4DV7L

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a915g, bound with streptomycin
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 13
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dv7L00
3M4PA 5C44H 3BZKA 3PUYA 4OWTB 1OXSC 3S2HH 3PO2G 2RCNA 5AJ3L 4A3EH 4LF6L 1TWGH 3JC66 1VQKA 2Y0SE 5IP7G 3GO5A 3L2PA 4LF7Q 1FJGQ 1FJGL 1MIUA 1B70B 3M9BA 3KFUA 1Y1WG 5IE8A 1M1KC 1AH9A 3F8TA 3PO3H 4GKKQ 1HNWQ 3OYYA 2UUCQ 5IY0A 4A3MG 3FP9A 2D0OA 3U4VA 2JA8G 4DV7L 2YYZA 3FKIG 3G48A 2RHQB 1I94Q 5M3FH 4R4IA 4DV5L 1C7YA 1ASYA 1YI2A 4A3BH 2JA5H 1HR0Q 2UXCQ 3CCVA 3GTOH 4JI3Q 2NN6I 2VQEQ 2JA7G 4RMFA 4LWCA 2R7FA 4B3RL 1N8RC 1QZGA 3GTQH 4A3EG 1NMFA 1Q1BA 1YIJA 2UXDQ 1KC8C 1K73C 3F2BA 4P75A 5IP7H 3TRZA 2K50A 4AQYQ 4A3JG 3L7ZC 3H0GH 4J15A 4JI5Q 2FXQA 1N36Q 3S14H 4BBRG 2KHIA 4LF6Q 1HZ9A 1X6OA 2E8GA 1S40A 4A93G 1I3QH 4DR3Q 4LFCQ 3T1YQ 4LFCL 4A3CH 1XNRL 3HOYG 3CAMA 1Z9FA 4GKKL 2JA6G 4A3KG 4JBMA 4DR7L 2GVAA 3S24A 2ZTDA 1GD7A 3HKZG 1IXRA 3J81i 2OTJA 2HIXA 3I4MG 3J81j 4JI6L 5FJ8H 3KLWA 1Y1WH 2AMCB 3PCOB 4EQ5A 2VY3A 5BR8L 5IYBG 1VQGA 3PGZA 1Q82C 1VQJA 3W1BA 3KDFB 2VNUD 4YHHQ 3CC7A 2ZJQA 1S3OA 2F52A 4BBRH 1X54A 1TWCH 1A0IA 2NN6G 4QJFA 2Q2UA 4MZ9A 4B3TL 1E7ZA 4BY7G 5C0XI 4Y7NH 3BZCA 3NEMA 1Y1VG 4LUOA 2MO0A 1OXTA 4QL5A 2F3IA 3HFZB 3OTOQ 4JOIC 2Z6KA 4DV1Q 2IX1A 4DV0Q 5IYCG 1IZ6A 1PH5A 3T1HQ 2LSSA 4AYBG 3S16H 2QEXA 3H3VI 5JJKA 1PH1A 1SROA 2PMZE 1D8LA 1HZBA 4NXNL 2VS1A 3K8AA 4OO1I 3PUZA 4JV5Q 3HOVH 1KQSA 3ER0A 4PZ6A 2AWNA 3E9HA 4JC0A 1XPUA 3ULPA 4A76A 4B3SL 1KXLA 1RIPA 3FKIH 1E1TA 4B3SQ 4OWXB 3I4NG 2NZOA 1TXYA 4B3ML 1V1QA 3HKSA 1P8LA 4YCVA 1HNZL 1H95A 1PV4A 5C44G 3RNUA 2F4VL 2WFWA 4R4OA 3RLFA 2NVQH 3RLNA 3I56A 1Y1VH 5LMNW 4JYAL 1HR0W 1UE6A 3TREA 1PVOA 4JI7Q 1XJVA 4EX5A 3UE1A 3AQQA 4TQUS 1XPOA 4HJ7A 3S1NH 4KHPL 2AKWB 3RR5A 1IBKQ 1FGUA 3CXCA 2UXDL 3STBC 5FJ8G 3S15H 1PA6A 2IX0A 1N32Q 4JBWA 4GKJQ 4JI4Q 1N36L 5LMNL 1KRTA 4NXML 3GTLH 4DR6Q 2CCZA 4LUVA 3TS0A 2D62A 2ZTCA 3F2CA 1YITA 1YJWA 4JCVE 3T1HL 1EYGA 4BY7H 3I2ZA 2UXBL 1WJJA 2I0QA 4JOIA 4GLVB 3T1YL 1K8GA 1QUQA 3BU2A 1PH9A 4A3IG 3G4SA 4YWLA 2BH2A 4APVA 1VQMA 2CWAA 3M3YH 3HOUG 1FL0A 4X65L 1WOCA 3CF5A 1EQQA 2PI2E 3H15A 3H0GG 2JEBI 4UP7A 1I94L 4HIMA 1YNXA 3PV0A 2EIFA 1SFOH 2R92G 3PIOA 2MO1A 3CD6A 3CCLA 1VQ7A 3A0JA 1CUKA 4A75A 1VQNA 2B29A 2K5NA 5C4JH 4KHPQ 1Q12A 4DR2L 4A3LH 1BBWA 3HOYH 2EXDA 3TS2A 2NVYH 1VQCA 1PYBA 2XTIA 1PH8A 1QVGA 3RZOH 4LF9Q 1MJCA 1E3PA 1DGSA 2WAQG 4X64L 4AQYL 3DM3A 3I4MH 2WP8J 2ZM6L 2BA0A 2CQOA 3TEHB 1SR3A 2IHEA 4POFA 1YJ9A 3HOUH 3G6EA 1O7IA 1HZCA 4GOPC 2ZTEA 1T9HA 3U50C 2HHHQ 4DR1L 5IWAQ 4X62L 2A1AA 5IWAL 4X62Q 2IY5B 1L1OC 1U0LA 1X3EA 4QIWE 3KYHC 5GAGC 1FVIA 4DUYQ 1HNXL 3K7AH 5M3FG 2V1CC 1KAWA 4H02A 3J7A5 3K0XA 4A3FH 1AE3A 3HOXG 2OQKA 2ES2A 5M3MH 1I6HH 2HQLA 2Q2HA 1VQDA 3FHWA 1YVCA 1VQ9A 1IYJB 2CFMA 1CKNA 2MQHA 2I5MX 4DK6C 1IBMQ 2OCEA 1N32L 1EOVA 1SN8A 1SRUA 2R92H 4BA2I 3UE0A 1OTCA 4DR5Q 1A62A 4NB3A 2PQAB 4AYBE 1PH3A 1K0RA 2N8NA 1GM5A 1E1OA 2IT1A 4QY7A 2VQFL 2JA8H 4DR6L 4A3LG 2A19A 4DR1Q 1YZ6A 5C4XH 1MJEA 1N33Q 4MNOA 2HHHL 5M5YH 3AEVA 2R93H 3MEFA 3HOXH 2K5VA 3GTJH 5M3MG 1AE2A 2UUAQ 3CQZH 3PIPA 4A3DH 4IFDJ 1CSPA 2LXJA 2N3SA 4DNIA 1R9TH 1VCIA 1JMCA 4RG1A 2KBNA 1OXUA 2N49A 4X65Q 4LW1A 1LTLA 2B63H 4DV5Q 1HJPA 3GTGH 4JI1L 5BR8Q 2RHSB 3PSIA 4JI8Q 3ULJA 5LMUL 1UE1A 5LMUQ 1YEZA 4BBSH 1W2BA 1IBML 1VQFA 2JJQA 1VQ6A 1XTDA 4L5QA 1TWHH 3I7FA 3CCJA 3CMEA 3PO2H 2R7ZH 1NBWA 4GKJL 3BJUA 2K14A 4DV0L 5EAYA 2ZM6Q 2C35B 4LNQA 3K80C 2H5XA 4JI2Q 4DPGA 5IP9G 4HIOA 3PF4A 3S2DH 1WCMG 3I4OA 3GDEA 1QZHA 4JV5L 3HOVG 2OWOA 1A63A 2GN5A 2VUMG 1CKOA 3CCMA 2WAQE 3RZDH 4IOAA 1L2FA 1S72A 4B3MQ 4HIDA 4JI0L 1VQPA 3CPFA 2YTVA 3UDIA 4FDBA 5C0XG 4JI8L 2NZHA 4ALPA 4HJ9A 3I4NH 1QVFA 1Y14B 5FLXc 1JJGA 4LFBL 4POGA 1JJCB 2UU9Q 4YHHL 1QUQB 3GTPH 4LF8L 2QGQA 1K8AC 1X3FA 4DV3Q 1Q7YC 2LXKA 2E2HH 4LF4L 2Y0SG 4DV2Q 1CSQA 1X56A 3CCUA 3LGJA 4C3JH 3RN5A 1K83H 4JI5L 1XMQQ 2ATWA 1UWVA 4PZ7A 4UP9A 2ALYB 4KLKA 5DLQE 4JBJA 2AHOB 4AIMA 3J80c 2JA6H 4GS3A 1EWIA 2DUDA 2JE6I 4ME3A 3CCSA 1OXVA 1XMOL 4R4CA 2JEAI 5IT9c 1XNRQ 1IL2A 4GN5A 2MNAA 4GN3B 3PF5A 2K4KA 1MKHA 2IHFA 1N9WA 5HGQA 3S1RH 4P73A 4IPHA 1I50H 4HJAA 1WYDA 1IBLL 4IO9A 3PO3G 4JYAQ 3ZJYC 2QA4A 4YY3Q 3H3VH 3RLOA 4DUZQ 2VL6A 4IJHA 3U58A 4BBSG 2E2IH 2K75A 2Z6KC 5E7NA 4DAMA 4DV3L 2ZJRA 5ELOA 3J7ZC 1X65A 2DGYA 1GO3E 3HOWH 4NXMQ 2K5HA 2VQFQ 4JI4L 3CPWA 2I5LX 2JQOA 2A8VA 4DR5L 1SE8A 2KCTA 3GTKH 1UEBA 1Z47A 5JEAG 4DR3L 1B7YB 4DV6L 4X6AH 3A5ZB 4LUZA 5ELNA 4A3MH 1XMOQ 4A3GG 2BH8A 3GTMH 4IPDA 4OWWB 5C0XJ 4HJ8A 5M5WH 2L15A 1WFQA 1IBLQ 2E2JH 4A93H 3KF6A 4KI0A 3ULLA 3E9IA 1HNZQ 2HT1A 3KOJA 2KENA 3NBHB 2AWOA 4DUYL 1HNXQ 1LM0A 1KHIA 1TWAH 2K52A 4C3HH 4A3KH 1NJIC 5GQOA 3J81c 1Q81C 4GOPA 3HOWG 2JA9A 3K81C 3S17H 3PUXA 3DLLA 2UU9L 3PUWA 3G71A 1V9PA 4DR4Q 1HH2P 4TVAB 3KF6B 1X9NA 2UUBQ 1VQOA 4IFDI 3S1MH 1PHJA 2WB1G 1YHAA 1E24A 1L1OA 1J5EL 2HIVA 3ERSX 1YBYA 1TWFH 3PUVA 3AYHB 4DV2L 1WI5A 3HKZE 4YWMA 1JE5A 1V43A 2E5LQ 4A3BG 2E5LL 4GN4B 3OTOL 3U4ZA 1EUJA 1VQ4A 5C3EH 3JAMi 2RF4A 1N33L 4A3IH 1UE5A 3F1ZA 1PH7A 1K9MC 3L0OA 4R4TA 4LF7L 2B3GA 2MFIA 1YHQA 4L5RC 3K7UC 2R93G 4R4QA 1X55A 4HIKA 1JT8A 1J6QA 5GAEC 3MXNB 2UUAL 2VZAA 5FLMH 4KHZA 4WJ4A 3A74A 1GKHA 1SMXA 4JI0Q 3EIVA 4DKAC 2UUCL 2CKZB 1G6PA 3M7NA 3AFPA 1LUZA 4K0KQ 1N34Q 4IPCA 2BA1A 5JJLA 3Q8DA 1HR0L 1K3RA 4YCUA 4DV4L 2F4VQ 3M4OH 3CC2A 4NPSA 1JJ2A 4YCWA 2ASBA 3UDGA 4B3RQ 4OX9Q 5JJIA 3CCRA 5GAHC 2ID0A 1CKMA 1B8AA 4LF9L 1UE7A 2R6GA 4GLAC 4L5SA 1XMQL 5LMNQ 4C2MH 4UP8A 2OQ0A 3J80i 1KRSA 1W3SA 4P74A 2OTLA 4DV6Q 2I5HA 4BXXG 5K36G 3CC4A 1NMGA 1SLJA 2UXBQ 2PI2A 4X66L 1Q1EA 3HOZH 1M90C 4P72A 1GVPA 4A3CG 3CCEA 5C4XG 3E0EA 4NXNQ 5M5XH 1PFSA 1L1OB 4IOCA 4K0KL 3EBEA 4DR7Q 2YTYA 3EN2A 2NVTH 1NTGA 4OONA 5IYCH 4O2DA 2NVXH 1P16A 4GOPB 4A3DG 1C9OA 1HZAA 2KCMA 3UDXA 4DAYB 1RL2A 3D31A 3W1GA 3A5UA 4DUZL 1PH2A 1E22A 3KF8B 4YY3L 4JI7L 4JI3L 4AH6A 2UUBL 5IYBH 5HY6A 1L0WA 3SGIA 3JAMc 4DR4L 4A3GH 1WCMH 1EIYB 3STBD 4GNXA 4PMWA 1XNQL 1NY4A 3TQYA 3CMAA 1C0AA 1ASZA 3S1QH 1JB7A 1X3GA 4LF4Q 2PQAA 1Q8KA 4DV1L 4L5TA 4OXPA 4O0AA 1QVCA 4X64Q 1PH4A 4LF5Q 1OXXK 1VQEA 1BBUA 4IPGA 2YTXA 2VW9A 4IJLA 5GADC 4DK3C 3I55A 1CKNB 1G291 3WWVA 5FLMG 1VQ8A 1NE3A 2WB1E 4X66Q 2B63G 4C3IH 2Z0SA 4R1JA 3UDFA 4JG2A 5GROA 2YU9H 4XTCS 4YWKA 3VDYA 4BXXH 4JI6Q 1PYSB 2EQSA 3W5OA 4PZ8A 4UY8C 4DV4Q 1VQBA 1EQRA 5J3BA 4LFBQ 2UXCL 2ZJPA 1KD1C 5IYDG 4QGUA 4DR2Q 2Q2TA 2R7ZG 1Q46A 1KIXA 1IBKL 4QQBX 2JA7H 1J5EQ 5IP9H 1XNQQ 4B3TQ 1VQIA 3M85A 1VS0A 4A3JH 2Q2IA 1EIFA 1BVSA 4MTNA 3AFQA 4LF5L 3IRBA 4A4IA 5AJ3Q 4GLXA 3CCQA 1YJNA 2VUMH 4JI2L 1EFWA 4BY1G 1YHBA 2KHJA 4GNXB 1U5KA 1HNWL 3KJPA 2JK8A 3CP0A 2GVBA 5IYDH 2CWPA 4A3FG 3D0FA 1N34L 3B6YA 1PH6A 4JBKA 1I5FA 4DV7Q 4BA1I 4GNXC 1VQLA 1VQHA 1A8VA 4LFAQ 4Y52H 3KJOA 4LFAL 2YV5A 1KL9A 1Q86C 3OW2A 4OO1G 4IFDG 4JI1Q 4HJ5A 4WJ3M 1D7QA 1BKBA 3M4QA 4PG3A 2VQEL 3RN2A 1VQ5A 4LF8Q 1VQAA 4XIGS 3KDFA 3HOZG 3CW2C 5JEAJ 3NELA 1XPRA 2PNHA 3GD7A 1G51A 3F2DA 2D0PA 4P71A 2JA5G 4BY1H 2XGTA 4OX9L 4UPAA 2R7DA 1LYLA 3NENA 5H1SE 2N78A 5C3EG 3ICEA
chains in the Genus database with same CATH superfamily
2QW7A 2O5JC 2Y0SE 2X6GA 1FJGL 3QIAA 1ZYRD 3MXPA 1AH9A 1K0SA 1I4XA 1I4RA 2HUGA 4DU9A 3OHXC 5IY0A 4A3MG 3TZUA 3FP9A 1K28A 3OIQA 3TP5A 4DV7L 2YYZA 3FKIG 3G48A 2RHQB 3V96A 5M3FH 4A3BH 1C7YA 1U4MA 3K5NA 2IPKD 3TZDA 1D1IA 1IYUA 1DCZA 4DK0A 2K03A 1B50A 3TRZA 3DUZA 3K0YA 1N36Q 2KHIA 4J8QA 2WKDA 4A93G 5TSSA 4BBRB 3T1YQ 2K32A 3CAMA 4CGYB 4GKKL 4O42A 4HR7B 3HGBA 4IZ8A 3S24A 3A7AB 3J81i 1FR3A 5K5PA 5FJ8H 5CBAE 4NMZA 1Y1WH 3PCOB 1WTWA 2X69A 4XT3B 5IYBG 1VQGA 2XSCA 2VNUD 1X54A 1TWCH 1I3QB 2I07B 1EYCA 1E7ZA 4OL7A 1Y1VG 3OTOQ 4DAVA 4JOIC 4DA2A 4DV0Q 1SYCA 3T1HQ 4AYBG 2QEXA 2XIWA 1PH1A 2HDLA 1C8CA 1UUPA 3K8AA 3PUZA 2GA4B 1KQSA 3ER0A 4PZ6A 3E9HA 5KRUA 1XPUA 3BVGA 3ULPA 2AUJD 5C4HA 4A76A 4B3SL 1HA5A 1RIPA 2ICEC 3FKIH 4B3SQ 2JA5B 1KXLA 1DXMA 4B3ML 4YCVA 3A7LA 3DMUA 2WFWA 4R4OA 2F0QA 3TREA 3HOXB 1PVOA 1XPOA 3AQQA 4HN7A 1F9RA 1SNDA 4HJ7A 4K5WA 3RR5A 1FGUA 1EY7A 3STBC 1N32Q 3S15H 1TQOA 2ZXPA 1KRTA 2PPBC 3I3CA 4JCVE 4BY7H 5JAVA 2UXBL 4JOIA 4GLVB 3QWNA 4A3IG 3FDTA 3HS0C 3G4SA 4CHTB 2CWAA 3M3YH 4C1NK 1K3BC 2OF1A 3H0GG 2PO4A 3VR5A 4C3IG 2F0UA 2EIFA 4XT1B 2TMPA 2A69D 4IQZA 4MN3A 4A3GB 2K5NA 3GTGB 5IGEA 4RA8A 4KHPQ 5C3WA 1Q12A 2B8GA 3HOYH 3H91A 2XTIA 3HOZB 1TY2A 1E3PA 2BA0A 1SR3A 2IHEA 4POFA 1O7IA 1HPCA 1QOHA 3U50C 2HHHQ 4H0LC 5DNFA 3NTHA 5IWAQ 1ET6A 4X62Q 4JPBW 4G4KA 2F0SA 3Q24A 4CDFC 5GAGC 4G7HC 5C6AA 3IAYA 1WTOA 1H9KA 3HP3A 4FP5D 4A3FH 3HOXG 4TSSA 1BOSA 5M3MH 2WKCA 2CFMA 1CKNA 2DNCA 1AW7A 3BYTB 4ZUJA 5M3MB 1ET9A 2BOSA 1QWYA 4FF4A 1N32L 1EOVA 1EY8A 1TS3A 2KOLA 5DEHA 5EPLA 4Q5VA 4DR5Q 1K0RA 1GM5A 2PZUA 2JA8H 5EBDA 5CV4A 3K6OA 4MNOA 1WTVA 2F03A 1V1PA 3C1EA 2R93H 2PW7A 5M3MG 4RHRA 3N52A 1CSPA 1TU2B 2N3SA 3S1NB 1R9TH 4RG1A 2Q8RE 1OXUA 5J22A 1PLFA 2CQAA 4IALA 2PMZB 3DEPA 4JI1L 5BR8Q 1ENFA 5LMUL 4A93B 1IBML 5IT9L 1O7YA 1CI3M 3E0JA 5E4XA 2H5XA 4DPGA 1RODA 1PZKD 1PFNA 2KHSA 3FEWX 1CHPD 4JV5L 2EY2A 1A63A 5FO8B 4L63B 1CT1D 4IOAA 1L2FA 2NVYB 2JYOA 3RD4A 4I7ZC 3BDCA 5ISRA 2FFKB 1QVFA 4ME5A 1Y14B 2HCCA 1JJGA 2CW0D 4AYBB 4OHJA 2FHTA 1JJCB 1QUQB 4FF3A 1I50B 4DV3Q 4NDXA 3SK5A 3S14B 3LGJA 4C3JH 1A3UA 1TS4A 1EQVA 4UHVA 4JI5L 2VB2X 3T16A 1UWVA 4PZ7A 4AIMA 1UAPA 5IODA 3EQLC 4KY5A 1TWGB 3CCSA 1XMOL 2JEAI 2A74C 2NBFA 1AZPA 4HSPA 2FMCA 1S5FD 1WYDA 3ZJYC 5KNCA 4ZUIA 3U58A 2SOBA 3HOYB 2E2IH 1ILPA 4RWSC 2DNEA 2OEOA 4DV3L 1PTOF 2HCIA 1GO3E 3HOWH 2IWHA 2VQFQ 4IUTA 2VXWA 3ZYYX 2I5LX 2JQOA 3JAME 2A8VA 1JE4A 3GTKH 2WAQB 1Q8IA 1B1ZA 1B7YB 4DV6L 2JA8B 4LUZA 4A3GG 3GV3A 5EKIA 1EL0A 5C0XJ 2E2IB 2L15A 2O5IC 1G8ZD 3M4YA 3KF6A 1RF2D 4KI0A 3ULLA 2HT1A 3KOJA 3R2TA 1GUWA 3AU7A 1LM0A 4A3KH 3K81C 3J7AV 1EIHA 5C3XA 3EROA 4XDXA 1BDOA 3KF6B 2UUBQ 1VQOA 4IFDI 1PHJA 2WB1G 3HRZC 5BN3A 2A6HD 1TWFH 1WI5A 1EY4A 3HKZE 1V43A 4YWMA 2E5LQ 5M5WB 3U4ZA 3A8JE 3DEOA 2KJXA 3TP7A 4DAPA 4CKEA 4HAEA 1XTCD 2HD3A 4Y7NB 1XWEA 3I90A 1YHQA 3K7UC 2R93G 3KBGA 1SJED 3OSOA 2K28A 2AQ3B 1J8IA 2B2VA 1QILA 3QB3A 3IL8A 1LUZA 2ZT9C 2BA1A 1K3RA 4ID6A 2NWGA 4JW0A 4J6HA 4YCWA 3T56B 2ASBA 4FO2A 1SNQA 4B3RQ 4OX9Q 1STAA 2ID0A 1B8AA 4LF9L 1UE7A 2R6GA 1KABA 1XMQL 5LMNQ 4C2MH 2LS01 5ELFA 3J80i 1W3SA 4A3MB 4H44C 5IGFA 4X66L 1SMYD 1Z7TA 3VYUA 3EBEA 2YTYA 1RKNA 2Z9HA 1NTGA 3NQTA 4O2DA 1W6KA 1XYIA 2KCMA 2PZTA 1NSNS 1PH2A 5C5LA 3A5UA 3IKJA 4YY3L 2UUBL 4N8X1 4FYDA 1XNQL 2B2VC 1S5CD 1JB7A 4L5TA 4OXPA 4O0AA 1QVCA 4X64Q 5IIFA 3SK4A 1CQFA 4IPGA 2VW9A 2R93B 2MP1A 4KN4C 1X32A 1G291 5FLMG 1VQ8A 3RMHA 2DY7A 4WJWA 4X66Q 3QG1A 4KHVA 1PZID 4C3IH 2B2TA 4JG2A 4QUFA 4KY7A 5D14A 2EQSA 1KTKA 3ND8A 2UXCL 2F0JA 4DR2Q 2EYOA 4YIJA 3MTSA 2JA7H 2L9HA 5KGUA 4XQQA 1J5EQ 2NVXB 1C4QA 2SEBD 3VA5A 5A2QE 1QNUA 3GTMB 1A2UA 4JI2L 1EFWA 1YHBA 1SE4A 2JA6B 4GNXB 1U5KA 4M8AA 2JK8A 2F0NA 2PYKA 2GVBA 4KK7A 5A35A 4A3FG 3D0FA 2KVMA 4XQJA 4PMCA 1I5FA 4I65A 4BS9A 1VQLA 1VQHA 4LFAQ 3KJOA 1HTLD 4HJ5A 3M4QA 1SYBA 4XIGS 3HOZG 1KNEA 3CW2C 4CDEC 2A6ED 1G51A 2JA5G 2L5TA 4L8JA 3P7JA 5M9OA 5H1SE 2N78A 5C3EG 2CH4A 3PUYA 4OWTB 1OXSC 5AJ3L 4HCSA 5ELCA 3GO5A 1PXUA 4HCEA 1B70B 3KFUA 4BWGB 1Y1WG 3PO3H 1LTRD 4GKKQ 1HNWQ 2B39A 1UEAB 2LKVA 2JA8G 1D2BA 1TIID 4R4IA 1IYVA 2XN9C 3GTOH 2B2UA 4RMFA 2KQ3A 4LWCA 5KNDA 1N8RC 2JA7G 4B3RL 1Q1BA 5I2XA 2EYHA 3F2BA 4A3JG 1U4PA 1F2LA 1BCPF 4FXKC 2RCFA 2FXQA 4BBRG 4LF6Q 1HZ9A 1X6OA 1S40A 4C3JB 1PFMA 1FGBD 3ND9A 4NW2A 2JA6G 1V8QA 4ODGA 1I4HA 2ZTDA 2OTJA 4TKOB 1H9RA 4CJ2C 1SMYC 3J81j 4JI6L 4F8MA 3TBIB 4EQ5A 1STBA 1DJRD 1Q82C 1HQRD 2MGSA 3KDFB 4OGQC 3W1BA 3CC7A 2F52A 4BBRH 3A55A 4B3TL 4MZ9A 3OWEB 5EQ0A 4Y7NH 3BZCA 4QL5A 2Z6KA 1IZ6A 3H3VI 5COYA 2L1BA 1O7ZA 1D8LA 1HZBA 5EPKA 3VR4A 2WV6D 5HGTA 4JV5Q 4OO1I 3A8IE 4EQPA 4JC0A 1WCMB 4DN4M 4ABNA 1PV4A 3RNUA 2F0LA 4JYAL 3RLNA 1Y1VH 1CZWA 1TVXA 4R8NA 2IW3A 3SK8A 1HR0W 1UE6A 3I4LA 3MZ5A 3S1NH 2H1EA 4KHPL 4A3DB 1IBKQ 3CXCA 2IX0A 3QOJA 3NUCA 1LTAD 1EEID 4P2CB 4JI4Q 1I4QA 4NXML 3GTLH 1QJOA 2CCZA 3TS0A 1KLGD 3BZDB 2ZTCA 5ELEA 3I2ZA 4DK1A 1WJJA 3T1YL 1FNUA 4ZCKA 4BY1B 1QUQA 3BU2A 4APVA 4C3HG 1YNNC 1DOLA 1FL0A 1EZ6A 4X65L 3CF5A 3NWSA 3I70A 4UP7A 1I94L 3PIOA 2MO1A 5EPJA 1VQNA 2B29A 5C4JH 2NTTA 4DR2L 5IOCA 3BVMA 2NVTB 1TS5A 1PH8A 1A15A 3CHBD 1QVGA 5JOBA 1SNMA 3V05A 4QF4A 1QNKA 3S1RB 2BDNA 2WP8J 3S2DB 1VMPA 3SVMA 1HZCA 4GOPC 2ZTEA 4QIWB 4DR1L 2VUMB 4X62L 3FRPB 1E2VA 5IWAL 1STNA 3S15B 4BBSB 3KYHC 3QOLA 1HNXL 2XRQD 3OPOA 3SDZA 2V1CC 1KAWA 3HEJA 3U9SA 3K0XA 3J80E 3J7A5 2EE1A 3GTOB 2ES2A 1I6HH 3FHWA 1YVCA 1VQ9A 2MQHA 5D65A 2I5MX 1IBMQ 1I6HB 2OCEA 2X6LA 5I2YA 2R92H 3HG9A 1OTCA 3RZDB 5C4XB 2IT1A 1HA6A 2EVBA 4DR1Q 5C4XH 1N33Q 2RA4A 3NSWA 5EBCA 2HDMA 2RSOA 5C5MA 1ICWA 4FXDA 3CQZH 1PDQA 4IFDJ 2LXJA 1JOKA 1JMCA 1SE2A 2EYLA 4DV5Q 1HJPA 5IGCA 3GTGH 2RDHA 3NE5B 4ZQ3A 2MUYA 4S3SA 1ONLA 2K5DA 5LHY1 5LMUQ 3A54A 4BBSH 1II3A 1S5ED 3NBIA 3I7FA 2R7ZH 1HHVA 1GUGA 4GKJL 3BJUA 1NUCA 2K14A 4B9WA 5DM73 5EAYA 2C35B 2EZVA 4HIOA 4JI2Q 3A8KE 4KJNA 3GDEA 1QZHA 1RCVD 3HOVG 2GN5A 1CKOA 3CCMA 4CDCC 3C2PA 1IW7C 4DNRB 1O7LA 1SYEA 4FDBA 4X3KA 2PNRC 5C0XG 1TT2A 4ALPA 4RCNA 1JORA 2E74C 1JICA 1W6JA 2QGQA 3WOEA 2E76C 1LT6D 2LXKA 2E2HH 3CCUA 2SNMA 3BG3A 1I6VC 4BY7B 4KLKA 5DLQE 3J80c 2JE6I 4HSVA 1JQYD 4R4CA 2DY8A 3QO2A 3DXJC 1SYDA 4GN5A 1EY6A 2EJMA 4LJZC 1EYAA 1IBLL 4HJAA 3EJIA 3I72A 4JYAQ 3VYSA 2QA4A 2B8FA 2K6AA 4YY3Q 3H3VH 2M9VA 4IJHA 1QCBD 3I4NB 2LY7A 5E4WC 3DHQA 2Z6KC 5E7NA 4XXEA 2KUMA 5ELOA 1GXDC 2NTSA 1C48A 2EJGC 4DGZA 3SXHA 3PIP3 1SE8A 1UEBA 5I9PA 1D1KA 4X6AH 1ESFA 1NR4A 1XMOQ 2BH8A 3GTMH 2O2LD 1HNZQ 1Y1VB 3RZOB 3VYTA 4DUYL 3VA7A 1QG7A 2FMMA 3SE0A 2CHBD 4C3HB 1U4LA 3DLLA 3G71A 4DR4Q 1HH2P 1SNPA 1YHAA 1L1OA 2JP1A 3PUVA 1AN8A 4CDDC 3AYHB 4DV2L 4A3BG 5M5XB 4GN4B 3FVQA 1EUJA 1VQ4A 3JAMi 4EGVA 1N33L 1EWHA 2PCFB 1UE5A 1PH7A 1K9MC 2J0TD 4R4TA 1EZ8A 1JT8A 2VB3X 1MSHA 3ITPA 5FLMH 4WJ4A 3A74A 4JI0Q 3EIVA 1E2ZA 2K5QA 1ENCA 2CKZB 2UUCL 3GTPB 5FOBB 1EIGA 1BNZA 3EFXD 2XNAC 3MA2B 1N34Q 5J39A 4YCUA 5CGKA 1TY0A 4R9WA 2F1MA 1MBYA 1UNSA 3UDGA 3FPPA 3LWUA 3CCRA 5GAHC 1CKMA 5D3DA 1SJHD 4EVOA 2A6HC 1RHPA 2F0KA 4L5SA 1WTQA 3H0GB 4DV6Q 2I5HA 1ML0D 1X3QA 3P1HA 1SLJA 4HMJA 2UXBQ 3MHBA 4RCOA 3GQBA 4A3CG 3E0EA 1L1OB 1A6XA 3R3OA 2NVTH 4M1UB 1IKMA 3W3AA 1GHJA 4A3DG 3OW7A 1LABA 1F2YA 1CA6A 1E22A 3KF8B 1L0WA 3SGIA 4A3GH 1WCMH 2BCOA 4ULLA 3STBD 1EU3A 1NY4A 5CV5A 3CMAA 3WDNA 2JN4A 4LF4Q 2PQAA 4DV1L 2CH4W 2PZWA 1ZKOA 2AQ2B 1BXTA 1BBUA 5GADC 3I55A 1CQVA 1LO5D 1NE3A 1EY0A 2WB1E 3ICEA 1YNND 4R1JA 3UDFA 4XTCS 4YWKA 5KEEA 1E0BA 4PZ8A 3MVVA 1WTPA 1B4OA 1ZEQX 5DAUA 2E75C 3IFDA 3MC0B 1TR5A 2FJ2A 2K33A 5I6WA 3NBHA 3L3OC 4IFDH 2L12A 3CQZB 1EIFA 1WTXA 5CORA 4MTNA 1WD0A 3IRBA 5AJ3Q 2F0VA 1F77A 1YJNA 2EYFA 2KHJA 4PV1C 3JAML 2WACA 1TWCB 3KJPA 2NB0A 1Q3LA 1G91A 1BCPC 5IYDH 1A3VA 3T53B 1N34L 5FO9B 4JBKA 2F4IA 1AEXA 4A3KB 1F2ZA 5KYIA 2NVQB 4GNXC 3IFTA 2EYPA 1Q90A 4LFAL 3OW2A 4JI1Q 3RN2A 4Q0FA 1JR0D 3LNNA 3NELA 3OIPA 3SHLA 3TMEA 3F2DA 1HQMC 2R7DA 1ENAA 3NENA 1KLUD 4H13C 3KLSA 2P5ZX 5C44H 3BZKA 5KNBA 3PO2G 2RCNA 4A3EH 3J7YW 4LF6L 1TWGH 2L4NA 3JC66 1VQKA 3EA6A 5IP7G 3L2PA 1FJGQ 1K8MA 2R92B 1GUNA 3G7LA 1M1KC 3F8TA 1GOZA 1WD1A 1STEA 2B63B 1BCPB 3U4VA 3I4NH 1SAPA 2R3ZA 1WVLA 1I94Q 4DV5L 1ASYA 1YI2A 3S1QB 4OEMB 3VYRA 2UXCQ 2Z6BA 4MHEA 1JCKB 2R7FA 4KKTA 3X3NA 1STYA 1D5XC 4P75A 5IP7H 2K50A 4AQYQ 4WORA 3L7ZC 3TN2A 3H0GH 3PO3B 4JI5Q 3S14H 1KDBA 3AB9A 1R4QB 1XNRL 3HOYG 5A2QL 5CV9A 4CJ1B 2D2CC 1Z9FA 1KDAA 4A3KG 4JBMA 1VDZA 4DR7L 2GVAA 4CKBA 2JA7B 3OMGA 1GD7A 3HKZG 1IXRA 2KEEA 3VR6A 2B2YC 2HIXA 3I4MG 4HEDA 4N8FA 4JK1C 5JPMC 2AMCB 1G2TA 1JWMD 4DFAA 2VY3A 5BR8L 5NUCA 2QCPX 3PGZA 1VQJA 1DOMA 3D3RA 1L0XB 2JXMB 1S3OA 4QJFA 2Q2UA 1A0IA 2NN6G 2G9HD 4BY7G 5HURA 3NEMA 3A56A 4LUOA 1WTHA 2F3IA 3DWPA 3HFZB 4DV1Q 4K2KA 1CA5A 2N55A 5IYCG 1PH5A 3KLSX 2LSSA 5JJKA 3K5OA 1SROA 1V1PB 2PMZE 4NXNL 1O78A 1HFNA 3S16B 1JC7A 3HOVH 2MPMA 1RDPD 4K14A 1KNAA 1BBXC 3I4NG 2NZOA 1TXYA 1V1QA 3HKSA 1P8LA 2OT2A 1HNZL 5C44G 2NVQH 5LMNW 3I56A 4K6DA 2M00A 2B2YA 4A3FB 4EX5A 1XJVA 3UE1A 2UXDL 3AMUA 2G9DA 5FJ8G 1JWSD 1PA6A 2F3VA 4RAUC 1GUSA 4GKJQ 1B9NA 1H9JA 2PQEA 4LUVA 5C44B 2D62A 3F2CA 1EYGA 3T1HL 1EU4A 2I0QA 1K8GA 5CC4A 4YWLA 1IKLA 1NCVA 1FYCA 1WOCA 2PI2E 3NHHA 3H15A 2JEBI 3NTIA 4HIMA 3PV0A 4ZK9B 3H6MA 3PMFA 1VQ7A 1CUKA 4A75A 1GUOA 3J7AF 2EY5A 4KV6A 3RZOH 4K8IA 1MJCA 3K5LA 3D4RA 2RSNA 4AQYL 4X64L 3TEHB 2F0DA 1YJ9A 3G6EA 1AZQA 4NKLA 4OO1H 5E1FA 1L1OC 1U0LA 1X3EA 4DUYQ 4FF2A 3K7AH 5M3FG 3M4OB 3HZXA 4H02A 2BDOA 2OQKA 1YNJD 2HQLA 1VQDA 3MFGA 1IYJB 1LT3D 4F88A 4EQNA 2Y0SB 2F0TA 1SRUA 1SN8A 3F2UA 4BA2I 4XYQA 3UE0A 3G6JB 1A62A 4NB3A 2PQAB 5IGDA 3D4DA 4PQXA 2WB1B 4WRDA 1E1OA 2LMCB 2K1BA 3FPUB 4A3LG 1STGA 1MJEA 2HHHL 4A3IB 2IL8A 3WOFA 1Y69U 3AEVA 2F0PA 5AFWA 3MEFA 3HOXH 3GTJH 2UUAQ 3Q23A 1SNOA 2J4XA 3PIPA 4A3DH 1M4VA 2KBNA 4X65Q 4QB4A 4LW1A 1LTLA 2B63H 4DNTB 2K5WA 4K5VA 1MSGA 3RUZA 2RHSB 1UE1A 1W2BA 4N9PA 2JJQA 3NP8A 1TWHH 3CCJA 3PO2H 3CMEA 1AFPA 1NBWA 5JVH3 2FINB 4IUPA 1RTNA 3Q0AA 4DV0L 4LNQA 1SEBD 3K80C 4A3JB 4V190 3VR2A 3I4OA 5G3LF 3GTKB 5JVG3 1A2TA 1BUVT 2Q8TA 1A3TA 3RZDH 1S72A 4JI0L 3UDIA 3DWQA 3TDQA 3TSSA 4HJ9A 1X3PA 1HCZA 2ENBA 4POGA 4YHHL 3GTPH 4LF8L 1MGSA 1H9SA 1K8AC 1G2SA 1X3FA 1B53A 5IT9E 1Q7YC 4LF4L 2Y0SG 3KBXA 4DV2Q 2LFNA 4I7AA 3RN5A 3MEHA 3CU7A 1XMQQ 2ATWA 1BQQT 4RGTA 3E5SA 2R61A 4GS3A 2DUDA 4ME3A 2NYZD 1OXVA 4G57A 3O13A 5IT9c 1FD7D 3MXUA 4G7ZC 2QILA 1IL2A 1HXYD 2MNAA 3PF5A 2K4KA 2IHFA 1N9WA 4P73A 4IPHA 1I50H 1LLRD 4IO9A 4KJOA 1MI2A 4DUZQ 2VL6A 3K5MA 4U68A 4BBSG 2K75A 4DAMA 2F0GA 4FXGC 4NXMQ 2K5HA 4KD4A 4JI4L 3CPWA 1JOQA 2KCTA 5C4ZA 4QCLA 5JEAG 5FLXL 2Z4HA 5FK9C 1DONA 4IPDA 5BN5A 4HJ8A 1PTOB 1WFQA 1IBLQ 2E2JH 3E9IA 1JB3A 3NBHB 3T4AC 2AWOA 2AUKA 4RGOS 1HNXQ 1BCPD 4C3HH 1KHIA 2K52A 3C3LA 3NQIA 1Q81C 3PIO3 1TWAB 3ONAB 3OMCA 2UU9L 3BDLA 1V9PA 3TP6A 3S1MH 2HIVA 1GHKA 3ERSX 1YBYA 1PRTB 1JE5A 1JOOA 1GJXA 4K2LA 1DM0B 4K8JA 1RD9D 5FKAC 5DM63 5C0XH 4A3IH 3F1ZA 1HUMA 2B3GA 2M2LA 2MFIA 2NUCA 4RH6A 3H09A 4LK1C 1J6QA 2IJ0A 5GAEC 2UUAL 4KHZA 1GKHA 1SMXA 2PW5A 4JVZA 1PRTF 1G6PA 5K36H 5J1ZA 4RGMA 5LL6S 3AFPA 3D4WA 4IPCA 2Q8IB 2RVLA 4DV4L 4A3BB 3CC2A 4NPSA 1JJ2A 2C9OA 4KKSA 3T51B 1IL8A 2QDLA 3HOUB 4UP8A 2OQ0A 3K57A 2KA7A 2F0EA 3J81L 1LACA 3CC4A 1K83B 1NMGA 2PI2A 1MHWC 1Q1EA 4P72A 1MD2D 3CCEA 3MWYW 4NXNQ 5M5XH 1PFSA 5I9OA 4IOCA 5CR3A 2Z8LA 3I4MB 2V4DA 4DR7Q 3Q22A 3EN2A 1EY9A 5T1GA 1LTSD 4OONA 5KIXA 3D8GA 1TWHB 3PO2B 4TRDA 2MJ8A 1P16A 1PFBA 2K04A 4GOPB 1J9OA 4RKBA 4DAYB 1RL2A 3D31A 4JI7L 4JI3L 4AH6A 2A69C 1STHA 5HY6A 5IYBH 4ZRZA 3SK6A 3R93A 1C0AA 3S1QH 1DZ1A 1X3GA 5M3FB 3Q6SA 1Q8KA 4J1MA 1PYWD 4LF5Q 1VQEA 3CKIB 5BN4A 4IJLA 3C46A 1B3QA 4DK3C 4F7XA 2F0FA 1CKNB 2Z0SA 5GROA 2YU9H 3VDYA 4JI6Q 3W5OA 4UY8C 5J3BA 4LFBQ 2JSOA 5ELDA 2RDFA 2ZJPA 1KD1C 4QGUA 2Q2TA 4PMBA 1KAAA 1SXTA 1ILQA 1KIXA 2EJFC 4QQBX 3UI2A 5IP9H 3C1FA 4B3TQ 1VQIA 3M85A 1VS0A 4A3JH 3R8BA 2Q2IA 1BVSA 5D3IB 5LL6X 3QJYA 4A4IA 1I4GA 3CCQA 1PZJD 1M8AA 5E3FA 3DM1A 5I4DA 3CP0A 4E6IA 3TP8A 3B6YA 1LTID 4B9XA 1SBBB 4BA1I 4Y52H 1A8VA 5EGTA 2YV5A 4WJ3M 1Q86C 3PQIA 4DXGA 2VQEL 4LF8Q 2A68D 1TKWB 2E2DC 2G5DA 4B08A 5JEAJ 3GD7A 1EY5A 3FKIB 4BY1H 5IGGA 1PMRA 1EYDA 3J81E 2XWJB 1D6EC 2H4OA 3M4PA 3S2HH 3KUPA 4LF7Q 1S5BD 1MIUA 3M9BA 5IE8A 3OYYA 2UUCQ 4CBVA 3V2TA 1EFID 1D5MC 2D0OA 3LWEA 4IUVA 1PTOC 4HMIA 2B2WC 2JA5H 1HR0Q 5ELBA 3CCVA 3GTQB 4JI3Q 2NN6I 2VQEQ 3QR8A 1NAPA 4DF7A 1QZGA 3GTQH 4A3EG 1NMFA 1YIJA 2UXDQ 1KC8C 1K73C 4FF1A 4J15A 2I46A 1SE3A 2E8GA 1B2TA 1I3QH 2TSSA 4DR3Q 4LFCQ 3GTLB 4LFCL 4A3CH 4PNYA 1ZXTA 1NNXA 3CRKC 4EQOA 5CV8A 3KLWA 4GZYC 2NZ1D 2EYMA 1BO0A 2ZXOA 2MHVA 2DJFC 2CVRA 3DWAA 4C3IB 3K59A 4YHHQ 2ZJQA 4H7BA 5C0XI 4IN3A 1LTBD 1PTOH 2MO0A 1OXTA 2IX1A 1DD2A 1F9PA 1HUNA 3I73A 3URYA 3S16H 4IUNA 3E3XA 1D5ZC 2B2WA 2VS1A 2SNSA 5JEAH 1Z6HA 4IURA 2AWNA 4U673 1SNCA 1E1TA 4OWXB 2QKIC 4DXFA 1H95A 4LAAA 2F4VL 3KF8A 3RLFA 2Z1CA 1QB5D 1T5XD 3M3YB 4JI7Q 2L11A 4TQUS 2AKWB 3S17B 1DOKA 4FVMA 4OIJA 2WINB 4V0BA 2F0MA 1KDCA 2QEJC 4JBWA 1HRJA 1N36L 5LMNL 1CM9A 4DR6Q 2D9UA 2EPBA 1B9MA 3S2HB 1YITA 4UDUC 1YJWA 4RGNA 1SYFA 1PH9A 2BH2A 3FMCA 1RTOA 5F2DA 1VQMA 3HOUG 1EQQA 2EDGA 2KECA 4FNFA 1YNXA 1SFOH 2R92G 3BDOA 2KEDA 3CD6A 3CCLA 5IGBA 1B3AA 1LV9A 3A0JA 3N6RA 2A5HA 4A3LH 1BBWA 2EXDA 1U4RA 3TS2A 2NVYH 1VQCA 1PYBA 4LF9Q 4C56C 1QE6A 1DGSA 2WAQG 1IHZA 3DM3A 2RKSA 3I4MH 4N9TA 1O80A 2ZM6L 2CQOA 4C2MB 3MXGA 3NTKA 3HOUH 3HOVB 1T9HA 3R2IA 2BE5C 1VF7A 2A1AA 3K58A 2IY5B 3NK9A 4CJ0B 1PTOD 4QIWE 1FVIA 2RBMA 2QDBA 5CYUA 1AE3A 2Q2HA 2C5CA 1EEFD 3NWTA 3I91A 4DK6C 4ILWA 1PH3A 4AYBE 2N8NA 2F0IA 4QY7A 2VQFL 4DR6L 2A19A 1YZ6A 3S9WA 5G3LD 5M5YH 1B44D 3KLRA 3MXNA 2R7ZB 1ICFB 2K5VA 1CTMA 1AE2A 2DN8A 4DNIA 5EJWA 1VCIA 2N49A 4ZKCB 1BF4A 2CW0C 3PSIA 4JI8Q 3ULJA 2IX3A 4LMQD 3J80L 2E2JB 1FNWA 1YEZA 3NXWA 3BVZA 1VQFA 4L6TB 1VQ6A 1XTDA 4L5QA 1LT5D 3GTJB 2QF7A 4MIUA 2ZM6Q 1SDFA 5IP9G 1DYQA 3H3VC 3PF4A 3SR1A 4HTHA 1WCMG 4R8IA 1TWFB 2OWOA 1IW7D 2VUMG 2WAQE 3NPPA 4B3MQ 4HIDA 3MFYA 1VQPA 2YTVA 3CPFA 1Y8NB 3HOWB 3U9OA 4JI8L 4DAYA 4G7OC 2NZHA 5FLXc 2DJGC 4LFBL 2Z4IA 4X3UA 2UU9Q 4K5XA 4KTAA 4OIKA 1V1OA 1T5EA 2B2TC 2KCNA 5EKKA 1CSQA 1X56A 3MAQA 2NN6H 1S4ZA 1K83H 4UP9A 2ALYB 2JA6H 4JBJA 2AHOB 1EWIA 3HKZB 3EVQA 1XNRQ 1K8OA 1H9MA 4GN3B 1MKHA 3CRLC 3S1RH 2ZXRA 5HGQA 2RDGA 4IUQA 3S2DH 2A73B 3H94A 3PO3G 2YU9B 3E6ZX 5L37A 3RLOA 3I8ZA 2F0OA 2XRSD 2EOTA 1JWUD 2ZJRA 4KN7C 3J7ZC 1SSOA 1X65A 2DGYA 4X3TA 4XYOA 2SDFA 1ESRA 4DR5L 3BYYB 2BE5D 1Z47A 2K7VA 4RHSA 1CFMA 4DR3L 4F87A 3A5ZB 3ERQA 2WIIB 5ELNA 4A3MH 4OWWB 5M5WH 5JJZA 4A93H 2F0HA 1S5DD 2AQ1B 4OELB 2KENA 2O4XA 1AP0A 1TWAH 1LTTD 1G6ZA 1NJIC 5GQOA 3J81c 4GOPA 3HOWG 2JA9A 5CV7A 3S17H 3PUXA 1RJTA 2L0CA 3PUWA 4TVAB 1SYGA 1X9NA 4MTKA 1F9SA 1E24A 1J5EL 5KYLA 1VMCA 4C3JG 2E5LL 3OTOL 1CHQD 5C3EH 2XWBB 2RF4A 1LTGD 3W2DA 5M5YB 1NR2A 3L0OA 4LF7L 3OWFA 4L5RC 3LX0A 3M7GA 4KY6A 4R4QA 1X55A 4HIKA 5T1IA 3MXNB 2F3WA 2VZAA 3KK7A 3P20A 3T13A 4DKAC 5JPNC 3D6WA 1L0YB 1ZYRC 3M7NA 3S1MB 1F9QA 2E2HB 4K0KQ 2EYJA 5JJLA 3Q8DA 1HR0L 4RKLA 2F4VQ 3K7AB 3M4OH 4Z9CB 4UAIA 4IUUA 4ZLTF 5CBEE 2A6EC 1PRTC 1Y8PB 1F2MA 5JJIA 1HFGA 1XXGA 4GLAC 4WFN3 2L55A 2HQEA 1KRSA 5EKLA 4P74A 2ICIA 2OTLA 4BXXG 5K36G 1WTRA 3GP7A 3HOZH 1M90C 1GVPA 5C4XG 1BR9A 1H9SB 4K6LA 4K0KL 2RQXA 4ZYSA 5C3EB 5IYCH 2NVXH 1CZGA 1C9OA 1YNJC 4KKUA 1HZAA 3UDXA 2D5DA 4DUZL 3W1GA 4QMGA 1TS2A 2KCCA 1OO9B 1SFOB 3GV6A 3JAMc 4DR4L 1EIYB 5CV6A 4X3SA 4GNXA 4PMWA 2J7ZA 3TQYA 1ASZA 4CKCA 5CMDA 5FO7B 1PH4A 1OXXK 2YTXA 4KD3A 3SEBA 3L9AX 1Y8OB 3WWVA 4ZKBB 4A3EB 3P75A 2B63G 4BXXH 1PYSB 1Y1WB 5I6YA 4DV4Q 1U9RA 1EQRA 1VQBA 4QUCA 5C4JB 1EQTA 2N88A 1EWCA 5IYDG 2R7ZG 3BS1A 1GUTA 1Q46A 2K01A 1R9TB 1IBKL 4KMUC 1XNQQ 2F0WA 4RFBA 1EOTA 2B2UC 3AFQA 1CK1A 4LF5L 4GLXA 2VUMH 2EY6A 4BY1G 1VF5C 3X3MA 3VR3A 1HNWL 3D6CA 1I4PA 1FNVA 5FLXE 1LT4D 2CWPA 4XQNA 4NP5A 4ZAIA 1PH6A 3OOCA 1HTPA 4DV7Q 2A68C 4C1NI 1KL9A 4OO1G 4IFDG 4O1NA 1D7QA 2EXZA 1BKBA 1XX8A 4PG3A 1VQ5A 1VQAA 3KDFA 1XPRA 2K05A 2PNHA 1E2WA 2D0PA 4P71A 1PRTD 2XGTA 2EY1A 4OX9L 4UPAA 1LYLA 1R4PB 2OXPA 2XVSA
chains in the Genus database with same CATH topology
3M4PA 5C44H 3BZKA 3PUYA 4OWTB 1OXSC 3S2HH 3PO2G 2RCNA 5AJ3L 4A3EH 4LF6L 1TWGH 3JC66 1VQKA 2Y0SE 5IP7G 3GO5A 3L2PA 4LF7Q 1FJGQ 1FJGL 1MIUA 1B70B 3M9BA 3KFUA 1Y1WG 5IE8A 1M1KC 1AH9A 3F8TA 3PO3H 4GKKQ 1HNWQ 3OYYA 2UUCQ 5IY0A 4A3MG 3FP9A 2D0OA 3U4VA 2JA8G 4DV7L 2YYZA 3FKIG 3G48A 2RHQB 1I94Q 5M3FH 4R4IA 4DV5L 1C7YA 1ASYA 1YI2A 4A3BH 2JA5H 1HR0Q 2UXCQ 3CCVA 3GTOH 4JI3Q 2NN6I 2VQEQ 2JA7G 4RMFA 4LWCA 2R7FA 4B3RL 1N8RC 1QZGA 3GTQH 4A3EG 1NMFA 1Q1BA 1YIJA 2UXDQ 1KC8C 1K73C 3F2BA 4P75A 5IP7H 3TRZA 2K50A 4AQYQ 4A3JG 3L7ZC 3H0GH 4J15A 4JI5Q 2FXQA 1N36Q 3S14H 4BBRG 2KHIA 4LF6Q 1HZ9A 1X6OA 2E8GA 1S40A 4A93G 1I3QH 4DR3Q 4LFCQ 3T1YQ 4LFCL 4A3CH 1XNRL 3HOYG 3CAMA 1Z9FA 4GKKL 2JA6G 4A3KG 4JBMA 4DR7L 2GVAA 3S24A 2ZTDA 1GD7A 3HKZG 1IXRA 3J81i 2OTJA 2HIXA 3I4MG 3J81j 4JI6L 5FJ8H 3KLWA 1Y1WH 2AMCB 3PCOB 4EQ5A 2VY3A 5BR8L 5IYBG 1VQGA 3PGZA 1Q82C 1VQJA 3W1BA 3KDFB 2VNUD 4YHHQ 3CC7A 2ZJQA 1S3OA 2F52A 4BBRH 1X54A 1TWCH 1A0IA 2NN6G 4QJFA 2Q2UA 4MZ9A 4B3TL 1E7ZA 4BY7G 5C0XI 4Y7NH 3BZCA 3NEMA 1Y1VG 4LUOA 2MO0A 1OXTA 4QL5A 2F3IA 3HFZB 3OTOQ 4JOIC 2Z6KA 4DV1Q 2IX1A 4DV0Q 5IYCG 1IZ6A 1PH5A 3T1HQ 2LSSA 4AYBG 3S16H 2QEXA 3H3VI 5JJKA 1PH1A 1SROA 2PMZE 1D8LA 1HZBA 4NXNL 2VS1A 3K8AA 4OO1I 3PUZA 4JV5Q 3HOVH 1KQSA 3ER0A 4PZ6A 2AWNA 3E9HA 4JC0A 1XPUA 3ULPA 4A76A 4B3SL 1KXLA 1RIPA 3FKIH 1E1TA 4B3SQ 4OWXB 3I4NG 2NZOA 1TXYA 4B3ML 1V1QA 3HKSA 1P8LA 4YCVA 1HNZL 1H95A 1PV4A 5C44G 3RNUA 2F4VL 2WFWA 4R4OA 3RLFA 2NVQH 3RLNA 3I56A 1Y1VH 5LMNW 4JYAL 1HR0W 1UE6A 3TREA 1PVOA 4JI7Q 1XJVA 4EX5A 3UE1A 3AQQA 4TQUS 1XPOA 4HJ7A 3S1NH 4KHPL 2AKWB 3RR5A 1IBKQ 1FGUA 3CXCA 2UXDL 3STBC 5FJ8G 3S15H 1PA6A 2IX0A 1N32Q 4JBWA 4GKJQ 4JI4Q 1N36L 5LMNL 1KRTA 4NXML 3GTLH 4DR6Q 2CCZA 4LUVA 3TS0A 2D62A 2ZTCA 3F2CA 1YITA 1YJWA 4JCVE 3T1HL 1EYGA 4BY7H 3I2ZA 2UXBL 1WJJA 2I0QA 4JOIA 4GLVB 3T1YL 1K8GA 1QUQA 3BU2A 1PH9A 4A3IG 3G4SA 4YWLA 2BH2A 4APVA 1VQMA 2CWAA 3M3YH 3HOUG 1FL0A 4X65L 1WOCA 3CF5A 1EQQA 2PI2E 3H15A 3H0GG 2JEBI 4UP7A 1I94L 4HIMA 1YNXA 3PV0A 2EIFA 1SFOH 2R92G 3PIOA 2MO1A 3CD6A 3CCLA 1VQ7A 3A0JA 1CUKA 4A75A 1VQNA 2B29A 2K5NA 5C4JH 4KHPQ 1Q12A 4DR2L 4A3LH 1BBWA 3HOYH 2EXDA 3TS2A 2NVYH 1VQCA 1PYBA 2XTIA 1PH8A 1QVGA 3RZOH 4LF9Q 1MJCA 1E3PA 1DGSA 2WAQG 4X64L 4AQYL 3DM3A 3I4MH 2WP8J 2ZM6L 2BA0A 2CQOA 3TEHB 1SR3A 2IHEA 4POFA 1YJ9A 3HOUH 3G6EA 1O7IA 1HZCA 4GOPC 2ZTEA 1T9HA 3U50C 2HHHQ 4DR1L 5IWAQ 4X62L 2A1AA 5IWAL 4X62Q 2IY5B 1L1OC 1U0LA 1X3EA 4QIWE 3KYHC 5GAGC 1FVIA 4DUYQ 1HNXL 3K7AH 5M3FG 2V1CC 1KAWA 4H02A 3J7A5 3K0XA 4A3FH 1AE3A 3HOXG 2OQKA 2ES2A 5M3MH 1I6HH 2HQLA 2Q2HA 1VQDA 3FHWA 1YVCA 1VQ9A 1IYJB 2CFMA 1CKNA 2MQHA 2I5MX 4DK6C 1IBMQ 2OCEA 1N32L 1EOVA 1SN8A 1SRUA 2R92H 4BA2I 3UE0A 1OTCA 4DR5Q 1A62A 4NB3A 2PQAB 4AYBE 1PH3A 1K0RA 2N8NA 1GM5A 1E1OA 2IT1A 4QY7A 2VQFL 2JA8H 4DR6L 4A3LG 2A19A 4DR1Q 1YZ6A 5C4XH 1MJEA 1N33Q 4MNOA 2HHHL 5M5YH 3AEVA 2R93H 3MEFA 3HOXH 2K5VA 3GTJH 5M3MG 1AE2A 2UUAQ 3CQZH 3PIPA 4A3DH 4IFDJ 1CSPA 2LXJA 2N3SA 4DNIA 1R9TH 1VCIA 1JMCA 4RG1A 2KBNA 1OXUA 2N49A 4X65Q 4LW1A 1LTLA 2B63H 4DV5Q 1HJPA 3GTGH 4JI1L 5BR8Q 2RHSB 3PSIA 4JI8Q 3ULJA 5LMUL 1UE1A 5LMUQ 1YEZA 4BBSH 1W2BA 1IBML 1VQFA 2JJQA 1VQ6A 1XTDA 4L5QA 1TWHH 3I7FA 3CCJA 3CMEA 3PO2H 2R7ZH 1NBWA 4GKJL 3BJUA 2K14A 4DV0L 5EAYA 2ZM6Q 2C35B 4LNQA 3K80C 2H5XA 4JI2Q 4DPGA 5IP9G 4HIOA 3PF4A 3S2DH 1WCMG 3I4OA 3GDEA 1QZHA 4JV5L 3HOVG 2OWOA 1A63A 2GN5A 2VUMG 1CKOA 3CCMA 2WAQE 3RZDH 4IOAA 1L2FA 1S72A 4B3MQ 4HIDA 4JI0L 1VQPA 3CPFA 2YTVA 3UDIA 4FDBA 5C0XG 4JI8L 2NZHA 4ALPA 4HJ9A 3I4NH 1QVFA 1Y14B 5FLXc 1JJGA 4LFBL 4POGA 1JJCB 2UU9Q 4YHHL 1QUQB 3GTPH 4LF8L 2QGQA 1K8AC 1X3FA 4DV3Q 1Q7YC 2LXKA 2E2HH 4LF4L 2Y0SG 4DV2Q 1CSQA 1X56A 3CCUA 3LGJA 4C3JH 3RN5A 1K83H 4JI5L 1XMQQ 2ATWA 1UWVA 4PZ7A 4UP9A 2ALYB 4KLKA 5DLQE 4JBJA 2AHOB 4AIMA 3J80c 2JA6H 4GS3A 1EWIA 2DUDA 2JE6I 4ME3A 3CCSA 1OXVA 1XMOL 4R4CA 2JEAI 5IT9c 1XNRQ 1IL2A 4GN5A 2MNAA 4GN3B 3PF5A 2K4KA 1MKHA 2IHFA 1N9WA 5HGQA 3S1RH 4P73A 4IPHA 1I50H 4HJAA 1WYDA 1IBLL 4IO9A 3PO3G 4JYAQ 3ZJYC 2QA4A 4YY3Q 3H3VH 3RLOA 4DUZQ 2VL6A 4IJHA 3U58A 4BBSG 2E2IH 2K75A 2Z6KC 5E7NA 4DAMA 4DV3L 2ZJRA 5ELOA 3J7ZC 1X65A 2DGYA 1GO3E 3HOWH 4NXMQ 2K5HA 2VQFQ 4JI4L 3CPWA 2I5LX 2JQOA 2A8VA 4DR5L 1SE8A 2KCTA 3GTKH 1UEBA 1Z47A 5JEAG 4DR3L 1B7YB 4DV6L 4X6AH 3A5ZB 4LUZA 5ELNA 4A3MH 1XMOQ 4A3GG 2BH8A 3GTMH 4IPDA 4OWWB 5C0XJ 4HJ8A 5M5WH 2L15A 1WFQA 1IBLQ 2E2JH 4A93H 3KF6A 4KI0A 3ULLA 3E9IA 1HNZQ 2HT1A 3KOJA 2KENA 3NBHB 2AWOA 4DUYL 1HNXQ 1LM0A 1KHIA 1TWAH 2K52A 4C3HH 4A3KH 1NJIC 5GQOA 3J81c 1Q81C 4GOPA 3HOWG 2JA9A 3K81C 3S17H 3PUXA 3DLLA 2UU9L 3PUWA 3G71A 1V9PA 4DR4Q 1HH2P 4TVAB 3KF6B 1X9NA 2UUBQ 1VQOA 4IFDI 3S1MH 1PHJA 2WB1G 1YHAA 1E24A 1L1OA 1J5EL 2HIVA 3ERSX 1YBYA 1TWFH 3PUVA 3AYHB 4DV2L 1WI5A 3HKZE 4YWMA 1JE5A 1V43A 2E5LQ 4A3BG 2E5LL 4GN4B 3OTOL 3U4ZA 1EUJA 1VQ4A 5C3EH 3JAMi 2RF4A 1N33L 4A3IH 1UE5A 3F1ZA 1PH7A 1K9MC 3L0OA 4R4TA 4LF7L 2B3GA 2MFIA 1YHQA 4L5RC 3K7UC 2R93G 4R4QA 1X55A 4HIKA 1JT8A 1J6QA 5GAEC 3MXNB 2UUAL 2VZAA 5FLMH 4KHZA 4WJ4A 3A74A 1GKHA 1SMXA 4JI0Q 3EIVA 4DKAC 2UUCL 2CKZB 1G6PA 3M7NA 3AFPA 1LUZA 4K0KQ 1N34Q 4IPCA 2BA1A 5JJLA 3Q8DA 1HR0L 1K3RA 4YCUA 4DV4L 2F4VQ 3M4OH 3CC2A 4NPSA 1JJ2A 4YCWA 2ASBA 3UDGA 4B3RQ 4OX9Q 5JJIA 3CCRA 5GAHC 2ID0A 1CKMA 1B8AA 4LF9L 1UE7A 2R6GA 4GLAC 4L5SA 1XMQL 5LMNQ 4C2MH 4UP8A 2OQ0A 3J80i 1KRSA 1W3SA 4P74A 2OTLA 4DV6Q 2I5HA 4BXXG 5K36G 3CC4A 1NMGA 1SLJA 2UXBQ 2PI2A 4X66L 1Q1EA 3HOZH 1M90C 4P72A 1GVPA 4A3CG 3CCEA 5C4XG 3E0EA 4NXNQ 5M5XH 1PFSA 1L1OB 4IOCA 4K0KL 3EBEA 4DR7Q 2YTYA 3EN2A 2NVTH 1NTGA 4OONA 5IYCH 4O2DA 2NVXH 1P16A 4GOPB 4A3DG 1C9OA 1HZAA 2KCMA 3UDXA 4DAYB 1RL2A 3D31A 3W1GA 3A5UA 4DUZL 1PH2A 1E22A 3KF8B 4YY3L 4JI7L 4JI3L 4AH6A 2UUBL 5IYBH 5HY6A 1L0WA 3SGIA 3JAMc 4DR4L 4A3GH 1WCMH 1EIYB 3STBD 4GNXA 4PMWA 1XNQL 1NY4A 3TQYA 3CMAA 1C0AA 1ASZA 3S1QH 1JB7A 1X3GA 4LF4Q 2PQAA 1Q8KA 4DV1L 4L5TA 4OXPA 4O0AA 1QVCA 4X64Q 1PH4A 4LF5Q 1OXXK 1VQEA 1BBUA 4IPGA 2YTXA 2VW9A 4IJLA 5GADC 4DK3C 3I55A 1CKNB 1G291 3WWVA 5FLMG 1VQ8A 1NE3A 2WB1E 4X66Q 2B63G 4C3IH 2Z0SA 4R1JA 3UDFA 4JG2A 5GROA 2YU9H 4XTCS 4YWKA 3VDYA 4BXXH 4JI6Q 1PYSB 2EQSA 3W5OA 4PZ8A 4UY8C 4DV4Q 1VQBA 1EQRA 5J3BA 4LFBQ 2UXCL 2ZJPA 1KD1C 5IYDG 4QGUA 4DR2Q 2Q2TA 2R7ZG 1Q46A 1KIXA 1IBKL 4QQBX 2JA7H 1J5EQ 5IP9H 1XNQQ 4B3TQ 1VQIA 3M85A 1VS0A 4A3JH 2Q2IA 1EIFA 1BVSA 4MTNA 3AFQA 4LF5L 3IRBA 4A4IA 5AJ3Q 4GLXA 3CCQA 1YJNA 2VUMH 4JI2L 1EFWA 4BY1G 1YHBA 2KHJA 4GNXB 1U5KA 1HNWL 3KJPA 2JK8A 3CP0A 2GVBA 5IYDH 2CWPA 4A3FG 3D0FA 1N34L 3B6YA 1PH6A 4JBKA 1I5FA 4DV7Q 4BA1I 4GNXC 1VQLA 1VQHA 1A8VA 4LFAQ 4Y52H 3KJOA 4LFAL 2YV5A 1KL9A 1Q86C 3OW2A 4OO1G 4IFDG 4JI1Q 4HJ5A 4WJ3M 1D7QA 1BKBA 3M4QA 4PG3A 2VQEL 3RN2A 1VQ5A 4LF8Q 1VQAA 4XIGS 3KDFA 3HOZG 3CW2C 5JEAJ 3NELA 1XPRA 2PNHA 3GD7A 1G51A 3F2DA 2D0PA 4P71A 2JA5G 4BY1H 2XGTA 4OX9L 4UPAA 2R7DA 1LYLA 3NENA 5H1SE 2N78A 5C3EG 3ICEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M4P A;  5C44 H;  3BZK A;  3PUY A;  4OWT B;  1OXS C;  3S2H H;  3PO2 G;  2RCN A;  5AJ3 L;  4A3E H;  4LF6 L;  1TWG H;  3JC6 6;  1VQK A;  2Y0S E;  5IP7 G;  3GO5 A;  3L2P A;  4LF7 Q;  1FJG Q;  1FJG L;  1MIU A;  1B70 B;  3M9B A;  3KFU A;  1Y1W G;  5IE8 A;  1M1K C;  1AH9 A;  3F8T A;  3PO3 H;  4GKK Q;  1HNW Q;  3OYY A;  2UUC Q;  5IY0 A;  4A3M G;  3FP9 A;  2D0O A;  3U4V A;  2JA8 G;  4DV7 L;  2YYZ A;  3FKI G;  3G48 A;  2RHQ B;  1I94 Q;  5M3F H;  4R4I A;  4DV5 L;  1C7Y A;  1ASY A;  1YI2 A;  4A3B H;  2JA5 H;  1HR0 Q;  2UXC Q;  3CCV A;  3GTO H;  4JI3 Q;  2NN6 I;  2VQE Q;  2JA7 G;  4RMF A;  4LWC A;  2R7F A;  4B3R L;  1N8R C;  1QZG A;  3GTQ H;  4A3E G;  1NMF A;  1Q1B A;  1YIJ A;  2UXD Q;  1KC8 C;  1K73 C;  3F2B A;  4P75 A;  5IP7 H;  3TRZ A;  2K50 A;  4AQY Q;  4A3J G;  3L7Z C;  3H0G H;  4J15 A;  4JI5 Q;  2FXQ A;  1N36 Q;  3S14 H;  4BBR G;  2KHI A;  4LF6 Q;  1HZ9 A;  1X6O A;  2E8G A;  1S40 A;  4A93 G;  1I3Q H;  4DR3 Q;  4LFC Q;  3T1Y Q;  4LFC L;  4A3C H;  1XNR L;  3HOY G;  3CAM A;  1Z9F A;  4GKK L;  2JA6 G;  4A3K G;  4JBM A;  4DR7 L;  2GVA A;  3S24 A;  2ZTD A;  1GD7 A;  3HKZ G;  1IXR A;  3J81 i;  2OTJ A;  2HIX A;  3I4M G;  3J81 j;  4JI6 L;  5FJ8 H;  3KLW A;  1Y1W H;  2AMC B;  3PCO B;  4EQ5 A;  2VY3 A;  5BR8 L;  5IYB G;  1VQG A;  3PGZ A;  1Q82 C;  1VQJ A;  3W1B A;  3KDF B;  2VNU D;  4YHH Q;  3CC7 A;  2ZJQ A;  1S3O A;  2F52 A;  4BBR H;  1X54 A;  1TWC H;  1A0I A;  2NN6 G;  4QJF A;  2Q2U A;  4MZ9 A;  4B3T L;  1E7Z A;  4BY7 G;  5C0X I;  4Y7N H;  3BZC A;  3NEM A;  1Y1V G;  4LUO A;  2MO0 A;  1OXT A;  4QL5 A;  2F3I A;  3HFZ B;  3OTO Q;  4JOI C;  2Z6K A;  4DV1 Q;  2IX1 A;  4DV0 Q;  5IYC G;  1IZ6 A;  1PH5 A;  3T1H Q;  2LSS A;  4AYB G;  3S16 H;  2QEX A;  3H3V I;  5JJK A;  1PH1 A;  1SRO A;  2PMZ E;  1D8L A;  1HZB A;  4NXN L;  2VS1 A;  3K8A A;  4OO1 I;  3PUZ A;  4JV5 Q;  3HOV H;  1KQS A;  3ER0 A;  4PZ6 A;  2AWN A;  3E9H A;  4JC0 A;  1XPU A;  3ULP A;  4A76 A;  4B3S L;  1KXL A;  1RIP A;  3FKI H;  1E1T A;  4B3S Q;  4OWX B;  3I4N G;  2NZO A;  1TXY A;  4B3M L;  1V1Q A;  3HKS A;  1P8L A;  4YCV A;  1HNZ L;  1H95 A;  1PV4 A;  5C44 G;  3RNU A;  2F4V L;  2WFW A;  4R4O A;  3RLF A;  2NVQ H;  3RLN A;  3I56 A;  1Y1V H;  5LMN W;  4JYA L;  1HR0 W;  1UE6 A;  3TRE A;  1PVO A;  4JI7 Q;  1XJV A;  4EX5 A;  3UE1 A;  3AQQ A;  4TQU S;  1XPO A;  4HJ7 A;  3S1N H;  4KHP L;  2AKW B;  3RR5 A;  1IBK Q;  1FGU A;  3CXC A;  2UXD L;  3STB C;  5FJ8 G;  3S15 H;  1PA6 A;  2IX0 A;  1N32 Q;  4JBW A;  4GKJ Q;  4JI4 Q;  1N36 L;  5LMN L;  1KRT A;  4NXM L;  3GTL H;  4DR6 Q;  2CCZ A;  4LUV A;  3TS0 A;  2D62 A;  2ZTC A;  3F2C A;  1YIT A;  1YJW A;  4JCV E;  3T1H L;  1EYG A;  4BY7 H;  3I2Z A;  2UXB L;  1WJJ A;  2I0Q A;  4JOI A;  4GLV B;  3T1Y L;  1K8G A;  1QUQ A;  3BU2 A;  1PH9 A;  4A3I G;  3G4S A;  4YWL A;  2BH2 A;  4APV A;  1VQM A;  2CWA A;  3M3Y H;  3HOU G;  1FL0 A;  4X65 L;  1WOC A;  3CF5 A;  1EQQ A;  2PI2 E;  3H15 A;  3H0G G;  2JEB I;  4UP7 A;  1I94 L;  4HIM A;  1YNX A;  3PV0 A;  2EIF A;  1SFO H;  2R92 G;  3PIO A;  2MO1 A;  3CD6 A;  3CCL A;  1VQ7 A;  3A0J A;  1CUK A;  4A75 A;  1VQN A;  2B29 A;  2K5N A;  5C4J H;  4KHP Q;  1Q12 A;  4DR2 L;  4A3L H;  1BBW A;  3HOY H;  2EXD A;  3TS2 A;  2NVY H;  1VQC A;  1PYB A;  2XTI A;  1PH8 A;  1QVG A;  3RZO H;  4LF9 Q;  1MJC A;  1E3P A;  1DGS A;  2WAQ G;  4X64 L;  4AQY L;  3DM3 A;  3I4M H;  2WP8 J;  2ZM6 L;  2BA0 A;  2CQO A;  3TEH B;  1SR3 A;  2IHE A;  4POF A;  1YJ9 A;  3HOU H;  3G6E A;  1O7I A;  1HZC A;  4GOP C;  2ZTE A;  1T9H A;  3U50 C;  2HHH Q;  4DR1 L;  5IWA Q;  4X62 L;  2A1A A;  5IWA L;  4X62 Q;  2IY5 B;  1L1O C;  1U0L A;  1X3E A;  4QIW E;  3KYH C;  5GAG C;  1FVI A;  4DUY Q;  1HNX L;  3K7A H;  5M3F G;  2V1C C;  1KAW A;  4H02 A;  3J7A 5;  3K0X A;  4A3F H;  1AE3 A;  3HOX G;  2OQK A;  2ES2 A;  5M3M H;  1I6H H;  2HQL A;  2Q2H A;  1VQD A;  3FHW A;  1YVC A;  1VQ9 A;  1IYJ B;  2CFM A;  1CKN A;  2MQH A;  2I5M X;  4DK6 C;  1IBM Q;  2OCE A;  1N32 L;  1EOV A;  1SN8 A;  1SRU A;  2R92 H;  4BA2 I;  3UE0 A;  1OTC A;  4DR5 Q;  1A62 A;  4NB3 A;  2PQA B;  4AYB E;  1PH3 A;  1K0R A;  2N8N A;  1GM5 A;  1E1O A;  2IT1 A;  4QY7 A;  2VQF L;  2JA8 H;  4DR6 L;  4A3L G;  2A19 A;  4DR1 Q;  1YZ6 A;  5C4X H;  1MJE A;  1N33 Q;  4MNO A;  2HHH L;  5M5Y H;  3AEV A;  2R93 H;  3MEF A;  3HOX H;  2K5V A;  3GTJ H;  5M3M G;  1AE2 A;  2UUA Q;  3CQZ H;  3PIP A;  4A3D H;  4IFD J;  1CSP A;  2LXJ A;  2N3S A;  4DNI A;  1R9T H;  1VCI A;  1JMC A;  4RG1 A;  2KBN A;  1OXU A;  2N49 A;  4X65 Q;  4LW1 A;  1LTL A;  2B63 H;  4DV5 Q;  1HJP A;  3GTG H;  4JI1 L;  5BR8 Q;  2RHS B;  3PSI A;  4JI8 Q;  3ULJ A;  5LMU L;  1UE1 A;  5LMU Q;  1YEZ A;  4BBS H;  1W2B A;  1IBM L;  1VQF A;  2JJQ A;  1VQ6 A;  1XTD A;  4L5Q A;  1TWH H;  3I7F A;  3CCJ A;  3CME A;  3PO2 H;  2R7Z H;  1NBW A;  4GKJ L;  3BJU A;  2K14 A;  4DV0 L;  5EAY A;  2ZM6 Q;  2C35 B;  4LNQ A;  3K80 C;  2H5X A;  4JI2 Q;  4DPG A;  5IP9 G;  4HIO A;  3PF4 A;  3S2D H;  1WCM G;  3I4O A;  3GDE A;  1QZH A;  4JV5 L;  3HOV G;  2OWO A;  1A63 A;  2GN5 A;  2VUM G;  1CKO A;  3CCM A;  2WAQ E;  3RZD H;  4IOA A;  1L2F A;  1S72 A;  4B3M Q;  4HID A;  4JI0 L;  1VQP A;  3CPF A;  2YTV A;  3UDI A;  4FDB A;  5C0X G;  4JI8 L;  2NZH A;  4ALP A;  4HJ9 A;  3I4N H;  1QVF A;  1Y14 B;  5FLX c;  1JJG A;  4LFB L;  4POG A;  1JJC B;  2UU9 Q;  4YHH L;  1QUQ B;  3GTP H;  4LF8 L;  2QGQ A;  1K8A C;  1X3F A;  4DV3 Q;  1Q7Y C;  2LXK A;  2E2H H;  4LF4 L;  2Y0S G;  4DV2 Q;  1CSQ A;  1X56 A;  3CCU A;  3LGJ A;  4C3J H;  3RN5 A;  1K83 H;  4JI5 L;  1XMQ Q;  2ATW A;  1UWV A;  4PZ7 A;  4UP9 A;  2ALY B;  4KLK A;  5DLQ E;  4JBJ A;  2AHO B;  4AIM A;  3J80 c;  2JA6 H;  4GS3 A;  1EWI A;  2DUD A;  2JE6 I;  4ME3 A;  3CCS A;  1OXV A;  1XMO L;  4R4C A;  2JEA I;  5IT9 c;  1XNR Q;  1IL2 A;  4GN5 A;  2MNA A;  4GN3 B;  3PF5 A;  2K4K A;  1MKH A;  2IHF A;  1N9W A;  5HGQ A;  3S1R H;  4P73 A;  4IPH A;  1I50 H;  4HJA A;  1WYD A;  1IBL L;  4IO9 A;  3PO3 G;  4JYA Q;  3ZJY C;  2QA4 A;  4YY3 Q;  3H3V H;  3RLO A;  4DUZ Q;  2VL6 A;  4IJH A;  3U58 A;  4BBS G;  2E2I H;  2K75 A;  2Z6K C;  5E7N A;  4DAM A;  4DV3 L;  2ZJR A;  5ELO A;  3J7Z C;  1X65 A;  2DGY A;  1GO3 E;  3HOW H;  4NXM Q;  2K5H A;  2VQF Q;  4JI4 L;  3CPW A;  2I5L X;  2JQO A;  2A8V A;  4DR5 L;  1SE8 A;  2KCT A;  3GTK H;  1UEB A;  1Z47 A;  5JEA G;  4DR3 L;  1B7Y B;  4DV6 L;  4X6A H;  3A5Z B;  4LUZ A;  5ELN A;  4A3M H;  1XMO Q;  4A3G G;  2BH8 A;  3GTM H;  4IPD A;  4OWW B;  5C0X J;  4HJ8 A;  5M5W H;  2L15 A;  1WFQ A;  1IBL Q;  2E2J H;  4A93 H;  3KF6 A;  4KI0 A;  3ULL A;  3E9I A;  1HNZ Q;  2HT1 A;  3KOJ A;  2KEN A;  3NBH B;  2AWO A;  4DUY L;  1HNX Q;  1LM0 A;  1KHI A;  1TWA H;  2K52 A;  4C3H H;  4A3K H;  1NJI C;  5GQO A;  3J81 c;  1Q81 C;  4GOP A;  3HOW G;  2JA9 A;  3K81 C;  3S17 H;  3PUX A;  3DLL A;  2UU9 L;  3PUW A;  3G71 A;  1V9P A;  4DR4 Q;  1HH2 P;  4TVA B;  3KF6 B;  1X9N A;  2UUB Q;  1VQO A;  4IFD I;  3S1M H;  1PHJ A;  2WB1 G;  1YHA A;  1E24 A;  1L1O A;  1J5E L;  2HIV A;  3ERS X;  1YBY A;  1TWF H;  3PUV A;  3AYH B;  4DV2 L;  1WI5 A;  3HKZ E;  4YWM A;  1JE5 A;  1V43 A;  2E5L Q;  4A3B G;  2E5L L;  4GN4 B;  3OTO L;  3U4Z A;  1EUJ A;  1VQ4 A;  5C3E H;  3JAM i;  2RF4 A;  1N33 L;  4A3I H;  1UE5 A;  3F1Z A;  1PH7 A;  1K9M C;  3L0O A;  4R4T A;  4LF7 L;  2B3G A;  2MFI A;  1YHQ A;  4L5R C;  3K7U C;  2R93 G;  4R4Q A;  1X55 A;  4HIK A;  1JT8 A;  1J6Q A;  5GAE C;  3MXN B;  2UUA L;  2VZA A;  5FLM H;  4KHZ A;  4WJ4 A;  3A74 A;  1GKH A;  1SMX A;  4JI0 Q;  3EIV A;  4DKA C;  2UUC L;  2CKZ B;  1G6P A;  3M7N A;  3AFP A;  1LUZ A;  4K0K Q;  1N34 Q;  4IPC A;  2BA1 A;  5JJL A;  3Q8D A;  1HR0 L;  1K3R A;  4YCU A;  4DV4 L;  2F4V Q;  3M4O H;  3CC2 A;  4NPS A;  1JJ2 A;  4YCW A;  2ASB A;  3UDG A;  4B3R Q;  4OX9 Q;  5JJI A;  3CCR A;  5GAH C;  2ID0 A;  1CKM A;  1B8A A;  4LF9 L;  1UE7 A;  2R6G A;  4GLA C;  4L5S A;  1XMQ L;  5LMN Q;  4C2M H;  4UP8 A;  2OQ0 A;  3J80 i;  1KRS A;  1W3S A;  4P74 A;  2OTL A;  4DV6 Q;  2I5H A;  4BXX G;  5K36 G;  3CC4 A;  1NMG A;  1SLJ A;  2UXB Q;  2PI2 A;  4X66 L;  1Q1E A;  3HOZ H;  1M90 C;  4P72 A;  1GVP A;  4A3C G;  3CCE A;  5C4X G;  3E0E A;  4NXN Q;  5M5X H;  1PFS A;  1L1O B;  4IOC A;  4K0K L;  3EBE A;  4DR7 Q;  2YTY A;  3EN2 A;  2NVT H;  1NTG A;  4OON A;  5IYC H;  4O2D A;  2NVX H;  1P16 A;  4GOP B;  4A3D G;  1C9O A;  1HZA A;  2KCM A;  3UDX A;  4DAY B;  1RL2 A;  3D31 A;  3W1G A;  3A5U A;  4DUZ L;  1PH2 A;  1E22 A;  3KF8 B;  4YY3 L;  4JI7 L;  4JI3 L;  4AH6 A;  2UUB L;  5IYB H;  5HY6 A;  1L0W A;  3SGI A;  3JAM c;  4DR4 L;  4A3G H;  1WCM H;  1EIY B;  3STB D;  4GNX A;  4PMW A;  1XNQ L;  1NY4 A;  3TQY A;  3CMA A;  1C0A A;  1ASZ A;  3S1Q H;  1JB7 A;  1X3G A;  4LF4 Q;  2PQA A;  1Q8K A;  4DV1 L;  4L5T A;  4OXP A;  4O0A A;  1QVC A;  4X64 Q;  1PH4 A;  4LF5 Q;  1OXX K;  1VQE A;  1BBU A;  4IPG A;  2YTX A;  2VW9 A;  4IJL A;  5GAD C;  4DK3 C;  3I55 A;  1CKN B;  1G29 1;  3WWV A;  5FLM G;  1VQ8 A;  1NE3 A;  2WB1 E;  4X66 Q;  2B63 G;  4C3I H;  2Z0S A;  4R1J A;  3UDF A;  4JG2 A;  5GRO A;  2YU9 H;  4XTC S;  4YWK A;  3VDY A;  4BXX H;  4JI6 Q;  1PYS B;  2EQS A;  3W5O A;  4PZ8 A;  4UY8 C;  4DV4 Q;  1VQB A;  1EQR A;  5J3B A;  4LFB Q;  2UXC L;  2ZJP A;  1KD1 C;  5IYD G;  4QGU A;  4DR2 Q;  2Q2T A;  2R7Z G;  1Q46 A;  1KIX A;  1IBK L;  4QQB X;  2JA7 H;  1J5E Q;  5IP9 H;  1XNQ Q;  4B3T Q;  1VQI A;  3M85 A;  1VS0 A;  4A3J H;  2Q2I A;  1EIF A;  1BVS A;  4MTN A;  3AFQ A;  4LF5 L;  3IRB A;  4A4I A;  5AJ3 Q;  4GLX A;  3CCQ A;  1YJN A;  2VUM H;  4JI2 L;  1EFW A;  4BY1 G;  1YHB A;  2KHJ A;  4GNX B;  1U5K A;  1HNW L;  3KJP A;  2JK8 A;  3CP0 A;  2GVB A;  5IYD H;  2CWP A;  4A3F G;  3D0F A;  1N34 L;  3B6Y A;  1PH6 A;  4JBK A;  1I5F A;  4DV7 Q;  4BA1 I;  4GNX C;  1VQL A;  1VQH A;  1A8V A;  4LFA Q;  4Y52 H;  3KJO A;  4LFA L;  2YV5 A;  1KL9 A;  1Q86 C;  3OW2 A;  4OO1 G;  4IFD G;  4JI1 Q;  4HJ5 A;  4WJ3 M;  1D7Q A;  1BKB A;  3M4Q A;  4PG3 A;  2VQE L;  3RN2 A;  1VQ5 A;  4LF8 Q;  1VQA A;  4XIG S;  3KDF A;  3HOZ G;  3CW2 C;  5JEA J;  3NEL A;  1XPR A;  2PNH A;  3GD7 A;  1G51 A;  3F2D A;  2D0P A;  4P71 A;  2JA5 G;  4BY1 H;  2XGT A;  4OX9 L;  4UPA A;  2R7D A;  1LYL A;  3NEN A;  5H1S E;  2N78 A;  5C3E G;  3ICE A; 
#chains in the Genus database with same CATH topology
 2QW7 A;  2O5J C;  2Y0S E;  2X6G A;  1FJG L;  3QIA A;  1ZYR D;  3MXP A;  1AH9 A;  1K0S A;  1I4X A;  1I4R A;  2HUG A;  4DU9 A;  3OHX C;  5IY0 A;  4A3M G;  3TZU A;  3FP9 A;  1K28 A;  3OIQ A;  3TP5 A;  4DV7 L;  2YYZ A;  3FKI G;  3G48 A;  2RHQ B;  3V96 A;  5M3F H;  4A3B H;  1C7Y A;  1U4M A;  3K5N A;  2IPK D;  3TZD A;  1D1I A;  1IYU A;  1DCZ A;  4DK0 A;  2K03 A;  1B50 A;  3TRZ A;  3DUZ A;  3K0Y A;  1N36 Q;  2KHI A;  4J8Q A;  2WKD A;  4A93 G;  5TSS A;  4BBR B;  3T1Y Q;  2K32 A;  3CAM A;  4CGY B;  4GKK L;  4O42 A;  4HR7 B;  3HGB A;  4IZ8 A;  3S24 A;  3A7A B;  3J81 i;  1FR3 A;  5K5P A;  5FJ8 H;  5CBA E;  4NMZ A;  1Y1W H;  3PCO B;  1WTW A;  2X69 A;  4XT3 B;  5IYB G;  1VQG A;  2XSC A;  2VNU D;  1X54 A;  1TWC H;  1I3Q B;  2I07 B;  1EYC A;  1E7Z A;  4OL7 A;  1Y1V G;  3OTO Q;  4DAV A;  4JOI C;  4DA2 A;  4DV0 Q;  1SYC A;  3T1H Q;  4AYB G;  2QEX A;  2XIW A;  1PH1 A;  2HDL A;  1C8C A;  1UUP A;  3K8A A;  3PUZ A;  2GA4 B;  1KQS A;  3ER0 A;  4PZ6 A;  3E9H A;  5KRU A;  1XPU A;  3BVG A;  3ULP A;  2AUJ D;  5C4H A;  4A76 A;  4B3S L;  1HA5 A;  1RIP A;  2ICE C;  3FKI H;  4B3S Q;  2JA5 B;  1KXL A;  1DXM A;  4B3M L;  4YCV A;  3A7L A;  3DMU A;  2WFW A;  4R4O A;  2F0Q A;  3TRE A;  3HOX B;  1PVO A;  1XPO A;  3AQQ A;  4HN7 A;  1F9R A;  1SND A;  4HJ7 A;  4K5W A;  3RR5 A;  1FGU A;  1EY7 A;  3STB C;  1N32 Q;  3S15 H;  1TQO A;  2ZXP A;  1KRT A;  2PPB C;  3I3C A;  4JCV E;  4BY7 H;  5JAV A;  2UXB L;  4JOI A;  4GLV B;  3QWN A;  4A3I G;  3FDT A;  3HS0 C;  3G4S A;  4CHT B;  2CWA A;  3M3Y H;  4C1N K;  1K3B C;  2OF1 A;  3H0G G;  2PO4 A;  3VR5 A;  4C3I G;  2F0U A;  2EIF A;  4XT1 B;  2TMP A;  2A69 D;  4IQZ A;  4MN3 A;  4A3G B;  2K5N A;  3GTG B;  5IGE A;  4RA8 A;  4KHP Q;  5C3W A;  1Q12 A;  2B8G A;  3HOY H;  3H91 A;  2XTI A;  3HOZ B;  1TY2 A;  1E3P A;  2BA0 A;  1SR3 A;  2IHE A;  4POF A;  1O7I A;  1HPC A;  1QOH A;  3U50 C;  2HHH Q;  4H0L C;  5DNF A;  3NTH A;  5IWA Q;  1ET6 A;  4X62 Q;  4JPB W;  4G4K A;  2F0S A;  3Q24 A;  4CDF C;  5GAG C;  4G7H C;  5C6A A;  3IAY A;  1WTO A;  1H9K A;  3HP3 A;  4FP5 D;  4A3F H;  3HOX G;  4TSS A;  1BOS A;  5M3M H;  2WKC A;  2CFM A;  1CKN A;  2DNC A;  1AW7 A;  3BYT B;  4ZUJ A;  5M3M B;  1ET9 A;  2BOS A;  1QWY A;  4FF4 A;  1N32 L;  1EOV A;  1EY8 A;  1TS3 A;  2KOL A;  5DEH A;  5EPL A;  4Q5V A;  4DR5 Q;  1K0R A;  1GM5 A;  2PZU A;  2JA8 H;  5EBD A;  5CV4 A;  3K6O A;  4MNO A;  1WTV A;  2F03 A;  1V1P A;  3C1E A;  2R93 H;  2PW7 A;  5M3M G;  4RHR A;  3N52 A;  1CSP A;  1TU2 B;  2N3S A;  3S1N B;  1R9T H;  4RG1 A;  2Q8R E;  1OXU A;  5J22 A;  1PLF A;  2CQA A;  4IAL A;  2PMZ B;  3DEP A;  4JI1 L;  5BR8 Q;  1ENF A;  5LMU L;  4A93 B;  1IBM L;  5IT9 L;  1O7Y A;  1CI3 M;  3E0J A;  5E4X A;  2H5X A;  4DPG A;  1ROD A;  1PZK D;  1PFN A;  2KHS A;  3FEW X;  1CHP D;  4JV5 L;  2EY2 A;  1A63 A;  5FO8 B;  4L63 B;  1CT1 D;  4IOA A;  1L2F A;  2NVY B;  2JYO A;  3RD4 A;  4I7Z C;  3BDC A;  5ISR A;  2FFK B;  1QVF A;  4ME5 A;  1Y14 B;  2HCC A;  1JJG A;  2CW0 D;  4AYB B;  4OHJ A;  2FHT A;  1JJC B;  1QUQ B;  4FF3 A;  1I50 B;  4DV3 Q;  4NDX A;  3SK5 A;  3S14 B;  3LGJ A;  4C3J H;  1A3U A;  1TS4 A;  1EQV A;  4UHV A;  4JI5 L;  2VB2 X;  3T16 A;  1UWV A;  4PZ7 A;  4AIM A;  1UAP A;  5IOD A;  3EQL C;  4KY5 A;  1TWG B;  3CCS A;  1XMO L;  2JEA I;  2A74 C;  2NBF A;  1AZP A;  4HSP A;  2FMC A;  1S5F D;  1WYD A;  3ZJY C;  5KNC A;  4ZUI A;  3U58 A;  2SOB A;  3HOY B;  2E2I H;  1ILP A;  4RWS C;  2DNE A;  2OEO A;  4DV3 L;  1PTO F;  2HCI A;  1GO3 E;  3HOW H;  2IWH A;  2VQF Q;  4IUT A;  2VXW A;  3ZYY X;  2I5L X;  2JQO A;  3JAM E;  2A8V A;  1JE4 A;  3GTK H;  2WAQ B;  1Q8I A;  1B1Z A;  1B7Y B;  4DV6 L;  2JA8 B;  4LUZ A;  4A3G G;  3GV3 A;  5EKI A;  1EL0 A;  5C0X J;  2E2I B;  2L15 A;  2O5I C;  1G8Z D;  3M4Y A;  3KF6 A;  1RF2 D;  4KI0 A;  3ULL A;  2HT1 A;  3KOJ A;  3R2T A;  1GUW A;  3AU7 A;  1LM0 A;  4A3K H;  3K81 C;  3J7A V;  1EIH A;  5C3X A;  3ERO A;  4XDX A;  1BDO A;  3KF6 B;  2UUB Q;  1VQO A;  4IFD I;  1PHJ A;  2WB1 G;  3HRZ C;  5BN3 A;  2A6H D;  1TWF H;  1WI5 A;  1EY4 A;  3HKZ E;  1V43 A;  4YWM A;  2E5L Q;  5M5W B;  3U4Z A;  3A8J E;  3DEO A;  2KJX A;  3TP7 A;  4DAP A;  4CKE A;  4HAE A;  1XTC D;  2HD3 A;  4Y7N B;  1XWE A;  3I90 A;  1YHQ A;  3K7U C;  2R93 G;  3KBG A;  1SJE D;  3OSO A;  2K28 A;  2AQ3 B;  1J8I A;  2B2V A;  1QIL A;  3QB3 A;  3IL8 A;  1LUZ A;  2ZT9 C;  2BA1 A;  1K3R A;  4ID6 A;  2NWG A;  4JW0 A;  4J6H A;  4YCW A;  3T56 B;  2ASB A;  4FO2 A;  1SNQ A;  4B3R Q;  4OX9 Q;  1STA A;  2ID0 A;  1B8A A;  4LF9 L;  1UE7 A;  2R6G A;  1KAB A;  1XMQ L;  5LMN Q;  4C2M H;  2LS0 1;  5ELF A;  3J80 i;  1W3S A;  4A3M B;  4H44 C;  5IGF A;  4X66 L;  1SMY D;  1Z7T A;  3VYU A;  3EBE A;  2YTY A;  1RKN A;  2Z9H A;  1NTG A;  3NQT A;  4O2D A;  1W6K A;  1XYI A;  2KCM A;  2PZT A;  1NSN S;  1PH2 A;  5C5L A;  3A5U A;  3IKJ A;  4YY3 L;  2UUB L;  4N8X 1;  4FYD A;  1XNQ L;  2B2V C;  1S5C D;  1JB7 A;  4L5T A;  4OXP A;  4O0A A;  1QVC A;  4X64 Q;  5IIF A;  3SK4 A;  1CQF A;  4IPG A;  2VW9 A;  2R93 B;  2MP1 A;  4KN4 C;  1X32 A;  1G29 1;  5FLM G;  1VQ8 A;  3RMH A;  2DY7 A;  4WJW A;  4X66 Q;  3QG1 A;  4KHV A;  1PZI D;  4C3I H;  2B2T A;  4JG2 A;  4QUF A;  4KY7 A;  5D14 A;  2EQS A;  1KTK A;  3ND8 A;  2UXC L;  2F0J A;  4DR2 Q;  2EYO A;  4YIJ A;  3MTS A;  2JA7 H;  2L9H A;  5KGU A;  4XQQ A;  1J5E Q;  2NVX B;  1C4Q A;  2SEB D;  3VA5 A;  5A2Q E;  1QNU A;  3GTM B;  1A2U A;  4JI2 L;  1EFW A;  1YHB A;  1SE4 A;  2JA6 B;  4GNX B;  1U5K A;  4M8A A;  2JK8 A;  2F0N A;  2PYK A;  2GVB A;  4KK7 A;  5A35 A;  4A3F G;  3D0F A;  2KVM A;  4XQJ A;  4PMC A;  1I5F A;  4I65 A;  4BS9 A;  1VQL A;  1VQH A;  4LFA Q;  3KJO A;  1HTL D;  4HJ5 A;  3M4Q A;  1SYB A;  4XIG S;  3HOZ G;  1KNE A;  3CW2 C;  4CDE C;  2A6E D;  1G51 A;  2JA5 G;  2L5T A;  4L8J A;  3P7J A;  5M9O A;  5H1S E;  2N78 A;  5C3E G;  2CH4 A;  3PUY A;  4OWT B;  1OXS C;  5AJ3 L;  4HCS A;  5ELC A;  3GO5 A;  1PXU A;  4HCE A;  1B70 B;  3KFU A;  4BWG B;  1Y1W G;  3PO3 H;  1LTR D;  4GKK Q;  1HNW Q;  2B39 A;  1UEA B;  2LKV A;  2JA8 G;  1D2B A;  1TII D;  4R4I A;  1IYV A;  2XN9 C;  3GTO H;  2B2U A;  4RMF A;  2KQ3 A;  4LWC A;  5KND A;  1N8R C;  2JA7 G;  4B3R L;  1Q1B A;  5I2X A;  2EYH A;  3F2B A;  4A3J G;  1U4P A;  1F2L A;  1BCP F;  4FXK C;  2RCF A;  2FXQ A;  4BBR G;  4LF6 Q;  1HZ9 A;  1X6O A;  1S40 A;  4C3J B;  1PFM A;  1FGB D;  3ND9 A;  4NW2 A;  2JA6 G;  1V8Q A;  4ODG A;  1I4H A;  2ZTD A;  2OTJ A;  4TKO B;  1H9R A;  4CJ2 C;  1SMY C;  3J81 j;  4JI6 L;  4F8M A;  3TBI B;  4EQ5 A;  1STB A;  1DJR D;  1Q82 C;  1HQR D;  2MGS A;  3KDF B;  4OGQ C;  3W1B A;  3CC7 A;  2F52 A;  4BBR H;  3A55 A;  4B3T L;  4MZ9 A;  3OWE B;  5EQ0 A;  4Y7N H;  3BZC A;  4QL5 A;  2Z6K A;  1IZ6 A;  3H3V I;  5COY A;  2L1B A;  1O7Z A;  1D8L A;  1HZB A;  5EPK A;  3VR4 A;  2WV6 D;  5HGT A;  4JV5 Q;  4OO1 I;  3A8I E;  4EQP A;  4JC0 A;  1WCM B;  4DN4 M;  4ABN A;  1PV4 A;  3RNU A;  2F0L A;  4JYA L;  3RLN A;  1Y1V H;  1CZW A;  1TVX A;  4R8N A;  2IW3 A;  3SK8 A;  1HR0 W;  1UE6 A;  3I4L A;  3MZ5 A;  3S1N H;  2H1E A;  4KHP L;  4A3D B;  1IBK Q;  3CXC A;  2IX0 A;  3QOJ A;  3NUC A;  1LTA D;  1EEI D;  4P2C B;  4JI4 Q;  1I4Q A;  4NXM L;  3GTL H;  1QJO A;  2CCZ A;  3TS0 A;  1KLG D;  3BZD B;  2ZTC A;  5ELE A;  3I2Z A;  4DK1 A;  1WJJ A;  3T1Y L;  1FNU A;  4ZCK A;  4BY1 B;  1QUQ A;  3BU2 A;  4APV A;  4C3H G;  1YNN C;  1DOL A;  1FL0 A;  1EZ6 A;  4X65 L;  3CF5 A;  3NWS A;  3I70 A;  4UP7 A;  1I94 L;  3PIO A;  2MO1 A;  5EPJ A;  1VQN A;  2B29 A;  5C4J H;  2NTT A;  4DR2 L;  5IOC A;  3BVM A;  2NVT B;  1TS5 A;  1PH8 A;  1A15 A;  3CHB D;  1QVG A;  5JOB A;  1SNM A;  3V05 A;  4QF4 A;  1QNK A;  3S1R B;  2BDN A;  2WP8 J;  3S2D B;  1VMP A;  3SVM A;  1HZC A;  4GOP C;  2ZTE A;  4QIW B;  4DR1 L;  2VUM B;  4X62 L;  3FRP B;  1E2V A;  5IWA L;  1STN A;  3S15 B;  4BBS B;  3KYH C;  3QOL A;  1HNX L;  2XRQ D;  3OPO A;  3SDZ A;  2V1C C;  1KAW A;  3HEJ A;  3U9S A;  3K0X A;  3J80 E;  3J7A 5;  2EE1 A;  3GTO B;  2ES2 A;  1I6H H;  3FHW A;  1YVC A;  1VQ9 A;  2MQH A;  5D65 A;  2I5M X;  1IBM Q;  1I6H B;  2OCE A;  2X6L A;  5I2Y A;  2R92 H;  3HG9 A;  1OTC A;  3RZD B;  5C4X B;  2IT1 A;  1HA6 A;  2EVB A;  4DR1 Q;  5C4X H;  1N33 Q;  2RA4 A;  3NSW A;  5EBC A;  2HDM A;  2RSO A;  5C5M A;  1ICW A;  4FXD A;  3CQZ H;  1PDQ A;  4IFD J;  2LXJ A;  1JOK A;  1JMC A;  1SE2 A;  2EYL A;  4DV5 Q;  1HJP A;  5IGC A;  3GTG H;  2RDH A;  3NE5 B;  4ZQ3 A;  2MUY A;  4S3S A;  1ONL A;  2K5D A;  5LHY 1;  5LMU Q;  3A54 A;  4BBS H;  1II3 A;  1S5E D;  3NBI A;  3I7F A;  2R7Z H;  1HHV A;  1GUG A;  4GKJ L;  3BJU A;  1NUC A;  2K14 A;  4B9W A;  5DM7 3;  5EAY A;  2C35 B;  2EZV A;  4HIO A;  4JI2 Q;  3A8K E;  4KJN A;  3GDE A;  1QZH A;  1RCV D;  3HOV G;  2GN5 A;  1CKO A;  3CCM A;  4CDC C;  3C2P A;  1IW7 C;  4DNR B;  1O7L A;  1SYE A;  4FDB A;  4X3K A;  2PNR C;  5C0X G;  1TT2 A;  4ALP A;  4RCN A;  1JOR A;  2E74 C;  1JIC A;  1W6J A;  2QGQ A;  3WOE A;  2E76 C;  1LT6 D;  2LXK A;  2E2H H;  3CCU A;  2SNM A;  3BG3 A;  1I6V C;  4BY7 B;  4KLK A;  5DLQ E;  3J80 c;  2JE6 I;  4HSV A;  1JQY D;  4R4C A;  2DY8 A;  3QO2 A;  3DXJ C;  1SYD A;  4GN5 A;  1EY6 A;  2EJM A;  4LJZ C;  1EYA A;  1IBL L;  4HJA A;  3EJI A;  3I72 A;  4JYA Q;  3VYS A;  2QA4 A;  2B8F A;  2K6A A;  4YY3 Q;  3H3V H;  2M9V A;  4IJH A;  1QCB D;  3I4N B;  2LY7 A;  5E4W C;  3DHQ A;  2Z6K C;  5E7N A;  4XXE A;  2KUM A;  5ELO A;  1GXD C;  2NTS A;  1C48 A;  2EJG C;  4DGZ A;  3SXH A;  3PIP 3;  1SE8 A;  1UEB A;  5I9P A;  1D1K A;  4X6A H;  1ESF A;  1NR4 A;  1XMO Q;  2BH8 A;  3GTM H;  2O2L D;  1HNZ Q;  1Y1V B;  3RZO B;  3VYT A;  4DUY L;  3VA7 A;  1QG7 A;  2FMM A;  3SE0 A;  2CHB D;  4C3H B;  1U4L A;  3DLL A;  3G71 A;  4DR4 Q;  1HH2 P;  1SNP A;  1YHA A;  1L1O A;  2JP1 A;  3PUV A;  1AN8 A;  4CDD C;  3AYH B;  4DV2 L;  4A3B G;  5M5X B;  4GN4 B;  3FVQ A;  1EUJ A;  1VQ4 A;  3JAM i;  4EGV A;  1N33 L;  1EWH A;  2PCF B;  1UE5 A;  1PH7 A;  1K9M C;  2J0T D;  4R4T A;  1EZ8 A;  1JT8 A;  2VB3 X;  1MSH A;  3ITP A;  5FLM H;  4WJ4 A;  3A74 A;  4JI0 Q;  3EIV A;  1E2Z A;  2K5Q A;  1ENC A;  2CKZ B;  2UUC L;  3GTP B;  5FOB B;  1EIG A;  1BNZ A;  3EFX D;  2XNA C;  3MA2 B;  1N34 Q;  5J39 A;  4YCU A;  5CGK A;  1TY0 A;  4R9W A;  2F1M A;  1MBY A;  1UNS A;  3UDG A;  3FPP A;  3LWU A;  3CCR A;  5GAH C;  1CKM A;  5D3D A;  1SJH D;  4EVO A;  2A6H C;  1RHP A;  2F0K A;  4L5S A;  1WTQ A;  3H0G B;  4DV6 Q;  2I5H A;  1ML0 D;  1X3Q A;  3P1H A;  1SLJ A;  4HMJ A;  2UXB Q;  3MHB A;  4RCO A;  3GQB A;  4A3C G;  3E0E A;  1L1O B;  1A6X A;  3R3O A;  2NVT H;  4M1U B;  1IKM A;  3W3A A;  1GHJ A;  4A3D G;  3OW7 A;  1LAB A;  1F2Y A;  1CA6 A;  1E22 A;  3KF8 B;  1L0W A;  3SGI A;  4A3G H;  1WCM H;  2BCO A;  4ULL A;  3STB D;  1EU3 A;  1NY4 A;  5CV5 A;  3CMA A;  3WDN A;  2JN4 A;  4LF4 Q;  2PQA A;  4DV1 L;  2CH4 W;  2PZW A;  1ZKO A;  2AQ2 B;  1BXT A;  1BBU A;  5GAD C;  3I55 A;  1CQV A;  1LO5 D;  1NE3 A;  1EY0 A;  2WB1 E;  3ICE A;  1YNN D;  4R1J A;  3UDF A;  4XTC S;  4YWK A;  5KEE A;  1E0B A;  4PZ8 A;  3MVV A;  1WTP A;  1B4O A;  1ZEQ X;  5DAU A;  2E75 C;  3IFD A;  3MC0 B;  1TR5 A;  2FJ2 A;  2K33 A;  5I6W A;  3NBH A;  3L3O C;  4IFD H;  2L12 A;  3CQZ B;  1EIF A;  1WTX A;  5COR A;  4MTN A;  1WD0 A;  3IRB A;  5AJ3 Q;  2F0V A;  1F77 A;  1YJN A;  2EYF A;  2KHJ A;  4PV1 C;  3JAM L;  2WAC A;  1TWC B;  3KJP A;  2NB0 A;  1Q3L A;  1G91 A;  1BCP C;  5IYD H;  1A3V A;  3T53 B;  1N34 L;  5FO9 B;  4JBK A;  2F4I A;  1AEX A;  4A3K B;  1F2Z A;  5KYI A;  2NVQ B;  4GNX C;  3IFT A;  2EYP A;  1Q90 A;  4LFA L;  3OW2 A;  4JI1 Q;  3RN2 A;  4Q0F A;  1JR0 D;  3LNN A;  3NEL A;  3OIP A;  3SHL A;  3TME A;  3F2D A;  1HQM C;  2R7D A;  1ENA A;  3NEN A;  1KLU D;  4H13 C;  3KLS A;  2P5Z X;  5C44 H;  3BZK A;  5KNB A;  3PO2 G;  2RCN A;  4A3E H;  3J7Y W;  4LF6 L;  1TWG H;  2L4N A;  3JC6 6;  1VQK A;  3EA6 A;  5IP7 G;  3L2P A;  1FJG Q;  1K8M A;  2R92 B;  1GUN A;  3G7L A;  1M1K C;  3F8T A;  1GOZ A;  1WD1 A;  1STE A;  2B63 B;  1BCP B;  3U4V A;  3I4N H;  1SAP A;  2R3Z A;  1WVL A;  1I94 Q;  4DV5 L;  1ASY A;  1YI2 A;  3S1Q B;  4OEM B;  3VYR A;  2UXC Q;  2Z6B A;  4MHE A;  1JCK B;  2R7F A;  4KKT A;  3X3N A;  1STY A;  1D5X C;  4P75 A;  5IP7 H;  2K50 A;  4AQY Q;  4WOR A;  3L7Z C;  3TN2 A;  3H0G H;  3PO3 B;  4JI5 Q;  3S14 H;  1KDB A;  3AB9 A;  1R4Q B;  1XNR L;  3HOY G;  5A2Q L;  5CV9 A;  4CJ1 B;  2D2C C;  1Z9F A;  1KDA A;  4A3K G;  4JBM A;  1VDZ A;  4DR7 L;  2GVA A;  4CKB A;  2JA7 B;  3OMG A;  1GD7 A;  3HKZ G;  1IXR A;  2KEE A;  3VR6 A;  2B2Y C;  2HIX A;  3I4M G;  4HED A;  4N8F A;  4JK1 C;  5JPM C;  2AMC B;  1G2T A;  1JWM D;  4DFA A;  2VY3 A;  5BR8 L;  5NUC A;  2QCP X;  3PGZ A;  1VQJ A;  1DOM A;  3D3R A;  1L0X B;  2JXM B;  1S3O A;  4QJF A;  2Q2U A;  1A0I A;  2NN6 G;  2G9H D;  4BY7 G;  5HUR A;  3NEM A;  3A56 A;  4LUO A;  1WTH A;  2F3I A;  3DWP A;  3HFZ B;  4DV1 Q;  4K2K A;  1CA5 A;  2N55 A;  5IYC G;  1PH5 A;  3KLS X;  2LSS A;  5JJK A;  3K5O A;  1SRO A;  1V1P B;  2PMZ E;  4NXN L;  1O78 A;  1HFN A;  3S16 B;  1JC7 A;  3HOV H;  2MPM A;  1RDP D;  4K14 A;  1KNA A;  1BBX C;  3I4N G;  2NZO A;  1TXY A;  1V1Q A;  3HKS A;  1P8L A;  2OT2 A;  1HNZ L;  5C44 G;  2NVQ H;  5LMN W;  3I56 A;  4K6D A;  2M00 A;  2B2Y A;  4A3F B;  4EX5 A;  1XJV A;  3UE1 A;  2UXD L;  3AMU A;  2G9D A;  5FJ8 G;  1JWS D;  1PA6 A;  2F3V A;  4RAU C;  1GUS A;  4GKJ Q;  1B9N A;  1H9J A;  2PQE A;  4LUV A;  5C44 B;  2D62 A;  3F2C A;  1EYG A;  3T1H L;  1EU4 A;  2I0Q A;  1K8G A;  5CC4 A;  4YWL A;  1IKL A;  1NCV A;  1FYC A;  1WOC A;  2PI2 E;  3NHH A;  3H15 A;  2JEB I;  3NTI A;  4HIM A;  3PV0 A;  4ZK9 B;  3H6M A;  3PMF A;  1VQ7 A;  1CUK A;  4A75 A;  1GUO A;  3J7A F;  2EY5 A;  4KV6 A;  3RZO H;  4K8I A;  1MJC A;  3K5L A;  3D4R A;  2RSN A;  4AQY L;  4X64 L;  3TEH B;  2F0D A;  1YJ9 A;  3G6E A;  1AZQ A;  4NKL A;  4OO1 H;  5E1F A;  1L1O C;  1U0L A;  1X3E A;  4DUY Q;  4FF2 A;  3K7A H;  5M3F G;  3M4O B;  3HZX A;  4H02 A;  2BDO A;  2OQK A;  1YNJ D;  2HQL A;  1VQD A;  3MFG A;  1IYJ B;  1LT3 D;  4F88 A;  4EQN A;  2Y0S B;  2F0T A;  1SRU A;  1SN8 A;  3F2U A;  4BA2 I;  4XYQ A;  3UE0 A;  3G6J B;  1A62 A;  4NB3 A;  2PQA B;  5IGD A;  3D4D A;  4PQX A;  2WB1 B;  4WRD A;  1E1O A;  2LMC B;  2K1B A;  3FPU B;  4A3L G;  1STG A;  1MJE A;  2HHH L;  4A3I B;  2IL8 A;  3WOF A;  1Y69 U;  3AEV A;  2F0P A;  5AFW A;  3MEF A;  3HOX H;  3GTJ H;  2UUA Q;  3Q23 A;  1SNO A;  2J4X A;  3PIP A;  4A3D H;  1M4V A;  2KBN A;  4X65 Q;  4QB4 A;  4LW1 A;  1LTL A;  2B63 H;  4DNT B;  2K5W A;  4K5V A;  1MSG A;  3RUZ A;  2RHS B;  1UE1 A;  1W2B A;  4N9P A;  2JJQ A;  3NP8 A;  1TWH H;  3CCJ A;  3PO2 H;  3CME A;  1AFP A;  1NBW A;  5JVH 3;  2FIN B;  4IUP A;  1RTN A;  3Q0A A;  4DV0 L;  4LNQ A;  1SEB D;  3K80 C;  4A3J B;  4V19 0;  3VR2 A;  3I4O A;  5G3L F;  3GTK B;  5JVG 3;  1A2T A;  1BUV T;  2Q8T A;  1A3T A;  3RZD H;  1S72 A;  4JI0 L;  3UDI A;  3DWQ A;  3TDQ A;  3TSS A;  4HJ9 A;  1X3P A;  1HCZ A;  2ENB A;  4POG A;  4YHH L;  3GTP H;  4LF8 L;  1MGS A;  1H9S A;  1K8A C;  1G2S A;  1X3F A;  1B53 A;  5IT9 E;  1Q7Y C;  4LF4 L;  2Y0S G;  3KBX A;  4DV2 Q;  2LFN A;  4I7A A;  3RN5 A;  3MEH A;  3CU7 A;  1XMQ Q;  2ATW A;  1BQQ T;  4RGT A;  3E5S A;  2R61 A;  4GS3 A;  2DUD A;  4ME3 A;  2NYZ D;  1OXV A;  4G57 A;  3O13 A;  5IT9 c;  1FD7 D;  3MXU A;  4G7Z C;  2QIL A;  1IL2 A;  1HXY D;  2MNA A;  3PF5 A;  2K4K A;  2IHF A;  1N9W A;  4P73 A;  4IPH A;  1I50 H;  1LLR D;  4IO9 A;  4KJO A;  1MI2 A;  4DUZ Q;  2VL6 A;  3K5M A;  4U68 A;  4BBS G;  2K75 A;  4DAM A;  2F0G A;  4FXG C;  4NXM Q;  2K5H A;  4KD4 A;  4JI4 L;  3CPW A;  1JOQ A;  2KCT A;  5C4Z A;  4QCL A;  5JEA G;  5FLX L;  2Z4H A;  5FK9 C;  1DON A;  4IPD A;  5BN5 A;  4HJ8 A;  1PTO B;  1WFQ A;  1IBL Q;  2E2J H;  3E9I A;  1JB3 A;  3NBH B;  3T4A C;  2AWO A;  2AUK A;  4RGO S;  1HNX Q;  1BCP D;  4C3H H;  1KHI A;  2K52 A;  3C3L A;  3NQI A;  1Q81 C;  3PIO 3;  1TWA B;  3ONA B;  3OMC A;  2UU9 L;  3BDL A;  1V9P A;  3TP6 A;  3S1M H;  2HIV A;  1GHK A;  3ERS X;  1YBY A;  1PRT B;  1JE5 A;  1JOO A;  1GJX A;  4K2L A;  1DM0 B;  4K8J A;  1RD9 D;  5FKA C;  5DM6 3;  5C0X H;  4A3I H;  3F1Z A;  1HUM A;  2B3G A;  2M2L A;  2MFI A;  2NUC A;  4RH6 A;  3H09 A;  4LK1 C;  1J6Q A;  2IJ0 A;  5GAE C;  2UUA L;  4KHZ A;  1GKH A;  1SMX A;  2PW5 A;  4JVZ A;  1PRT F;  1G6P A;  5K36 H;  5J1Z A;  4RGM A;  5LL6 S;  3AFP A;  3D4W A;  4IPC A;  2Q8I B;  2RVL A;  4DV4 L;  4A3B B;  3CC2 A;  4NPS A;  1JJ2 A;  2C9O A;  4KKS A;  3T51 B;  1IL8 A;  2QDL A;  3HOU B;  4UP8 A;  2OQ0 A;  3K57 A;  2KA7 A;  2F0E A;  3J81 L;  1LAC A;  3CC4 A;  1K83 B;  1NMG A;  2PI2 A;  1MHW C;  1Q1E A;  4P72 A;  1MD2 D;  3CCE A;  3MWY W;  4NXN Q;  5M5X H;  1PFS A;  5I9O A;  4IOC A;  5CR3 A;  2Z8L A;  3I4M B;  2V4D A;  4DR7 Q;  3Q22 A;  3EN2 A;  1EY9 A;  5T1G A;  1LTS D;  4OON A;  5KIX A;  3D8G A;  1TWH B;  3PO2 B;  4TRD A;  2MJ8 A;  1P16 A;  1PFB A;  2K04 A;  4GOP B;  1J9O A;  4RKB A;  4DAY B;  1RL2 A;  3D31 A;  4JI7 L;  4JI3 L;  4AH6 A;  2A69 C;  1STH A;  5HY6 A;  5IYB H;  4ZRZ A;  3SK6 A;  3R93 A;  1C0A A;  3S1Q H;  1DZ1 A;  1X3G A;  5M3F B;  3Q6S A;  1Q8K A;  4J1M A;  1PYW D;  4LF5 Q;  1VQE A;  3CKI B;  5BN4 A;  4IJL A;  3C46 A;  1B3Q A;  4DK3 C;  4F7X A;  2F0F A;  1CKN B;  2Z0S A;  5GRO A;  2YU9 H;  3VDY A;  4JI6 Q;  3W5O A;  4UY8 C;  5J3B A;  4LFB Q;  2JSO A;  5ELD A;  2RDF A;  2ZJP A;  1KD1 C;  4QGU A;  2Q2T A;  4PMB A;  1KAA A;  1SXT A;  1ILQ A;  1KIX A;  2EJF C;  4QQB X;  3UI2 A;  5IP9 H;  3C1F A;  4B3T Q;  1VQI A;  3M85 A;  1VS0 A;  4A3J H;  3R8B A;  2Q2I A;  1BVS A;  5D3I B;  5LL6 X;  3QJY A;  4A4I A;  1I4G A;  3CCQ A;  1PZJ D;  1M8A A;  5E3F A;  3DM1 A;  5I4D A;  3CP0 A;  4E6I A;  3TP8 A;  3B6Y A;  1LTI D;  4B9X A;  1SBB B;  4BA1 I;  4Y52 H;  1A8V A;  5EGT A;  2YV5 A;  4WJ3 M;  1Q86 C;  3PQI A;  4DXG A;  2VQE L;  4LF8 Q;  2A68 D;  1TKW B;  2E2D C;  2G5D A;  4B08 A;  5JEA J;  3GD7 A;  1EY5 A;  3FKI B;  4BY1 H;  5IGG A;  1PMR A;  1EYD A;  3J81 E;  2XWJ B;  1D6E C;  2H4O A;  3M4P A;  3S2H H;  3KUP A;  4LF7 Q;  1S5B D;  1MIU A;  3M9B A;  5IE8 A;  3OYY A;  2UUC Q;  4CBV A;  3V2T A;  1EFI D;  1D5M C;  2D0O A;  3LWE A;  4IUV A;  1PTO C;  4HMI A;  2B2W C;  2JA5 H;  1HR0 Q;  5ELB A;  3CCV A;  3GTQ B;  4JI3 Q;  2NN6 I;  2VQE Q;  3QR8 A;  1NAP A;  4DF7 A;  1QZG A;  3GTQ H;  4A3E G;  1NMF A;  1YIJ A;  2UXD Q;  1KC8 C;  1K73 C;  4FF1 A;  4J15 A;  2I46 A;  1SE3 A;  2E8G A;  1B2T A;  1I3Q H;  2TSS A;  4DR3 Q;  4LFC Q;  3GTL B;  4LFC L;  4A3C H;  4PNY A;  1ZXT A;  1NNX A;  3CRK C;  4EQO A;  5CV8 A;  3KLW A;  4GZY C;  2NZ1 D;  2EYM A;  1BO0 A;  2ZXO A;  2MHV A;  2DJF C;  2CVR A;  3DWA A;  4C3I B;  3K59 A;  4YHH Q;  2ZJQ A;  4H7B A;  5C0X I;  4IN3 A;  1LTB D;  1PTO H;  2MO0 A;  1OXT A;  2IX1 A;  1DD2 A;  1F9P A;  1HUN A;  3I73 A;  3URY A;  3S16 H;  4IUN A;  3E3X A;  1D5Z C;  2B2W A;  2VS1 A;  2SNS A;  5JEA H;  1Z6H A;  4IUR A;  2AWN A;  4U67 3;  1SNC A;  1E1T A;  4OWX B;  2QKI C;  4DXF A;  1H95 A;  4LAA A;  2F4V L;  3KF8 A;  3RLF A;  2Z1C A;  1QB5 D;  1T5X D;  3M3Y B;  4JI7 Q;  2L11 A;  4TQU S;  2AKW B;  3S17 B;  1DOK A;  4FVM A;  4OIJ A;  2WIN B;  4V0B A;  2F0M A;  1KDC A;  2QEJ C;  4JBW A;  1HRJ A;  1N36 L;  5LMN L;  1CM9 A;  4DR6 Q;  2D9U A;  2EPB A;  1B9M A;  3S2H B;  1YIT A;  4UDU C;  1YJW A;  4RGN A;  1SYF A;  1PH9 A;  2BH2 A;  3FMC A;  1RTO A;  5F2D A;  1VQM A;  3HOU G;  1EQQ A;  2EDG A;  2KEC A;  4FNF A;  1YNX A;  1SFO H;  2R92 G;  3BDO A;  2KED A;  3CD6 A;  3CCL A;  5IGB A;  1B3A A;  1LV9 A;  3A0J A;  3N6R A;  2A5H A;  4A3L H;  1BBW A;  2EXD A;  1U4R A;  3TS2 A;  2NVY H;  1VQC A;  1PYB A;  4LF9 Q;  4C56 C;  1QE6 A;  1DGS A;  2WAQ G;  1IHZ A;  3DM3 A;  2RKS A;  3I4M H;  4N9T A;  1O80 A;  2ZM6 L;  2CQO A;  4C2M B;  3MXG A;  3NTK A;  3HOU H;  3HOV B;  1T9H A;  3R2I A;  2BE5 C;  1VF7 A;  2A1A A;  3K58 A;  2IY5 B;  3NK9 A;  4CJ0 B;  1PTO D;  4QIW E;  1FVI A;  2RBM A;  2QDB A;  5CYU A;  1AE3 A;  2Q2H A;  2C5C A;  1EEF D;  3NWT A;  3I91 A;  4DK6 C;  4ILW A;  1PH3 A;  4AYB E;  2N8N A;  2F0I A;  4QY7 A;  2VQF L;  4DR6 L;  2A19 A;  1YZ6 A;  3S9W A;  5G3L D;  5M5Y H;  1B44 D;  3KLR A;  3MXN A;  2R7Z B;  1ICF B;  2K5V A;  1CTM A;  1AE2 A;  2DN8 A;  4DNI A;  5EJW A;  1VCI A;  2N49 A;  4ZKC B;  1BF4 A;  2CW0 C;  3PSI A;  4JI8 Q;  3ULJ A;  2IX3 A;  4LMQ D;  3J80 L;  2E2J B;  1FNW A;  1YEZ A;  3NXW A;  3BVZ A;  1VQF A;  4L6T B;  1VQ6 A;  1XTD A;  4L5Q A;  1LT5 D;  3GTJ B;  2QF7 A;  4MIU A;  2ZM6 Q;  1SDF A;  5IP9 G;  1DYQ A;  3H3V C;  3PF4 A;  3SR1 A;  4HTH A;  1WCM G;  4R8I A;  1TWF B;  2OWO A;  1IW7 D;  2VUM G;  2WAQ E;  3NPP A;  4B3M Q;  4HID A;  3MFY A;  1VQP A;  2YTV A;  3CPF A;  1Y8N B;  3HOW B;  3U9O A;  4JI8 L;  4DAY A;  4G7O C;  2NZH A;  5FLX c;  2DJG C;  4LFB L;  2Z4I A;  4X3U A;  2UU9 Q;  4K5X A;  4KTA A;  4OIK A;  1V1O A;  1T5E A;  2B2T C;  2KCN A;  5EKK A;  1CSQ A;  1X56 A;  3MAQ A;  2NN6 H;  1S4Z A;  1K83 H;  4UP9 A;  2ALY B;  2JA6 H;  4JBJ A;  2AHO B;  1EWI A;  3HKZ B;  3EVQ A;  1XNR Q;  1K8O A;  1H9M A;  4GN3 B;  1MKH A;  3CRL C;  3S1R H;  2ZXR A;  5HGQ A;  2RDG A;  4IUQ A;  3S2D H;  2A73 B;  3H94 A;  3PO3 G;  2YU9 B;  3E6Z X;  5L37 A;  3RLO A;  3I8Z A;  2F0O A;  2XRS D;  2EOT A;  1JWU D;  2ZJR A;  4KN7 C;  3J7Z C;  1SSO A;  1X65 A;  2DGY A;  4X3T A;  4XYO A;  2SDF A;  1ESR A;  4DR5 L;  3BYY B;  2BE5 D;  1Z47 A;  2K7V A;  4RHS A;  1CFM A;  4DR3 L;  4F87 A;  3A5Z B;  3ERQ A;  2WII B;  5ELN A;  4A3M H;  4OWW B;  5M5W H;  5JJZ A;  4A93 H;  2F0H A;  1S5D D;  2AQ1 B;  4OEL B;  2KEN A;  2O4X A;  1AP0 A;  1TWA H;  1LTT D;  1G6Z A;  1NJI C;  5GQO A;  3J81 c;  4GOP A;  3HOW G;  2JA9 A;  5CV7 A;  3S17 H;  3PUX A;  1RJT A;  2L0C A;  3PUW A;  4TVA B;  1SYG A;  1X9N A;  4MTK A;  1F9S A;  1E24 A;  1J5E L;  5KYL A;  1VMC A;  4C3J G;  2E5L L;  3OTO L;  1CHQ D;  5C3E H;  2XWB B;  2RF4 A;  1LTG D;  3W2D A;  5M5Y B;  1NR2 A;  3L0O A;  4LF7 L;  3OWF A;  4L5R C;  3LX0 A;  3M7G A;  4KY6 A;  4R4Q A;  1X55 A;  4HIK A;  5T1I A;  3MXN B;  2F3W A;  2VZA A;  3KK7 A;  3P20 A;  3T13 A;  4DKA C;  5JPN C;  3D6W A;  1L0Y B;  1ZYR C;  3M7N A;  3S1M B;  1F9Q A;  2E2H B;  4K0K Q;  2EYJ A;  5JJL A;  3Q8D A;  1HR0 L;  4RKL A;  2F4V Q;  3K7A B;  3M4O H;  4Z9C B;  4UAI A;  4IUU A;  4ZLT F;  5CBE E;  2A6E C;  1PRT C;  1Y8P B;  1F2M A;  5JJI A;  1HFG A;  1XXG A;  4GLA C;  4WFN 3;  2L55 A;  2HQE A;  1KRS A;  5EKL A;  4P74 A;  2ICI A;  2OTL A;  4BXX G;  5K36 G;  1WTR A;  3GP7 A;  3HOZ H;  1M90 C;  1GVP A;  5C4X G;  1BR9 A;  1H9S B;  4K6L A;  4K0K L;  2RQX A;  4ZYS A;  5C3E B;  5IYC H;  2NVX H;  1CZG A;  1C9O A;  1YNJ C;  4KKU A;  1HZA A;  3UDX A;  2D5D A;  4DUZ L;  3W1G A;  4QMG A;  1TS2 A;  2KCC A;  1OO9 B;  1SFO B;  3GV6 A;  3JAM c;  4DR4 L;  1EIY B;  5CV6 A;  4X3S A;  4GNX A;  4PMW A;  2J7Z A;  3TQY A;  1ASZ A;  4CKC A;  5CMD A;  5FO7 B;  1PH4 A;  1OXX K;  2YTX A;  4KD3 A;  3SEB A;  3L9A X;  1Y8O B;  3WWV A;  4ZKB B;  4A3E B;  3P75 A;  2B63 G;  4BXX H;  1PYS B;  1Y1W B;  5I6Y A;  4DV4 Q;  1U9R A;  1EQR A;  1VQB A;  4QUC A;  5C4J B;  1EQT A;  2N88 A;  1EWC A;  5IYD G;  2R7Z G;  3BS1 A;  1GUT A;  1Q46 A;  2K01 A;  1R9T B;  1IBK L;  4KMU C;  1XNQ Q;  2F0W A;  4RFB A;  1EOT A;  2B2U C;  3AFQ A;  1CK1 A;  4LF5 L;  4GLX A;  2VUM H;  2EY6 A;  4BY1 G;  1VF5 C;  3X3M A;  3VR3 A;  1HNW L;  3D6C A;  1I4P A;  1FNV A;  5FLX E;  1LT4 D;  2CWP A;  4XQN A;  4NP5 A;  4ZAI A;  1PH6 A;  3OOC A;  1HTP A;  4DV7 Q;  2A68 C;  4C1N I;  1KL9 A;  4OO1 G;  4IFD G;  4O1N A;  1D7Q A;  2EXZ A;  1BKB A;  1XX8 A;  4PG3 A;  1VQ5 A;  1VQA A;  3KDF A;  1XPR A;  2K05 A;  2PNH A;  1E2W A;  2D0P A;  4P71 A;  1PRT D;  2XGT A;  2EY1 A;  4OX9 L;  4UPA A;  1LYL A;  1R4P B;  2OXP A;  2XVS A; 
#chains in the Genus database with same CATH homology
 3M4P A;  5C44 H;  3BZK A;  3PUY A;  4OWT B;  1OXS C;  3S2H H;  3PO2 G;  2RCN A;  5AJ3 L;  4A3E H;  4LF6 L;  1TWG H;  3JC6 6;  1VQK A;  2Y0S E;  5IP7 G;  3GO5 A;  3L2P A;  4LF7 Q;  1FJG Q;  1FJG L;  1MIU A;  1B70 B;  3M9B A;  3KFU A;  1Y1W G;  5IE8 A;  1M1K C;  1AH9 A;  3F8T A;  3PO3 H;  4GKK Q;  1HNW Q;  3OYY A;  2UUC Q;  5IY0 A;  4A3M G;  3FP9 A;  2D0O A;  3U4V A;  2JA8 G;  4DV7 L;  2YYZ A;  3FKI G;  3G48 A;  2RHQ B;  1I94 Q;  5M3F H;  4R4I A;  4DV5 L;  1C7Y A;  1ASY A;  1YI2 A;  4A3B H;  2JA5 H;  1HR0 Q;  2UXC Q;  3CCV A;  3GTO H;  4JI3 Q;  2NN6 I;  2VQE Q;  2JA7 G;  4RMF A;  4LWC A;  2R7F A;  4B3R L;  1N8R C;  1QZG A;  3GTQ H;  4A3E G;  1NMF A;  1Q1B A;  1YIJ A;  2UXD Q;  1KC8 C;  1K73 C;  3F2B A;  4P75 A;  5IP7 H;  3TRZ A;  2K50 A;  4AQY Q;  4A3J G;  3L7Z C;  3H0G H;  4J15 A;  4JI5 Q;  2FXQ A;  1N36 Q;  3S14 H;  4BBR G;  2KHI A;  4LF6 Q;  1HZ9 A;  1X6O A;  2E8G A;  1S40 A;  4A93 G;  1I3Q H;  4DR3 Q;  4LFC Q;  3T1Y Q;  4LFC L;  4A3C H;  1XNR L;  3HOY G;  3CAM A;  1Z9F A;  4GKK L;  2JA6 G;  4A3K G;  4JBM A;  4DR7 L;  2GVA A;  3S24 A;  2ZTD A;  1GD7 A;  3HKZ G;  1IXR A;  3J81 i;  2OTJ A;  2HIX A;  3I4M G;  3J81 j;  4JI6 L;  5FJ8 H;  3KLW A;  1Y1W H;  2AMC B;  3PCO B;  4EQ5 A;  2VY3 A;  5BR8 L;  5IYB G;  1VQG A;  3PGZ A;  1Q82 C;  1VQJ A;  3W1B A;  3KDF B;  2VNU D;  4YHH Q;  3CC7 A;  2ZJQ A;  1S3O A;  2F52 A;  4BBR H;  1X54 A;  1TWC H;  1A0I A;  2NN6 G;  4QJF A;  2Q2U A;  4MZ9 A;  4B3T L;  1E7Z A;  4BY7 G;  5C0X I;  4Y7N H;  3BZC A;  3NEM A;  1Y1V G;  4LUO A;  2MO0 A;  1OXT A;  4QL5 A;  2F3I A;  3HFZ B;  3OTO Q;  4JOI C;  2Z6K A;  4DV1 Q;  2IX1 A;  4DV0 Q;  5IYC G;  1IZ6 A;  1PH5 A;  3T1H Q;  2LSS A;  4AYB G;  3S16 H;  2QEX A;  3H3V I;  5JJK A;  1PH1 A;  1SRO A;  2PMZ E;  1D8L A;  1HZB A;  4NXN L;  2VS1 A;  3K8A A;  4OO1 I;  3PUZ A;  4JV5 Q;  3HOV H;  1KQS A;  3ER0 A;  4PZ6 A;  2AWN A;  3E9H A;  4JC0 A;  1XPU A;  3ULP A;  4A76 A;  4B3S L;  1KXL A;  1RIP A;  3FKI H;  1E1T A;  4B3S Q;  4OWX B;  3I4N G;  2NZO A;  1TXY A;  4B3M L;  1V1Q A;  3HKS A;  1P8L A;  4YCV A;  1HNZ L;  1H95 A;  1PV4 A;  5C44 G;  3RNU A;  2F4V L;  2WFW A;  4R4O A;  3RLF A;  2NVQ H;  3RLN A;  3I56 A;  1Y1V H;  5LMN W;  4JYA L;  1HR0 W;  1UE6 A;  3TRE A;  1PVO A;  4JI7 Q;  1XJV A;  4EX5 A;  3UE1 A;  3AQQ A;  4TQU S;  1XPO A;  4HJ7 A;  3S1N H;  4KHP L;  2AKW B;  3RR5 A;  1IBK Q;  1FGU A;  3CXC A;  2UXD L;  3STB C;  5FJ8 G;  3S15 H;  1PA6 A;  2IX0 A;  1N32 Q;  4JBW A;  4GKJ Q;  4JI4 Q;  1N36 L;  5LMN L;  1KRT A;  4NXM L;  3GTL H;  4DR6 Q;  2CCZ A;  4LUV A;  3TS0 A;  2D62 A;  2ZTC A;  3F2C A;  1YIT A;  1YJW A;  4JCV E;  3T1H L;  1EYG A;  4BY7 H;  3I2Z A;  2UXB L;  1WJJ A;  2I0Q A;  4JOI A;  4GLV B;  3T1Y L;  1K8G A;  1QUQ A;  3BU2 A;  1PH9 A;  4A3I G;  3G4S A;  4YWL A;  2BH2 A;  4APV A;  1VQM A;  2CWA A;  3M3Y H;  3HOU G;  1FL0 A;  4X65 L;  1WOC A;  3CF5 A;  1EQQ A;  2PI2 E;  3H15 A;  3H0G G;  2JEB I;  4UP7 A;  1I94 L;  4HIM A;  1YNX A;  3PV0 A;  2EIF A;  1SFO H;  2R92 G;  3PIO A;  2MO1 A;  3CD6 A;  3CCL A;  1VQ7 A;  3A0J A;  1CUK A;  4A75 A;  1VQN A;  2B29 A;  2K5N A;  5C4J H;  4KHP Q;  1Q12 A;  4DR2 L;  4A3L H;  1BBW A;  3HOY H;  2EXD A;  3TS2 A;  2NVY H;  1VQC A;  1PYB A;  2XTI A;  1PH8 A;  1QVG A;  3RZO H;  4LF9 Q;  1MJC A;  1E3P A;  1DGS A;  2WAQ G;  4X64 L;  4AQY L;  3DM3 A;  3I4M H;  2WP8 J;  2ZM6 L;  2BA0 A;  2CQO A;  3TEH B;  1SR3 A;  2IHE A;  4POF A;  1YJ9 A;  3HOU H;  3G6E A;  1O7I A;  1HZC A;  4GOP C;  2ZTE A;  1T9H A;  3U50 C;  2HHH Q;  4DR1 L;  5IWA Q;  4X62 L;  2A1A A;  5IWA L;  4X62 Q;  2IY5 B;  1L1O C;  1U0L A;  1X3E A;  4QIW E;  3KYH C;  5GAG C;  1FVI A;  4DUY Q;  1HNX L;  3K7A H;  5M3F G;  2V1C C;  1KAW A;  4H02 A;  3J7A 5;  3K0X A;  4A3F H;  1AE3 A;  3HOX G;  2OQK A;  2ES2 A;  5M3M H;  1I6H H;  2HQL A;  2Q2H A;  1VQD A;  3FHW A;  1YVC A;  1VQ9 A;  1IYJ B;  2CFM A;  1CKN A;  2MQH A;  2I5M X;  4DK6 C;  1IBM Q;  2OCE A;  1N32 L;  1EOV A;  1SN8 A;  1SRU A;  2R92 H;  4BA2 I;  3UE0 A;  1OTC A;  4DR5 Q;  1A62 A;  4NB3 A;  2PQA B;  4AYB E;  1PH3 A;  1K0R A;  2N8N A;  1GM5 A;  1E1O A;  2IT1 A;  4QY7 A;  2VQF L;  2JA8 H;  4DR6 L;  4A3L G;  2A19 A;  4DR1 Q;  1YZ6 A;  5C4X H;  1MJE A;  1N33 Q;  4MNO A;  2HHH L;  5M5Y H;  3AEV A;  2R93 H;  3MEF A;  3HOX H;  2K5V A;  3GTJ H;  5M3M G;  1AE2 A;  2UUA Q;  3CQZ H;  3PIP A;  4A3D H;  4IFD J;  1CSP A;  2LXJ A;  2N3S A;  4DNI A;  1R9T H;  1VCI A;  1JMC A;  4RG1 A;  2KBN A;  1OXU A;  2N49 A;  4X65 Q;  4LW1 A;  1LTL A;  2B63 H;  4DV5 Q;  1HJP A;  3GTG H;  4JI1 L;  5BR8 Q;  2RHS B;  3PSI A;  4JI8 Q;  3ULJ A;  5LMU L;  1UE1 A;  5LMU Q;  1YEZ A;  4BBS H;  1W2B A;  1IBM L;  1VQF A;  2JJQ A;  1VQ6 A;  1XTD A;  4L5Q A;  1TWH H;  3I7F A;  3CCJ A;  3CME A;  3PO2 H;  2R7Z H;  1NBW A;  4GKJ L;  3BJU A;  2K14 A;  4DV0 L;  5EAY A;  2ZM6 Q;  2C35 B;  4LNQ A;  3K80 C;  2H5X A;  4JI2 Q;  4DPG A;  5IP9 G;  4HIO A;  3PF4 A;  3S2D H;  1WCM G;  3I4O A;  3GDE A;  1QZH A;  4JV5 L;  3HOV G;  2OWO A;  1A63 A;  2GN5 A;  2VUM G;  1CKO A;  3CCM A;  2WAQ E;  3RZD H;  4IOA A;  1L2F A;  1S72 A;  4B3M Q;  4HID A;  4JI0 L;  1VQP A;  3CPF A;  2YTV A;  3UDI A;  4FDB A;  5C0X G;  4JI8 L;  2NZH A;  4ALP A;  4HJ9 A;  3I4N H;  1QVF A;  1Y14 B;  5FLX c;  1JJG A;  4LFB L;  4POG A;  1JJC B;  2UU9 Q;  4YHH L;  1QUQ B;  3GTP H;  4LF8 L;  2QGQ A;  1K8A C;  1X3F A;  4DV3 Q;  1Q7Y C;  2LXK A;  2E2H H;  4LF4 L;  2Y0S G;  4DV2 Q;  1CSQ A;  1X56 A;  3CCU A;  3LGJ A;  4C3J H;  3RN5 A;  1K83 H;  4JI5 L;  1XMQ Q;  2ATW A;  1UWV A;  4PZ7 A;  4UP9 A;  2ALY B;  4KLK A;  5DLQ E;  4JBJ A;  2AHO B;  4AIM A;  3J80 c;  2JA6 H;  4GS3 A;  1EWI A;  2DUD A;  2JE6 I;  4ME3 A;  3CCS A;  1OXV A;  1XMO L;  4R4C A;  2JEA I;  5IT9 c;  1XNR Q;  1IL2 A;  4GN5 A;  2MNA A;  4GN3 B;  3PF5 A;  2K4K A;  1MKH A;  2IHF A;  1N9W A;  5HGQ A;  3S1R H;  4P73 A;  4IPH A;  1I50 H;  4HJA A;  1WYD A;  1IBL L;  4IO9 A;  3PO3 G;  4JYA Q;  3ZJY C;  2QA4 A;  4YY3 Q;  3H3V H;  3RLO A;  4DUZ Q;  2VL6 A;  4IJH A;  3U58 A;  4BBS G;  2E2I H;  2K75 A;  2Z6K C;  5E7N A;  4DAM A;  4DV3 L;  2ZJR A;  5ELO A;  3J7Z C;  1X65 A;  2DGY A;  1GO3 E;  3HOW H;  4NXM Q;  2K5H A;  2VQF Q;  4JI4 L;  3CPW A;  2I5L X;  2JQO A;  2A8V A;  4DR5 L;  1SE8 A;  2KCT A;  3GTK H;  1UEB A;  1Z47 A;  5JEA G;  4DR3 L;  1B7Y B;  4DV6 L;  4X6A H;  3A5Z B;  4LUZ A;  5ELN A;  4A3M H;  1XMO Q;  4A3G G;  2BH8 A;  3GTM H;  4IPD A;  4OWW B;  5C0X J;  4HJ8 A;  5M5W H;  2L15 A;  1WFQ A;  1IBL Q;  2E2J H;  4A93 H;  3KF6 A;  4KI0 A;  3ULL A;  3E9I A;  1HNZ Q;  2HT1 A;  3KOJ A;  2KEN A;  3NBH B;  2AWO A;  4DUY L;  1HNX Q;  1LM0 A;  1KHI A;  1TWA H;  2K52 A;  4C3H H;  4A3K H;  1NJI C;  5GQO A;  3J81 c;  1Q81 C;  4GOP A;  3HOW G;  2JA9 A;  3K81 C;  3S17 H;  3PUX A;  3DLL A;  2UU9 L;  3PUW A;  3G71 A;  1V9P A;  4DR4 Q;  1HH2 P;  4TVA B;  3KF6 B;  1X9N A;  2UUB Q;  1VQO A;  4IFD I;  3S1M H;  1PHJ A;  2WB1 G;  1YHA A;  1E24 A;  1L1O A;  1J5E L;  2HIV A;  3ERS X;  1YBY A;  1TWF H;  3PUV A;  3AYH B;  4DV2 L;  1WI5 A;  3HKZ E;  4YWM A;  1JE5 A;  1V43 A;  2E5L Q;  4A3B G;  2E5L L;  4GN4 B;  3OTO L;  3U4Z A;  1EUJ A;  1VQ4 A;  5C3E H;  3JAM i;  2RF4 A;  1N33 L;  4A3I H;  1UE5 A;  3F1Z A;  1PH7 A;  1K9M C;  3L0O A;  4R4T A;  4LF7 L;  2B3G A;  2MFI A;  1YHQ A;  4L5R C;  3K7U C;  2R93 G;  4R4Q A;  1X55 A;  4HIK A;  1JT8 A;  1J6Q A;  5GAE C;  3MXN B;  2UUA L;  2VZA A;  5FLM H;  4KHZ A;  4WJ4 A;  3A74 A;  1GKH A;  1SMX A;  4JI0 Q;  3EIV A;  4DKA C;  2UUC L;  2CKZ B;  1G6P A;  3M7N A;  3AFP A;  1LUZ A;  4K0K Q;  1N34 Q;  4IPC A;  2BA1 A;  5JJL A;  3Q8D A;  1HR0 L;  1K3R A;  4YCU A;  4DV4 L;  2F4V Q;  3M4O H;  3CC2 A;  4NPS A;  1JJ2 A;  4YCW A;  2ASB A;  3UDG A;  4B3R Q;  4OX9 Q;  5JJI A;  3CCR A;  5GAH C;  2ID0 A;  1CKM A;  1B8A A;  4LF9 L;  1UE7 A;  2R6G A;  4GLA C;  4L5S A;  1XMQ L;  5LMN Q;  4C2M H;  4UP8 A;  2OQ0 A;  3J80 i;  1KRS A;  1W3S A;  4P74 A;  2OTL A;  4DV6 Q;  2I5H A;  4BXX G;  5K36 G;  3CC4 A;  1NMG A;  1SLJ A;  2UXB Q;  2PI2 A;  4X66 L;  1Q1E A;  3HOZ H;  1M90 C;  4P72 A;  1GVP A;  4A3C G;  3CCE A;  5C4X G;  3E0E A;  4NXN Q;  5M5X H;  1PFS A;  1L1O B;  4IOC A;  4K0K L;  3EBE A;  4DR7 Q;  2YTY A;  3EN2 A;  2NVT H;  1NTG A;  4OON A;  5IYC H;  4O2D A;  2NVX H;  1P16 A;  4GOP B;  4A3D G;  1C9O A;  1HZA A;  2KCM A;  3UDX A;  4DAY B;  1RL2 A;  3D31 A;  3W1G A;  3A5U A;  4DUZ L;  1PH2 A;  1E22 A;  3KF8 B;  4YY3 L;  4JI7 L;  4JI3 L;  4AH6 A;  2UUB L;  5IYB H;  5HY6 A;  1L0W A;  3SGI A;  3JAM c;  4DR4 L;  4A3G H;  1WCM H;  1EIY B;  3STB D;  4GNX A;  4PMW A;  1XNQ L;  1NY4 A;  3TQY A;  3CMA A;  1C0A A;  1ASZ A;  3S1Q H;  1JB7 A;  1X3G A;  4LF4 Q;  2PQA A;  1Q8K A;  4DV1 L;  4L5T A;  4OXP A;  4O0A A;  1QVC A;  4X64 Q;  1PH4 A;  4LF5 Q;  1OXX K;  1VQE A;  1BBU A;  4IPG A;  2YTX A;  2VW9 A;  4IJL A;  5GAD C;  4DK3 C;  3I55 A;  1CKN B;  1G29 1;  3WWV A;  5FLM G;  1VQ8 A;  1NE3 A;  2WB1 E;  4X66 Q;  2B63 G;  4C3I H;  2Z0S A;  4R1J A;  3UDF A;  4JG2 A;  5GRO A;  2YU9 H;  4XTC S;  4YWK A;  3VDY A;  4BXX H;  4JI6 Q;  1PYS B;  2EQS A;  3W5O A;  4PZ8 A;  4UY8 C;  4DV4 Q;  1VQB A;  1EQR A;  5J3B A;  4LFB Q;  2UXC L;  2ZJP A;  1KD1 C;  5IYD G;  4QGU A;  4DR2 Q;  2Q2T A;  2R7Z G;  1Q46 A;  1KIX A;  1IBK L;  4QQB X;  2JA7 H;  1J5E Q;  5IP9 H;  1XNQ Q;  4B3T Q;  1VQI A;  3M85 A;  1VS0 A;  4A3J H;  2Q2I A;  1EIF A;  1BVS A;  4MTN A;  3AFQ A;  4LF5 L;  3IRB A;  4A4I A;  5AJ3 Q;  4GLX A;  3CCQ A;  1YJN A;  2VUM H;  4JI2 L;  1EFW A;  4BY1 G;  1YHB A;  2KHJ A;  4GNX B;  1U5K A;  1HNW L;  3KJP A;  2JK8 A;  3CP0 A;  2GVB A;  5IYD H;  2CWP A;  4A3F G;  3D0F A;  1N34 L;  3B6Y A;  1PH6 A;  4JBK A;  1I5F A;  4DV7 Q;  4BA1 I;  4GNX C;  1VQL A;  1VQH A;  1A8V A;  4LFA Q;  4Y52 H;  3KJO A;  4LFA L;  2YV5 A;  1KL9 A;  1Q86 C;  3OW2 A;  4OO1 G;  4IFD G;  4JI1 Q;  4HJ5 A;  4WJ3 M;  1D7Q A;  1BKB A;  3M4Q A;  4PG3 A;  2VQE L;  3RN2 A;  1VQ5 A;  4LF8 Q;  1VQA A;  4XIG S;  3KDF A;  3HOZ G;  3CW2 C;  5JEA J;  3NEL A;  1XPR A;  2PNH A;  3GD7 A;  1G51 A;  3F2D A;  2D0P A;  4P71 A;  2JA5 G;  4BY1 H;  2XGT A;  4OX9 L;  4UPA A;  2R7D A;  1LYL A;  3NEN A;  5H1S E;  2N78 A;  5C3E G;  3ICE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...