  2IX1 A;  2L11 A;  3QO2 A;  2JA7 G;  1RDP D;  5IP9 H;  3V05 A;  5C4Z A;  1AEX A;  4DR5 Q;  3C2P A;  4LUO A;  4ALP A;  5H1S E;  1SNQ A;  1LTA D;  1PDQ A;  2A6E D;  3W1B A;  4X62 L;  4G7Z C;  4L5R C;  1V1P A;  4K0K L;  1FJG L;  1SYC A;  1HZA A;  2HIX A;  4E6I A;  3GD7 A;  4R8N A;  4A93 B;  5EPK A;  1IKL A;  1PFS A;  3JAM E;  4GLX A;  1X56 A;  4BY7 G;  1EIF A;  1XMQ Q;  2K28 A;  2NVX H;  3K58 A;  2ZJP A;  1CUK A;  4IN3 A;  3GTP B;  5IWA L;  3E0E A;  4DNI A;  3VR4 A;  4LUZ A;  3PO2 H;  3TS2 A;  1UAP A;  1X3E A;  2SNS A;  2QDB A;  3F2U A;  2UXC Q;  1Q90 A;  3V96 A;  5IT9 L;  3RZO B;  1UWV A;  5EJW A;  4AQY L;  3M3Y B;  4POG A;  1K8O A;  3A5U A;  2VUM H;  1VQE A;  5JPM C;  4DAM A;  4Y7N H;  4YIJ A;  3R2I A;  5IGC A;  5JAV A;  2C9O A;  1GHJ A;  4H0L C;  1L1O A;  4C3J B;  4LF6 Q;  3H3V I;  4B9X A;  1HNX L;  1XMO Q;  1HTL D;  5JOB A;  2E5L Q;  4BBR B;  2LMC B;  1K0R A;  4WJ3 M;  4WRD A;  4HIO A;  4C3I G;  2DN8 A;  3RN5 A;  4FVM A;  4OIJ A;  1EU3 A;  3A54 A;  1EY4 A;  3F2B A;  4DV4 Q;  4B3T Q;  3H3V H;  1E1O A;  3BZK A;  1H9S A;  3I55 A;  3T1Y Q;  4LF7 L;  3KBG A;  1PH1 A;  1KLU D;  3C1E A;  1BDO A;  4RHR A;  5K36 H;  5C4J H;  4LF9 L;  3KLS A;  2B2V C;  4DUZ Q;  2JE6 I;  2PI2 A;  4JBM A;  4DAP A;  1Q81 C;  2TSS A;  1WVL A;  4C56 C;  2NVX B;  1W3S A;  1HTP A;  3SXH A;  3ERQ A;  4IFD I;  1STN A;  3NBI A;  1SLJ A;  3LWU A;  2D5D A;  2L9H A;  1PH7 A;  1Y1V H;  2YV5 A;  2KQ3 A;  3MFG A;  3FRP B;  2UU9 L;  5C44 G;  3A8J E;  1YBY A;  2I5H A;  5C6A A;  3LNN A;  4ZLT F;  2VUM B;  2FFK B;  4IFD H;  2F0E A;  4Y7N B;  4OO1 I;  4EQO A;  2PZU A;  4DV1 Q;  1TVX A;  1II3 A;  3WWV A;  4IO9 A;  4QJF A;  1Q1E A;  4KD4 A;  3CCV A;  4K8I A;  1MKH A;  1NR4 A;  1T9H A;  1VS0 A;  1LAB A;  1T5E A;  4P73 A;  3AFQ A;  1BOS A;  3E9H A;  4MZ9 A;  5IYD G;  1E0B A;  4FF2 A;  1CM9 A;  4A3G G;  1KC8 C;  2YU9 B;  3A55 A;  4ZRZ A;  3KF8 A;  3N52 A;  4BBS B;  4TQU S;  5DNF A;  4K5X A;  3FMC A;  1EEF D;  4OO1 H;  4LF5 Q;  1BXT A;  1C4Q A;  3HP3 A;  2A73 B;  5JJI A;  4U68 A;  5LMN Q;  2F1M A;  1WYD A;  1M90 C;  2K5H A;  4JCV E;  4JI7 L;  2SEB D;  3OWF A;  3U4Z A;  1TWG H;  4L5S A;  2B8F A;  1VQ6 A;  4DA2 A;  2XWJ B;  4QY7 A;  5C4J B;  2HCI A;  4HAE A;  2A6H D;  1XNQ L;  3K7A H;  4WJ4 A;  1BF4 A;  4UPA A;  4DV7 Q;  3MC0 B;  5JVG 3;  2F0I A;  4GKK Q;  3PIP A;  2GA4 B;  4IZ8 A;  4L63 B;  2DJG C;  4OX9 Q;  3RLO A;  2XWB B;  3W3A A;  5EKI A;  3HOU G;  2Y0S G;  4KN7 C;  5FO8 B;  4NXM Q;  3J7A V;  3BDO A;  2RCN A;  1GM5 A;  4DR3 L;  1HXY D;  3DXJ C;  3RN2 A;  1Y1V B;  4A3B H;  2CW0 C;  2H1E A;  1PZK D;  3PCO B;  3P1H A;  2YTV A;  1V43 A;  2E2H H;  4EQ5 A;  4DAY B;  1NMF A;  4CDE C;  1PV4 A;  1UEA B;  3CMA A;  1WTR A;  4NDX A;  5IYB G;  4A3K H;  2ZTD A;  4DNT B;  3RLN A;  5HGQ A;  2F3I A;  4LUV A;  4HJ8 A;  1V9P A;  4KV6 A;  3KJP A;  2AKW B;  5J39 A;  4JI4 Q;  5FLX E;  4IOC A;  5CYU A;  3Q6S A;  4R8I A;  4GZY C;  2K5N A;  4DGZ A;  4JVZ A;  1UE7 A;  1N8R C;  2EYM A;  5E7N A;  1TWC B;  5I6Y A;  4HCE A;  3TZD A;  2BH2 A;  4P72 A;  2HQE A;  5HUR A;  4A3M G;  3NSW A;  1X65 A;  1TWG B;  2R6G A;  3GP7 A;  1VQG A;  2F0F A;  3QG1 A;  1D5Z C;  1Y14 B;  1GUN A;  2Q8I B;  3TSS A;  1ZYR C;  2NVY H;  3J81 L;  2VQF Q;  3K7A B;  1YHA A;  1Q3L A;  2F0L A;  3I4L A;  1FGU A;  3D8G A;  1RL2 A;  2IX0 A;  4OWW B;  4DK1 A;  5CV5 A;  3K80 C;  2F0U A;  5ISR A;  2B63 G;  1JWU D;  2NN6 I;  2R93 H;  1EWI A;  2KA7 A;  4JYA L;  1KNE A;  4A3B B;  2IPK D;  1P8L A;  2CQO A;  1YJ9 A;  2E2H B;  3QIA A;  5DAU A;  3FPP A;  2JA5 G;  3GTQ H;  3BJU A;  3CPW A;  3PUY A;  5BN5 A;  5EKK A;  4A3K B;  5LMU Q;  1PLF A;  4R1J A;  2MO0 A;  2NN6 H;  1E2W A;  1K9M C;  4V0B A;  5ELN A;  5E3F A;  1H9J A;  2OWO A;  3GTK H;  1VQ9 A;  4BXX G;  2JA6 H;  4HSP A;  1EY7 A;  2PQE A;  1K8M A;  2RF4 A;  4LFA L;  1LTI D;  3H09 A;  2RHQ B;  1NE3 A;  3EFX D;  5GAG C;  3P20 A;  1I6H H;  2WB1 E;  2PNH A;  5BR8 L;  2F3W A;  2Z9H A;  2L12 A;  2HD3 A;  3MEF A;  5M5Y B;  5C5M A;  4A3I G;  1FVI A;  4J15 A;  1WI5 A;  4DNR B;  5DM6 3;  1XPU A;  3EQL C;  2NVY B;  1KLG D;  1KL9 A;  4DV2 L;  3H0G B;  5I2Y A;  1TS5 A;  1SN8 A;  2BE5 D;  4GKJ Q;  2F0T A;  1MSG A;  3CU7 A;  3SGI A;  3ZJY C;  1NBW A;  2IWH A;  3X3M A;  3J80 c;  1LLR D;  1W6J A;  2B3G A;  5FOB B;  1OXV A;  4KHP Q;  2CWA A;  1YI2 A;  4HSV A;  4A3F H;  2NUC A;  2R93 B;  1BBX C;  1Q7Y C;  1WTH A;  1EY9 A;  4DV3 Q;  1N32 L;  2JJQ A;  1I3Q H;  2A5H A;  1TR5 A;  2DJF C;  1VMP A;  4JI0 L;  5E4X A;  3S15 B;  4IUN A;  3JAM i;  2NZO A;  2N49 A;  2Z4I A;  4PG3 A;  4KD3 A;  1ICW A;  4BY1 G;  3HKZ B;  2JA6 B;  3R2T A;  3B6Y A;  3CD6 A;  2HHH L;  4HTH A;  3BVG A;  1F9P A;  3DLL A;  2WAQ G;  2H4O A;  4PQX A;  3CCU A;  1XWE A;  2R92 G;  4G7H C;  4FP5 D;  2Y0S E;  5M5X B;  5IT9 c;  1I6H B;  4KN4 C;  1XTC D;  1OXU A;  1E2V A;  4BWG B;  5A2Q L;  1VF7 A;  1NJI C;  4B3M L;  3BVM A;  2KOL A;  4JV5 Q;  2RCF A;  4DK6 C;  1WTW A;  2JA8 H;  4O42 A;  3A8K E;  5IP7 G;  4OON A;  4YWM A;  2SNM A;  1Q8K A;  1JOO A;  1ESR A;  4U67 3;  2IW3 A;  3L7Z C;  1G2S A;  1PH4 A;  5G3L D;  5IT9 E;  2ZXO A;  2HUG A;  1DXM A;  1Q86 C;  4QUC A;  1HRJ A;  4RGT A;  4KMU C;  1GKH A;  4DAY A;  4R4C A;  1OXX K;  4QL5 A;  4CJ2 C;  3LGJ A;  2ASB A;  1EY5 A;  4HCS A;  1E3P A;  1KDB A;  1PYB A;  4DUY L;  1S5C D;  1SMX A;  2B29 A;  3I4N H;  4PZ7 A;  1K8A C;  4LFC L;  1H9R A;  1I3Q B;  5GAE C;  1PH8 A;  3CF5 A;  1HR0 Q;  1EYC A;  2B2V A;  1G51 A;  1PTO B;  1IXR A;  1YHB A;  2C35 B;  2HT1 A;  2F0O A;  2YTX A;  2K01 A;  2B39 A;  4C3H G;  1U9R A;  3CCQ A;  1ENF A;  1Z47 A;  4EX5 A;  5M3F H;  2F0S A;  3A74 A;  1EUJ A;  3FKI H;  1I4G A;  2BOS A;  1TS4 A;  4ZKC B;  4LF4 L;  1F2Z A;  3MFY A;  4GLV B;  3G6J B;  2VB3 X;  1NMG A;  3PF4 A;  4K2K A;  1EY0 A;  1U4M A;  4MN3 A;  3HOY G;  4NMZ A;  2K04 A;  2RSO A;  1OXS C;  1SND A;  2EY5 A;  3WOE A;  4JI6 L;  1IBM L;  4K14 A;  2QW7 A;  3A5Z B;  4QB4 A;  1EYA A;  2JA8 B;  3T16 A;  2EY6 A;  4FXK C;  4HID A;  1WOC A;  2A69 D;  1LT5 D;  3CRK C;  4LF8 L;  3E3X A;  3D4R A;  4YY3 L;  1STE A;  1X3G A;  1QB5 D;  3BYY B;  3J7A 5;  1ENA A;  2KEN A;  2DGY A;  4RG1 A;  1BUV T;  1IW7 C;  2PMZ B;  4KHZ A;  4JG2 A;  1A15 A;  3S2H H;  3CCJ A;  2AHO B;  2ZXP A;  4GNX C;  3NXW A;  2R7F A;  1HQM C;  3EN2 A;  3TBI B;  2J0T D;  3H94 A;  5L37 A;  3NPP A;  4TSS A;  4JI2 L;  3AMU A;  2JA9 A;  5EBC A;  5J22 A;  4C2M B;  4ZUJ A;  4GN4 B;  2KED A;  2KVM A;  5M3F B;  1MD2 D;  2K1B A;  1U0L A;  3FKI B;  4WOR A;  1GO3 E;  1ONL A;  3ULP A;  3HZX A;  4DR7 Q;  2WAC A;  1Q12 A;  3VR6 A;  1IBK L;  2EYJ A;  4A3E G;  1QUQ B;  2R7D A;  2LXJ A;  1Y1W B;  4JI7 Q;  1QNK A;  4F88 A;  2M2L A;  4A3L G;  3PO3 G;  1N36 L;  2FHT A;  1Y8N B;  4J6H A;  2OQK A;  1M1K C;  4RGM A;  3TQY A;  5KYI A;  2ZTE A;  3SK5 A;  1HZ9 A;  1JT8 A;  1LUZ A;  2GN5 A;  2F0V A;  3FHW A;  2UXB Q;  4AYB B;  2BCO A;  1D2B A;  2A6E C;  3UDG A;  4HMJ A;  1HFG A;  2B2T C;  2HDM A;  1TT2 A;  3S2H B;  3VR3 A;  2WAQ E;  5C4X G;  3S1Q H;  1JWS D;  1WTP A;  3IFD A;  1GXD C;  1JB7 A;  4A93 H;  3HOW H;  1GHK A;  3OMC A;  4H02 A;  4A3D G;  1A8V A;  3ULL A;  1EYD A;  4X3T A;  4I7A A;  3J81 c;  2IL8 A;  2RDH A;  1TKW B;  4RAU C;  3BG3 A;  1F2Y A;  2UUB Q;  2UUC Q;  2E75 C;  1NY4 A;  2TMP A;  1K3R A;  3CQZ H;  1EL0 A;  2EPB A;  1AZQ A;  3VYU A;  3I4M G;  3RZO H;  1V1O A;  5LHY 1;  3MXN B;  5T1I A;  3M3Y H;  3RLF A;  1DOK A;  5I6W A;  1KQS A;  3EA6 A;  2OEO A;  4JI5 Q;  4XQQ A;  4GNX B;  4XYO A;  2R7Z G;  5KEE A;  4KHV A;  5DM7 3;  3TME A;  4BY7 H;  4KJO A;  3SR1 A;  1DD2 A;  3TZU A;  2UXD L;  3WOF A;  3UE1 A;  4IFD J;  4NXN L;  4JI3 L;  4YWK A;  1EIY B;  2L0C A;  4L6T B;  1S72 A;  5IGB A;  4OEL B;  3D4D A;  4A75 A;  5COR A;  1Q46 A;  5CR3 A;  4JYA Q;  5C3E G;  3BZC A;  1IZ6 A;  2PW5 A;  4JBK A;  2LKV A;  4M1U B;  4FXD A;  4X66 Q;  3KF6 B;  3S1Q B;  4KI0 A;  1S5F D;  2NTT A;  1JOQ A;  3NEN A;  1B7Y B;  4BS9 A;  3SEB A;  4L8J A;  2EXZ A;  1RHP A;  3HOW B;  5IYC G;  1CKN B;  3HOV H;  1L0X B;  3ND9 A;  4CBV A;  1NCV A;  4JPB W;  2VW9 A;  2RDF A;  3FPU B;  1PRT D;  3I56 A;  2VQE Q;  3CRL C;  3CQZ B;  4BA2 I;  4QMG A;  1G6P A;  2V4D A;  1A2U A;  1JWM D;  1S3O A;  1N34 Q;  4C3J G;  1KDA A;  4LWC A;  3GQB A;  4PMC A;  1YNN D;  5BR8 Q;  5KND A;  2EZV A;  4BBR G;  2F4V Q;  4P71 A;  1VQH A;  3S17 B;  4A76 A;  1KXL A;  3F2D A;  4HJ5 A;  4BY7 B;  3J80 i;  4DV2 Q;  2PI2 E;  1X6O A;  2M00 A;  2UUA L;  2I46 A;  3R93 A;  2EDG A;  5ELC A;  2YU9 H;  2KHJ A;  4K2L A;  2LY7 A;  5IP9 G;  1PHJ A;  4HJA A;  2IHE A;  4BBS H;  4NPS A;  3OYY A;  5TSS A;  5T1G A;  2HIV A;  1B53 A;  5JPN C;  2O5J C;  4AIM A;  3VDY A;  4QIW B;  1AP0 A;  2EY1 A;  1JR0 D;  2JP1 A;  1K0S A;  4B9W A;  4YCU A;  1X55 A;  2E2D C;  4KKT A;  1HZB A;  3AYH B;  1RKN A;  4C1N K;  4YCW A;  2QEX A;  3EIV A;  2MFI A;  1K3B C;  4IUR A;  3I4O A;  4OWX B;  3U50 C;  3I3C A;  3PO2 G;  5IGD A;  3H6M A;  3GV3 A;  1MJE A;  3K59 A;  3HOV B;  1KRS A;  3KLR A;  5D14 A;  5C0X I;  4ME5 A;  1PTO F;  1TU2 B;  3SK6 A;  5BN4 A;  1NAP A;  1ML0 D;  2J7Z A;  2HHH Q;  2DNE A;  2VUM G;  2WB1 G;  5E4W C;  1QUQ A;  3TP7 A;  1YIJ A;  1TQO A;  2XGT A;  5A2Q E;  3STB D;  4DR1 Q;  4BA1 I;  3T13 A;  1C9O A;  1B2T A;  5C0X H;  4B3M Q;  1E7Z A;  1HNW Q;  2H5X A;  4CKB A;  1AN8 A;  1I4P A;  1GUT A;  3GV6 A;  5LL6 X;  1GUO A;  2Z1C A;  2KJX A;  4LFB Q;  1FYC A;  1PH2 A;  3FEW X;  3OHX C;  3EJI A;  3NUC A;  2LSS A;  2ZM6 Q;  4FDB A;  3MTS A;  4XQN A;  1SYF A;  4YWL A;  1RTN A;  2K50 A;  2IT1 A;  4HMI A;  2GVA A;  3F2C A;  1OXT A;  5K36 G;  1TWC H;  3ZYY X;  1DON A;  4DUY Q;  2RBM A;  1ILP A;  1X9N A;  2WII B;  1RTO A;  3I73 A;  3PV0 A;  1JMC A;  3S14 H;  1MIU A;  4DR4 L;  4LW1 A;  1L2F A;  3C3L A;  2ZJR A;  1KNA A;  1X54 A;  1Y1V G;  4DR6 L;  3D6W A;  3E6Z X;  1VF5 C;  3T51 B;  3Q0A A;  4O1N A;  2F3V A;  1CQV A;  1SYD A;  1J5E L;  2K14 A;  1VQ4 A;  3MXN A;  5CV8 A;  4RFB A;  1LO5 D;  4IFD G;  4RMF A;  4JI8 L;  1MJC A;  4UP7 A;  1IL8 A;  1BCP D;  4KKS A;  2IY5 B;  4GNX A;  4B3S L;  1F9Q A;  4DR2 L;  2K33 A;  2E8G A;  2PW7 A;  4HIK A;  3CW2 C;  1PYW D;  1VQA A;  4X3S A;  1VQN A;  4IPH A;  1HR0 W;  3C1F A;  1QJO A;  4XT1 B;  3UDI A;  4F7X A;  2OT2 A;  3DM3 A;  3QR8 A;  4GS3 A;  3TEH B;  1YNJ C;  3HOZ H;  2BA0 A;  1LTT D;  2NVT H;  1I94 L;  2DNC A;  2Y0S B;  2JK8 A;  1NTG A;  3KF6 A;  2OF1 A;  3PQI A;  5FO9 B;  4KK7 A;  3SK4 A;  3MEH A;  4YHH L;  1A6X A;  5M5Y H;  1CKN A;  3AEV A;  4MNO A;  2Q8R E;  2Q2T A;  1EIG A;  2BE5 C;  3S14 B;  1GUW A;  3AFP A;  1XXG A;  1BQQ T;  1L0W A;  2A68 D;  5I2X A;  3H0G H;  4JI2 Q;  1QVG A;  1S5B D;  1V1Q A;  1VQJ A;  4YCV A;  3HEJ A;  4A3C G;  3JC6 6;  1ASZ A;  1CA6 A;  4A3B G;  3VYS A;  3I90 A;  3HS0 C;  4BXX H;  3KBX A;  1IBL L;  2JEB I;  2AUK A;  4NB3 A;  3R3O A;  4DV5 L;  4A3K G;  1CSQ A;  5JEA H;  2SOB A;  2FJ2 A;  2AQ2 B;  2B2T A;  1IYV A;  4F87 A;  1H95 A;  3AB9 A;  4KLK A;  2QDL A;  5I4D A;  1IBK Q;  1QWY A;  2PZW A;  1LM0 A;  1SR3 A;  2K05 A;  4OEM B;  1SYG A;  4RGN A;  4FF1 A;  1B9N A;  3OWE B;  1X32 A;  5CV9 A;  5I9O A;  3S15 H;  3CP0 A;  3QWN A;  1KD1 C;  2JQO A;  5IY0 A;  2HQL A;  3MHB A;  1W2B A;  4IUP A;  5GQO A;  2VB2 X;  4J8Q A;  2Z4H A;  3G4S A;  1TXY A;  4X64 Q;  3HOZ B;  4DXG A;  2DY8 A;  4XQJ A;  4DFA A;  4GN3 B;  3E9I A;  2NVT B;  1EY8 A;  2Z8L A;  4LNQ A;  2CW0 D;  1BO0 A;  5M5X H;  1XMQ L;  1ET9 A;  1PTO C;  4JI1 Q;  3T4A C;  2A8V A;  3J81 i;  1STY A;  1K8G A;  3VYR A;  2PCF B;  2MUY A;  2F0J A;  5KGU A;  3U9S A;  2R93 G;  4DV0 L;  2UXC L;  4JC0 A;  1D1I A;  4RCO A;  1WJJ A;  5IE8 A;  3MZ5 A;  1B9M A;  1SRO A;  2WKD A;  4RKB A;  2AWN A;  3SDZ A;  4RH6 A;  1QCB D;  1G8Z D;  2NN6 G;  4LF6 L;  1I50 H;  5EKL A;  1E22 A;  1CFM A;  3MWY W;  1HH2 P;  2VY3 A;  1NSN S;  1PTO H;  3HKZ G;  2E5L L;  2JA6 G;  1EOV A;  1Q82 C;  2QKI C;  1ZYR D;  3J80 E;  2G9H D;  1M4V A;  5K5P A;  1VQD A;  3R8B A;  1XYI A;  3T53 B;  3VA5 A;  3J7Z C;  1PH5 A;  2UXD Q;  3KFU A;  3CCL A;  2F0Q A;  4DV4 L;  4NXN Q;  3RZD B;  1X3Q A;  4JI3 Q;  1EIH A;  3T1Y L;  4HR7 B;  2ZJQ A;  4R4T A;  4CJ0 B;  1E24 A;  3NHH A;  1CI3 M;  4UP8 A;  4JBW A;  2ES2 A;  2B2Y C;  4AH6 A;  4UHV A;  4HED A;  4DUZ L;  1ILQ A;  1Q1B A;  1HHV A;  1GVP A;  1F9R A;  1DJR D;  5D65 A;  2WV6 D;  1JIC A;  4X62 Q;  2IJ0 A;  4K0K Q;  3K0X A;  4IUV A;  5M5W H;  5FLM H;  1FJG Q;  2EYO A;  1FR3 A;  1C8C A;  1OTC A;  3M4Q A;  3KUP A;  5ELD A;  2N55 A;  5AFW A;  4A3F G;  1VQO A;  4OHJ A;  2PNR C;  1CZG A;  3NQT A;  2XRS D;  4K6L A;  2PYK A;  5IWA Q;  3S2D H;  1QOH A;  1B1Z A;  5HGT A;  3CME A;  1R4Q B;  3A7L A;  1N33 L;  1A0I A;  3MXU A;  3CAM A;  2B8G A;  3DHQ A;  1VCI A;  1A3U A;  2RVL A;  4AQY Q;  3OIP A;  3CXC A;  3IFT A;  3PGZ A;  1I50 B;  1J8I A;  1KTK A;  2D0P A;  1E1T A;  2M9V A;  3DUZ A;  4FF3 A;  4J1M A;  1SNP A;  4R4O A;  4UAI A;  3U9O A;  5AJ3 L;  3K5L A;  1IYJ B;  3AQQ A;  4K8J A;  4LMQ D;  2QIL A;  3H91 A;  3HOX H;  1HNX Q;  1IKM A;  1AH9 A;  3K7U C;  4X3K A;  1FGB D;  2K5W A;  3M7N A;  4C2M H;  1SYE A;  3TS0 A;  4XT3 B;  3D0F A;  3OPO A;  3Q22 A;  1O7Z A;  5IOD A;  5EPL A;  2X69 A;  4ABN A;  3TP5 A;  2A19 A;  1HUN A;  2XIW A;  5KNB A;  1Z9F A;  1WCM H;  3ONA B;  3WDN A;  4APV A;  1YJN A;  2JA8 G;  5IGE A;  1Y1W H;  4DV7 L;  4LF7 Q;  1LTR D;  1UNS A;  4GKK L;  1MSH A;  1STH A;  4DKA C;  3DEP A;  3BVZ A;  1B8A A;  1LT6 D;  5M5W B;  4LF9 Q;  3E5S A;  1B3Q A;  2MHV A;  3RNU A;  4A3J H;  3A56 A;  3FP9 A;  2OCE A;  4C3H B;  3SVM A;  4N9T A;  3T1H L;  1YJW A;  4WJW A;  3S2D B;  3I4N G;  3M4Y A;  3J7A F;  2BA1 A;  1RIP A;  1DZ1 A;  2QGQ A;  1DCZ A;  2UU9 Q;  2D9U A;  2E2J H;  4NKL A;  5JJZ A;  2WP8 J;  5M3M H;  1SBB B;  3I91 A;  5CGK A;  4JI4 L;  1HNZ L;  2Z0S A;  2ATW A;  4GOP C;  3ERS X;  3S1R H;  1EEI D;  2NWG A;  3FKI G;  1RJT A;  5EAY A;  5EPJ A;  5KIX A;  2KHI A;  4X65 L;  3HOX B;  3NK9 A;  1TS3 A;  2QEJ C;  1WD1 A;  5FLX L;  1TWH B;  3KJO A;  1G2T A;  2LFN A;  1HCZ A;  2K5Q A;  2V1C C;  5LL6 S;  2B2U C;  3DEO A;  5NUC A;  4XYQ A;  2XN9 C;  1I4X A;  1MHW C;  1PZI D; 
#chains in the Genus database with same CATH homology
 1UE5 A;  4LWC A;  2IHF A;  5BR8 Q;  5IYB G;  4A3K H;  1YNX A;  2VQF L;  2ZTD A;  1U5K A;  1N9W A;  5C4X H;  1L1O C;  4BBR G;  3RLN A;  5HGQ A;  2F3I A;  1VQM A;  2F4V Q;  4LUV A;  4P71 A;  1VQH A;  4HJ7 A;  4A76 A;  4DR4 Q;  4HJ8 A;  3L0O A;  3F2D A;  1KXL A;  1V9P A;  3KJP A;  4HJ5 A;  2AKW B;  3J80 i;  4IPC A;  3UE0 A;  4DV2 Q;  1XNQ Q;  4JI4 Q;  2PI2 E;  1X6O A;  2UUA L;  2Q2I A;  2YU9 H;  4A3D H;  4IOC A;  2KHJ A;  5IP9 G;  3HKZ E;  2K5N A;  4C3H H;  1PHJ A;  4HJA A;  2IHE A;  4BBS H;  4NPS A;  2EQS A;  3TRZ A;  1JE5 A;  3OYY A;  1UE7 A;  2I0Q A;  2HIV A;  3KOJ A;  1N8R C;  4DR1 L;  1SE8 A;  5FJ8 H;  5E7N A;  1EQQ A;  4AIM A;  1EFW A;  4JOI A;  4DR3 Q;  3VDY A;  4JI8 Q;  1YZ6 A;  5LMU L;  2BH2 A;  4P72 A;  1SFO H;  4YCU A;  1X55 A;  1HNW L;  4A3M G;  4DV1 L;  1HZB A;  1WFQ A;  3AYH B;  4B3S Q;  1X65 A;  2BH8 A;  4YCW A;  2QEX A;  1VQC A;  2R6G A;  3EIV A;  1XNR Q;  1VQG A;  2MFI A;  1Y14 B;  1VQL A;  1VQF A;  3I4O A;  3HOY H;  4OWX B;  5LMN W;  2NVY H;  2VQF Q;  3U50 C;  3ULJ A;  1YHA A;  3PO2 G;  3U4V A;  4LFB L;  3TRE A;  2D0O A;  3KYH C;  1MJE A;  1FGU A;  1KRS A;  1RL2 A;  2IX0 A;  2ZM6 L;  3H15 A;  4OWW B;  2ID0 A;  3K80 C;  3J81 j;  2B63 G;  5C0X I;  3W5O A;  5GAD C;  1XJV A;  1PH3 A;  4LF5 L;  1TWH H;  3OTO L;  1YHQ A;  2UUA Q;  2NN6 I;  2HHH Q;  2VUM G;  2WB1 G;  2R93 H;  1EWI A;  4L5T A;  5LMN L;  1QUQ A;  4JYA L;  1YIJ A;  1P8L A;  2XGT A;  3KDF B;  2E2I H;  3EBE A;  2CQO A;  2XTI A;  3STB D;  4BA1 I;  4DR1 Q;  1YJ9 A;  3D31 A;  1JJ2 A;  2JA7 H;  5FLM G;  4OWT B;  2JA5 G;  3GTQ H;  4TVA B;  3BJU A;  4YHH Q;  3CPW A;  1C9O A;  3PUY A;  1CSP A;  5LMU Q;  1BKB A;  4B3M Q;  1E7Z A;  5GAH C;  4A4I A;  4R4I A;  4R1J A;  2H5X A;  1HNW Q;  2MO0 A;  4POF A;  4PZ8 A;  1K9M C;  3S17 H;  1KHI A;  4GKJ L;  3F1Z A;  5ELN A;  4DV6 L;  1QVF A;  3S1M H;  2OWO A;  3GTO H;  3GTK H;  5IYC H;  1VQ9 A;  4OX9 L;  1PH9 A;  4BXX G;  1XTD A;  4LFB Q;  4DPG A;  4GOP B;  1PH2 A;  2JA6 H;  2YTY A;  4PMW A;  4KHP L;  4NXM L;  2VL6 A;  2LSS A;  1A62 A;  5C0X J;  5J3B A;  4FDB A;  2ZM6 Q;  2LXK A;  1IBL Q;  3L2P A;  1G29 1;  2RF4 A;  4GN5 A;  3NEL A;  4YWL A;  4LFA L;  2K50 A;  4P75 A;  2IT1 A;  3PF5 A;  4DV5 Q;  2GVA A;  3PSI A;  1OXT A;  2RHQ B;  1NE3 A;  1TWC H;  3F2C A;  3ICE A;  5GAG C;  5K36 G;  4QGU A;  4DUY Q;  4A93 G;  1I6H H;  2WB1 E;  2PNH A;  5BR8 L;  3GTM H;  3GO5 A;  1X9N A;  3HOW G;  1D7Q A;  4QQB X;  3MEF A;  3K8A A;  1VQ7 A;  3M4P A;  4UY8 C;  3PV0 A;  4A3I G;  1YIT A;  1JMC A;  1MIU A;  3S14 H;  3HOX G;  1FVI A;  4A3E H;  4DR4 L;  4J15 A;  1BBW A;  4LW1 A;  1WI5 A;  1XPU A;  1KL9 A;  3PUV A;  4DV2 L;  1L2F A;  3GTG H;  1H95 A;  1HJP A;  1L1O B;  2ZJR A;  4B3R Q;  4A3L H;  1SN8 A;  1VQI A;  1YVC A;  5M3F G;  4HIM A;  1X54 A;  1Y1V G;  2KCT A;  3PO3 H;  4DR6 L;  4GKJ Q;  1PVO A;  3SGI A;  3ZJY C;  3CC2 A;  2NVQ H;  1NBW A;  3J80 c;  3PIO A;  1J5E L;  2K14 A;  2B3G A;  2Q2U A;  1VQ4 A;  1OXV A;  4KHP Q;  3STB C;  2CWA A;  1WCM G;  1YI2 A;  4C3I H;  4A3F H;  4RMF A;  4IFD G;  2PQA A;  2PMZ E;  1Q7Y C;  4JI8 L;  1D8L A;  1MJC A;  4UP7 A;  1Y1W G;  2K5V A;  2WFW A;  2IY5 B;  1P16 A;  4GNX A;  4LFA Q;  4B3S L;  4DR2 L;  4DV3 Q;  1PA6 A;  4JV5 L;  1C7Y A;  1N32 L;  2JJQ A;  1I3Q H;  1XNR L;  3I2Z A;  2N3S A;  2E8G A;  4HIK A;  3CW2 C;  2K4K A;  1K73 C;  1YEZ A;  4A3J G;  4JI0 L;  3M4O H;  2NZH A;  1VQA A;  4L5Q A;  3JAM i;  2ZTC A;  2NZO A;  4IPH A;  1HR0 W;  1VQN A;  2N49 A;  3GTL H;  3NBH B;  4PG3 A;  1XPR A;  1S40 A;  1ASY A;  4BY1 G;  2Q2H A;  3UDI A;  3DM3 A;  4GS3 A;  1BVS A;  3B6Y A;  3TEH B;  4AYB G;  4DV0 Q;  2MO1 A;  3CD6 A;  2HHH L;  3HOZ H;  2BA0 A;  3DLL A;  2WAQ G;  4DR6 Q;  2NVT H;  1UE1 A;  1I94 L;  1LTL A;  2JK8 A;  3HFZ B;  3CCU A;  1J5E Q;  2CKZ B;  2R92 G;  4JOI C;  1NTG A;  3KF6 A;  1TWF H;  5M3M G;  2Y0S E;  1HR0 L;  5IT9 c;  2N78 A;  4YHH L;  5HY6 A;  3I4M H;  1NJI C;  1OXU A;  1PYS B;  4B3M L;  5C44 H;  1HZC A;  5M5Y H;  1VQ8 A;  1CKN A;  3GDE A;  3RR5 A;  3AEV A;  3HOV G;  4DR2 Q;  4JV5 Q;  4MNO A;  1EYG A;  2Q2T A;  1N32 Q;  4DK6 C;  3AFP A;  2JA8 H;  1L0W A;  1BBU A;  2R7Z H;  3ER0 A;  3H0G H;  4JI2 Q;  4OON A;  4YWM A;  5IP7 G;  1V1Q A;  1QVG A;  1Q8K A;  4X64 L;  1VQJ A;  4YCV A;  4JI0 Q;  4A3C G;  2YYZ A;  3JC6 6;  1ASZ A;  2AMC B;  3L7Z C;  2OTL A;  4A3B G;  1K83 H;  1X3F A;  1PH4 A;  3HKS A;  4BXX H;  3OW2 A;  1LYL A;  1Q86 C;  1IBL L;  4A3G H;  5IYD H;  2JEB I;  3BU2 A;  5DLQ E;  1GKH A;  3KF8 B;  1KAW A;  4NB3 A;  1CKM A;  1OXX K;  4QL5 A;  4R4C A;  4DV5 L;  3LGJ A;  4AYB E;  2ASB A;  4A3K G;  1CSQ A;  1E3P A;  4DUY L;  1PYB A;  3G6E A;  2F52 A;  1SMX A;  4KLK A;  4MTN A;  4R4Q A;  4JI1 L;  2B29 A;  1I94 Q;  3I4N H;  4PZ7 A;  1K8A C;  4LFC L;  1IBK Q;  1J6Q A;  1SRU A;  4IPD A;  1LM0 A;  5GAE C;  1KIX A;  1PH8 A;  3CF5 A;  1SR3 A;  5C3E H;  1HR0 Q;  1PH6 A;  1G51 A;  2C35 B;  1IXR A;  1YHB A;  2HT1 A;  2YTX A;  1FL0 A;  2RHS B;  2DUD A;  4B3R L;  3CCM A;  5JEA J;  3GTP H;  1B70 B;  1KRT A;  3S15 H;  3CP0 A;  4BBS G;  1KD1 C;  2JQO A;  4Y52 H;  3PUW A;  5IY0 A;  3CCS A;  2HQL A;  1W2B A;  1QZG A;  3CCQ A;  5GQO A;  1Z47 A;  3UDX A;  5FJ8 G;  4EX5 A;  3G4S A;  5M3F H;  1TXY A;  1EUJ A;  3A74 A;  3FKI H;  4X64 Q;  5JJL A;  4LF4 L;  4GN3 B;  4GLV B;  1VQB A;  3E9I A;  3M85 A;  1NMG A;  1UEB A;  1UE6 A;  3HOU H;  4LNQ A;  3PF4 A;  1N33 Q;  4DV3 L;  3HOY G;  3A0J A;  1OXS C;  5M5X H;  1XMQ L;  1GD7 A;  4JI1 Q;  4JI6 L;  1IBM L;  4C3J H;  2K52 A;  1I5F A;  4LFC Q;  1CKO A;  2A8V A;  5JJK A;  2OTJ A;  3K81 C;  5ELO A;  3J81 i;  3A5Z B;  2K75 A;  1K8G A;  5IYB H;  2Z6K A;  4HID A;  4BBR H;  5AJ3 Q;  1JJG A;  1WOC A;  4LF8 L;  1VQ5 A;  4YY3 L;  4JBJ A;  4DK3 C;  4DV0 L;  4O0A A;  2L15 A;  2UXC L;  2R93 G;  1X3G A;  2A1A A;  4JC0 A;  3JAM c;  3J7A 5;  2KEN A;  1WJJ A;  2DGY A;  4RG1 A;  2CFM A;  4IJL A;  5IE8 A;  4DR7 L;  2MNA A;  3F8T A;  3KDF A;  2MQH A;  2JA7 G;  2IX1 A;  1SRO A;  3KLW A;  4KHZ A;  2VS1 A;  2AWN A;  4JG2 A;  5IP9 H;  2D62 A;  3S2H H;  2GVB A;  3CCJ A;  4LF4 Q;  2AHO B;  5C0X G;  2EXD A;  2KCM A;  4GNX C;  4DR5 Q;  4LUO A;  4ALP A;  5H1S E;  4X62 L;  4L5R C;  2NN6 G;  3W1B A;  1I50 H;  4LF6 L;  4K0K L;  2R7F A;  3PUX A;  1E22 A;  1FJG L;  3EN2 A;  2HIX A;  1HZA A;  3GD7 A;  1HH2 P;  1QVC A;  1PFS A;  4BY7 G;  4GLX A;  1X56 A;  1EIF A;  2VY3 A;  1XMQ Q;  3HKZ G;  4A3M H;  2E5L L;  2JA6 G;  4JI6 Q;  1EOV A;  1Q82 C;  1IBM Q;  2NVX H;  4GOP A;  4JI2 L;  2I5M X;  4IPG A;  2ZJP A;  3CCR A;  2JA9 A;  3PUZ A;  1CUK A;  1O7I A;  1VQD A;  5IWA L;  3E0E A;  4DNI A;  3J7Z C;  1PH5 A;  3PO2 H;  4LUZ A;  3TS2 A;  4OO1 G;  3KFU A;  3CCL A;  4GN4 B;  2UXB L;  3IRB A;  1VQP A;  2UXD Q;  1X3E A;  4DV4 L;  4NXN Q;  4A3C H;  4LF8 Q;  4JI3 Q;  1U0L A;  4YY3 Q;  2UXC Q;  3T1H Q;  1GO3 E;  3T1Y L;  2ZJQ A;  1IL2 A;  4R4T A;  1UWV A;  5FLX c;  3ULP A;  2B63 H;  1E24 A;  4DR7 Q;  4UP8 A;  4AQY L;  1Q12 A;  4X6A H;  4POG A;  4JBW A;  2ES2 A;  3A5U A;  1IBK L;  3W1G A;  4AH6 A;  2VUM H;  1VQE A;  4A3E G;  4DAM A;  4DUZ L;  1QUQ B;  2R7D A;  4Y7N H;  1Q1B A;  2LXJ A;  1GVP A;  4JI7 Q;  4A3L G;  1L1O A;  1A63 A;  4X62 Q;  4LF6 Q;  1VQK A;  1N36 L;  3H3V I;  3K0X A;  5M5W H;  5FLM H;  2JA5 H;  1FJG Q;  1HNX L;  3PO3 G;  4K0K Q;  1AE3 A;  1HNZ Q;  1OTC A;  1XMO Q;  2OQK A;  2UUC L;  2UUB L;  1EQR A;  1M1K C;  3CC7 A;  3M4Q A;  2E5L Q;  3TQY A;  3Q8D A;  1K0R A;  4WJ3 M;  4HIO A;  3G48 A;  4X65 Q;  4A3F G;  1VQO A;  2ZTE A;  4XIG S;  3RN5 A;  1HZ9 A;  3S2D H;  5IWA Q;  1JT8 A;  2GN5 A;  1LUZ A;  3FHW A;  2UXB Q;  3CME A;  2VZA A;  3F2B A;  4DV4 Q;  4B3T Q;  3H3V H;  1E1O A;  3UDG A;  1N33 L;  2KBN A;  1A0I A;  3BZK A;  3I55 A;  3CAM A;  4JI5 L;  3T1Y Q;  1C0A A;  1AE2 A;  4LF7 L;  1VCI A;  4QIW E;  2WAQ E;  5C4X G;  4AQY Q;  3CXC A;  1PH1 A;  3S1Q H;  3PGZ A;  4P74 A;  2D0P A;  5C4J H;  4LF9 L;  1E1T A;  4DUZ Q;  1JB7 A;  2JE6 I;  4A93 H;  2PI2 A;  4JBM A;  3HOW H;  5GRO A;  4R4O A;  1Q81 C;  4O2D A;  4XTC S;  2CWP A;  4PZ6 A;  5AJ3 L;  2CCZ A;  1IYJ B;  3AQQ A;  3HOZ G;  1W3S A;  2ALY B;  4H02 A;  4A3I H;  1N36 Q;  1A8V A;  3ULL A;  1R9T H;  3HOX H;  4A3D G;  1HNX Q;  4IFD I;  1AH9 A;  3K7U C;  3J81 c;  1DGS A;  2OQ0 A;  3M7N A;  4C2M H;  2UUC Q;  2UUB Q;  3TS0 A;  3S16 H;  2AWO A;  1SLJ A;  1NY4 A;  3D0F A;  1JJC B;  1K3R A;  3CQZ H;  1PH7 A;  3UDF A;  3RZD H;  1Y1V H;  2YV5 A;  4OXP A;  3I4M G;  3RZO H;  2A19 A;  2UU9 L;  3MXN B;  4X66 L;  5C44 G;  4DR5 L;  3M3Y H;  2VNU D;  3RLF A;  1YBY A;  2I5H A;  1Z9F A;  3GTJ H;  1WCM H;  4ME3 A;  2PQA B;  1YJN A;  4APV A;  3S24 A;  1KQS A;  2JA8 G;  4JI5 Q;  4OO1 I;  1Y1W H;  4DV1 Q;  4DV7 L;  4UP9 A;  4HJ9 A;  4LF7 Q;  4GKK L;  4GNX B;  2R7Z G;  3H0G G;  3WWV A;  4DKA C;  4IO9 A;  1B8A A;  4QJF A;  1Q1E A;  3CCV A;  1MKH A;  2Z6K C;  1T9H A;  1VS0 A;  4LF9 Q;  4BY7 H;  4P73 A;  3AFQ A;  3RNU A;  3E9H A;  2FXQ A;  4MZ9 A;  5IYD G;  4A3G G;  4GLA C;  2QA4 A;  1KC8 C;  2UXD L;  4A3J H;  3UE1 A;  2VQE L;  4IFD J;  4NXN L;  3FP9 A;  2OCE A;  4JI3 L;  4YWK A;  4TQU S;  3S1N H;  5JEA G;  2N8N A;  1EIY B;  3T1H L;  4LF5 Q;  1YJW A;  3OTO Q;  1S72 A;  1N34 L;  4BY1 H;  3I4N G;  1TWA H;  5JJI A;  3CPF A;  2BA1 A;  1RIP A;  2JEA I;  4A75 A;  1Q46 A;  5LMN Q;  4JYA Q;  5C3E G;  3BZC A;  1IZ6 A;  1WYD A;  1M90 C;  2K5H A;  2QGQ A;  4JCV E;  4JBK A;  4JI7 L;  3CC4 A;  3U58 A;  2F4V L;  3NEM A;  3U4Z A;  1TWG H;  2UU9 Q;  4L5S A;  4X66 Q;  3KF6 B;  1VQ6 A;  2R92 H;  2E2J H;  4KI0 A;  3CCE A;  3G71 A;  2WP8 J;  4QY7 A;  5M3M H;  3NEN A;  1B7Y B;  1XNQ L;  2EIF A;  3K7A H;  4JI4 L;  4WJ4 A;  1HNZ L;  2Z0S A;  4UPA A;  4GOP C;  4DV7 Q;  3ERS X;  5IYC G;  3S1R H;  1CKN B;  1XMO L;  4GKK Q;  4IOA A;  3PIP A;  3HOV H;  3FKI G;  1QZH A;  5EAY A;  4DV6 Q;  2KHI A;  4X65 L;  4OX9 Q;  3RLO A;  2VW9 A;  3I7F A;  2ATW A;  3HOU G;  3KJO A;  2Y0S G;  3I56 A;  5IP7 H;  4NXM Q;  1XPO A;  2RCN A;  1GM5 A;  2VQE Q;  4DR3 L;  4B3T L;  3RN2 A;  4BA2 I;  2V1C C;  3M9B A;  4A3B H;  1G6P A;  4IJH A;  2I5L X;  1S3O A;  3PCO B;  2YTV A;  1N34 Q;  1V43 A;  2E2H H;  4EQ5 A;  4DAY B;  1NMF A;  1PV4 A;  3CMA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...