4DV7L

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a915g, bound with streptomycin
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
124
structure length
123
Chain Sequence
b'PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 13
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dv7L00
1VQAA 3PO3G 3HOUH 4A3BG 5GAGC 2UUCQ 3I4NG 4BXXH 2EQSA 2A19A 1VQ4A 2MFIA 1VQMA 4A3CG 1B7YB 4GLAC 4WJ3M 4XTCS 2RHSB 3CW2C 4A76A 1VQ7A 2RF4A 1KXLA 4DPGA 2JA6G 4DR6L 3AQQA 3H0GG 3KYHC 1LM0A 2NVYH 1PH2A 1ASYA 1GO3E 4O2DA 2IHEA 3D0FA 2R7ZG 4JYAL 3NBHB 4P74A 4A75A 1WJJA 5DLQE 4QL5A 4A3KG 5E7NA 2KCTA 4TQUS 4OXPA 1HZAA 2QGQA 3L0OA 4PZ6A 4DKAC 4X62L 3J81c 3GTQH 1HH2P 2OTLA 1JJCB 1H95A 4GOPC 4IPHA 2UU9Q 1TWFH 1PH8A 5JJKA 3KFUA 4JI8L 4YHHQ 1R9TH 4A93H 3PUXA 3U4ZA 1VQEA 2JK8A 4DUYQ 4GKKQ 3UDGA 1Q86C 2V1CC 4C3HH 1Q81C 4A3EG 5M5XH 1QVFA 3M4PA 3AFPA 5C44H 1E7ZA 3PO2G 4C2MH 4GN4B 4DK3C 4Y7NH 4GLVB 3A0JA 3M85A 4DUZQ 4DV4Q 4GOPA 4LF9Q 1WYDA 1RL2A 1TWAH 2GVBA 3KDFB 4B3RL 3ULLA 2CKZB 1KHIA 3KLWA 4POGA 3I7FA 4YY3Q 1FJGQ 1N33L 2KHIA 4R4IA 2UXCL 4NXML 2ZJRA 4JI7Q 2VQFQ 5C4XH 1BKBA 1E22A 2BA0A 3IRBA 3LGJA 1YVCA 4YCUA 4ALPA 3J7ZC 3TQYA 1G291 3E9HA 4HJAA 2UXDQ 1EIFA 3CC2A 2R92G 5EAYA 3PUVA 1WCMG 4OX9Q 3F2DA 1YJ9A 1WOCA 3F1ZA 3S2HH 2OCEA 3GD7A 1IBML 3TS2A 5H1SE 1BBUA 2HIXA 4X64L 1PHJA 3E0EA 2WAQE 1UE6A 3KJOA 2JA9A 2JJQA 3FKIG 3GO5A 4L5RC 3GTKH 1PH5A 4DAMA 2Z6KC 5C3EH 4BBSG 1YNXA 4BY1G 4A3JG 2D0OA 1XNRL 2IY5B 2CQOA 4PZ7A 1VQHA 2N3SA 2ZTCA 1SLJA 3Q8DA 5LMNW 4DV3L 4DV5Q 3H3VI 2K5HA 3HOXH 3G6EA 3EN2A 4A3FG 4A3GG 1T9HA 4GLXA 1XPOA 1NE3A 2MO1A 4LUVA 3SGIA 2EIFA 5M3FG 3CMAA 5IYDH 1NY4A 3CC4A 2N8NA 2F4VL 3D31A 2E2JH 4UP9A 1L0WA 3RLNA 3WWVA 5IE8A 1X56A 1GM5A 3S1NH 1Y1VH 2RCNA 4DV1Q 3PUYA 3GTJH 2NN6G 3DM3A 2K52A 2Z6KA 4HIDA 3PGZA 1Y1WH 1TWGH 3PCOB 4LFBQ 3PV0A 3CCSA 1HNXQ 4DR3L 2AWOA 4JG2A 1MJCA 3KDFA 1J5EL 1OXXK 5K36G 2MQHA 1JJGA 1PYBA 3JC66 3NELA 4NXNL 3A5ZB 3DLLA 5FJ8H 2VQEQ 4JI0L 3S1QH 2AHOB 2BA1A 2N49A 2F3IA 4HIKA 1CUKA 3G48A 2OQKA 5IY0A 2CCZA 2UUAQ 4PMWA 4PZ8A 2K75A 1E3PA 4L5SA 1TWHH 2VZAA 4EQ5A 1KIXA 4LF6Q 3TRZA 1SROA 4JI3L 1XTDA 3HOYG 4IPDA 1E1OA 5IYBG 1VQ8A 2NVTH 1IBKL 2VUMG 3HOZG 3OTOL 3I4MG 1K3RA 3A74A 1A63A 1OXUA 5JJIA 2Q2HA 4AYBE 3RLFA 1JMCA 2ATWA 4DV7Q 1A0IA 1K9MC 4JI5L 1JE5A 4P72A 3M9BA 2WB1G 4LFCL 2E5LQ 4JOIC 3T1HQ 2ZM6Q 1C9OA 3UE1A 1N34L 1B8AA 1VQFA 2CWPA 4YHHL 1PVOA 3K8AA 2YV5A 2HT1A 1B70B 3KF6B 1C0AA 1EQQA 1N8RC 1X54A 2R6GA 2I0QA 5C0XG 3CC7A 4IPCA 4DR4Q 4JI1Q 4A3LH 1XMQL 2AWNA 4FDBA 1IBLL 3BU2A 4LF5L 4LF8Q 3GTLH 1Q7YC 3T1YL 1CKNB 3JAMi 3PO3H 2WAQG 4A3MG 4B3SQ 5FLMG 3ERSX 3CQZH 4LF7L 1VQLA 2JA8G 3HKZE 3HOVG 1N32Q 1HNWQ 4HIOA 1I6HH 3CPWA 5GAHC 2K4KA 3BZCA 1YBYA 4DV0Q 1SN8A 3S17H 1FVIA 3A5UA 2I5LX 1OXTA 3OYYA 4B3ML 1FJGL 1PYSB 1UWVA 1X3FA 2E2IH 4DR1Q 3H0GH 2DGYA 4KLKA 1K0RA 1LYLA 3RZOH 1N9WA 2JEBI 4GNXB 4JI4Q 1UE5A 1X65A 1YHAA 2UXDL 4LWCA 4X66Q 4AQYQ 5GQOA 4JV5Q 2B3GA 2HIVA 2WP8J 1VQ9A 2UUBL 4DR7L 1BVSA 1VQJA 1EUJA 5ELOA 4HIMA 1Q8KA 4K0KL 1XPUA 4A3KH 4BA2I 2I5HA 1S72A 1U0LA 1XJVA 3S15H 1SR3A 5GADC 3ICEA 2VNUD 1SRUA 4MTNA 2RHQB 4DV2L 1PH4A 2K5VA 5IWAQ 1C7YA 5C44G 4JI6L 1N36Q 2Y0SE 4J15A 4O0AA 3RN5A 1W2BA 2R7FA 4BBRG 2JEAI 1GKHA 3K80C 2Q2TA 4C3IH 2YTXA 1VQNA 4DR2L 4LNQA 3J7A5 2IX1A 3RLOA 4LUOA 1EYGA 5HGQA 2DUDA 2NN6I 4OONA 4A3EH 5LMUL 2OTJA 4OO1G 1SE8A 2PMZE 2AKWB 4DV5L 4A3DG 4JBMA 1X3EA 1HJPA 2XGTA 4DR6Q 1IL2A 3E9IA 3STBC 3K7AH 1SMXA 3TEHB 1PV4A 3CD6A 2KCMA 2JA7G 1IZ6A 1A62A 3AFQA 3EIVA 3K0XA 3CCMA 1Z47A 5LMNL 2ZTEA 4GNXC 3S24A 4L5QA 4DR5L 2UXBL 1KAWA 4JYAQ 2EXDA 2R7DA 4P71A 1CKNA 1V9PA 2QEXA 4OWXB 4LFBL 3FHWA 1L2FA 4DV6Q 1I3QH 2GN5A 4A3IH 3J80c 3F8TA 4X62Q 3L2PA 2H5XA 1HNZL 2KHJA 2HQLA 1JJ2A 2Z0SA 1KC8C 3MXNB 5AJ3L 1HR0L 2PQAB 4JI8Q 2R92H 1I50H 4IOCA 1WCMH 2BH2A 4HJ7A 1K83H 4PG3A 3K81C 3F2CA 3ULPA 2XTIA 1XMOL 3FP9A 3I4OA 4KI0A 5J3BA 2K50A 1YZ6A 2AMCB 1TXYA 1KD1C 2CWAA 4P73A 5C4JH 3CF5A 2LXJA 3L7ZC 2OWOA 1KRTA 2Q2UA 4QY7A 2YU9H 3S14H 3HOWG 2I5MX 2MNAA 1YHQA 2ZTDA 4IOAA 3I56A 3HFZB 5C0XI 5M3MH 4BBSH 4JI2L 4BY1H 1D7QA 4IJLA 4A3JH 1VQOA 1V1QA 4APVA 5IP9G 1NTGA 4B3TQ 4B3RQ 4YWLA 1N33Q 4BY7H 2UUAL 2UXCQ 2E5LL 3W1BA 5IP7H 4NXMQ 2F52A 4A3FH 3CCEA 2A1AA 4GS3A 3UDFA 4JCVE 4A3GH 2UUCL 1Z9FA 5GROA 2R93H 5IYCG 5M3FH 1KL9A 4WJ4A 4KHPQ 1I94Q 4IFDI 2IHFA 2KBNA 1EWIA 1A8VA 1P8LA 2N78A 4AIMA 4L5TA 1S40A 1G51A 3GTPH 2YTVA 1IBMQ 3GDEA 2NVXH 4H02A 4DNIA 1PH6A 3BJUA 2JA5G 4MZ9A 4JC0A 1QZGA 3KF8B 1EIYB 1LUZA 1HZ9A 1PH9A 1Q1EA 4A4IA 4QJFA 1HNWL 2OQ0A 2A8VA 4GKJQ 3GTMH 4IJHA 2C35B 4GN3B 2B63G 1PH1A 2E8GA 3S1MH 1XNRQ 3S1RH 1SFOH 4A3BH 2QA4A 1PFSA 2VS1A 1LTLA 4BA1I 4DV3Q 2UU9L 2ID0A 1X9NA 3HOYH 3HOZH 5IYBH 1QZHA 3HKSA 4DUYL 3CCJA 1MJEA 3CCLA 2VUMH 3HOUG 4JBJA 4GKKL 4BXXG 4X66L 2JQOA 5M5YH 3I4MH 3ER0A 1L1OB 2F4VQ 3PSIA 3ZJYC 1X6OA 1W3SA 5C0XJ 4OO1I 1VS0A 1YITA 3AEVA 2ALYB 1MKHA 4A3LG 4LFAQ 3H3VH 4KHZA 4LW1A 1UEBA 4UP7A 1CSPA 3RZDH 5HY6A 3G71A 1QVGA 4JOIA 4DUZL 4DV4L 4DR3Q 1PH7A 4LF9L 1DGSA 4DK6C 2NVQH 3I4NH 1K73C 4A3CH 1VQDA 2IT1A 1J5EQ 3M4QA 4IFDG 1VQ5A 4NXNQ 5BR8Q 4JI0Q 4YY3L 4IFDJ 4JBKA 4X65Q 4JI7L 1NBWA 2JA6H 2VQFL 1YEZA 4POFA 1NMFA 1MIUA 3CCUA 4LF4Q 4R1JA 2HHHQ 1XNQQ 3RR5A 4QQBX 4R4CA 3ULJA 3U58A 1YIJA 3UDIA 4JI3Q 4OWWB 2R7ZH 4A93G 4OX9L 4A3MH 1J6QA 5FLMH 4YWKA 2JA8H 1IBKQ 3HOVH 3H15A 3OTOQ 3AYHB 4R4QA 2YYZA 1CSQA 2L15A 3STBD 4R4TA 1L1OC 4YCWA 4DV6L 2NZHA 4ME3A 1K8GA 1P16A 1WI5A 4JI5Q 1VQIA 3PUZA 3U50C 4LFCQ 3I2ZA 1V43A 1YJWA 1ASZA 1O7IA 4TVAB 4X6AH 1VQCA 1WFQA 4YWMA 3TREA 3PIPA 1N34Q 3NEMA 2IX0A 1VQGA 4GN5A 1D8LA 4RMFA 1OTCA 1E24A 1PA6A 1XMQQ 1GD7A 1IBLQ 3KF6A 4LF5Q 4IO9A 3PF4A 1S3OA 3GTGH 3J81j 3PO2H 4QIWE 3T1YQ 5C4XG 2YTYA 1L1OA 3CPFA 1VQPA 1JT8A 3S2DH 1EQRA 4MNOA 3CMEA 4BBRH 3U4VA 4LF7Q 1M90C 4DV1L 3W5OA 4AYBG 3I55A 4B3TL 2LXKA 1HNXL 3MEFA 2WB1E 1QUQB 2KENA 4A3DH 4B3MQ 2WFWA 1QVCA 2PI2E 4A3IG 3PF5A 3KJPA 3TS0A 1E1TA 1FL0A 2VQEL 2JA7H 1IYJB 4KHPL 5C3EG 1IXRA 1I94L 3VDYA 1KQSA 1Q82C 3NENA 4GNXA 4Y52H 4DR7Q 2UUBQ 4LF6L 3K7UC 4K0KQ 1VQKA 2ZJQA 3M3YH 3HOXG 1NJIC 4NB3A 3GTOH 1X55A 3FKIH 2PI2A 3RN2A 3JAMc 3G4SA 2E2HH 5IYDG 4DV2Q 4P75A 2D62A 1FGUA 2VL6A 4JI6Q 4IPGA 3UDXA 3HKZG 5M5WH 3CCRA 4GKJL 3PIOA 2K14A 4DV7L 4DR2Q 1NMGA 4RG1A 1Y1VG 3UE0A 5M3MG 1XPRA 1BBWA 1Y1WG 3CCVA 2MO0A 2CFMA 5LMUQ 2ZM6L 3T1HL 1U5KA 4UP8A 3J81i 1M1KC 3F2BA 3BZKA 4BY7G 3W1GA 2BH8A 5IP7G 1HR0W 2B29A 1PH3A 1Q12A 1YJNA 1VCIA 2R93G 2VW9A 5FJ8G 3PUWA 4DR4L 3HOWH 4JI1L 1YHBA 5LMNQ 1VQ6A 4DR5Q 5GAEC 4LF8L 2UXBQ 3CP0A 1UE1A 4XIGS 1K8AC 1Q1BA 4X64Q 5IP9H 1Q46A 4UY8C 2GVAA 4YCVA 4HJ5A 4R4OA 1OXSC 5IT9c 4B3SL 3CCQA 1AH9A 1N32L 1HNZQ 2Y0SG 5IYCH 5FLXc 5JJLA 4HJ8A 1RIPA 5AJ3Q 3EBEA 1HR0Q 1KRSA 1EOVA 1QUQA 1CKMA 4DV0L 1HZBA 5ELNA 5BR8L 4X65L 3S16H 4DR1L 2PQAA 4JBWA 4LFAL 1GVPA 2JE6I 4DAYB 2ZJPA 3RNUA 1XMOQ 1Y14B 2HHHL 4LF4L 4JI4L 1XNQL 3M7NA 2Q2IA 3OW2A 3B6YA 2JA5H 1AE2A 1AE3A 2FXQA 4AQYL 1EFWA 4JV5L 4UPAA 4AH6A 1YI2A 4HJ9A 5JEAG 4C3JH 1G6PA 2PNHA 3CAMA 2K5NA 5JEAJ 3CXCA 2NZOA 2ASBA 1CKOA 4NPSA 2LSSA 2B63H 2VY3A 4JI2Q 1I5FA 1TWCH 4GOPB 1X3GA 3M4OH 4OWTB 1UE7A 4QGUA 4EX5A 1JB7A 5IWAL 2ES2A 1VQBA 1HZCA 3KOJA 1N36L 2D0PA 4LUZA 1OXVA 3J80i
chains in the Genus database with same CATH superfamily
1VQAA 1D2BA 4BXXH 2A19A 5C0XH 1BOSA 2EOTA 5FK9C 3DHQA 3MXUA 4DFAA 2RHSB 4C3JB 4A76A 3KYHC 1K3BC 2NVYH 5DEHA 5C5LA 1U4MA 3TZDA 2F0DA 3HOUB 4IFDH 3NXWA 5L37A 1K0SA 1QJOA 4A75A 2F0UA 4TQUS 2PZWA 4PZ6A 4V0BA 5JJKA 4JI8L 1VMCA 2FINB 4GKKQ 3CRLC 4XT3B 2V1CC 1Q86C 4KD4A 5M5XH 3UI2A 3QO2A 3W2DA 1HXYD 3OIPA 4GN4B 4Y7NH 4GLVB 5IT9E 2E2IB 3A0JA 4DV4Q 4GOPA 4A93B 3RZOB 5T1IA 1RL2A 1TWAH 1H9JA 2QKIC 1S5DD 3ULLA 1IYUA 2CKZB 4FVMA 3CKIB 3KLWA 2UXCL 3W3AA 4C3HB 2VQFQ 1BKBA 1E22A 2F0KA 3LGJA 4ALPA 2N55A 2O5JC 4WJWA 2UXDQ 3VR2A 4X3KA 5EAYA 4TSSA 1V1OA 1H9SA 1BBUA 2HIXA 4QB4A 3E0EA 1JB3A 1UE6A 1F9PA 1RD9D 1ESRA 5C4XB 3GTKH 1PH5A 3FPPA 5CR3A 2A69C 4BBSG 2D9UA 1YNXA 2IW3A 4BY1G 5BN5A 2IY5B 1XNRL 1TS4A 5CV5A 2L0CA 1ILQA 3TP7A 2ZTCA 4DV5Q 5CC4A 3EN2A 4QUCA 5KNBA 1WTOA 1XPOA 1EY5A 1KNEA 1I3QB 2B2VC 2K5DA 4R9WA 3OOCA 1EY9A 1L0WA 3RLNA 2RCNA 5C3EB 1YNND 3DM3A 3Q6SA 2Z6KA 1Y1WH 1TWGH 3JAML 4OIKA 3QOLA 2F0SA 2L55A 1LTID 2XN9C 4DR3L 4JG2A 1Y8OB 3HOXB 2HDLA 4E6IA 3QJYA 1J5EL 2MQHA 2K5WA 3EFXD 3NELA 4NXNL 3A5ZB 3DLLA 2VQEQ 4JI0L 2BA1A 1ONLA 1V8QA 1CUKA 2E2JB 3HKZB 1BUVT 2VZAA 4LF6Q 1Y1VB 5M3MB 1SROA 3NHHA 3SXHA 3HS0C 2NVTH 1PTOB 1IBKL 3D4WA 1A63A 2EYOA 1GOZA 2ATWA 4AYBE 1JMCA 3Q22A 4JOIC 3T1HQ 1C9OA 1N34L 2CWPA 4YHHL 2AUJD 1ENAA 1ET6A 1HUNA 2YV5A 1B70B 2KCCA 4HMJA 2R6GA 1A2TA 1N8RC 4IPCA 4JI1Q 4A3LH 2F0LA 3BU2A 4WRDA 1TVXA 4RGMA 4CDDC 3IL8A 2PMZB 4B3SQ 2QDBA 3ERSX 2JA8G 3HOVG 1HNWQ 1PTOC 3CPWA 5GAHC 1Y8NB 2K4KA 1YBYA 4JVZA 3P20A 1SN8A 2I5LX 4DN4M 1X3FA 2K01A 3GTLB 5COYA 1YHAA 4NKLA 5CORA 2F3VA 1TY2A 4X66Q 1GHKA 4JV5Q 2B3GA 3PO3B 2HIVA 3FRPB 3CQZB 1EUJA 1Q8KA 3SDZA 3S17B 5GADC 5ISRA 2QDLA 4DV2L 2PZUA 3IFDA 1CFMA 1UAPA 2Y0SE 4J15A 4O0AA 5DAUA 4BBRG 2JEAI 1EU4A 1SMYD 4Z9CB 4LNQA 5FO8B 1D6EC 3DM1A 3DWAA 1EYGA 2K32A 2DUDA 4KKTA 4UAIA 2EVBA 4OO1G 1SE8A 2AKWB 4JBMA 4ZUIA 1EYDA 3E9IA 3LWUA 1EZ6A 2NWGA 3K7AH 1PV4A 1SNMA 1IZ6A 4J6HA 2JA7G 1Z47A 2UXBL 4C3IB 3J7AF 2R7DA 3OHXC 4L63B 2E76C 1V9PA 3BVMA 4OWXB 1L2FA 2JN4A 3NBHA 4A3IH 2NYZD 4B9XA 3L2PA 1JJ2A 2Z0SA 1KC8C 2K05A 3MXNB 1E2ZA 2M2LA 4HJ7A 2K28A 4PG3A 5C5MA 3HGBA 3F2CA 4KI0A 1W6JA 1YZ6A 1TXYA 1KD1C 4TRDA 2LXJA 1HFNA 3C1FA 2YU9H 1A3UA 3MFYA 1STEA 4KJNA 5NUCA 3HOWG 4IOAA 2B8GA 1YHQA 1CQVA 2KHSA 2L4NA 3HFZB 5C0XI 4BBSH 2R92B 3RMHA 4BY1H 5TSSA 3KLSX 4HMIA 4B08A 4B3TQ 1K83B 4KMUC 1GUSA 2F0FA 2QEJC 4BY7H 2E5LL 1B50A 3CCEA 4GS3A 2R93H 5GROA 5IYCG 1KL9A 5C4JB 4KHPQ 4IFDI 4CBVA 4J1MA 1LT5D 1WTXA 4L5TA 3GTPH 1JOKA 3OWEB 3VR6A 3BJUA 3BVGA 1EYCA 1KABA 1F9QA 2QCPX 1LUZA 2DN8A 3C2PA 4QJFA 4C3JG 4GKJQ 1YNJC 4GN3B 5CGKA 3S1RH 2XWJB 2F3WA 1PFSA 2VS1A 1GUGA 4BA1I 4DV3Q 1B3QA 2NVXB 1QZHA 3HOUG 3CCJA 1MJEA 4GKKL 5M5YH 1L1OB 3PSIA 5C0XJ 1TS5A 1Q90A 2LMCB 4LFAQ 2RA4A 1JE4A 1QOHA 1QVGA 4RGTA 4DV4L 2NVQH 1XXGA 1PH7A 4DK6C 2RCFA 1VQDA 1VDZA 5BR8Q 2PZTA 3KLRA 4IFDJ 1RKNA 3I4MB 1NBWA 2VQFL 1YEZA 4K5WA 3CCUA 2ICIA 1XNQQ 4R4CA 4HR7B 3U58A 1YIJA 4JI3Q 1PRTD 1FNVA 2R7ZH 4A93G 1J6QA 1H9SB 4YWKA 1TU2B 3JAME 2JA8H 3NBIA 3HOVH 1I4XA 4ME5A 2BOSA 4CKCA 1WD0A 4C3HG 1ZYRC 1EU3A 3SK6A 1CSQA 3STBD 2L15A 1L1OC 5IGFA 4XDXA 1BF4A 1NR4A 1P16A 4DNTB 4JI5Q 1VQIA 3U50C 2VB3X 2O2LD 1IW7D 1O7IA 3A8KE 1VQCA 3TREA 2EJGC 4O1NA 2C5CA 3A55A 3NEMA 2WAQB 1VQGA 2F0MA 4X3TA 4G7ZC 1RTOA 3KF6A 5C4XG 1CTMA 1O78A 2YTYA 3CPFA 1JT8A 1STYA 4U68A 5IGGA 1KDAA 2NTSA 1A3TA 4BBRH 3H3VC 2LS01 1TT2A 4N9TA 1SAPA 4FXGC 4OO1H 2LXKA 2WB1E 1G6ZA 2WFWA 3OIQA 2F0NA 3MXPA 1CA6A 3TS0A 1E1TA 3GTGB 2VQEL 2WKCA 1LABA 2JA7H 3I73A 3J7AV 5C3EG 1I94L 2UUBQ 3TP6A 4LF6L 1FD7D 3GQBA 1VQKA 3HOXG 1TR5A 4NB3A 1X55A 3FKIH 5HGTA 5A2QE 5IYDG 2D62A 2VL6A 1BCPD 4JI6Q 3K5LA 4IPGA 3HKZG 1PYWD 4M1UB 1NMGA 5ELCA 1Y1VG 2EYJA 5M3MG 5CBAE 4FP5D 4NMZA 5LMUQ 2G9HD 3T1HL 1U5KA 3J81i 3F2BA 4H44C 5E3FA 5IP7G 3V2TA 4U673 1YJNA 3DXJC 5I9PA 2VW9A 1WD1A 3HOWH 4JI1L 3VYUA 4ODGA 5LMNQ 5GAEC 1HA6A 4XIGS 4H7BA 2E74C 2L9HA 1CM9A 3I70A 3Q24A 1OXSC 4B3SL 3NSWA 1PFBA 2CH4A 1HNZQ 1EQTA 5IYCH 4IUNA 1RCVD 5FLXc 3P75A 1KRSA 3DMUA 1MD2D 3SHLA 4CDCC 2SEBD 4IZ8A 2OT2A 2PQAA 4XYOA 4JBWA 4K8IA 4LF4L 1Y14B 3M7NA 1YNNC 1TS2A 4JV5L 1D5MC 1O80A 5CV8A 5JEAG 4NDXA 4C3JH 1G6PA 1DD2A 2AQ2B 4NPSA 2FHTA 1UE7A 5D3DA 1JB7A 5J1ZA 3NE5B 2UUAQ 1JWMD 3PO3G 3HOUH 5C4ZA 1HCZA 4ZLTF 1GUNA 1B7YB 3VA7A 1H9RA 3FEWX 5IIFA 1TWCB 3K0YA 3K6OA 3FPUB 4O2DA 1XYIA 1NNXA 3T4AC 3NBHB 1HUMA 1WJJA 4RGOS 5DLQE 1WTHA 1TIID 2EYFA 2G9DA 4OXPA 1HZAA 1NSNS 4KY5A 3J81c 1HH2P 1JJCB 1B44D 4IPHA 2UU9Q 3KFUA 4YHHQ 1HTPA 4A93H 4C3IG 4DUYQ 1QCBD 2EZVA 1STBA 4F87A 4C3HH 1Q81C 3M7GA 4KD3A 5C44H 1E7ZA 3VYRA 1HA5A 3M85A 4DUZQ 4LF9Q 5EPJA 5EPKA 1R9TB 4TKOB 2O5IC 4YY3Q 3D8GA 3NTHA 4MN3A 5C4XH 2BA0A 2IL8A 4YCUA 1YVCA 5EKKA 3J7ZC 4HJAA 1O7ZA 2R92G 4C2MB 5E4WC 4OX9Q 3F2DA 3F1ZA 2OCEA 3GD7A 4K14A 1SMYC 1PHJA 2JYOA 5CBEE 2A74C 2WAQE 2JA9A 4GZYC 3T56B 3A7LA 3GO5A 5E4XA 4I7AA 5I4DA 4FNFA 4DAMA 2B2WA 5C3EH 2IX3A 3BVZA 2F03A 2RDHA 1VQHA 1SLJA 4DV3L 3Q8DA 1Y8PB 3HOXH 4AYBB 1T9HA 3K5OA 4LUVA 2K04A 5IYDH 3VYTA 3D31A 2E2JH 4ID6A 5IE8A 1ET9A 1SDFA 1X56A 1GHJA 1Y1VH 4LFAL 3PUYA 3K5NA 5G3LD 4HIDA 1M4VA 1WTQA 2I46A 1PTOH 4DNRB 1HNXQ 1H9KA 2AWOA 2F0JA 2F4IA 2B2TC 3KDFA 1OXXK 4KKUA 4DF7A 1PYBA 2HDMA 2Q8IB 2N49A 4HIKA 2F3IA 2CCZA 2OQKA 5IY0A 4PZ8A 2K75A 4PQXA 4CDEC 4EQ5A 3TRZA 1KIXA 3S1NB 3ZYYX 4JI3L 1XTDA 1LTBD 1EY6A 2DJGC 3I4MG 3A74A 4ZQ3A 1IYVA 5CV7A 4F8MA 4EQPA 4DV7Q 1K9MC 4JI5L 2BDOA 1B9NA 4P72A 5KYLA 2E5LQ 2B2YA 3P1HA 5FLXL 1B8AA 1PVOA 1EEFD 1EY4A 5JEAH 3KF6B 4QF4A 2Y0SB 1X54A 3CC7A 1D5ZC 3HRZC 1BQQT 2AWNA 4LF8Q 3GTLH 1Q7YC 1DOMA 1Z6HA 2XRQD 1CKNB 1FNWA 2A5HA 4FYDA 4K8JA 3PO3H 2WAQG 1S5FD 3CQZH 3ERQA 1PRTB 4ZCKA 3BDLA 1EWHA 3BZCA 1A15A 3S17H 1FVIA 1FJGL 4DA2A 1PYSB 1UWVA 5IGBA 4MIUA 2NZ1D 2K33A 1SSOA 3CHBD 4RCOA 2K5QA 3MZ5A 1A6XA 3E6ZX 2WP8J 1VQ9A 2UUBL 5D14A 4A3BB 1VQJA 4HIMA 3I4NB 1I6HB 1XPUA 3MWYW 3MXGA 1SRUA 2RHQB 2JA6B 4JI6L 3RN5A 1LACA 1W2BA 5J39A 2R7FA 2Q2TA 4C3IH 2CHBD 4BS9A 1AN8A 1AW7A 1PRTC 2NN6I 4DXFA 1QG7A 5LMUL 3I4LA 1K8OA 1HJPA 4A3KB 1F9RA 3STBC 3S15B 3TP8A 3TEHB 1SNQA 3K0XA 5LMNL 4G7OC 3S24A 4L5QA 1KAWA 4JYAQ 2EXDA 1IW7C 1K8MA 1K28A 2XWBB 4R8NA 1MBYA 4A3EB 4IQZA 3J80c 2H5XA 5I9OA 1O7YA 1HNZL 2F0OA 3EQLC 2ZT9C 2PQAB 2R92H 1JWUD 1EWCA 2MUYA 3PO2B 1BCPB 1K83H 1U4PA 3K81C 3ULPA 1LTRD 3I4OA 3NQIA 2K50A 1TY0A 2EY5A 4P73A 5C4JH 2LFNA 2PQEA 1O7LA 1T5EA 1KRTA 5IOCA 3S14H 2MNAA 1D7QA 4XQNA 3C1EA 1N33Q 2UUAL 1J8IA 3W1BA 4NXMQ 1BR9A 2K7VA 3BDCA 1EFID 4JCVE 1Z9FA 1F9SA 3EJIA 3U9SA 1I94Q 4KTAA 2IJ0A 1MSGA 2KBNA 2RKSA 2H4OA 4AIMA 1BCPC 2XIWA 1IBMQ 3GDEA 3MFGA 2NVXH 3AB9A 1CA5A 1PH6A 4RFBA 3SK4A 4JC0A 2A68D 1B9MA 4A3FB 1HZ9A 4X3SA 1Q1EA 2DNCA 1PH9A 3NTKA 2OQ0A 2A8VA 4IJHA 3A8IE 1PH1A 2ZXOA 2E8GA 4UDUC 2QA4A 1S4ZA 2UU9L 1X9NA 1JICA 5D3IB 4DUYL 1V1PB 2JQOA 3P7JA 3I4MH 1HPCA 2O4XA 2F0GA 3TZUA 1X6OA 3AEVA 3A56A 1MKHA 3H3VH 2BE5D 5C3XA 3RZDH 1QILA 5EGTA 1SFOB 4DUZL 3FVQA 4LF9L 1BO0A 1GUTA 1LTSD 3HOZB 2VUMB 3X3NA 1ENCA 5A2QL 4YY3L 4O42A 4JBKA 4ZRZA 4RCNA 1JC7A 1MIUA 1NMFA 2Z4HA 4LF4Q 5IODA 4P2CB 3LX0A 4QQBX 3ULJA 2J7ZA 2RVLA 3UDIA 4ULLA 1RODA 2WB1B 4L6TB 4OWWB 4OX9L 1LTGD 1QNKA 2Z8LA 3OTOQ 1DOKA 3AYHB 4R4QA 2YYZA 3KF8A 1K8GA 1EZ8A 4LFCQ 1ENFA 1NCVA 3I2ZA 1U4LA 2Q8TA 1WFQA 3PIPA 3BDOA 2DY7A 1RF2D 3V96A 4G7HC 1D8LA 4RMFA 1OTCA 4KKSA 1E24A 1GUOA 1XMQQ 1IBLQ 3EVQA 4LF5Q 3PF4A 3GTGH 3J81j 3T1YQ 1VQPA 1EQRA 1CQFA 3T13A 1JCKB 3GP7A 3U4VA 1S5BD 5FLXE 3R8BA 4RKBA 3VR5A 4AYBG 1HNXL 1UUPA 4X3UA 5M5XB 1QVCA 1W6KA 3QB3A 1IXRA 2E75C 4JW0A 3S2DB 5IGDA 2B2UA 3D6CA 4DR7Q 3R2TA 4QMGA 2KECA 4K0KQ 2ZJQA 4RGNA 1J9OA 2PI2A 3RN2A 4A3DB 2XVSA 2SNSA 3IKJA 1G91A 4DV7L 4DR2Q 4RG1A 2TMPA 4KN4C 4NP5A 2MO0A 5FKAC 1Q8IA 3J80L 2CFMA 2A6HD 1M1KC 4C56C 1LO5D 2ICEC 4KY7A 2BH8A 3GTOB 1ESFA 5FJ8G 3PUWA 5DM63 1ICWA 1YHBA 4DR5Q 4LF8L 3GTKB 3BZDB 1K8AC 1Q46A 1QE6A 1M8AA 5IT9c 1AZPA 3O13A 2Y0SG 1WTPA 5JJLA 3EBEA 1HR0Q 1QUQA 1IKLA 1XWEA 5FO7B 5C3WA 4QCLA 5I6YA 1GVPA 2JE6I 3I8ZA 5I6WA 2EY6A 1TWGB 1G2SA 1PTOF 1PXUA 4UPAA 2PNHA 5M9OA 2K5NA 5JEAJ 2VXWA 3CXCA 2LSSA 2VY3A 1AZQA 1TWCH 4GOPB 3F2UA 4EX5A 2ES2A 3S16B 3DUZA 1VQBA 5LHY1 4LUZA 1HQMC 5CYUA 4A3BG 5GAGC 3I4NG 2MJ8A 2JA5B 2EQSA 1R4PB 1VQ4A 2MFIA 3G6JB 4A3CG 2HD3A 1B3AA 3CW2C 1KXLA 2JA6G 3AQQA 1KTKA 2Z4IA 4PNYA 4IN3A 2D2CC 1GO3E 2EYLA 2IHEA 5ELDA 3D0FA 3A8JE 4JYAL 3X3MA 5FOBB 1STAA 1QNUA 4QL5A 4F88A 4A3KG 2KCTA 3RUZA 3QWNA 4DKAC 4GOPC 3N52A 1PH8A 2PYKA 1PZKD 2ZXRA 1SNDA 1R9TH 2DNEA 3PUXA 1VQEA 2JK8A 3OPOA 3K5MA 3UDGA 4DAYA 1PMRA 4A3EG 5A35A 1LT6D 3PO2G 1CHPD 4C2MH 3GTQB 1TWFB 4ZUJA 4FXKC 3S9WA 2R3ZA 2GVBA 1MSHA 2F0IA 1CK1A 1N33L 1KHIA 4POGA 1U4RA 3I7FA 1FJGQ 2KHIA 4R4IA 5JVH3 4NXML 4JI7Q 3D4DA 3IRBA 3EA6A 2CH4W 2Q8RE 1EQVA 2F0PA 1YJ9A 2OXPA 1UNSA 1S5CD 4CKBA 3E5SA 1IBML 4R8IA 1B53A 5H1SE 4X64L 2C9OA 2A6ED 1CHQD 4DAPA 3MVVA 4L5RC 1CT1D 2Z6KC 2PW7A 3KBXA 1KLUD 3WDNA 3K7AB 1BNZA 3TSSA 2CQOA 4PZ7A 2N3SA 1SEBD 5LMNW 3S2HB 3H3VI 2F0TA 2K5HA 4A3FG 4GLXA 1NE3A 3BYTB 1NY4A 3NUCA 3CC4A 2N8NA 4C1NI 4A3IB 4UP9A 1SE2A 1MHWC 4OELB 1GM5A 3I3CA 2KEEA 3S1NH 4DV1Q 1EIYB 4RWSC 3PGZA 3PCOB 2CW0D 3PV0A 3CCSA 1IHZA 2WKDA 2KVMA 1IL8A 3D4RA 5G3LF 5K36G 1JJGA 2FMCA 5FJ8H 1D1IA 2AHOB 3H91A 4PMWA 2YU9B 1E3PA 4L5SA 4DU9A 3GTJB 4FF1A 1FGBD 3EROA 4IPDA 1E1OA 5IYBG 2VUMG 3HOZG 4BY7B 3OTOL 1E0BA 1K3RA 1OXUA 5JJIA 2R93B 3S1QB 2Q2HA 3WOEA 4CGYB 1JE5A 3M9BA 2WB1G 4LFCL 1TWHB 1BXTA 3GTPB 3UE1A 1VQFA 3CRKC 1EQQA 4DR4Q 2I0QA 5C0XG 2A68C 1DJRD 1E2WA 1XMQL 4FDBA 1IBLL 4LF5L 1A3VA 4CDFC 3T1YL 1VF7A 3JAMi 3S1RB 5FLMG 3J80E 1F2ZA 4M8AA 2EY1A 4HIOA 1I6HH 3DWPA 4ZYSA 4DV0Q 5KGUA 3A5UA 1OXTA 4IUUA 2E2IH 4DR1Q 1BDOA 1LYLA 4KLKA 3RZOH 5EQ0A 3T53B 1UE5A 2EY2A 2OF1A 2I07B 4LWCA 5GQOA 2BE5C 4DAVA 4F7XA 4DR7L 1BVSA 5ELOA 1JWSD 4K0KL 4A3KH 4BA2I 1HTLD 1S72A 1U0LA 2NUCA 3S15H 1SR3A 2L11A 1SNCA 2KA7A 3T16A 4MTNA 1C7YA 2CVRA 5IWAQ 3U9OA 3H0GB 4DK1A 4S3SA 1SYFA 1JQYD 2HCIA 2YTXA 4RH6A 4CJ2C 4CJ0B 5KEEA 4DR2L 1VQNA 3J7A5 5EPLA 2IX1A 2G5DA 4LUOA 2F0HA 2R7ZB 4OONA 5JPNC 4A3EH 2QF7A 4A3DG 3C46A 2EJMA 1X3EA 2KOLA 2XGTA 4DR6Q 2M9VA 1IL2A 2B39A 2CQAA 2KCMA 1A62A 1H95A 2ZTEA 4DR5L 2BDNA 4P71A 2QEXA 2RDGA 4LFBL 1I3QH 2EE1A 2NB0A 3F8TA 4X62Q 2HQLA 1HR0L 4IURA 3KBGA 5EBCA 5I2YA 4IOCA 1STHA 1AFPA 2BH2A 4KV6A 3URYA 2MPMA 1X32A 1OO9B 3FP9A 2RBMA 4N8FA 1DONA 1FNUA 2AMCB 3KUPA 1HFGA 2CWAA 3CF5A 3ND8A 2ZTDA 5M3MH 1I50B 1WCMB 4B3RQ 4UHVA 1LT4D 1SYBA 5IP7H 3VYSA 2L12A 4A3FH 3OWFA 2A1AA 2RSOA 3CU7A 5IGCA 2NTTA 3FKIB 4WJ4A 2HCCA 1EWIA 4ZK9B 1P8LA 2N78A 2D5DA 1G51A 2YTVA 4DNIA 4A3JB 3MAQA 2GA4B 2JA5G 4MZ9A 1DM0B 4N9PA 4A3GB 2A6HC 5K36H 5M3FB 2L1BA 2C35B 3TP5A 4KN7C 1L0XB 3NQTA 1SFOH 2ID0A 3HOZH 4MHEA 5IYBH 3HKSA 2VUMH 1C4QA 4XQJA 2HQEA 4JBJA 2F0WA 3ER0A 3AU7A 2F4VQ 1S5ED 3GV6A 5LL6S 4OO1I 1VS0A 1YITA 3GTMB 4A3LG 1I6VC 2J4XA 4LW1A 5IGEA 3H94A 4G57A 1UEBA 2JP1A 2EYMA 3S1MB 5HY6A 3MA2B 1T5XD 3R3OA 2K1BA 1DGSA 1K73C 4CKEA 3HOYB 2IT1A 3VR3A 3A7AB 4HSPA 1VQ5A 1SNPA 2QILA 3DWQA 4JI7L 4POFA 4ABNA 1EOTA 4IUPA 4R1JA 1KAAA 2WIIB 4JPBW 3QG1A 5T1GA 5FLMH 2HUGA 5K5PA 3H15A 1KNAA 1PFNA 1ZXTA 2FMMA 4DV6L 3I91A 4ME3A 1WI5A 4RKLA 1F2LA 2WINB 2KEDA 5BN4A 1ASZA 4TVAB 4X6AH 4YWMA 5KNDA 4NW2A 4A3MB 1LV9A 4GN5A 3J81L 1SBBB 1EY0A 1PA6A 4ZKCB 1GD7A 1DCZA 1RJTA 3H6MA 1H9MA 1L1OA 2QW7A 1WTRA 1GXDC 3S2DH 3D6WA 1LTTD 3I90A 1G8ZD 1HQRD 4LF7Q 4DV1L 4KY6A 2Z6BA 3I55A 3MEFA 3TN2A 4K2KA 5C6AA 4B3MQ 4A3DH 2R61A 1ICFB 2PI2E 4A3IG 3PF5A 3GV3A 2RDFA 1FL0A 1FR3A 3VR4A 4LAAA 5C44B 5JPMC 3VDYA 4H0LC 3NENA 4GNXA 4Y52H 2WV6D 1NJIC 3GTOH 3G4SA 2AQ1B 4PMCA 1HHVA 4OHJA 3CCRA 3PIOA 2EYPA 1VF5C 1ZKOA 2H1EA 4BY7G 2MGSA 3M3YB 1Q12A 2A6EC 1VCIA 2E2HB 2R93G 4DR4L 3DEOA 3CP0A 1UE1A 5M5WB 4X64Q 4KJOA 4UY8C 1KDCA 4HJ5A 4R4OA 2SDFA 5JJZA 3CCQA 3T51B 2OEOA 4KK7A 4HJ8A 1RIPA 5AJ3Q 1L0YB 1EOVA 1CKMA 4DV0L 4QUFA 1DYQA 3MHBA 4X65L 3S16H 4EQNA 4DR1L 3M4YA 3SVMA 4Q0FA 3SK5A 1C8CA 1XMOQ 2HHHL 3E0JA 4WFN3 2JA5H 3B6YA 1AE2A 2FXQA 1EFWA 2CW0C 2BCOA 4HJ9A 1B2TA 1SE4A 3NTIA 2EJFC 2ASBA 3D3RA 4XYQA 4JI2Q 2MHVA 4I7ZC 4QGUA 3PIO3 1JR0D 5IWAL 2LY7A 2D0PA 3RD4A 3U4ZA 3SEBA 5CMDA 4Q5VA 2UUCQ 4HEDA 1VQMA 2X6LA 4GLAC 1A2UA 4V190 4WJ3M 4XTCS 3OSOA 1VQ7A 1C48A 3QOJA 2RF4A 4C1NK 4DPGA 4DR6L 2B63B 3H0GG 2TSSA 1LM0A 4ILWA 1MI2A 3M4OB 1PH2A 2J0TD 1ASYA 2R7ZG 2K03A 1PRTF 1CZWA 4JK1C 4P74A 5E7NA 1VMPA 2WACA 4J8QA 2QGQA 3L0OA 5JAVA 4X62L 3GTQH 2OTLA 3LWEA 1TWFH 2NVYB 1DZ1A 3TDQA 1QVFA 1CZGA 3M4PA 4N8X1 5ELBA 2RQXA 5CV9A 2DJFC 1KDBA 3AFPA 4K5VA 2KJXA 4OEMB 1I4RA 4DK3C 2K6AA 4IUQA 1WYDA 1SYCA 4I65A 4B3RL 3KDFB 3NWSA 1SYEA 2PO4A 3R2IA 2FFKB 2KQ3A 3NP8A 1Z7TA 2ZJRA 1LLRD 4MTKA 2B2WC 3HP3A 3TQYA 1G291 3E9HA 1I4GA 1EIFA 3A54A 3LNNA 3CC2A 3C3LA 3BG3A 3PUVA 4Y7NB 2Z9HA 1WCMG 1WOCA 3S2HH 5KYIA 3TS2A 3QIAA 1TWAB 3KJOA 2JJQA 1PFMA 3FKIG 1U9RA 2F0VA 3PIP3 1BCPF 2EYHA 4LK1C 5KIXA 2D0OA 4A3JG 3MTSA 1NUCA 1SJED 2VB2X 3G6EA 1DXMA 3AMUA 1QWYA 4A3GG 2M00A 2MO1A 3SGIA 4RAUC 2EIFA 1II3A 3FDTA 3CMAA 5M3FG 2F4VL 1EL0A 3WWVA 3NWTA 1Y69U 1HR0W 3GTJH 1IKMA 2NN6G 2K52A 4LFBQ 3J81E 1MJCA 4OGQC 2F0EA 3JC66 3S1QH 3G48A 3S14B 1QB5D 2B2YC 5J22A 2KCNA 1TWHH 4EVOA 2NBFA 3L9AX 1Y1WB 3HOYG 1VQ8A 4XXEA 4IALA 5D65A 2B2TA 4HCEA 2E2DC 3RLFA 4DXGA 1A0IA 1PZJD 4FO2A 3BYYB 2ZM6Q 5I2XA 3K8AA 2HT1A 2NVTB 3Q0AA 1C0AA 1STGA 1I4QA 4FF4A 2A73B 5DNFA 4RHSA 3SR1A 5CV4A 5EJWA 4HSVA 3H09A 4A3MG 1GJXA 5E1FA 4LF7L 1VQLA 3HKZE 1N32Q 3OMGA 1R4QB 4QIWB 1WTWA 4B3ML 3OYYA 3H0GH 2DGYA 4RHRA 1K0RA 1N9WA 2JEBI 4GNXB 4JI4Q 2UXDL 1X65A 3ITPA 3HG9A 4AQYQ 3RZDB 4K6LA 5EBDA 3K58A 2I5HA 2Z1CA 4HAEA 1XJVA 2VNUD 3ICEA 2V4DA 1PH4A 1EYAA 2K5VA 3OW7A 5ELFA 5C44G 1X3QA 1N36Q 2DY8A 1GKHA 3K80C 1NR2A 3NPPA 3RLOA 3WOFA 5HGQA 2OTJA 4FXDA 2PPBC 1SJHD 1EEID 2PMZE 4DV5L 3ND9A 2A69D 3V05A 4FF2A 1AP0A 2XRSD 1SMXA 3CD6A 3AFQA 3EIVA 3CCMA 4GNXC 1E2VA 2N88A 3I72A 3HEJA 1FYCA 2MP1A 1CKNA 1SNOA 2SOBA 4K5XA 4IUTA 3FHWA 1D1KA 4DV6Q 2GN5A 2L5TA 1F77A 3KLSA 2KHJA 4HCSA 5AJ3L 1SXTA 4JI8Q 1PDQA 4HN7A 1I50H 1WCMH 1X3PA 5FO9B 1CI3M 1MGSA 1XMOL 2XTIA 4B9WA 1WTVA 3OMCA 5J3BA 1ZEQX 4L8JA 1EY7A 2JSOA 1I4HA 5F2DA 3L7ZC 2OWOA 2Q2UA 4QY7A 2EDGA 2X69A 2I5MX 3I56A 4JI2L 1RDPD 3SE0A 4IJLA 4A3JH 1VQOA 1V1QA 4APVA 5IP9G 1NTGA 4YWLA 1RHPA 2UXCQ 1JOOA 5JVG3 4DK0A 2F52A 4A3GH 3UDFA 2UUCL 3FMCA 5M3FH 2ZXPA 1SE3A 2B2VA 1ILPA 2IHFA 1EY8A 4CJ1B 1A8VA 1XX8A 1PLFA 1S40A 1B4OA 2NN6H 4BBSB 3N6RA 4BY1B 4H02A 1TQOA 1QZGA 2F1MA 3KF8B 2EXZA 3G7LA 1EIGA 4A4IA 1HNWL 4RA8A 2PW5A 3GTMH 3PMFA 2B63G 1BBXC 5IT9L 3S1MH 5EKIA 1XNRQ 1LTLA 1SYDA 1PTOD 4H13C 3VA5A 3HOYH 1EIHA 3CCLA 4BXXG 4X66L 1STNA 4OIJA 2IPKD 3ZJYC 1W3SA 5JOBA 1ML0D 2ALYB 4KHZA 4ZKBB 4UP7A 1CSPA 3IAYA 3G71A 1LTAD 4JOIA 4EGVA 4DR3Q 3I4NH 4A3BH 5EKLA 4A3CH 1J5EQ 1JORA 3M4QA 4HTHA 2FJ2A 4IFDG 1I4PA 5C4HA 4NXNQ 4OL7A 4JI0Q 4X65Q 5M5YB 2JA6H 3QR8A 3MEHA 3RR5A 2HHHQ 3K59A 1PZID 4A3MH 1IBKQ 2NVQB 4K2LA 2EPBA 4K6DA 3HZXA 4R4TA 4YCWA 2NZHA 1RTNA 3PUZA 1V43A 1YJWA 4ZAIA 1TS3A 1N34Q 1SYGA 5ELEA 4XT1B 2IX0A 2JA8B 3HOVB 1AEXA 3MC0B 2P5ZX 4IO9A 3J7YW 1S3OA 1V1PA 1HRJA 3PO2H 4QIWE 4CHTB 2B2UC 4MNOA 3CMEA 3Q23A 3TBIB 5KRUA 5BN3A 1M90C 3W5OA 4B3TL 1KLGD 2F0QA 1QUQB 2KENA 2AQ3B 3KJPA 1IYJB 4KHPL 4LMQD 3PQIA 4BBRB 1Q82C 1KQSA 1LT3D 3K7UC 3M3YH 2ENBA 3JAMc 1F2MA 2E2HH 2RSNA 4XQQA 4DV2Q 3R93A 4P75A 1FGUA 4PMBA 3UDXA 5M5WH 4GKJL 2K14A 2JA7B 2XSCA 3UE0A 1XPRA 5HURA 1XTCD 1BBWA 3E3XA 1Y1WG 3CCVA 5LL6X 3SK8A 2ZM6L 1G2TA 4UP8A 3KK7A 3BZKA 1Q3LA 1NAPA 3W1GA 3K57A 4PV1C 2B29A 2LKVA 1PH3A 1YNJD 5DM73 3L3OC 2X6GA 1VQ6A 2PNRC 2UXBQ 2SNMA 3DEPA 1Q1BA 5IP9H 4FF3A 1WVLA 2GVAA 4YCVA 3ONAB 3NK9A 2PCFB 1AH9A 1B1ZA 4BWGB 1TKWB 1N32L 1UEAB 1F2YA 1D5XC 5KNCA 2JXMB 1HZBA 5ELNA 5BR8L 3MXNA 3HOWB 2IWHA 2KUMA 4DAYB 3RNUA 2ZJPA 1XNQL 4G4KA 4JI4L 2Q2IA 4EQOA 3OW2A 1AE3A 4AQYL 5AFWA 4YIJA 5CV6A 4AH6A 4DGZA 1GUWA 1JOQA 1YI2A 3BS1A 3CAMA 3IFTA 2NZOA 2AUKA 1CKOA 2B63H 4LJZC 1I5FA 4KHVA 1X3GA 2XNAC 4OWTB 3TMEA 3M4OH 2B8FA 1DOLA 1HZCA 3KOJA 4WORA 1N36L 1OXVA 4IUVA 1ZYRD 3J80i
chains in the Genus database with same CATH topology
1VQAA 3PO3G 3HOUH 4A3BG 5GAGC 2UUCQ 3I4NG 4BXXH 2EQSA 2A19A 1VQ4A 2MFIA 1VQMA 4A3CG 1B7YB 4GLAC 4WJ3M 4XTCS 2RHSB 3CW2C 4A76A 1VQ7A 2RF4A 1KXLA 4DPGA 2JA6G 4DR6L 3AQQA 3H0GG 3KYHC 1LM0A 2NVYH 1PH2A 1ASYA 1GO3E 4O2DA 2IHEA 3D0FA 2R7ZG 4JYAL 3NBHB 4P74A 4A75A 1WJJA 5DLQE 4QL5A 4A3KG 5E7NA 2KCTA 4TQUS 4OXPA 1HZAA 2QGQA 3L0OA 4PZ6A 4DKAC 4X62L 3J81c 3GTQH 1HH2P 2OTLA 1JJCB 1H95A 4GOPC 4IPHA 2UU9Q 1TWFH 1PH8A 5JJKA 3KFUA 4JI8L 4YHHQ 1R9TH 4A93H 3PUXA 3U4ZA 1VQEA 2JK8A 4DUYQ 4GKKQ 3UDGA 1Q86C 2V1CC 4C3HH 1Q81C 4A3EG 5M5XH 1QVFA 3M4PA 3AFPA 5C44H 1E7ZA 3PO2G 4C2MH 4GN4B 4DK3C 4Y7NH 4GLVB 3A0JA 3M85A 4DUZQ 4DV4Q 4GOPA 4LF9Q 1WYDA 1RL2A 1TWAH 2GVBA 3KDFB 4B3RL 3ULLA 2CKZB 1KHIA 3KLWA 4POGA 3I7FA 4YY3Q 1FJGQ 1N33L 2KHIA 4R4IA 2UXCL 4NXML 2ZJRA 4JI7Q 2VQFQ 5C4XH 1BKBA 1E22A 2BA0A 3IRBA 3LGJA 1YVCA 4YCUA 4ALPA 3J7ZC 3TQYA 1G291 3E9HA 4HJAA 2UXDQ 1EIFA 3CC2A 2R92G 5EAYA 3PUVA 1WCMG 4OX9Q 3F2DA 1YJ9A 1WOCA 3F1ZA 3S2HH 2OCEA 3GD7A 1IBML 3TS2A 5H1SE 1BBUA 2HIXA 4X64L 1PHJA 3E0EA 2WAQE 1UE6A 3KJOA 2JA9A 2JJQA 3FKIG 3GO5A 4L5RC 3GTKH 1PH5A 4DAMA 2Z6KC 5C3EH 4BBSG 1YNXA 4BY1G 4A3JG 2D0OA 1XNRL 2IY5B 2CQOA 4PZ7A 1VQHA 2N3SA 2ZTCA 1SLJA 3Q8DA 5LMNW 4DV3L 4DV5Q 3H3VI 2K5HA 3HOXH 3G6EA 3EN2A 4A3FG 4A3GG 1T9HA 4GLXA 1XPOA 1NE3A 2MO1A 4LUVA 3SGIA 2EIFA 5M3FG 3CMAA 5IYDH 1NY4A 3CC4A 2N8NA 2F4VL 3D31A 2E2JH 4UP9A 1L0WA 3RLNA 3WWVA 5IE8A 1X56A 1GM5A 3S1NH 1Y1VH 2RCNA 4DV1Q 3PUYA 3GTJH 2NN6G 3DM3A 2K52A 2Z6KA 4HIDA 3PGZA 1Y1WH 1TWGH 3PCOB 4LFBQ 3PV0A 3CCSA 1HNXQ 4DR3L 2AWOA 4JG2A 1MJCA 3KDFA 1J5EL 1OXXK 5K36G 2MQHA 1JJGA 1PYBA 3JC66 3NELA 4NXNL 3A5ZB 3DLLA 5FJ8H 2VQEQ 4JI0L 3S1QH 2AHOB 2BA1A 2N49A 2F3IA 4HIKA 1CUKA 3G48A 2OQKA 5IY0A 2CCZA 2UUAQ 4PMWA 4PZ8A 2K75A 1E3PA 4L5SA 1TWHH 2VZAA 4EQ5A 1KIXA 4LF6Q 3TRZA 1SROA 4JI3L 1XTDA 3HOYG 4IPDA 1E1OA 5IYBG 1VQ8A 2NVTH 1IBKL 2VUMG 3HOZG 3OTOL 3I4MG 1K3RA 3A74A 1A63A 1OXUA 5JJIA 2Q2HA 4AYBE 3RLFA 1JMCA 2ATWA 4DV7Q 1A0IA 1K9MC 4JI5L 1JE5A 4P72A 3M9BA 2WB1G 4LFCL 2E5LQ 4JOIC 3T1HQ 2ZM6Q 1C9OA 3UE1A 1N34L 1B8AA 1VQFA 2CWPA 4YHHL 1PVOA 3K8AA 2YV5A 2HT1A 1B70B 3KF6B 1C0AA 1EQQA 1N8RC 1X54A 2R6GA 2I0QA 5C0XG 3CC7A 4IPCA 4DR4Q 4JI1Q 4A3LH 1XMQL 2AWNA 4FDBA 1IBLL 3BU2A 4LF5L 4LF8Q 3GTLH 1Q7YC 3T1YL 1CKNB 3JAMi 3PO3H 2WAQG 4A3MG 4B3SQ 5FLMG 3ERSX 3CQZH 4LF7L 1VQLA 2JA8G 3HKZE 3HOVG 1N32Q 1HNWQ 4HIOA 1I6HH 3CPWA 5GAHC 2K4KA 3BZCA 1YBYA 4DV0Q 1SN8A 3S17H 1FVIA 3A5UA 2I5LX 1OXTA 3OYYA 4B3ML 1FJGL 1PYSB 1UWVA 1X3FA 2E2IH 4DR1Q 3H0GH 2DGYA 4KLKA 1K0RA 1LYLA 3RZOH 1N9WA 2JEBI 4GNXB 4JI4Q 1UE5A 1X65A 1YHAA 2UXDL 4LWCA 4X66Q 4AQYQ 5GQOA 4JV5Q 2B3GA 2HIVA 2WP8J 1VQ9A 2UUBL 4DR7L 1BVSA 1VQJA 1EUJA 5ELOA 4HIMA 1Q8KA 4K0KL 1XPUA 4A3KH 4BA2I 2I5HA 1S72A 1U0LA 1XJVA 3S15H 1SR3A 5GADC 3ICEA 2VNUD 1SRUA 4MTNA 2RHQB 4DV2L 1PH4A 2K5VA 5IWAQ 1C7YA 5C44G 4JI6L 1N36Q 2Y0SE 4J15A 4O0AA 3RN5A 1W2BA 2R7FA 4BBRG 2JEAI 1GKHA 3K80C 2Q2TA 4C3IH 2YTXA 1VQNA 4DR2L 4LNQA 3J7A5 2IX1A 3RLOA 4LUOA 1EYGA 5HGQA 2DUDA 2NN6I 4OONA 4A3EH 5LMUL 2OTJA 4OO1G 1SE8A 2PMZE 2AKWB 4DV5L 4A3DG 4JBMA 1X3EA 1HJPA 2XGTA 4DR6Q 1IL2A 3E9IA 3STBC 3K7AH 1SMXA 3TEHB 1PV4A 3CD6A 2KCMA 2JA7G 1IZ6A 1A62A 3AFQA 3EIVA 3K0XA 3CCMA 1Z47A 5LMNL 2ZTEA 4GNXC 3S24A 4L5QA 4DR5L 2UXBL 1KAWA 4JYAQ 2EXDA 2R7DA 4P71A 1CKNA 1V9PA 2QEXA 4OWXB 4LFBL 3FHWA 1L2FA 4DV6Q 1I3QH 2GN5A 4A3IH 3J80c 3F8TA 4X62Q 3L2PA 2H5XA 1HNZL 2KHJA 2HQLA 1JJ2A 2Z0SA 1KC8C 3MXNB 5AJ3L 1HR0L 2PQAB 4JI8Q 2R92H 1I50H 4IOCA 1WCMH 2BH2A 4HJ7A 1K83H 4PG3A 3K81C 3F2CA 3ULPA 2XTIA 1XMOL 3FP9A 3I4OA 4KI0A 5J3BA 2K50A 1YZ6A 2AMCB 1TXYA 1KD1C 2CWAA 4P73A 5C4JH 3CF5A 2LXJA 3L7ZC 2OWOA 1KRTA 2Q2UA 4QY7A 2YU9H 3S14H 3HOWG 2I5MX 2MNAA 1YHQA 2ZTDA 4IOAA 3I56A 3HFZB 5C0XI 5M3MH 4BBSH 4JI2L 4BY1H 1D7QA 4IJLA 4A3JH 1VQOA 1V1QA 4APVA 5IP9G 1NTGA 4B3TQ 4B3RQ 4YWLA 1N33Q 4BY7H 2UUAL 2UXCQ 2E5LL 3W1BA 5IP7H 4NXMQ 2F52A 4A3FH 3CCEA 2A1AA 4GS3A 3UDFA 4JCVE 4A3GH 2UUCL 1Z9FA 5GROA 2R93H 5IYCG 5M3FH 1KL9A 4WJ4A 4KHPQ 1I94Q 4IFDI 2IHFA 2KBNA 1EWIA 1A8VA 1P8LA 2N78A 4AIMA 4L5TA 1S40A 1G51A 3GTPH 2YTVA 1IBMQ 3GDEA 2NVXH 4H02A 4DNIA 1PH6A 3BJUA 2JA5G 4MZ9A 4JC0A 1QZGA 3KF8B 1EIYB 1LUZA 1HZ9A 1PH9A 1Q1EA 4A4IA 4QJFA 1HNWL 2OQ0A 2A8VA 4GKJQ 3GTMH 4IJHA 2C35B 4GN3B 2B63G 1PH1A 2E8GA 3S1MH 1XNRQ 3S1RH 1SFOH 4A3BH 2QA4A 1PFSA 2VS1A 1LTLA 4BA1I 4DV3Q 2UU9L 2ID0A 1X9NA 3HOYH 3HOZH 5IYBH 1QZHA 3HKSA 4DUYL 3CCJA 1MJEA 3CCLA 2VUMH 3HOUG 4JBJA 4GKKL 4BXXG 4X66L 2JQOA 5M5YH 3I4MH 3ER0A 1L1OB 2F4VQ 3PSIA 3ZJYC 1X6OA 1W3SA 5C0XJ 4OO1I 1VS0A 1YITA 3AEVA 2ALYB 1MKHA 4A3LG 4LFAQ 3H3VH 4KHZA 4LW1A 1UEBA 4UP7A 1CSPA 3RZDH 5HY6A 3G71A 1QVGA 4JOIA 4DUZL 4DV4L 4DR3Q 1PH7A 4LF9L 1DGSA 4DK6C 2NVQH 3I4NH 1K73C 4A3CH 1VQDA 2IT1A 1J5EQ 3M4QA 4IFDG 1VQ5A 4NXNQ 5BR8Q 4JI0Q 4YY3L 4IFDJ 4JBKA 4X65Q 4JI7L 1NBWA 2JA6H 2VQFL 1YEZA 4POFA 1NMFA 1MIUA 3CCUA 4LF4Q 4R1JA 2HHHQ 1XNQQ 3RR5A 4QQBX 4R4CA 3ULJA 3U58A 1YIJA 3UDIA 4JI3Q 4OWWB 2R7ZH 4A93G 4OX9L 4A3MH 1J6QA 5FLMH 4YWKA 2JA8H 1IBKQ 3HOVH 3H15A 3OTOQ 3AYHB 4R4QA 2YYZA 1CSQA 2L15A 3STBD 4R4TA 1L1OC 4YCWA 4DV6L 2NZHA 4ME3A 1K8GA 1P16A 1WI5A 4JI5Q 1VQIA 3PUZA 3U50C 4LFCQ 3I2ZA 1V43A 1YJWA 1ASZA 1O7IA 4TVAB 4X6AH 1VQCA 1WFQA 4YWMA 3TREA 3PIPA 1N34Q 3NEMA 2IX0A 1VQGA 4GN5A 1D8LA 4RMFA 1OTCA 1E24A 1PA6A 1XMQQ 1GD7A 1IBLQ 3KF6A 4LF5Q 4IO9A 3PF4A 1S3OA 3GTGH 3J81j 3PO2H 4QIWE 3T1YQ 5C4XG 2YTYA 1L1OA 3CPFA 1VQPA 1JT8A 3S2DH 1EQRA 4MNOA 3CMEA 4BBRH 3U4VA 4LF7Q 1M90C 4DV1L 3W5OA 4AYBG 3I55A 4B3TL 2LXKA 1HNXL 3MEFA 2WB1E 1QUQB 2KENA 4A3DH 4B3MQ 2WFWA 1QVCA 2PI2E 4A3IG 3PF5A 3KJPA 3TS0A 1E1TA 1FL0A 2VQEL 2JA7H 1IYJB 4KHPL 5C3EG 1IXRA 1I94L 3VDYA 1KQSA 1Q82C 3NENA 4GNXA 4Y52H 4DR7Q 2UUBQ 4LF6L 3K7UC 4K0KQ 1VQKA 2ZJQA 3M3YH 3HOXG 1NJIC 4NB3A 3GTOH 1X55A 3FKIH 2PI2A 3RN2A 3JAMc 3G4SA 2E2HH 5IYDG 4DV2Q 4P75A 2D62A 1FGUA 2VL6A 4JI6Q 4IPGA 3UDXA 3HKZG 5M5WH 3CCRA 4GKJL 3PIOA 2K14A 4DV7L 4DR2Q 1NMGA 4RG1A 1Y1VG 3UE0A 5M3MG 1XPRA 1BBWA 1Y1WG 3CCVA 2MO0A 2CFMA 5LMUQ 2ZM6L 3T1HL 1U5KA 4UP8A 3J81i 1M1KC 3F2BA 3BZKA 4BY7G 3W1GA 2BH8A 5IP7G 1HR0W 2B29A 1PH3A 1Q12A 1YJNA 1VCIA 2R93G 2VW9A 5FJ8G 3PUWA 4DR4L 3HOWH 4JI1L 1YHBA 5LMNQ 1VQ6A 4DR5Q 5GAEC 4LF8L 2UXBQ 3CP0A 1UE1A 4XIGS 1K8AC 1Q1BA 4X64Q 5IP9H 1Q46A 4UY8C 2GVAA 4YCVA 4HJ5A 4R4OA 1OXSC 5IT9c 4B3SL 3CCQA 1AH9A 1N32L 1HNZQ 2Y0SG 5IYCH 5FLXc 5JJLA 4HJ8A 1RIPA 5AJ3Q 3EBEA 1HR0Q 1KRSA 1EOVA 1QUQA 1CKMA 4DV0L 1HZBA 5ELNA 5BR8L 4X65L 3S16H 4DR1L 2PQAA 4JBWA 4LFAL 1GVPA 2JE6I 4DAYB 2ZJPA 3RNUA 1XMOQ 1Y14B 2HHHL 4LF4L 4JI4L 1XNQL 3M7NA 2Q2IA 3OW2A 3B6YA 2JA5H 1AE2A 1AE3A 2FXQA 4AQYL 1EFWA 4JV5L 4UPAA 4AH6A 1YI2A 4HJ9A 5JEAG 4C3JH 1G6PA 2PNHA 3CAMA 2K5NA 5JEAJ 3CXCA 2NZOA 2ASBA 1CKOA 4NPSA 2LSSA 2B63H 2VY3A 4JI2Q 1I5FA 1TWCH 4GOPB 1X3GA 3M4OH 4OWTB 1UE7A 4QGUA 4EX5A 1JB7A 5IWAL 2ES2A 1VQBA 1HZCA 3KOJA 1N36L 2D0PA 4LUZA 1OXVA 3J80i
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQA A;  3PO3 G;  3HOU H;  4A3B G;  5GAG C;  2UUC Q;  3I4N G;  4BXX H;  2EQS A;  2A19 A;  1VQ4 A;  2MFI A;  1VQM A;  4A3C G;  1B7Y B;  4GLA C;  4WJ3 M;  4XTC S;  2RHS B;  3CW2 C;  4A76 A;  1VQ7 A;  2RF4 A;  1KXL A;  4DPG A;  2JA6 G;  4DR6 L;  3AQQ A;  3H0G G;  3KYH C;  1LM0 A;  2NVY H;  1PH2 A;  1ASY A;  1GO3 E;  4O2D A;  2IHE A;  3D0F A;  2R7Z G;  4JYA L;  3NBH B;  4P74 A;  4A75 A;  1WJJ A;  5DLQ E;  4QL5 A;  4A3K G;  5E7N A;  2KCT A;  4TQU S;  4OXP A;  1HZA A;  2QGQ A;  3L0O A;  4PZ6 A;  4DKA C;  4X62 L;  3J81 c;  3GTQ H;  1HH2 P;  2OTL A;  1JJC B;  1H95 A;  4GOP C;  4IPH A;  2UU9 Q;  1TWF H;  1PH8 A;  5JJK A;  3KFU A;  4JI8 L;  4YHH Q;  1R9T H;  4A93 H;  3PUX A;  3U4Z A;  1VQE A;  2JK8 A;  4DUY Q;  4GKK Q;  3UDG A;  1Q86 C;  2V1C C;  4C3H H;  1Q81 C;  4A3E G;  5M5X H;  1QVF A;  3M4P A;  3AFP A;  5C44 H;  1E7Z A;  3PO2 G;  4C2M H;  4GN4 B;  4DK3 C;  4Y7N H;  4GLV B;  3A0J A;  3M85 A;  4DUZ Q;  4DV4 Q;  4GOP A;  4LF9 Q;  1WYD A;  1RL2 A;  1TWA H;  2GVB A;  3KDF B;  4B3R L;  3ULL A;  2CKZ B;  1KHI A;  3KLW A;  4POG A;  3I7F A;  4YY3 Q;  1FJG Q;  1N33 L;  2KHI A;  4R4I A;  2UXC L;  4NXM L;  2ZJR A;  4JI7 Q;  2VQF Q;  5C4X H;  1BKB A;  1E22 A;  2BA0 A;  3IRB A;  3LGJ A;  1YVC A;  4YCU A;  4ALP A;  3J7Z C;  3TQY A;  1G29 1;  3E9H A;  4HJA A;  2UXD Q;  1EIF A;  3CC2 A;  2R92 G;  5EAY A;  3PUV A;  1WCM G;  4OX9 Q;  3F2D A;  1YJ9 A;  1WOC A;  3F1Z A;  3S2H H;  2OCE A;  3GD7 A;  1IBM L;  3TS2 A;  5H1S E;  1BBU A;  2HIX A;  4X64 L;  1PHJ A;  3E0E A;  2WAQ E;  1UE6 A;  3KJO A;  2JA9 A;  2JJQ A;  3FKI G;  3GO5 A;  4L5R C;  3GTK H;  1PH5 A;  4DAM A;  2Z6K C;  5C3E H;  4BBS G;  1YNX A;  4BY1 G;  4A3J G;  2D0O A;  1XNR L;  2IY5 B;  2CQO A;  4PZ7 A;  1VQH A;  2N3S A;  2ZTC A;  1SLJ A;  3Q8D A;  5LMN W;  4DV3 L;  4DV5 Q;  3H3V I;  2K5H A;  3HOX H;  3G6E A;  3EN2 A;  4A3F G;  4A3G G;  1T9H A;  4GLX A;  1XPO A;  1NE3 A;  2MO1 A;  4LUV A;  3SGI A;  2EIF A;  5M3F G;  3CMA A;  5IYD H;  1NY4 A;  3CC4 A;  2N8N A;  2F4V L;  3D31 A;  2E2J H;  4UP9 A;  1L0W A;  3RLN A;  3WWV A;  5IE8 A;  1X56 A;  1GM5 A;  3S1N H;  1Y1V H;  2RCN A;  4DV1 Q;  3PUY A;  3GTJ H;  2NN6 G;  3DM3 A;  2K52 A;  2Z6K A;  4HID A;  3PGZ A;  1Y1W H;  1TWG H;  3PCO B;  4LFB Q;  3PV0 A;  3CCS A;  1HNX Q;  4DR3 L;  2AWO A;  4JG2 A;  1MJC A;  3KDF A;  1J5E L;  1OXX K;  5K36 G;  2MQH A;  1JJG A;  1PYB A;  3JC6 6;  3NEL A;  4NXN L;  3A5Z B;  3DLL A;  5FJ8 H;  2VQE Q;  4JI0 L;  3S1Q H;  2AHO B;  2BA1 A;  2N49 A;  2F3I A;  4HIK A;  1CUK A;  3G48 A;  2OQK A;  5IY0 A;  2CCZ A;  2UUA Q;  4PMW A;  4PZ8 A;  2K75 A;  1E3P A;  4L5S A;  1TWH H;  2VZA A;  4EQ5 A;  1KIX A;  4LF6 Q;  3TRZ A;  1SRO A;  4JI3 L;  1XTD A;  3HOY G;  4IPD A;  1E1O A;  5IYB G;  1VQ8 A;  2NVT H;  1IBK L;  2VUM G;  3HOZ G;  3OTO L;  3I4M G;  1K3R A;  3A74 A;  1A63 A;  1OXU A;  5JJI A;  2Q2H A;  4AYB E;  3RLF A;  1JMC A;  2ATW A;  4DV7 Q;  1A0I A;  1K9M C;  4JI5 L;  1JE5 A;  4P72 A;  3M9B A;  2WB1 G;  4LFC L;  2E5L Q;  4JOI C;  3T1H Q;  2ZM6 Q;  1C9O A;  3UE1 A;  1N34 L;  1B8A A;  1VQF A;  2CWP A;  4YHH L;  1PVO A;  3K8A A;  2YV5 A;  2HT1 A;  1B70 B;  3KF6 B;  1C0A A;  1EQQ A;  1N8R C;  1X54 A;  2R6G A;  2I0Q A;  5C0X G;  3CC7 A;  4IPC A;  4DR4 Q;  4JI1 Q;  4A3L H;  1XMQ L;  2AWN A;  4FDB A;  1IBL L;  3BU2 A;  4LF5 L;  4LF8 Q;  3GTL H;  1Q7Y C;  3T1Y L;  1CKN B;  3JAM i;  3PO3 H;  2WAQ G;  4A3M G;  4B3S Q;  5FLM G;  3ERS X;  3CQZ H;  4LF7 L;  1VQL A;  2JA8 G;  3HKZ E;  3HOV G;  1N32 Q;  1HNW Q;  4HIO A;  1I6H H;  3CPW A;  5GAH C;  2K4K A;  3BZC A;  1YBY A;  4DV0 Q;  1SN8 A;  3S17 H;  1FVI A;  3A5U A;  2I5L X;  1OXT A;  3OYY A;  4B3M L;  1FJG L;  1PYS B;  1UWV A;  1X3F A;  2E2I H;  4DR1 Q;  3H0G H;  2DGY A;  4KLK A;  1K0R A;  1LYL A;  3RZO H;  1N9W A;  2JEB I;  4GNX B;  4JI4 Q;  1UE5 A;  1X65 A;  1YHA A;  2UXD L;  4LWC A;  4X66 Q;  4AQY Q;  5GQO A;  4JV5 Q;  2B3G A;  2HIV A;  2WP8 J;  1VQ9 A;  2UUB L;  4DR7 L;  1BVS A;  1VQJ A;  1EUJ A;  5ELO A;  4HIM A;  1Q8K A;  4K0K L;  1XPU A;  4A3K H;  4BA2 I;  2I5H A;  1S72 A;  1U0L A;  1XJV A;  3S15 H;  1SR3 A;  5GAD C;  3ICE A;  2VNU D;  1SRU A;  4MTN A;  2RHQ B;  4DV2 L;  1PH4 A;  2K5V A;  5IWA Q;  1C7Y A;  5C44 G;  4JI6 L;  1N36 Q;  2Y0S E;  4J15 A;  4O0A A;  3RN5 A;  1W2B A;  2R7F A;  4BBR G;  2JEA I;  1GKH A;  3K80 C;  2Q2T A;  4C3I H;  2YTX A;  1VQN A;  4DR2 L;  4LNQ A;  3J7A 5;  2IX1 A;  3RLO A;  4LUO A;  1EYG A;  5HGQ A;  2DUD A;  2NN6 I;  4OON A;  4A3E H;  5LMU L;  2OTJ A;  4OO1 G;  1SE8 A;  2PMZ E;  2AKW B;  4DV5 L;  4A3D G;  4JBM A;  1X3E A;  1HJP A;  2XGT A;  4DR6 Q;  1IL2 A;  3E9I A;  3STB C;  3K7A H;  1SMX A;  3TEH B;  1PV4 A;  3CD6 A;  2KCM A;  2JA7 G;  1IZ6 A;  1A62 A;  3AFQ A;  3EIV A;  3K0X A;  3CCM A;  1Z47 A;  5LMN L;  2ZTE A;  4GNX C;  3S24 A;  4L5Q A;  4DR5 L;  2UXB L;  1KAW A;  4JYA Q;  2EXD A;  2R7D A;  4P71 A;  1CKN A;  1V9P A;  2QEX A;  4OWX B;  4LFB L;  3FHW A;  1L2F A;  4DV6 Q;  1I3Q H;  2GN5 A;  4A3I H;  3J80 c;  3F8T A;  4X62 Q;  3L2P A;  2H5X A;  1HNZ L;  2KHJ A;  2HQL A;  1JJ2 A;  2Z0S A;  1KC8 C;  3MXN B;  5AJ3 L;  1HR0 L;  2PQA B;  4JI8 Q;  2R92 H;  1I50 H;  4IOC A;  1WCM H;  2BH2 A;  4HJ7 A;  1K83 H;  4PG3 A;  3K81 C;  3F2C A;  3ULP A;  2XTI A;  1XMO L;  3FP9 A;  3I4O A;  4KI0 A;  5J3B A;  2K50 A;  1YZ6 A;  2AMC B;  1TXY A;  1KD1 C;  2CWA A;  4P73 A;  5C4J H;  3CF5 A;  2LXJ A;  3L7Z C;  2OWO A;  1KRT A;  2Q2U A;  4QY7 A;  2YU9 H;  3S14 H;  3HOW G;  2I5M X;  2MNA A;  1YHQ A;  2ZTD A;  4IOA A;  3I56 A;  3HFZ B;  5C0X I;  5M3M H;  4BBS H;  4JI2 L;  4BY1 H;  1D7Q A;  4IJL A;  4A3J H;  1VQO A;  1V1Q A;  4APV A;  5IP9 G;  1NTG A;  4B3T Q;  4B3R Q;  4YWL A;  1N33 Q;  4BY7 H;  2UUA L;  2UXC Q;  2E5L L;  3W1B A;  5IP7 H;  4NXM Q;  2F52 A;  4A3F H;  3CCE A;  2A1A A;  4GS3 A;  3UDF A;  4JCV E;  4A3G H;  2UUC L;  1Z9F A;  5GRO A;  2R93 H;  5IYC G;  5M3F H;  1KL9 A;  4WJ4 A;  4KHP Q;  1I94 Q;  4IFD I;  2IHF A;  2KBN A;  1EWI A;  1A8V A;  1P8L A;  2N78 A;  4AIM A;  4L5T A;  1S40 A;  1G51 A;  3GTP H;  2YTV A;  1IBM Q;  3GDE A;  2NVX H;  4H02 A;  4DNI A;  1PH6 A;  3BJU A;  2JA5 G;  4MZ9 A;  4JC0 A;  1QZG A;  3KF8 B;  1EIY B;  1LUZ A;  1HZ9 A;  1PH9 A;  1Q1E A;  4A4I A;  4QJF A;  1HNW L;  2OQ0 A;  2A8V A;  4GKJ Q;  3GTM H;  4IJH A;  2C35 B;  4GN3 B;  2B63 G;  1PH1 A;  2E8G A;  3S1M H;  1XNR Q;  3S1R H;  1SFO H;  4A3B H;  2QA4 A;  1PFS A;  2VS1 A;  1LTL A;  4BA1 I;  4DV3 Q;  2UU9 L;  2ID0 A;  1X9N A;  3HOY H;  3HOZ H;  5IYB H;  1QZH A;  3HKS A;  4DUY L;  3CCJ A;  1MJE A;  3CCL A;  2VUM H;  3HOU G;  4JBJ A;  4GKK L;  4BXX G;  4X66 L;  2JQO A;  5M5Y H;  3I4M H;  3ER0 A;  1L1O B;  2F4V Q;  3PSI A;  3ZJY C;  1X6O A;  1W3S A;  5C0X J;  4OO1 I;  1VS0 A;  1YIT A;  3AEV A;  2ALY B;  1MKH A;  4A3L G;  4LFA Q;  3H3V H;  4KHZ A;  4LW1 A;  1UEB A;  4UP7 A;  1CSP A;  3RZD H;  5HY6 A;  3G71 A;  1QVG A;  4JOI A;  4DUZ L;  4DV4 L;  4DR3 Q;  1PH7 A;  4LF9 L;  1DGS A;  4DK6 C;  2NVQ H;  3I4N H;  1K73 C;  4A3C H;  1VQD A;  2IT1 A;  1J5E Q;  3M4Q A;  4IFD G;  1VQ5 A;  4NXN Q;  5BR8 Q;  4JI0 Q;  4YY3 L;  4IFD J;  4JBK A;  4X65 Q;  4JI7 L;  1NBW A;  2JA6 H;  2VQF L;  1YEZ A;  4POF A;  1NMF A;  1MIU A;  3CCU A;  4LF4 Q;  4R1J A;  2HHH Q;  1XNQ Q;  3RR5 A;  4QQB X;  4R4C A;  3ULJ A;  3U58 A;  1YIJ A;  3UDI A;  4JI3 Q;  4OWW B;  2R7Z H;  4A93 G;  4OX9 L;  4A3M H;  1J6Q A;  5FLM H;  4YWK A;  2JA8 H;  1IBK Q;  3HOV H;  3H15 A;  3OTO Q;  3AYH B;  4R4Q A;  2YYZ A;  1CSQ A;  2L15 A;  3STB D;  4R4T A;  1L1O C;  4YCW A;  4DV6 L;  2NZH A;  4ME3 A;  1K8G A;  1P16 A;  1WI5 A;  4JI5 Q;  1VQI A;  3PUZ A;  3U50 C;  4LFC Q;  3I2Z A;  1V43 A;  1YJW A;  1ASZ A;  1O7I A;  4TVA B;  4X6A H;  1VQC A;  1WFQ A;  4YWM A;  3TRE A;  3PIP A;  1N34 Q;  3NEM A;  2IX0 A;  1VQG A;  4GN5 A;  1D8L A;  4RMF A;  1OTC A;  1E24 A;  1PA6 A;  1XMQ Q;  1GD7 A;  1IBL Q;  3KF6 A;  4LF5 Q;  4IO9 A;  3PF4 A;  1S3O A;  3GTG H;  3J81 j;  3PO2 H;  4QIW E;  3T1Y Q;  5C4X G;  2YTY A;  1L1O A;  3CPF A;  1VQP A;  1JT8 A;  3S2D H;  1EQR A;  4MNO A;  3CME A;  4BBR H;  3U4V A;  4LF7 Q;  1M90 C;  4DV1 L;  3W5O A;  4AYB G;  3I55 A;  4B3T L;  2LXK A;  1HNX L;  3MEF A;  2WB1 E;  1QUQ B;  2KEN A;  4A3D H;  4B3M Q;  2WFW A;  1QVC A;  2PI2 E;  4A3I G;  3PF5 A;  3KJP A;  3TS0 A;  1E1T A;  1FL0 A;  2VQE L;  2JA7 H;  1IYJ B;  4KHP L;  5C3E G;  1IXR A;  1I94 L;  3VDY A;  1KQS A;  1Q82 C;  3NEN A;  4GNX A;  4Y52 H;  4DR7 Q;  2UUB Q;  4LF6 L;  3K7U C;  4K0K Q;  1VQK A;  2ZJQ A;  3M3Y H;  3HOX G;  1NJI C;  4NB3 A;  3GTO H;  1X55 A;  3FKI H;  2PI2 A;  3RN2 A;  3JAM c;  3G4S A;  2E2H H;  5IYD G;  4DV2 Q;  4P75 A;  2D62 A;  1FGU A;  2VL6 A;  4JI6 Q;  4IPG A;  3UDX A;  3HKZ G;  5M5W H;  3CCR A;  4GKJ L;  3PIO A;  2K14 A;  4DV7 L;  4DR2 Q;  1NMG A;  4RG1 A;  1Y1V G;  3UE0 A;  5M3M G;  1XPR A;  1BBW A;  1Y1W G;  3CCV A;  2MO0 A;  2CFM A;  5LMU Q;  2ZM6 L;  3T1H L;  1U5K A;  4UP8 A;  3J81 i;  1M1K C;  3F2B A;  3BZK A;  4BY7 G;  3W1G A;  2BH8 A;  5IP7 G;  1HR0 W;  2B29 A;  1PH3 A;  1Q12 A;  1YJN A;  1VCI A;  2R93 G;  2VW9 A;  5FJ8 G;  3PUW A;  4DR4 L;  3HOW H;  4JI1 L;  1YHB A;  5LMN Q;  1VQ6 A;  4DR5 Q;  5GAE C;  4LF8 L;  2UXB Q;  3CP0 A;  1UE1 A;  4XIG S;  1K8A C;  1Q1B A;  4X64 Q;  5IP9 H;  1Q46 A;  4UY8 C;  2GVA A;  4YCV A;  4HJ5 A;  4R4O A;  1OXS C;  5IT9 c;  4B3S L;  3CCQ A;  1AH9 A;  1N32 L;  1HNZ Q;  2Y0S G;  5IYC H;  5FLX c;  5JJL A;  4HJ8 A;  1RIP A;  5AJ3 Q;  3EBE A;  1HR0 Q;  1KRS A;  1EOV A;  1QUQ A;  1CKM A;  4DV0 L;  1HZB A;  5ELN A;  5BR8 L;  4X65 L;  3S16 H;  4DR1 L;  2PQA A;  4JBW A;  4LFA L;  1GVP A;  2JE6 I;  4DAY B;  2ZJP A;  3RNU A;  1XMO Q;  1Y14 B;  2HHH L;  4LF4 L;  4JI4 L;  1XNQ L;  3M7N A;  2Q2I A;  3OW2 A;  3B6Y A;  2JA5 H;  1AE2 A;  1AE3 A;  2FXQ A;  4AQY L;  1EFW A;  4JV5 L;  4UPA A;  4AH6 A;  1YI2 A;  4HJ9 A;  5JEA G;  4C3J H;  1G6P A;  2PNH A;  3CAM A;  2K5N A;  5JEA J;  3CXC A;  2NZO A;  2ASB A;  1CKO A;  4NPS A;  2LSS A;  2B63 H;  2VY3 A;  4JI2 Q;  1I5F A;  1TWC H;  4GOP B;  1X3G A;  3M4O H;  4OWT B;  1UE7 A;  4QGU A;  4EX5 A;  1JB7 A;  5IWA L;  2ES2 A;  1VQB A;  1HZC A;  3KOJ A;  1N36 L;  2D0P A;  4LUZ A;  1OXV A;  3J80 i; 
#chains in the Genus database with same CATH topology
 1VQA A;  1D2B A;  4BXX H;  2A19 A;  5C0X H;  1BOS A;  2EOT A;  5FK9 C;  3DHQ A;  3MXU A;  4DFA A;  2RHS B;  4C3J B;  4A76 A;  3KYH C;  1K3B C;  2NVY H;  5DEH A;  5C5L A;  1U4M A;  3TZD A;  2F0D A;  3HOU B;  4IFD H;  3NXW A;  5L37 A;  1K0S A;  1QJO A;  4A75 A;  2F0U A;  4TQU S;  2PZW A;  4PZ6 A;  4V0B A;  5JJK A;  4JI8 L;  1VMC A;  2FIN B;  4GKK Q;  3CRL C;  4XT3 B;  2V1C C;  1Q86 C;  4KD4 A;  5M5X H;  3UI2 A;  3QO2 A;  3W2D A;  1HXY D;  3OIP A;  4GN4 B;  4Y7N H;  4GLV B;  5IT9 E;  2E2I B;  3A0J A;  4DV4 Q;  4GOP A;  4A93 B;  3RZO B;  5T1I A;  1RL2 A;  1TWA H;  1H9J A;  2QKI C;  1S5D D;  3ULL A;  1IYU A;  2CKZ B;  4FVM A;  3CKI B;  3KLW A;  2UXC L;  3W3A A;  4C3H B;  2VQF Q;  1BKB A;  1E22 A;  2F0K A;  3LGJ A;  4ALP A;  2N55 A;  2O5J C;  4WJW A;  2UXD Q;  3VR2 A;  4X3K A;  5EAY A;  4TSS A;  1V1O A;  1H9S A;  1BBU A;  2HIX A;  4QB4 A;  3E0E A;  1JB3 A;  1UE6 A;  1F9P A;  1RD9 D;  1ESR A;  5C4X B;  3GTK H;  1PH5 A;  3FPP A;  5CR3 A;  2A69 C;  4BBS G;  2D9U A;  1YNX A;  2IW3 A;  4BY1 G;  5BN5 A;  2IY5 B;  1XNR L;  1TS4 A;  5CV5 A;  2L0C A;  1ILQ A;  3TP7 A;  2ZTC A;  4DV5 Q;  5CC4 A;  3EN2 A;  4QUC A;  5KNB A;  1WTO A;  1XPO A;  1EY5 A;  1KNE A;  1I3Q B;  2B2V C;  2K5D A;  4R9W A;  3OOC A;  1EY9 A;  1L0W A;  3RLN A;  2RCN A;  5C3E B;  1YNN D;  3DM3 A;  3Q6S A;  2Z6K A;  1Y1W H;  1TWG H;  3JAM L;  4OIK A;  3QOL A;  2F0S A;  2L55 A;  1LTI D;  2XN9 C;  4DR3 L;  4JG2 A;  1Y8O B;  3HOX B;  2HDL A;  4E6I A;  3QJY A;  1J5E L;  2MQH A;  2K5W A;  3EFX D;  3NEL A;  4NXN L;  3A5Z B;  3DLL A;  2VQE Q;  4JI0 L;  2BA1 A;  1ONL A;  1V8Q A;  1CUK A;  2E2J B;  3HKZ B;  1BUV T;  2VZA A;  4LF6 Q;  1Y1V B;  5M3M B;  1SRO A;  3NHH A;  3SXH A;  3HS0 C;  2NVT H;  1PTO B;  1IBK L;  3D4W A;  1A63 A;  2EYO A;  1GOZ A;  2ATW A;  4AYB E;  1JMC A;  3Q22 A;  4JOI C;  3T1H Q;  1C9O A;  1N34 L;  2CWP A;  4YHH L;  2AUJ D;  1ENA A;  1ET6 A;  1HUN A;  2YV5 A;  1B70 B;  2KCC A;  4HMJ A;  2R6G A;  1A2T A;  1N8R C;  4IPC A;  4JI1 Q;  4A3L H;  2F0L A;  3BU2 A;  4WRD A;  1TVX A;  4RGM A;  4CDD C;  3IL8 A;  2PMZ B;  4B3S Q;  2QDB A;  3ERS X;  2JA8 G;  3HOV G;  1HNW Q;  1PTO C;  3CPW A;  5GAH C;  1Y8N B;  2K4K A;  1YBY A;  4JVZ A;  3P20 A;  1SN8 A;  2I5L X;  4DN4 M;  1X3F A;  2K01 A;  3GTL B;  5COY A;  1YHA A;  4NKL A;  5COR A;  2F3V A;  1TY2 A;  4X66 Q;  1GHK A;  4JV5 Q;  2B3G A;  3PO3 B;  2HIV A;  3FRP B;  3CQZ B;  1EUJ A;  1Q8K A;  3SDZ A;  3S17 B;  5GAD C;  5ISR A;  2QDL A;  4DV2 L;  2PZU A;  3IFD A;  1CFM A;  1UAP A;  2Y0S E;  4J15 A;  4O0A A;  5DAU A;  4BBR G;  2JEA I;  1EU4 A;  1SMY D;  4Z9C B;  4LNQ A;  5FO8 B;  1D6E C;  3DM1 A;  3DWA A;  1EYG A;  2K32 A;  2DUD A;  4KKT A;  4UAI A;  2EVB A;  4OO1 G;  1SE8 A;  2AKW B;  4JBM A;  4ZUI A;  1EYD A;  3E9I A;  3LWU A;  1EZ6 A;  2NWG A;  3K7A H;  1PV4 A;  1SNM A;  1IZ6 A;  4J6H A;  2JA7 G;  1Z47 A;  2UXB L;  4C3I B;  3J7A F;  2R7D A;  3OHX C;  4L63 B;  2E76 C;  1V9P A;  3BVM A;  4OWX B;  1L2F A;  2JN4 A;  3NBH A;  4A3I H;  2NYZ D;  4B9X A;  3L2P A;  1JJ2 A;  2Z0S A;  1KC8 C;  2K05 A;  3MXN B;  1E2Z A;  2M2L A;  4HJ7 A;  2K28 A;  4PG3 A;  5C5M A;  3HGB A;  3F2C A;  4KI0 A;  1W6J A;  1YZ6 A;  1TXY A;  1KD1 C;  4TRD A;  2LXJ A;  1HFN A;  3C1F A;  2YU9 H;  1A3U A;  3MFY A;  1STE A;  4KJN A;  5NUC A;  3HOW G;  4IOA A;  2B8G A;  1YHQ A;  1CQV A;  2KHS A;  2L4N A;  3HFZ B;  5C0X I;  4BBS H;  2R92 B;  3RMH A;  4BY1 H;  5TSS A;  3KLS X;  4HMI A;  4B08 A;  4B3T Q;  1K83 B;  4KMU C;  1GUS A;  2F0F A;  2QEJ C;  4BY7 H;  2E5L L;  1B50 A;  3CCE A;  4GS3 A;  2R93 H;  5GRO A;  5IYC G;  1KL9 A;  5C4J B;  4KHP Q;  4IFD I;  4CBV A;  4J1M A;  1LT5 D;  1WTX A;  4L5T A;  3GTP H;  1JOK A;  3OWE B;  3VR6 A;  3BJU A;  3BVG A;  1EYC A;  1KAB A;  1F9Q A;  2QCP X;  1LUZ A;  2DN8 A;  3C2P A;  4QJF A;  4C3J G;  4GKJ Q;  1YNJ C;  4GN3 B;  5CGK A;  3S1R H;  2XWJ B;  2F3W A;  1PFS A;  2VS1 A;  1GUG A;  4BA1 I;  4DV3 Q;  1B3Q A;  2NVX B;  1QZH A;  3HOU G;  3CCJ A;  1MJE A;  4GKK L;  5M5Y H;  1L1O B;  3PSI A;  5C0X J;  1TS5 A;  1Q90 A;  2LMC B;  4LFA Q;  2RA4 A;  1JE4 A;  1QOH A;  1QVG A;  4RGT A;  4DV4 L;  2NVQ H;  1XXG A;  1PH7 A;  4DK6 C;  2RCF A;  1VQD A;  1VDZ A;  5BR8 Q;  2PZT A;  3KLR A;  4IFD J;  1RKN A;  3I4M B;  1NBW A;  2VQF L;  1YEZ A;  4K5W A;  3CCU A;  2ICI A;  1XNQ Q;  4R4C A;  4HR7 B;  3U58 A;  1YIJ A;  4JI3 Q;  1PRT D;  1FNV A;  2R7Z H;  4A93 G;  1J6Q A;  1H9S B;  4YWK A;  1TU2 B;  3JAM E;  2JA8 H;  3NBI A;  3HOV H;  1I4X A;  4ME5 A;  2BOS A;  4CKC A;  1WD0 A;  4C3H G;  1ZYR C;  1EU3 A;  3SK6 A;  1CSQ A;  3STB D;  2L15 A;  1L1O C;  5IGF A;  4XDX A;  1BF4 A;  1NR4 A;  1P16 A;  4DNT B;  4JI5 Q;  1VQI A;  3U50 C;  2VB3 X;  2O2L D;  1IW7 D;  1O7I A;  3A8K E;  1VQC A;  3TRE A;  2EJG C;  4O1N A;  2C5C A;  3A55 A;  3NEM A;  2WAQ B;  1VQG A;  2F0M A;  4X3T A;  4G7Z C;  1RTO A;  3KF6 A;  5C4X G;  1CTM A;  1O78 A;  2YTY A;  3CPF A;  1JT8 A;  1STY A;  4U68 A;  5IGG A;  1KDA A;  2NTS A;  1A3T A;  4BBR H;  3H3V C;  2LS0 1;  1TT2 A;  4N9T A;  1SAP A;  4FXG C;  4OO1 H;  2LXK A;  2WB1 E;  1G6Z A;  2WFW A;  3OIQ A;  2F0N A;  3MXP A;  1CA6 A;  3TS0 A;  1E1T A;  3GTG B;  2VQE L;  2WKC A;  1LAB A;  2JA7 H;  3I73 A;  3J7A V;  5C3E G;  1I94 L;  2UUB Q;  3TP6 A;  4LF6 L;  1FD7 D;  3GQB A;  1VQK A;  3HOX G;  1TR5 A;  4NB3 A;  1X55 A;  3FKI H;  5HGT A;  5A2Q E;  5IYD G;  2D62 A;  2VL6 A;  1BCP D;  4JI6 Q;  3K5L A;  4IPG A;  3HKZ G;  1PYW D;  4M1U B;  1NMG A;  5ELC A;  1Y1V G;  2EYJ A;  5M3M G;  5CBA E;  4FP5 D;  4NMZ A;  5LMU Q;  2G9H D;  3T1H L;  1U5K A;  3J81 i;  3F2B A;  4H44 C;  5E3F A;  5IP7 G;  3V2T A;  4U67 3;  1YJN A;  3DXJ C;  5I9P A;  2VW9 A;  1WD1 A;  3HOW H;  4JI1 L;  3VYU A;  4ODG A;  5LMN Q;  5GAE C;  1HA6 A;  4XIG S;  4H7B A;  2E74 C;  2L9H A;  1CM9 A;  3I70 A;  3Q24 A;  1OXS C;  4B3S L;  3NSW A;  1PFB A;  2CH4 A;  1HNZ Q;  1EQT A;  5IYC H;  4IUN A;  1RCV D;  5FLX c;  3P75 A;  1KRS A;  3DMU A;  1MD2 D;  3SHL A;  4CDC C;  2SEB D;  4IZ8 A;  2OT2 A;  2PQA A;  4XYO A;  4JBW A;  4K8I A;  4LF4 L;  1Y14 B;  3M7N A;  1YNN C;  1TS2 A;  4JV5 L;  1D5M C;  1O80 A;  5CV8 A;  5JEA G;  4NDX A;  4C3J H;  1G6P A;  1DD2 A;  2AQ2 B;  4NPS A;  2FHT A;  1UE7 A;  5D3D A;  1JB7 A;  5J1Z A;  3NE5 B;  2UUA Q;  1JWM D;  3PO3 G;  3HOU H;  5C4Z A;  1HCZ A;  4ZLT F;  1GUN A;  1B7Y B;  3VA7 A;  1H9R A;  3FEW X;  5IIF A;  1TWC B;  3K0Y A;  3K6O A;  3FPU B;  4O2D A;  1XYI A;  1NNX A;  3T4A C;  3NBH B;  1HUM A;  1WJJ A;  4RGO S;  5DLQ E;  1WTH A;  1TII D;  2EYF A;  2G9D A;  4OXP A;  1HZA A;  1NSN S;  4KY5 A;  3J81 c;  1HH2 P;  1JJC B;  1B44 D;  4IPH A;  2UU9 Q;  3KFU A;  4YHH Q;  1HTP A;  4A93 H;  4C3I G;  4DUY Q;  1QCB D;  2EZV A;  1STB A;  4F87 A;  4C3H H;  1Q81 C;  3M7G A;  4KD3 A;  5C44 H;  1E7Z A;  3VYR A;  1HA5 A;  3M85 A;  4DUZ Q;  4LF9 Q;  5EPJ A;  5EPK A;  1R9T B;  4TKO B;  2O5I C;  4YY3 Q;  3D8G A;  3NTH A;  4MN3 A;  5C4X H;  2BA0 A;  2IL8 A;  4YCU A;  1YVC A;  5EKK A;  3J7Z C;  4HJA A;  1O7Z A;  2R92 G;  4C2M B;  5E4W C;  4OX9 Q;  3F2D A;  3F1Z A;  2OCE A;  3GD7 A;  4K14 A;  1SMY C;  1PHJ A;  2JYO A;  5CBE E;  2A74 C;  2WAQ E;  2JA9 A;  4GZY C;  3T56 B;  3A7L A;  3GO5 A;  5E4X A;  4I7A A;  5I4D A;  4FNF A;  4DAM A;  2B2W A;  5C3E H;  2IX3 A;  3BVZ A;  2F03 A;  2RDH A;  1VQH A;  1SLJ A;  4DV3 L;  3Q8D A;  1Y8P B;  3HOX H;  4AYB B;  1T9H A;  3K5O A;  4LUV A;  2K04 A;  5IYD H;  3VYT A;  3D31 A;  2E2J H;  4ID6 A;  5IE8 A;  1ET9 A;  1SDF A;  1X56 A;  1GHJ A;  1Y1V H;  4LFA L;  3PUY A;  3K5N A;  5G3L D;  4HID A;  1M4V A;  1WTQ A;  2I46 A;  1PTO H;  4DNR B;  1HNX Q;  1H9K A;  2AWO A;  2F0J A;  2F4I A;  2B2T C;  3KDF A;  1OXX K;  4KKU A;  4DF7 A;  1PYB A;  2HDM A;  2Q8I B;  2N49 A;  4HIK A;  2F3I A;  2CCZ A;  2OQK A;  5IY0 A;  4PZ8 A;  2K75 A;  4PQX A;  4CDE C;  4EQ5 A;  3TRZ A;  1KIX A;  3S1N B;  3ZYY X;  4JI3 L;  1XTD A;  1LTB D;  1EY6 A;  2DJG C;  3I4M G;  3A74 A;  4ZQ3 A;  1IYV A;  5CV7 A;  4F8M A;  4EQP A;  4DV7 Q;  1K9M C;  4JI5 L;  2BDO A;  1B9N A;  4P72 A;  5KYL A;  2E5L Q;  2B2Y A;  3P1H A;  5FLX L;  1B8A A;  1PVO A;  1EEF D;  1EY4 A;  5JEA H;  3KF6 B;  4QF4 A;  2Y0S B;  1X54 A;  3CC7 A;  1D5Z C;  3HRZ C;  1BQQ T;  2AWN A;  4LF8 Q;  3GTL H;  1Q7Y C;  1DOM A;  1Z6H A;  2XRQ D;  1CKN B;  1FNW A;  2A5H A;  4FYD A;  4K8J A;  3PO3 H;  2WAQ G;  1S5F D;  3CQZ H;  3ERQ A;  1PRT B;  4ZCK A;  3BDL A;  1EWH A;  3BZC A;  1A15 A;  3S17 H;  1FVI A;  1FJG L;  4DA2 A;  1PYS B;  1UWV A;  5IGB A;  4MIU A;  2NZ1 D;  2K33 A;  1SSO A;  3CHB D;  4RCO A;  2K5Q A;  3MZ5 A;  1A6X A;  3E6Z X;  2WP8 J;  1VQ9 A;  2UUB L;  5D14 A;  4A3B B;  1VQJ A;  4HIM A;  3I4N B;  1I6H B;  1XPU A;  3MWY W;  3MXG A;  1SRU A;  2RHQ B;  2JA6 B;  4JI6 L;  3RN5 A;  1LAC A;  1W2B A;  5J39 A;  2R7F A;  2Q2T A;  4C3I H;  2CHB D;  4BS9 A;  1AN8 A;  1AW7 A;  1PRT C;  2NN6 I;  4DXF A;  1QG7 A;  5LMU L;  3I4L A;  1K8O A;  1HJP A;  4A3K B;  1F9R A;  3STB C;  3S15 B;  3TP8 A;  3TEH B;  1SNQ A;  3K0X A;  5LMN L;  4G7O C;  3S24 A;  4L5Q A;  1KAW A;  4JYA Q;  2EXD A;  1IW7 C;  1K8M A;  1K28 A;  2XWB B;  4R8N A;  1MBY A;  4A3E B;  4IQZ A;  3J80 c;  2H5X A;  5I9O A;  1O7Y A;  1HNZ L;  2F0O A;  3EQL C;  2ZT9 C;  2PQA B;  2R92 H;  1JWU D;  1EWC A;  2MUY A;  3PO2 B;  1BCP B;  1K83 H;  1U4P A;  3K81 C;  3ULP A;  1LTR D;  3I4O A;  3NQI A;  2K50 A;  1TY0 A;  2EY5 A;  4P73 A;  5C4J H;  2LFN A;  2PQE A;  1O7L A;  1T5E A;  1KRT A;  5IOC A;  3S14 H;  2MNA A;  1D7Q A;  4XQN A;  3C1E A;  1N33 Q;  2UUA L;  1J8I A;  3W1B A;  4NXM Q;  1BR9 A;  2K7V A;  3BDC A;  1EFI D;  4JCV E;  1Z9F A;  1F9S A;  3EJI A;  3U9S A;  1I94 Q;  4KTA A;  2IJ0 A;  1MSG A;  2KBN A;  2RKS A;  2H4O A;  4AIM A;  1BCP C;  2XIW A;  1IBM Q;  3GDE A;  3MFG A;  2NVX H;  3AB9 A;  1CA5 A;  1PH6 A;  4RFB A;  3SK4 A;  4JC0 A;  2A68 D;  1B9M A;  4A3F B;  1HZ9 A;  4X3S A;  1Q1E A;  2DNC A;  1PH9 A;  3NTK A;  2OQ0 A;  2A8V A;  4IJH A;  3A8I E;  1PH1 A;  2ZXO A;  2E8G A;  4UDU C;  2QA4 A;  1S4Z A;  2UU9 L;  1X9N A;  1JIC A;  5D3I B;  4DUY L;  1V1P B;  2JQO A;  3P7J A;  3I4M H;  1HPC A;  2O4X A;  2F0G A;  3TZU A;  1X6O A;  3AEV A;  3A56 A;  1MKH A;  3H3V H;  2BE5 D;  5C3X A;  3RZD H;  1QIL A;  5EGT A;  1SFO B;  4DUZ L;  3FVQ A;  4LF9 L;  1BO0 A;  1GUT A;  1LTS D;  3HOZ B;  2VUM B;  3X3N A;  1ENC A;  5A2Q L;  4YY3 L;  4O42 A;  4JBK A;  4ZRZ A;  4RCN A;  1JC7 A;  1MIU A;  1NMF A;  2Z4H A;  4LF4 Q;  5IOD A;  4P2C B;  3LX0 A;  4QQB X;  3ULJ A;  2J7Z A;  2RVL A;  3UDI A;  4ULL A;  1ROD A;  2WB1 B;  4L6T B;  4OWW B;  4OX9 L;  1LTG D;  1QNK A;  2Z8L A;  3OTO Q;  1DOK A;  3AYH B;  4R4Q A;  2YYZ A;  3KF8 A;  1K8G A;  1EZ8 A;  4LFC Q;  1ENF A;  1NCV A;  3I2Z A;  1U4L A;  2Q8T A;  1WFQ A;  3PIP A;  3BDO A;  2DY7 A;  1RF2 D;  3V96 A;  4G7H C;  1D8L A;  4RMF A;  1OTC A;  4KKS A;  1E24 A;  1GUO A;  1XMQ Q;  1IBL Q;  3EVQ A;  4LF5 Q;  3PF4 A;  3GTG H;  3J81 j;  3T1Y Q;  1VQP A;  1EQR A;  1CQF A;  3T13 A;  1JCK B;  3GP7 A;  3U4V A;  1S5B D;  5FLX E;  3R8B A;  4RKB A;  3VR5 A;  4AYB G;  1HNX L;  1UUP A;  4X3U A;  5M5X B;  1QVC A;  1W6K A;  3QB3 A;  1IXR A;  2E75 C;  4JW0 A;  3S2D B;  5IGD A;  2B2U A;  3D6C A;  4DR7 Q;  3R2T A;  4QMG A;  2KEC A;  4K0K Q;  2ZJQ A;  4RGN A;  1J9O A;  2PI2 A;  3RN2 A;  4A3D B;  2XVS A;  2SNS A;  3IKJ A;  1G91 A;  4DV7 L;  4DR2 Q;  4RG1 A;  2TMP A;  4KN4 C;  4NP5 A;  2MO0 A;  5FKA C;  1Q8I A;  3J80 L;  2CFM A;  2A6H D;  1M1K C;  4C56 C;  1LO5 D;  2ICE C;  4KY7 A;  2BH8 A;  3GTO B;  1ESF A;  5FJ8 G;  3PUW A;  5DM6 3;  1ICW A;  1YHB A;  4DR5 Q;  4LF8 L;  3GTK B;  3BZD B;  1K8A C;  1Q46 A;  1QE6 A;  1M8A A;  5IT9 c;  1AZP A;  3O13 A;  2Y0S G;  1WTP A;  5JJL A;  3EBE A;  1HR0 Q;  1QUQ A;  1IKL A;  1XWE A;  5FO7 B;  5C3W A;  4QCL A;  5I6Y A;  1GVP A;  2JE6 I;  3I8Z A;  5I6W A;  2EY6 A;  1TWG B;  1G2S A;  1PTO F;  1PXU A;  4UPA A;  2PNH A;  5M9O A;  2K5N A;  5JEA J;  2VXW A;  3CXC A;  2LSS A;  2VY3 A;  1AZQ A;  1TWC H;  4GOP B;  3F2U A;  4EX5 A;  2ES2 A;  3S16 B;  3DUZ A;  1VQB A;  5LHY 1;  4LUZ A;  1HQM C;  5CYU A;  4A3B G;  5GAG C;  3I4N G;  2MJ8 A;  2JA5 B;  2EQS A;  1R4P B;  1VQ4 A;  2MFI A;  3G6J B;  4A3C G;  2HD3 A;  1B3A A;  3CW2 C;  1KXL A;  2JA6 G;  3AQQ A;  1KTK A;  2Z4I A;  4PNY A;  4IN3 A;  2D2C C;  1GO3 E;  2EYL A;  2IHE A;  5ELD A;  3D0F A;  3A8J E;  4JYA L;  3X3M A;  5FOB B;  1STA A;  1QNU A;  4QL5 A;  4F88 A;  4A3K G;  2KCT A;  3RUZ A;  3QWN A;  4DKA C;  4GOP C;  3N52 A;  1PH8 A;  2PYK A;  1PZK D;  2ZXR A;  1SND A;  1R9T H;  2DNE A;  3PUX A;  1VQE A;  2JK8 A;  3OPO A;  3K5M A;  3UDG A;  4DAY A;  1PMR A;  4A3E G;  5A35 A;  1LT6 D;  3PO2 G;  1CHP D;  4C2M H;  3GTQ B;  1TWF B;  4ZUJ A;  4FXK C;  3S9W A;  2R3Z A;  2GVB A;  1MSH A;  2F0I A;  1CK1 A;  1N33 L;  1KHI A;  4POG A;  1U4R A;  3I7F A;  1FJG Q;  2KHI A;  4R4I A;  5JVH 3;  4NXM L;  4JI7 Q;  3D4D A;  3IRB A;  3EA6 A;  2CH4 W;  2Q8R E;  1EQV A;  2F0P A;  1YJ9 A;  2OXP A;  1UNS A;  1S5C D;  4CKB A;  3E5S A;  1IBM L;  4R8I A;  1B53 A;  5H1S E;  4X64 L;  2C9O A;  2A6E D;  1CHQ D;  4DAP A;  3MVV A;  4L5R C;  1CT1 D;  2Z6K C;  2PW7 A;  3KBX A;  1KLU D;  3WDN A;  3K7A B;  1BNZ A;  3TSS A;  2CQO A;  4PZ7 A;  2N3S A;  1SEB D;  5LMN W;  3S2H B;  3H3V I;  2F0T A;  2K5H A;  4A3F G;  4GLX A;  1NE3 A;  3BYT B;  1NY4 A;  3NUC A;  3CC4 A;  2N8N A;  4C1N I;  4A3I B;  4UP9 A;  1SE2 A;  1MHW C;  4OEL B;  1GM5 A;  3I3C A;  2KEE A;  3S1N H;  4DV1 Q;  1EIY B;  4RWS C;  3PGZ A;  3PCO B;  2CW0 D;  3PV0 A;  3CCS A;  1IHZ A;  2WKD A;  2KVM A;  1IL8 A;  3D4R A;  5G3L F;  5K36 G;  1JJG A;  2FMC A;  5FJ8 H;  1D1I A;  2AHO B;  3H91 A;  4PMW A;  2YU9 B;  1E3P A;  4L5S A;  4DU9 A;  3GTJ B;  4FF1 A;  1FGB D;  3ERO A;  4IPD A;  1E1O A;  5IYB G;  2VUM G;  3HOZ G;  4BY7 B;  3OTO L;  1E0B A;  1K3R A;  1OXU A;  5JJI A;  2R93 B;  3S1Q B;  2Q2H A;  3WOE A;  4CGY B;  1JE5 A;  3M9B A;  2WB1 G;  4LFC L;  1TWH B;  1BXT A;  3GTP B;  3UE1 A;  1VQF A;  3CRK C;  1EQQ A;  4DR4 Q;  2I0Q A;  5C0X G;  2A68 C;  1DJR D;  1E2W A;  1XMQ L;  4FDB A;  1IBL L;  4LF5 L;  1A3V A;  4CDF C;  3T1Y L;  1VF7 A;  3JAM i;  3S1R B;  5FLM G;  3J80 E;  1F2Z A;  4M8A A;  2EY1 A;  4HIO A;  1I6H H;  3DWP A;  4ZYS A;  4DV0 Q;  5KGU A;  3A5U A;  1OXT A;  4IUU A;  2E2I H;  4DR1 Q;  1BDO A;  1LYL A;  4KLK A;  3RZO H;  5EQ0 A;  3T53 B;  1UE5 A;  2EY2 A;  2OF1 A;  2I07 B;  4LWC A;  5GQO A;  2BE5 C;  4DAV A;  4F7X A;  4DR7 L;  1BVS A;  5ELO A;  1JWS D;  4K0K L;  4A3K H;  4BA2 I;  1HTL D;  1S72 A;  1U0L A;  2NUC A;  3S15 H;  1SR3 A;  2L11 A;  1SNC A;  2KA7 A;  3T16 A;  4MTN A;  1C7Y A;  2CVR A;  5IWA Q;  3U9O A;  3H0G B;  4DK1 A;  4S3S A;  1SYF A;  1JQY D;  2HCI A;  2YTX A;  4RH6 A;  4CJ2 C;  4CJ0 B;  5KEE A;  4DR2 L;  1VQN A;  3J7A 5;  5EPL A;  2IX1 A;  2G5D A;  4LUO A;  2F0H A;  2R7Z B;  4OON A;  5JPN C;  4A3E H;  2QF7 A;  4A3D G;  3C46 A;  2EJM A;  1X3E A;  2KOL A;  2XGT A;  4DR6 Q;  2M9V A;  1IL2 A;  2B39 A;  2CQA A;  2KCM A;  1A62 A;  1H95 A;  2ZTE A;  4DR5 L;  2BDN A;  4P71 A;  2QEX A;  2RDG A;  4LFB L;  1I3Q H;  2EE1 A;  2NB0 A;  3F8T A;  4X62 Q;  2HQL A;  1HR0 L;  4IUR A;  3KBG A;  5EBC A;  5I2Y A;  4IOC A;  1STH A;  1AFP A;  2BH2 A;  4KV6 A;  3URY A;  2MPM A;  1X32 A;  1OO9 B;  3FP9 A;  2RBM A;  4N8F A;  1DON A;  1FNU A;  2AMC B;  3KUP A;  1HFG A;  2CWA A;  3CF5 A;  3ND8 A;  2ZTD A;  5M3M H;  1I50 B;  1WCM B;  4B3R Q;  4UHV A;  1LT4 D;  1SYB A;  5IP7 H;  3VYS A;  2L12 A;  4A3F H;  3OWF A;  2A1A A;  2RSO A;  3CU7 A;  5IGC A;  2NTT A;  3FKI B;  4WJ4 A;  2HCC A;  1EWI A;  4ZK9 B;  1P8L A;  2N78 A;  2D5D A;  1G51 A;  2YTV A;  4DNI A;  4A3J B;  3MAQ A;  2GA4 B;  2JA5 G;  4MZ9 A;  1DM0 B;  4N9P A;  4A3G B;  2A6H C;  5K36 H;  5M3F B;  2L1B A;  2C35 B;  3TP5 A;  4KN7 C;  1L0X B;  3NQT A;  1SFO H;  2ID0 A;  3HOZ H;  4MHE A;  5IYB H;  3HKS A;  2VUM H;  1C4Q A;  4XQJ A;  2HQE A;  4JBJ A;  2F0W A;  3ER0 A;  3AU7 A;  2F4V Q;  1S5E D;  3GV6 A;  5LL6 S;  4OO1 I;  1VS0 A;  1YIT A;  3GTM B;  4A3L G;  1I6V C;  2J4X A;  4LW1 A;  5IGE A;  3H94 A;  4G57 A;  1UEB A;  2JP1 A;  2EYM A;  3S1M B;  5HY6 A;  3MA2 B;  1T5X D;  3R3O A;  2K1B A;  1DGS A;  1K73 C;  4CKE A;  3HOY B;  2IT1 A;  3VR3 A;  3A7A B;  4HSP A;  1VQ5 A;  1SNP A;  2QIL A;  3DWQ A;  4JI7 L;  4POF A;  4ABN A;  1EOT A;  4IUP A;  4R1J A;  1KAA A;  2WII B;  4JPB W;  3QG1 A;  5T1G A;  5FLM H;  2HUG A;  5K5P A;  3H15 A;  1KNA A;  1PFN A;  1ZXT A;  2FMM A;  4DV6 L;  3I91 A;  4ME3 A;  1WI5 A;  4RKL A;  1F2L A;  2WIN B;  2KED A;  5BN4 A;  1ASZ A;  4TVA B;  4X6A H;  4YWM A;  5KND A;  4NW2 A;  4A3M B;  1LV9 A;  4GN5 A;  3J81 L;  1SBB B;  1EY0 A;  1PA6 A;  4ZKC B;  1GD7 A;  1DCZ A;  1RJT A;  3H6M A;  1H9M A;  1L1O A;  2QW7 A;  1WTR A;  1GXD C;  3S2D H;  3D6W A;  1LTT D;  3I90 A;  1G8Z D;  1HQR D;  4LF7 Q;  4DV1 L;  4KY6 A;  2Z6B A;  3I55 A;  3MEF A;  3TN2 A;  4K2K A;  5C6A A;  4B3M Q;  4A3D H;  2R61 A;  1ICF B;  2PI2 E;  4A3I G;  3PF5 A;  3GV3 A;  2RDF A;  1FL0 A;  1FR3 A;  3VR4 A;  4LAA A;  5C44 B;  5JPM C;  3VDY A;  4H0L C;  3NEN A;  4GNX A;  4Y52 H;  2WV6 D;  1NJI C;  3GTO H;  3G4S A;  2AQ1 B;  4PMC A;  1HHV A;  4OHJ A;  3CCR A;  3PIO A;  2EYP A;  1VF5 C;  1ZKO A;  2H1E A;  4BY7 G;  2MGS A;  3M3Y B;  1Q12 A;  2A6E C;  1VCI A;  2E2H B;  2R93 G;  4DR4 L;  3DEO A;  3CP0 A;  1UE1 A;  5M5W B;  4X64 Q;  4KJO A;  4UY8 C;  1KDC A;  4HJ5 A;  4R4O A;  2SDF A;  5JJZ A;  3CCQ A;  3T51 B;  2OEO A;  4KK7 A;  4HJ8 A;  1RIP A;  5AJ3 Q;  1L0Y B;  1EOV A;  1CKM A;  4DV0 L;  4QUF A;  1DYQ A;  3MHB A;  4X65 L;  3S16 H;  4EQN A;  4DR1 L;  3M4Y A;  3SVM A;  4Q0F A;  3SK5 A;  1C8C A;  1XMO Q;  2HHH L;  3E0J A;  4WFN 3;  2JA5 H;  3B6Y A;  1AE2 A;  2FXQ A;  1EFW A;  2CW0 C;  2BCO A;  4HJ9 A;  1B2T A;  1SE4 A;  3NTI A;  2EJF C;  2ASB A;  3D3R A;  4XYQ A;  4JI2 Q;  2MHV A;  4I7Z C;  4QGU A;  3PIO 3;  1JR0 D;  5IWA L;  2LY7 A;  2D0P A;  3RD4 A;  3U4Z A;  3SEB A;  5CMD A;  4Q5V A;  2UUC Q;  4HED A;  1VQM A;  2X6L A;  4GLA C;  1A2U A;  4V19 0;  4WJ3 M;  4XTC S;  3OSO A;  1VQ7 A;  1C48 A;  3QOJ A;  2RF4 A;  4C1N K;  4DPG A;  4DR6 L;  2B63 B;  3H0G G;  2TSS A;  1LM0 A;  4ILW A;  1MI2 A;  3M4O B;  1PH2 A;  2J0T D;  1ASY A;  2R7Z G;  2K03 A;  1PRT F;  1CZW A;  4JK1 C;  4P74 A;  5E7N A;  1VMP A;  2WAC A;  4J8Q A;  2QGQ A;  3L0O A;  5JAV A;  4X62 L;  3GTQ H;  2OTL A;  3LWE A;  1TWF H;  2NVY B;  1DZ1 A;  3TDQ A;  1QVF A;  1CZG A;  3M4P A;  4N8X 1;  5ELB A;  2RQX A;  5CV9 A;  2DJF C;  1KDB A;  3AFP A;  4K5V A;  2KJX A;  4OEM B;  1I4R A;  4DK3 C;  2K6A A;  4IUQ A;  1WYD A;  1SYC A;  4I65 A;  4B3R L;  3KDF B;  3NWS A;  1SYE A;  2PO4 A;  3R2I A;  2FFK B;  2KQ3 A;  3NP8 A;  1Z7T A;  2ZJR A;  1LLR D;  4MTK A;  2B2W C;  3HP3 A;  3TQY A;  1G29 1;  3E9H A;  1I4G A;  1EIF A;  3A54 A;  3LNN A;  3CC2 A;  3C3L A;  3BG3 A;  3PUV A;  4Y7N B;  2Z9H A;  1WCM G;  1WOC A;  3S2H H;  5KYI A;  3TS2 A;  3QIA A;  1TWA B;  3KJO A;  2JJQ A;  1PFM A;  3FKI G;  1U9R A;  2F0V A;  3PIP 3;  1BCP F;  2EYH A;  4LK1 C;  5KIX A;  2D0O A;  4A3J G;  3MTS A;  1NUC A;  1SJE D;  2VB2 X;  3G6E A;  1DXM A;  3AMU A;  1QWY A;  4A3G G;  2M00 A;  2MO1 A;  3SGI A;  4RAU C;  2EIF A;  1II3 A;  3FDT A;  3CMA A;  5M3F G;  2F4V L;  1EL0 A;  3WWV A;  3NWT A;  1Y69 U;  1HR0 W;  3GTJ H;  1IKM A;  2NN6 G;  2K52 A;  4LFB Q;  3J81 E;  1MJC A;  4OGQ C;  2F0E A;  3JC6 6;  3S1Q H;  3G48 A;  3S14 B;  1QB5 D;  2B2Y C;  5J22 A;  2KCN A;  1TWH H;  4EVO A;  2NBF A;  3L9A X;  1Y1W B;  3HOY G;  1VQ8 A;  4XXE A;  4IAL A;  5D65 A;  2B2T A;  4HCE A;  2E2D C;  3RLF A;  4DXG A;  1A0I A;  1PZJ D;  4FO2 A;  3BYY B;  2ZM6 Q;  5I2X A;  3K8A A;  2HT1 A;  2NVT B;  3Q0A A;  1C0A A;  1STG A;  1I4Q A;  4FF4 A;  2A73 B;  5DNF A;  4RHS A;  3SR1 A;  5CV4 A;  5EJW A;  4HSV A;  3H09 A;  4A3M G;  1GJX A;  5E1F A;  4LF7 L;  1VQL A;  3HKZ E;  1N32 Q;  3OMG A;  1R4Q B;  4QIW B;  1WTW A;  4B3M L;  3OYY A;  3H0G H;  2DGY A;  4RHR A;  1K0R A;  1N9W A;  2JEB I;  4GNX B;  4JI4 Q;  2UXD L;  1X65 A;  3ITP A;  3HG9 A;  4AQY Q;  3RZD B;  4K6L A;  5EBD A;  3K58 A;  2I5H A;  2Z1C A;  4HAE A;  1XJV A;  2VNU D;  3ICE A;  2V4D A;  1PH4 A;  1EYA A;  2K5V A;  3OW7 A;  5ELF A;  5C44 G;  1X3Q A;  1N36 Q;  2DY8 A;  1GKH A;  3K80 C;  1NR2 A;  3NPP A;  3RLO A;  3WOF A;  5HGQ A;  2OTJ A;  4FXD A;  2PPB C;  1SJH D;  1EEI D;  2PMZ E;  4DV5 L;  3ND9 A;  2A69 D;  3V05 A;  4FF2 A;  1AP0 A;  2XRS D;  1SMX A;  3CD6 A;  3AFQ A;  3EIV A;  3CCM A;  4GNX C;  1E2V A;  2N88 A;  3I72 A;  3HEJ A;  1FYC A;  2MP1 A;  1CKN A;  1SNO A;  2SOB A;  4K5X A;  4IUT A;  3FHW A;  1D1K A;  4DV6 Q;  2GN5 A;  2L5T A;  1F77 A;  3KLS A;  2KHJ A;  4HCS A;  5AJ3 L;  1SXT A;  4JI8 Q;  1PDQ A;  4HN7 A;  1I50 H;  1WCM H;  1X3P A;  5FO9 B;  1CI3 M;  1MGS A;  1XMO L;  2XTI A;  4B9W A;  1WTV A;  3OMC A;  5J3B A;  1ZEQ X;  4L8J A;  1EY7 A;  2JSO A;  1I4H A;  5F2D A;  3L7Z C;  2OWO A;  2Q2U A;  4QY7 A;  2EDG A;  2X69 A;  2I5M X;  3I56 A;  4JI2 L;  1RDP D;  3SE0 A;  4IJL A;  4A3J H;  1VQO A;  1V1Q A;  4APV A;  5IP9 G;  1NTG A;  4YWL A;  1RHP A;  2UXC Q;  1JOO A;  5JVG 3;  4DK0 A;  2F52 A;  4A3G H;  3UDF A;  2UUC L;  3FMC A;  5M3F H;  2ZXP A;  1SE3 A;  2B2V A;  1ILP A;  2IHF A;  1EY8 A;  4CJ1 B;  1A8V A;  1XX8 A;  1PLF A;  1S40 A;  1B4O A;  2NN6 H;  4BBS B;  3N6R A;  4BY1 B;  4H02 A;  1TQO A;  1QZG A;  2F1M A;  3KF8 B;  2EXZ A;  3G7L A;  1EIG A;  4A4I A;  1HNW L;  4RA8 A;  2PW5 A;  3GTM H;  3PMF A;  2B63 G;  1BBX C;  5IT9 L;  3S1M H;  5EKI A;  1XNR Q;  1LTL A;  1SYD A;  1PTO D;  4H13 C;  3VA5 A;  3HOY H;  1EIH A;  3CCL A;  4BXX G;  4X66 L;  1STN A;  4OIJ A;  2IPK D;  3ZJY C;  1W3S A;  5JOB A;  1ML0 D;  2ALY B;  4KHZ A;  4ZKB B;  4UP7 A;  1CSP A;  3IAY A;  3G71 A;  1LTA D;  4JOI A;  4EGV A;  4DR3 Q;  3I4N H;  4A3B H;  5EKL A;  4A3C H;  1J5E Q;  1JOR A;  3M4Q A;  4HTH A;  2FJ2 A;  4IFD G;  1I4P A;  5C4H A;  4NXN Q;  4OL7 A;  4JI0 Q;  4X65 Q;  5M5Y B;  2JA6 H;  3QR8 A;  3MEH A;  3RR5 A;  2HHH Q;  3K59 A;  1PZI D;  4A3M H;  1IBK Q;  2NVQ B;  4K2L A;  2EPB A;  4K6D A;  3HZX A;  4R4T A;  4YCW A;  2NZH A;  1RTN A;  3PUZ A;  1V43 A;  1YJW A;  4ZAI A;  1TS3 A;  1N34 Q;  1SYG A;  5ELE A;  4XT1 B;  2IX0 A;  2JA8 B;  3HOV B;  1AEX A;  3MC0 B;  2P5Z X;  4IO9 A;  3J7Y W;  1S3O A;  1V1P A;  1HRJ A;  3PO2 H;  4QIW E;  4CHT B;  2B2U C;  4MNO A;  3CME A;  3Q23 A;  3TBI B;  5KRU A;  5BN3 A;  1M90 C;  3W5O A;  4B3T L;  1KLG D;  2F0Q A;  1QUQ B;  2KEN A;  2AQ3 B;  3KJP A;  1IYJ B;  4KHP L;  4LMQ D;  3PQI A;  4BBR B;  1Q82 C;  1KQS A;  1LT3 D;  3K7U C;  3M3Y H;  2ENB A;  3JAM c;  1F2M A;  2E2H H;  2RSN A;  4XQQ A;  4DV2 Q;  3R93 A;  4P75 A;  1FGU A;  4PMB A;  3UDX A;  5M5W H;  4GKJ L;  2K14 A;  2JA7 B;  2XSC A;  3UE0 A;  1XPR A;  5HUR A;  1XTC D;  1BBW A;  3E3X A;  1Y1W G;  3CCV A;  5LL6 X;  3SK8 A;  2ZM6 L;  1G2T A;  4UP8 A;  3KK7 A;  3BZK A;  1Q3L A;  1NAP A;  3W1G A;  3K57 A;  4PV1 C;  2B29 A;  2LKV A;  1PH3 A;  1YNJ D;  5DM7 3;  3L3O C;  2X6G A;  1VQ6 A;  2PNR C;  2UXB Q;  2SNM A;  3DEP A;  1Q1B A;  5IP9 H;  4FF3 A;  1WVL A;  2GVA A;  4YCV A;  3ONA B;  3NK9 A;  2PCF B;  1AH9 A;  1B1Z A;  4BWG B;  1TKW B;  1N32 L;  1UEA B;  1F2Y A;  1D5X C;  5KNC A;  2JXM B;  1HZB A;  5ELN A;  5BR8 L;  3MXN A;  3HOW B;  2IWH A;  2KUM A;  4DAY B;  3RNU A;  2ZJP A;  1XNQ L;  4G4K A;  4JI4 L;  2Q2I A;  4EQO A;  3OW2 A;  1AE3 A;  4AQY L;  5AFW A;  4YIJ A;  5CV6 A;  4AH6 A;  4DGZ A;  1GUW A;  1JOQ A;  1YI2 A;  3BS1 A;  3CAM A;  3IFT A;  2NZO A;  2AUK A;  1CKO A;  2B63 H;  4LJZ C;  1I5F A;  4KHV A;  1X3G A;  2XNA C;  4OWT B;  3TME A;  3M4O H;  2B8F A;  1DOL A;  1HZC A;  3KOJ A;  4WOR A;  1N36 L;  1OXV A;  4IUV A;  1ZYR D;  3J80 i; 
#chains in the Genus database with same CATH homology
 1VQA A;  3PO3 G;  3HOU H;  4A3B G;  5GAG C;  2UUC Q;  3I4N G;  4BXX H;  2EQS A;  2A19 A;  1VQ4 A;  2MFI A;  1VQM A;  4A3C G;  1B7Y B;  4GLA C;  4WJ3 M;  4XTC S;  2RHS B;  3CW2 C;  4A76 A;  1VQ7 A;  2RF4 A;  1KXL A;  4DPG A;  2JA6 G;  4DR6 L;  3AQQ A;  3H0G G;  3KYH C;  1LM0 A;  2NVY H;  1PH2 A;  1ASY A;  1GO3 E;  4O2D A;  2IHE A;  3D0F A;  2R7Z G;  4JYA L;  3NBH B;  4P74 A;  4A75 A;  1WJJ A;  5DLQ E;  4QL5 A;  4A3K G;  5E7N A;  2KCT A;  4TQU S;  4OXP A;  1HZA A;  2QGQ A;  3L0O A;  4PZ6 A;  4DKA C;  4X62 L;  3J81 c;  3GTQ H;  1HH2 P;  2OTL A;  1JJC B;  1H95 A;  4GOP C;  4IPH A;  2UU9 Q;  1TWF H;  1PH8 A;  5JJK A;  3KFU A;  4JI8 L;  4YHH Q;  1R9T H;  4A93 H;  3PUX A;  3U4Z A;  1VQE A;  2JK8 A;  4DUY Q;  4GKK Q;  3UDG A;  1Q86 C;  2V1C C;  4C3H H;  1Q81 C;  4A3E G;  5M5X H;  1QVF A;  3M4P A;  3AFP A;  5C44 H;  1E7Z A;  3PO2 G;  4C2M H;  4GN4 B;  4DK3 C;  4Y7N H;  4GLV B;  3A0J A;  3M85 A;  4DUZ Q;  4DV4 Q;  4GOP A;  4LF9 Q;  1WYD A;  1RL2 A;  1TWA H;  2GVB A;  3KDF B;  4B3R L;  3ULL A;  2CKZ B;  1KHI A;  3KLW A;  4POG A;  3I7F A;  4YY3 Q;  1FJG Q;  1N33 L;  2KHI A;  4R4I A;  2UXC L;  4NXM L;  2ZJR A;  4JI7 Q;  2VQF Q;  5C4X H;  1BKB A;  1E22 A;  2BA0 A;  3IRB A;  3LGJ A;  1YVC A;  4YCU A;  4ALP A;  3J7Z C;  3TQY A;  1G29 1;  3E9H A;  4HJA A;  2UXD Q;  1EIF A;  3CC2 A;  2R92 G;  5EAY A;  3PUV A;  1WCM G;  4OX9 Q;  3F2D A;  1YJ9 A;  1WOC A;  3F1Z A;  3S2H H;  2OCE A;  3GD7 A;  1IBM L;  3TS2 A;  5H1S E;  1BBU A;  2HIX A;  4X64 L;  1PHJ A;  3E0E A;  2WAQ E;  1UE6 A;  3KJO A;  2JA9 A;  2JJQ A;  3FKI G;  3GO5 A;  4L5R C;  3GTK H;  1PH5 A;  4DAM A;  2Z6K C;  5C3E H;  4BBS G;  1YNX A;  4BY1 G;  4A3J G;  2D0O A;  1XNR L;  2IY5 B;  2CQO A;  4PZ7 A;  1VQH A;  2N3S A;  2ZTC A;  1SLJ A;  3Q8D A;  5LMN W;  4DV3 L;  4DV5 Q;  3H3V I;  2K5H A;  3HOX H;  3G6E A;  3EN2 A;  4A3F G;  4A3G G;  1T9H A;  4GLX A;  1XPO A;  1NE3 A;  2MO1 A;  4LUV A;  3SGI A;  2EIF A;  5M3F G;  3CMA A;  5IYD H;  1NY4 A;  3CC4 A;  2N8N A;  2F4V L;  3D31 A;  2E2J H;  4UP9 A;  1L0W A;  3RLN A;  3WWV A;  5IE8 A;  1X56 A;  1GM5 A;  3S1N H;  1Y1V H;  2RCN A;  4DV1 Q;  3PUY A;  3GTJ H;  2NN6 G;  3DM3 A;  2K52 A;  2Z6K A;  4HID A;  3PGZ A;  1Y1W H;  1TWG H;  3PCO B;  4LFB Q;  3PV0 A;  3CCS A;  1HNX Q;  4DR3 L;  2AWO A;  4JG2 A;  1MJC A;  3KDF A;  1J5E L;  1OXX K;  5K36 G;  2MQH A;  1JJG A;  1PYB A;  3JC6 6;  3NEL A;  4NXN L;  3A5Z B;  3DLL A;  5FJ8 H;  2VQE Q;  4JI0 L;  3S1Q H;  2AHO B;  2BA1 A;  2N49 A;  2F3I A;  4HIK A;  1CUK A;  3G48 A;  2OQK A;  5IY0 A;  2CCZ A;  2UUA Q;  4PMW A;  4PZ8 A;  2K75 A;  1E3P A;  4L5S A;  1TWH H;  2VZA A;  4EQ5 A;  1KIX A;  4LF6 Q;  3TRZ A;  1SRO A;  4JI3 L;  1XTD A;  3HOY G;  4IPD A;  1E1O A;  5IYB G;  1VQ8 A;  2NVT H;  1IBK L;  2VUM G;  3HOZ G;  3OTO L;  3I4M G;  1K3R A;  3A74 A;  1A63 A;  1OXU A;  5JJI A;  2Q2H A;  4AYB E;  3RLF A;  1JMC A;  2ATW A;  4DV7 Q;  1A0I A;  1K9M C;  4JI5 L;  1JE5 A;  4P72 A;  3M9B A;  2WB1 G;  4LFC L;  2E5L Q;  4JOI C;  3T1H Q;  2ZM6 Q;  1C9O A;  3UE1 A;  1N34 L;  1B8A A;  1VQF A;  2CWP A;  4YHH L;  1PVO A;  3K8A A;  2YV5 A;  2HT1 A;  1B70 B;  3KF6 B;  1C0A A;  1EQQ A;  1N8R C;  1X54 A;  2R6G A;  2I0Q A;  5C0X G;  3CC7 A;  4IPC A;  4DR4 Q;  4JI1 Q;  4A3L H;  1XMQ L;  2AWN A;  4FDB A;  1IBL L;  3BU2 A;  4LF5 L;  4LF8 Q;  3GTL H;  1Q7Y C;  3T1Y L;  1CKN B;  3JAM i;  3PO3 H;  2WAQ G;  4A3M G;  4B3S Q;  5FLM G;  3ERS X;  3CQZ H;  4LF7 L;  1VQL A;  2JA8 G;  3HKZ E;  3HOV G;  1N32 Q;  1HNW Q;  4HIO A;  1I6H H;  3CPW A;  5GAH C;  2K4K A;  3BZC A;  1YBY A;  4DV0 Q;  1SN8 A;  3S17 H;  1FVI A;  3A5U A;  2I5L X;  1OXT A;  3OYY A;  4B3M L;  1FJG L;  1PYS B;  1UWV A;  1X3F A;  2E2I H;  4DR1 Q;  3H0G H;  2DGY A;  4KLK A;  1K0R A;  1LYL A;  3RZO H;  1N9W A;  2JEB I;  4GNX B;  4JI4 Q;  1UE5 A;  1X65 A;  1YHA A;  2UXD L;  4LWC A;  4X66 Q;  4AQY Q;  5GQO A;  4JV5 Q;  2B3G A;  2HIV A;  2WP8 J;  1VQ9 A;  2UUB L;  4DR7 L;  1BVS A;  1VQJ A;  1EUJ A;  5ELO A;  4HIM A;  1Q8K A;  4K0K L;  1XPU A;  4A3K H;  4BA2 I;  2I5H A;  1S72 A;  1U0L A;  1XJV A;  3S15 H;  1SR3 A;  5GAD C;  3ICE A;  2VNU D;  1SRU A;  4MTN A;  2RHQ B;  4DV2 L;  1PH4 A;  2K5V A;  5IWA Q;  1C7Y A;  5C44 G;  4JI6 L;  1N36 Q;  2Y0S E;  4J15 A;  4O0A A;  3RN5 A;  1W2B A;  2R7F A;  4BBR G;  2JEA I;  1GKH A;  3K80 C;  2Q2T A;  4C3I H;  2YTX A;  1VQN A;  4DR2 L;  4LNQ A;  3J7A 5;  2IX1 A;  3RLO A;  4LUO A;  1EYG A;  5HGQ A;  2DUD A;  2NN6 I;  4OON A;  4A3E H;  5LMU L;  2OTJ A;  4OO1 G;  1SE8 A;  2PMZ E;  2AKW B;  4DV5 L;  4A3D G;  4JBM A;  1X3E A;  1HJP A;  2XGT A;  4DR6 Q;  1IL2 A;  3E9I A;  3STB C;  3K7A H;  1SMX A;  3TEH B;  1PV4 A;  3CD6 A;  2KCM A;  2JA7 G;  1IZ6 A;  1A62 A;  3AFQ A;  3EIV A;  3K0X A;  3CCM A;  1Z47 A;  5LMN L;  2ZTE A;  4GNX C;  3S24 A;  4L5Q A;  4DR5 L;  2UXB L;  1KAW A;  4JYA Q;  2EXD A;  2R7D A;  4P71 A;  1CKN A;  1V9P A;  2QEX A;  4OWX B;  4LFB L;  3FHW A;  1L2F A;  4DV6 Q;  1I3Q H;  2GN5 A;  4A3I H;  3J80 c;  3F8T A;  4X62 Q;  3L2P A;  2H5X A;  1HNZ L;  2KHJ A;  2HQL A;  1JJ2 A;  2Z0S A;  1KC8 C;  3MXN B;  5AJ3 L;  1HR0 L;  2PQA B;  4JI8 Q;  2R92 H;  1I50 H;  4IOC A;  1WCM H;  2BH2 A;  4HJ7 A;  1K83 H;  4PG3 A;  3K81 C;  3F2C A;  3ULP A;  2XTI A;  1XMO L;  3FP9 A;  3I4O A;  4KI0 A;  5J3B A;  2K50 A;  1YZ6 A;  2AMC B;  1TXY A;  1KD1 C;  2CWA A;  4P73 A;  5C4J H;  3CF5 A;  2LXJ A;  3L7Z C;  2OWO A;  1KRT A;  2Q2U A;  4QY7 A;  2YU9 H;  3S14 H;  3HOW G;  2I5M X;  2MNA A;  1YHQ A;  2ZTD A;  4IOA A;  3I56 A;  3HFZ B;  5C0X I;  5M3M H;  4BBS H;  4JI2 L;  4BY1 H;  1D7Q A;  4IJL A;  4A3J H;  1VQO A;  1V1Q A;  4APV A;  5IP9 G;  1NTG A;  4B3T Q;  4B3R Q;  4YWL A;  1N33 Q;  4BY7 H;  2UUA L;  2UXC Q;  2E5L L;  3W1B A;  5IP7 H;  4NXM Q;  2F52 A;  4A3F H;  3CCE A;  2A1A A;  4GS3 A;  3UDF A;  4JCV E;  4A3G H;  2UUC L;  1Z9F A;  5GRO A;  2R93 H;  5IYC G;  5M3F H;  1KL9 A;  4WJ4 A;  4KHP Q;  1I94 Q;  4IFD I;  2IHF A;  2KBN A;  1EWI A;  1A8V A;  1P8L A;  2N78 A;  4AIM A;  4L5T A;  1S40 A;  1G51 A;  3GTP H;  2YTV A;  1IBM Q;  3GDE A;  2NVX H;  4H02 A;  4DNI A;  1PH6 A;  3BJU A;  2JA5 G;  4MZ9 A;  4JC0 A;  1QZG A;  3KF8 B;  1EIY B;  1LUZ A;  1HZ9 A;  1PH9 A;  1Q1E A;  4A4I A;  4QJF A;  1HNW L;  2OQ0 A;  2A8V A;  4GKJ Q;  3GTM H;  4IJH A;  2C35 B;  4GN3 B;  2B63 G;  1PH1 A;  2E8G A;  3S1M H;  1XNR Q;  3S1R H;  1SFO H;  4A3B H;  2QA4 A;  1PFS A;  2VS1 A;  1LTL A;  4BA1 I;  4DV3 Q;  2UU9 L;  2ID0 A;  1X9N A;  3HOY H;  3HOZ H;  5IYB H;  1QZH A;  3HKS A;  4DUY L;  3CCJ A;  1MJE A;  3CCL A;  2VUM H;  3HOU G;  4JBJ A;  4GKK L;  4BXX G;  4X66 L;  2JQO A;  5M5Y H;  3I4M H;  3ER0 A;  1L1O B;  2F4V Q;  3PSI A;  3ZJY C;  1X6O A;  1W3S A;  5C0X J;  4OO1 I;  1VS0 A;  1YIT A;  3AEV A;  2ALY B;  1MKH A;  4A3L G;  4LFA Q;  3H3V H;  4KHZ A;  4LW1 A;  1UEB A;  4UP7 A;  1CSP A;  3RZD H;  5HY6 A;  3G71 A;  1QVG A;  4JOI A;  4DUZ L;  4DV4 L;  4DR3 Q;  1PH7 A;  4LF9 L;  1DGS A;  4DK6 C;  2NVQ H;  3I4N H;  1K73 C;  4A3C H;  1VQD A;  2IT1 A;  1J5E Q;  3M4Q A;  4IFD G;  1VQ5 A;  4NXN Q;  5BR8 Q;  4JI0 Q;  4YY3 L;  4IFD J;  4JBK A;  4X65 Q;  4JI7 L;  1NBW A;  2JA6 H;  2VQF L;  1YEZ A;  4POF A;  1NMF A;  1MIU A;  3CCU A;  4LF4 Q;  4R1J A;  2HHH Q;  1XNQ Q;  3RR5 A;  4QQB X;  4R4C A;  3ULJ A;  3U58 A;  1YIJ A;  3UDI A;  4JI3 Q;  4OWW B;  2R7Z H;  4A93 G;  4OX9 L;  4A3M H;  1J6Q A;  5FLM H;  4YWK A;  2JA8 H;  1IBK Q;  3HOV H;  3H15 A;  3OTO Q;  3AYH B;  4R4Q A;  2YYZ A;  1CSQ A;  2L15 A;  3STB D;  4R4T A;  1L1O C;  4YCW A;  4DV6 L;  2NZH A;  4ME3 A;  1K8G A;  1P16 A;  1WI5 A;  4JI5 Q;  1VQI A;  3PUZ A;  3U50 C;  4LFC Q;  3I2Z A;  1V43 A;  1YJW A;  1ASZ A;  1O7I A;  4TVA B;  4X6A H;  1VQC A;  1WFQ A;  4YWM A;  3TRE A;  3PIP A;  1N34 Q;  3NEM A;  2IX0 A;  1VQG A;  4GN5 A;  1D8L A;  4RMF A;  1OTC A;  1E24 A;  1PA6 A;  1XMQ Q;  1GD7 A;  1IBL Q;  3KF6 A;  4LF5 Q;  4IO9 A;  3PF4 A;  1S3O A;  3GTG H;  3J81 j;  3PO2 H;  4QIW E;  3T1Y Q;  5C4X G;  2YTY A;  1L1O A;  3CPF A;  1VQP A;  1JT8 A;  3S2D H;  1EQR A;  4MNO A;  3CME A;  4BBR H;  3U4V A;  4LF7 Q;  1M90 C;  4DV1 L;  3W5O A;  4AYB G;  3I55 A;  4B3T L;  2LXK A;  1HNX L;  3MEF A;  2WB1 E;  1QUQ B;  2KEN A;  4A3D H;  4B3M Q;  2WFW A;  1QVC A;  2PI2 E;  4A3I G;  3PF5 A;  3KJP A;  3TS0 A;  1E1T A;  1FL0 A;  2VQE L;  2JA7 H;  1IYJ B;  4KHP L;  5C3E G;  1IXR A;  1I94 L;  3VDY A;  1KQS A;  1Q82 C;  3NEN A;  4GNX A;  4Y52 H;  4DR7 Q;  2UUB Q;  4LF6 L;  3K7U C;  4K0K Q;  1VQK A;  2ZJQ A;  3M3Y H;  3HOX G;  1NJI C;  4NB3 A;  3GTO H;  1X55 A;  3FKI H;  2PI2 A;  3RN2 A;  3JAM c;  3G4S A;  2E2H H;  5IYD G;  4DV2 Q;  4P75 A;  2D62 A;  1FGU A;  2VL6 A;  4JI6 Q;  4IPG A;  3UDX A;  3HKZ G;  5M5W H;  3CCR A;  4GKJ L;  3PIO A;  2K14 A;  4DV7 L;  4DR2 Q;  1NMG A;  4RG1 A;  1Y1V G;  3UE0 A;  5M3M G;  1XPR A;  1BBW A;  1Y1W G;  3CCV A;  2MO0 A;  2CFM A;  5LMU Q;  2ZM6 L;  3T1H L;  1U5K A;  4UP8 A;  3J81 i;  1M1K C;  3F2B A;  3BZK A;  4BY7 G;  3W1G A;  2BH8 A;  5IP7 G;  1HR0 W;  2B29 A;  1PH3 A;  1Q12 A;  1YJN A;  1VCI A;  2R93 G;  2VW9 A;  5FJ8 G;  3PUW A;  4DR4 L;  3HOW H;  4JI1 L;  1YHB A;  5LMN Q;  1VQ6 A;  4DR5 Q;  5GAE C;  4LF8 L;  2UXB Q;  3CP0 A;  1UE1 A;  4XIG S;  1K8A C;  1Q1B A;  4X64 Q;  5IP9 H;  1Q46 A;  4UY8 C;  2GVA A;  4YCV A;  4HJ5 A;  4R4O A;  1OXS C;  5IT9 c;  4B3S L;  3CCQ A;  1AH9 A;  1N32 L;  1HNZ Q;  2Y0S G;  5IYC H;  5FLX c;  5JJL A;  4HJ8 A;  1RIP A;  5AJ3 Q;  3EBE A;  1HR0 Q;  1KRS A;  1EOV A;  1QUQ A;  1CKM A;  4DV0 L;  1HZB A;  5ELN A;  5BR8 L;  4X65 L;  3S16 H;  4DR1 L;  2PQA A;  4JBW A;  4LFA L;  1GVP A;  2JE6 I;  4DAY B;  2ZJP A;  3RNU A;  1XMO Q;  1Y14 B;  2HHH L;  4LF4 L;  4JI4 L;  1XNQ L;  3M7N A;  2Q2I A;  3OW2 A;  3B6Y A;  2JA5 H;  1AE2 A;  1AE3 A;  2FXQ A;  4AQY L;  1EFW A;  4JV5 L;  4UPA A;  4AH6 A;  1YI2 A;  4HJ9 A;  5JEA G;  4C3J H;  1G6P A;  2PNH A;  3CAM A;  2K5N A;  5JEA J;  3CXC A;  2NZO A;  2ASB A;  1CKO A;  4NPS A;  2LSS A;  2B63 H;  2VY3 A;  4JI2 Q;  1I5F A;  1TWC H;  4GOP B;  1X3G A;  3M4O H;  4OWT B;  1UE7 A;  4QGU A;  4EX5 A;  1JB7 A;  5IWA L;  2ES2 A;  1VQB A;  1HZC A;  3KOJ A;  1N36 L;  2D0P A;  4LUZ A;  1OXV A;  3J80 i; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...