4DVGA

Crystal structure of e. histolytica formin1 bound to ehrho1-gtpgammas
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
164
structure length
164
Chain Sequence
LKIVVVGDGAVGKTCLLLAFSKGEIPTAYVPTVFENFSHVMKYKNEEFILHLWDTAGQEEYDRLRPLSYADSDVVLLCFAVNNRTSFDNISTKWEPEIKHYIDTAKTVLVGLKVDLRKDGSDDVTKQEGDDLCQKLGCVAYIEASSVAKIGLNEVFEKSVDCIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gtp binding/actin binding proteins
molecule keywords Rho-like small GTPase
publication title Entamoeba histolytica Rho1 Regulates Actin Polymerization through a Divergent, Diaphanous-Related Formin.
pubmed doi rcsb
source organism Entamoeba histolytica
total genus 51
structure length 164
sequence length 164
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2012-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dvgA00
5EZ6B 2XNSA 4WZBE 5BN3A 3FKSD 3HP1A 3Q7QA 4C7OB 2IYVA 3SBEA 1IOZA 1MO5A 2OEPA 1AQYA 3W6OA 3NXSA 2OFWA 4BFZA 3LX8A 2GJ9A 2GJAA 1NN3A 1CS4C 1NI3A 1FMJA 2ZTSA 5AWFC 1OKKA 2C77A 4EQ6B 3EPJA 2IYQA 2F9MA 1XFAA 2AX4A 3T1QA 1U8YA 5GJCA 3EC1A 4Q02A 2GCPA 1IXZA 1XMVA 2HF8A 3UMRA 2FWRA 1YZNA 4FWIB 2NO1A 2QGNA 1FTSA 3K0CA 4TT3A 4M1KA 1NY5A 3LBNA 5GJVC 3REGA 3X1YA 4LGMA 3P26A 2QAGB 4OHVA 1PVOA 4Q7MB 2ZE6A 3AM1A 3FPAA 3O8RA 4ASUD 3U7EB 2BEJA 2F1JA 4DT1B 4NCIA 1YR6A 4D2IA 1P4SA 4C0BA 4XH9B 1NN1A 3GJ5A 2PT5A 2I1QA 1XX6A 2QP9X 2ONJA 4NHOA 2X1VA 5DI9A 4HI0E 3ICEA 5EXPA 3TNFA 1NVXQ 1KDPA 1ZU4A 1YHNA 4EIWA 4B3XA 2G3YA 2C78A 5SZKB 2CL6X 3JVUA 1HQCA 1SXJA 1Z47A 3VU9B 3K9HA 5KDDA 4U7DA 1E2HA 4KO8A 3GLIB 1SHKA 1UFQA 2WSMA 2V7QD 2HV8A 1G291 3GFOA 3THXB 2FSHA 2YKGA 2O52A 3X1WA 5CIQA 3RNLA 5B30A 2VO1A 3DMNA 2A5FA 4ABYA 4DUGD 3PIRA 2WJVA 1CR2A 2YVUA 3H0KA 1DOAA 5EZ5A 4RFSB 1ZM7A 3K70D 1CR1A 3OEHA 1Q57A 2J1LA 1DEKA 2C2HA 1XMIA 2I4IA 2EFGA 3CBQA 1E6CA 2KBEA 4IDHA 3DMDA 1T5LA 2OLJA 3U61B 1VG1A 4YMTA 1PV4A 1RRPA 2VP0A 4Q9HA 1VCIA 1OW3B 1G4AE 1CR0A 1OKKD 2OCBA 2D62A 4PC1A 4TMWA 2JJ1A 1NSTA 4CEHA 2QT1A 4XJXA 2AFHE 1CKEA 1COWA 1LS1A 1TF5A 4JVSB 4LV5B 4RFVA 4TMXA 1SKYE 1HT2E 1JQLB 3KXLA 1N6KA 1XCGB 2Y8EA 3C5CA 4M2LA 4K46A 1TAGA 5FR1A 2DBYA 4CT5A 4TT3D 1M7GA 4NTZA 5EE0A 4LJYA 1NBMA 1E2NA 3TIFA 4R98A 4V0LA 3RS7A 3MWLA 1IHUA 2ZSAA 3NTUA 4ZKDA 1RJ9B 1IN6A 4AI6A 2GCOB 2OO7A 2E87A 2FFBA 4UNNA 1JR6A 3KTAB 1XPOA 4N1AA 4TMTA 4KU4A 2ZYUX 3ZIAA 2AKYA 3TVDA 1NVVQ 4HLCA 1WA5A 3TSZA 3WYAA 4AC9A 2IXFA 4GNKA 2D4HA 4F92B 4RKFA 4JSTA 2V54A 3ADBA 3VAAA 4E03A 1V5WA 3MSXA 4RCZA 2KJQA 5TV2A 1G3MA 4Q1FA 5IT5A 5KPDA 2GCNA 3HU3A 5ANRB 1NJGA 3LQQA 1AKYA 1BO6A 1GWNA 1UBEA 2PMDA 2FE4A 2H8KA 4AG5A 3CKLA 4D0GA 5EE1A 2PJRA 5K8UA 1KZGB 3CH4B 4LJAA 1XEXB 4JS0A 4YONB 1NLZA 1Q12A 3PV0A 2QBYA 1S9HA 4GI7A 1P60A 4D0NA 3HR7A 4JBWA 1WE2A 2FSIA 4MRVA 2W6IA 5JHGB 1QHIA 4FXPA 3SU8A 2GWHA 1OIWA 4ZCMA 2AD1A 1YRAA 5L3QB 1D8TA 4A92A 2J3EA 4Z1MA 4M1TA 1N5IA 4PO1A 1P9WA 4ESHA 4NPHA 1ZAKA 2HXYA 3IBGA 1BMFA 3OEHD 4AURA 1NG1A 2QSYA 5LB2A 3W90A 5JEEA 2Q21A 3T1OA 1JALA 1HE8B 2R9VA 2GA8A 1OIVA 3C15C 2VSFA 4B3DA 4GP7A 2PT7A 3ECCA 3OFNA 2ZRHA 5HTKA 1GVNB 3RRYA 5CB8A 4NMMA 2XXAB 1KO7A 4RZXA 1CJTC 2F1RA 1KI6B 1ZM3A 1VECA 1P73A 1W4CA 1GFIA 3KQUA 1WB9A 5KYKA 1FUKA 5FBQB 3P27A 5B58C 2WV9A 4KFTA 5DN6A 1MO6A 4F4IA 2J46A 4LBZA 1NBMD 2DY1A 2DCUA 1P7CA 1ZD1A 3T5GA 1RE0A 2Q3MA 4M53A 4ZCLA 3O8CA 3N2IA 4HAWA 1NVUQ 1Q0UA 3OZXA 3QSYA 3W3ZB 5JJKA 2OHFA 3UIEA 2FU5C 2AHOA 3Q9LA 3THOA 2QAJA 1W47A 1N6IA 2J45A 2YOGA 4RSGA 1IJFA 3H4MA 2F6RA 4OI4A 4TSFA 2YWEA 2HCBA 1CTQA 3AKYA 4LC0A 5KU1A 4B2LA 1P9NA 2GXSA 3ZZTA 1CULC 5JWHA 1CIPA 1G5TA 1FNNA 2OG2A 5G41A 1JECA 3PG5A 3GLHE 2FJUA 1XDBA 1VCNA 2IUSA 2QPTA 2WSSD 2W6ID 3CZQA 3S1AB 4MYTA 3WY9A 1K6MA 3MCAA 2D06A 4UNQA 2ODWA 2YWGA 3I62A 4Z1MD 1Z2CA 1IXRC 2LKCA 3NG1A 2A2ZA 4F38A 1FQJA 3A1SA 3EG5A 1UEIA 1U94A 1Z63A 1IY1A 1OXSC 2O0KA 4BRWA 3OF5A 1M1YE 2JDID 3IO3A 2F43A 2J7PA 3W5JA 1S8FA 5L3VA 1FX0B 2EFCB 3PR1A 3OFND 4TQ9A 3K8YA 4Z54A 2ZS9A 3IEVA 4HDOB 2WICA 1KDTA 4XVRA 2V6IA 3GJ7A 3KXKA 5HCNA 1LB1B 2JJ8A 2WWFA 2ZUDA 3NBZC 4E22A 3AVQA 3BFXA 3EZ6A 5FPKA 1GAJA 3KZ1E 4EFNA 3AGPA 4ZIRA 5G3ZA 2H17A 4A82A 2QP4A 1JBKA 4NP6A 1D9XA 5HKKA 1G64A 1HURA 4DCSA 5DN6D 2FDCA 4RJLA 2DR3A 2BMEA 1G5RA 3E70C 3PITA 1W48A 4DDWA 2H92A 5CITA 1EGAA 4BQSA 4FCWA 2D3WA 2EYUA 2GZDA 4TTPA 4Q9IA 3THXA 1VKJA 4JKYA 4LJ7A 1A2KC 1N6PA 4D4LA 1E9SA 2FZ4A 2ZUBA 2IYWA 2WAXA 4IRUB 2RGXA 3CF6R 1ZMXA 4JLKA 1OXXK 1IN5A 1T3SA 1BKDR 1M6NA 4UNPA 1HT1E 1Q1QA 2GVDC 1S4QA 4JL8A 1ZD8A 4I4LA 2MSEB 2ODBA 4A6PA 1FMLA 3A58B 1L4YA 4N0EA 3IPXA 4LJ5A 4Q00A 2OCAA 3KJIA 1HEIA 1RRGA 8OHMA 2XJ9A 3CH5A 1EESA 3B1WA 2QL6A 1UBFA 4H1VA 1N6NA 3QF4B 3I61A 4A2PA 2C96A 4ITRC 2G1JA 1SHZA 2GESA 2ZRLA 4LYFA 4UJ5A 4EFMA 2X77A 1DAHA 5L8VA 3B82A 1KJZA 2EWWA 3U3KA 1SGWA 2F3RA 4O2LA 4O0MA 2N46A 4Q1AA 1W36C 1J2JA 1W46A 2GZAA 4QBHA 1KK2A 4TYNA 4BGDA 3I3SR 1LF5A 1KSFX 5BWMA 1S3SA 4KODA 1JAHA 2JLRA 1X1SA 3SQXA 1G7SA 5FL7A 3QXJA 4RD6A 5JEDA 5E4FA 3ZQJA 4HLUC 3BD9A 1UM8A 2GAAA 4PC6A 4IDQA 3GJ6A 2WWWA 4JL6A 1KK0A 1QF9A 1A1VA 3GLFE 3B1VA 2P65A 2QPAA 4G5GA 3UMFA 4QOSA 4DKXA 1KI2A 2GILA 5KSYA 5LBIA 1XJ0A 2WJHA 4OQFA 1DE0A 1KO1A 4BFXA 5B57C 1E0AA 4JJZA 3LRPA 4JJKA 4HB4A 2J87A 2W0SA 2ZRKA 3MAAC 2J7PD 1E1QD 3NWJA 3DPUA 4DEYA 3K70B 4YDSA 4F93B 2C5LA 4X8LA 3QVVA 1CEEA 4OI2A 5GVRA 1R0YA 3UK6A 3V9PA 4EJSC 2YV5A 3LA6A 2YOFA 3LVQE 5BYKA 4KVAA 2D7DA 4B71A 1GUAA 5HKKD 2FSFA 1XEXA 2QMHA 3B1XA 3L82B 1Z07A 3KFVA 4L8GA 3SOPA 2OZEA 1Z0KA 3WHKA 4ACAA 1WMSA 4HAVA 1G8YA 1WF3A 2OCPA 2D2FA 1IQPA 3JVVA 1OYWA 2BMDA 2PLFA 3WMGA 3MGCA 4WZAE 3R7WA 1G1MA 4TL8A 1SXJC 5L3QA 4ILEA 4IFBA 1V43A 1NMZA 3FVQA 4KV9A 1UEJA 5F3WB 3NBYC 4MKHA 3HU1A 2CLSA 1X1RA 3CIOA 1W7AA 2ZRFA 3W9YA 3EW9A 1KMHA 3AV0B 3LV8A 3D8BA 1QG4A 4WIAA 2DWOA 3QXSA 3SFZA 3H1TA 2FNAA 2HLDA 1UKZA 3SHWA 2FMXA 2VHQA 3M4YA 4OI0A 4A4DA 2XXAA 2FPLA 3O8BA 1TQDA 3M6AA 1KI6A 5AJWA 4R9UC 2FPMA 2ZS7A 4LHXA 1LNZA 3WP0A 3U3OA 1Y3AA 2ZROA 2YNMA 1DG3A 2BOVA 2L0XA 2NQ2C 1VCMA 2QRNA 3ICQB 2IK8A 1N0WA 4A1FA 3BB3A 3SFVA 3PJRA 4QGAA 1NIJA 1SXJB 4TL7A 3SS8A 4M1SA 2FEOA 2J5XA 4TQAA 2VHCA 3FGNA 3TRFA 2NZJA 1G3QA 1FOEB 1GDDA 5FH9A 5LDDC 1CP2A 1E0JA 4QKQA 5CJPA 4M9XA 3BB1A 2A30A 1OFUX 2HDNB 2DWPA 1T0JB 2PBRA 3CX6A 1DBSA 4P33A 1G6HA 3W34A 2ZITA 3KUDA 2KBFA 4XWOA 3B6EA 3CRW1 5B2ZA 1DAFA 4DC9A 3WBKA 1R0WA 5FOXA 1KNXA 2Z0MA 3QKSB 2IEYA 1GL9B 4IHQA 5CYOA 1P61B 3BWDD 4J0QA 1QVRA 3ASZA 1XMJA 3H84A 5J4HA 3I4LA 2RGNA 6Q21A 1WBDA 1J8MF 5FUWA 621PA 4TWZA 1F2TA 4JKIA 3VNUA 3SQWA 1R7RA 3GLHB 4V03A 3LW8A 3WNDA 1Z0FA 1ZUNB 2OV2A 5E95A 5JMTA 2ASEA 3Q85A 4WA7A 5KNDA 4LK2A 4YQFA 3MUFA 2XOKD 2J0UA 2G0TA 2WVJA 2ZIAA 3EZ9A 4KAXA 1N2CE 2HCJB 3HR8A 1PJRA 3X2SA 4D4MA 2JLZA 4MDEA 1T5IA 3CNNA 5DLQC 3R9IA 3IHWA 3QIAA 4TMVA 2G77B 2V1UA 1E2PA 1C9KA 3B9PA 4ZKEA 2REBA 5JFGA 1D2MA 2Q3FA 3WRYC 4BLPA 3W5IA 3QBVA 3SZRA 3NDPA 1XPRA 2IYUA 3GFPA 4GOXA 3JZMA 1VYUA 1ZCAA 2HLDD 2ZI5A 3TJZA 1FX0A 1KJWA 3F8TA 1QHGA 4IXMA 5CYPA 1J8YF 5FL3A 2WOOA 2JIZD 2H5EA 4BZXA 5FBRB 4A0RA 5BN4A 3GMTA 4X8HA 3D7MA 2O0HA 4B6EA 2ZR0A 3MWYW 3C16C 3QF7A 2ZVQX 5KOYA 3ZJYA 4PAQA 4LBWA 4Q66C 2RGBA 4PX9A 4DIEA 4WW0A 2EQBA 2PH1A 2QBYB 1LV7A 2IX3A 4B35A 3B5JA 1DAIA 4Z8XA 1R4AA 1JPJA 3IDQA 4I1OA 5LPNA 2ZRCA 3EASA 3LLUA 1U2RA 4DLTA 1T8TA 4D82A 3QEJA 5HR5A 3RC8A 1FQKA 4P4TA 4F4JA 2X2EA 1I2DA 4Q9KA 1ZD9A 1NIPA 1II0A 1U0JA 1J99A 1E9CA 4PSAA 1I4DD 5DISB 4IOMA 4LHWA 4FW9A 4MKGA 2R6AA 4GFDA 5EUQB 4QGFA 2ORVA 3SYNA 3K0SA 1PLLA 4EPWA 2DFKB 3O8DA 4PHHA 1VMAA 1TQ4A 4BPBA 5FI1B 3GQBA 4B74A 1TUEA 1UDWA 2WIAA 4QHYA 3T12A 3LFUA 3ND8A 1U0HC 1S96A 1GKYA 1ESNA 4BZPA 3CR7A 1D6JA 1LW7A 1NVWQ 1F3OA 1DO0A 2ZE8A 2ZRDA 2NO7A 5JECA 1DVRA 1T6NA 1NY6A 1GKUB 1ZC3A 4WAUA 1QHHA 2EFHB 2CMKA 1FPMA 1WBBA 2QSZA 4AKGA 1E9DA 2J0VA 1QHSA 3IQWA 1OSNA 4GSYA 4QBGB 4R2IA 1CU1A 3G82C 4B3FX 2B7BA 3EA5A 5SZIA 4QBIA 1TQ2A 4Q7LA 3T35A 1AM4D 3K0AB 2WKQA 4QRHA 4FD2A 3SHFA 4URVR 2CE7A 4HB3A 2YJTD 3VHXA 4JLJA 4S2EA 4TLDA 3ASYA 4DUGA 2XZLA 1HE1C 1UKVY 2O8CA 5TDHA 1UF9A 4RD4A 5DHAA 2IT1A 2ZJ8A 5CK5A 3FFAA 2QAGC 1TQ6A 3MFYA 3ZS9A 3SN6A 3NDBB 4JBYA 1Z5ZA 4ERNA 2ODEA 4DZZA 2WWHA 1YZUA 1I4TD 3V4FA 1OV4A 1KIMA 3TAUA 1ZNXA 3LWNA 1MRNA 3RSLA 1LTQA 1OF1A 3AKCA 3OEED 1S3GA 1OH6A 2ZRMA 2FFHA 2WJJA 3QENA 2ZRAA 4C0SA 1VTKA 5A5GA 1KSGA 4DCTA 4I1VA 2BJWA 4KSBA 4OQNA 1GSIA 1P2UA 4LJ9A 4NONA 5DSZA 1II8A 1ZJ6A 2FG5A 2B92A 4DVGA 3TSWA 1XEWX 5TARA 3DVLA 4URWR 2VIIA 3R9XA 1S1MA 1U98A 1KNQA 2VP9A 1P62B 1N5LA 5JRJA 2A5GA 1UBGA 1P2TA 3H2YA 4AYWA 2VP2A 5EXTA 1KAGA 1LF0A 5E7MA 2AD5A 4EPVA 1G7CA 3RSOA 4Q19A 2F43B 5E3HA 4O25A 3I1FA 2QNRA 3CNLA 1B0UA 3LNCA 3KQLA 3B13B 4LPSA 2ZRBA 2Q6TA 1S0UA 3AGQA 3A4MA 2AK2A 3QUSA 3TW8B 4EFLA 5AJYA 1N5KA 1E9BA 2PEZA 2EWVA 5F2EA 5JRZA 4ZIRB 4CDGA 4PPFA 121PA 1CJUC 4ACBA 2O8BA 3FFBA 2JLXA 1RFLA 5TB5A 4EDHA 5KDOA 2CEAA 2WJIA 3PXGA 4IJMA 1G41A 4PO9A 3RRNA 1IN7A 1XTIA 1EFUA 4P3YA 1KO4A 2FSGA 1JNYA 1DAGA 4DWJA 3PQCA 3Q8XB 3IBYA 1U8ZA 2JLSA 2A5DA 2DPXA 2OBLA 3RWOA 1G8FA 2QUZA 1W2HA 1ZVQA 3AUXA 1QRAA 5KSZA 3NHBA 4YMUA 1ZW6A 4BLQA 5JCZA 2CL0X 4DCNA 4Q7KA 3QKSA 2GKSA 2ZI6A 4H1UA 1NLYA 2RCNA 4URZR 4M4SA 4A0HA 4NBSA 1M74A 2PCLA 4D25A 1TEVA 5GADl 3TUJC 5GJBA 4Q21A 4OHXA 4HLDA 4F4CA 2WIBA 5J4YA 4OQXA 2JLUA 2K5UA 3GLHA 1LFDB 2NZ8A 4MUAA 3GLGE 1TUIA 1UAAA 1YRBA 4G5OA 2WMOB 2O8FA 1CF4A 4M8NE 1OFTA 5BN5A 1IY0A 4TYPA 2QPOA 2XTNA 2C95A 2C9CA 3RANA 4RZ3A 5IF9A 1OFIA 1X3SA 5F98A 3VNVA 1I2MA 1ZM4A 1QHNA 2I1VB 3VMFA 2Q0HA 4TLCA 3RRZA 521PA 2GAOA 3AF2A 3FWYA 1E79A 1RPZA 4NU0A 2I3BA 4Y0VA 2JLYA 1E2JA 1N5JA 4L16A 1GRNA 4RD2A 4DHEA 1G5PA 4MUBA 4QJ5A 1EFHA 4KITB 3BIFA 2R6CA 1E2QA 2RH5A 4MH0R 4TL6A 1NG9A 2W83A 2KSQA 3A1TA 3A36A 1SKQA 2HT6A 3L0PA 4KCGA 2JA1A 4OQLA 2CCGA 1CJVC 4WXPA 2IYTA 2GBLA 4Q01A 2QG6A 1XRJA 3PUVA 421PA 1R8QA 2ZRIA 3ONWA 5AJVB 3I32A 1IM2A 2VHTA 1BH2A 2GJKA 4YC7A 3L2OB 2RMKA 4DLZA 4P31A 2HF9A 1XEWY 3BH6A 1JJVA 2V1XA 3QOFA 2ERYA 3FTQA 1PUJA 2YZ2A 3A1UA 1NNEA 3RWMB 5JI3E 1AKEA 4V0NA 3ZYCA 2NOAA 2VF7A 3AP1A 2ZI7A 2FOLA 3QKRB 4PPGA 4QFMA 4EKDA 2WWYA 2WSSA 1OXTA 2RGDA 4DSNA 2ZI4A 4QBFA 2H57A 2JAQA 2PZGA 3F5FA 4KYIB 3R7WB 4OYHA 4MYCA 2SHKA 4DLSA 2QTVB 3CUEF 4CZ2A 1OHHA 4O2RA 3QI2A 4Q9LA 1TF2A 1AJEA 2VF8A 4OHYA 4NCNA 3DDCA 2UKDA 1G17A 1G8GA 2VP6A 4B76A 1KMHB 2ZEJA 1E1RD 2VHJA 4TYWA 1YZQA 3R8FA 1EFRD 2JDIA 4TQUS 2ZANA 5EXXA 4BFWA 4EAQA 5KSOA 4BECA 1EFCA 3LAWA 4GMXA 5KHOC 1E94E 2FZLA 2IF2A 5EP2A 3SJAA 3MMPA 3TW4A 2GHIA 5FOVA 5H70A 4AKHA 2ATXA 5CM9C 1US8B 3SC3A 1IAQA 1P6XA 4G5RA 4QHSA 4DDUA 3LW7A 5DNYB 1E96A 4PANA 2YYZA 4YLGA 1HY3A 1KJYA 3TE6A 1OXUA 1QVAA 4DJTA 3GLFA 4RD0A 1E79D 2Z4RA 4Q4HA 4U02A 2Q9BA 4TN1A 3QXXA 5HZHA 4NCKA 4C2UA 5FPSA 3K0AA 2CXXA 4RVCA 4PZYA 3R9WA 3VQTA 3T5DA 1ZIOA 1XB2A 3THWB 4CEIA 3P1JA 3TQFA 1RRCA 4WXRA 1A7JA 3EZ2A 3CPJB 5CIWA 1S2MA 3N5CA 4G5QA 4ZO4A 4KHZA 1JXMA 4MGKR 1CJKC 3HPRA 4BASA 4PAMA 1E9EA 3FOZA 2KE5A 3PUWA 1GTVA 1J7KA 1W5SA 1PZNA 3SYLA 3SYKA 2VTKA 1T91A 2ZU0C 1F2UA 1Q1EA 1F2TB 2ERXA 3VX4A 5JZVA 4CW7A 1R6BX 2YC2C 3GJXC 4JLOA 2GEVA 2XNDA 1KHTA 1OH7A 1XD2A 1L8QA 1C4OA 2G83A 3KDSE 2J0SA 4XVQA 4DSUA 3NHAA 2H16A 3MD0A 2J0UB 4GBMA 3AKEA 2RGEA 1DAKA 1GNPA 3TUIC 2EYQA 2JGNA 2GZHA 4MGZR 5J4LA 1KO5A 1W0KD 2ZAOA 2W58A 4P4UA 2ZU6A 2IXEA 3BC1A 3K09A 2BCJQ 3RHFA 4W5HA 1KYIA 2IWHA 1YZKA 1OHHD 4LSGA 3DOEA 1AS3A 3WMFA 4DSOA 2IA5A 4M0LA 1TEXA 2IS1A 3ETLA 3B1ZA 4BZQA 2YWHA 2EW1A 3PFIA 4RZ2A 4U5XA 3CWQA 3EZ7A 3GP8A 3BORA 5EE9A 1E1QA 3P4XA 4HUTA 2IYZA 1XXHE 4BWYA 1PLKA 1DARA 1W0JD 1ZNYA 4LV8B 4B44A 2XZOA 1U9IC 2OXCA 3MJHA 1OPXA 1KY3A 2Z4SA 2ZE7A 2CBZA 4B47A 4DCUA 3A37A 1HV8A 1OYYA 3GJ0A 5K8IA 1G7RA 1VHTA 4HYYA 4XSGA 4YDHB 3CRVA 2QMUA 1BYIA 5F9FA 5C4GB 1WRBA 4GP6A 3QE0A 2H1LA 1A5TA 1U8AA 1ZUHA 2VBCA 1MOZA 2C8VA 4A8JB 2ZI9A 1X6VA 1KI9A 1ZUIA 2VSXA 4W5JA 4B2PA 3OIUA 2E9SA 2DYKA 2AWNA 2F1IA 5EP4A 1T3HA 3NH6A 4NH0A 5SZJA 4OBEA 2IHBA 1KO8A 2A9KA 3MWKA 1MKYA 4Q03A 4OJKA 1CRQA 3B78A 2JEOA 5HZKA 3FHTA 2QEQA 3VX3A 2AR7A 3TMKA 2JASA 2Z43A 2OAQ1 1YJ5A 3REFA 5FOWA 2DFTA 4LYAA 4B33A 1U99A 1J70A 1SKYB 2FN4A 2QY9A 2XNDD 2EU8A 3LLMA 3LY5A 4OK6A 1UDXA 3K70C 5TY0A 3AB3A 3VR4A 1IN8A 3FMFA 1SVWA 4QC2A 1JB1A 2R8RA 4JLPA 3DM5A 3VR2A 1QHHB 4DSTA 3BK7A 2W00A 2V3CC 1Q21A 4LCBA 2PL3A 1XWIA 4PZLA 5EE5B 3I8SA 1DG1G 1IXSB 5JHHB 4GOKA 4TYYA 1II9A 3HPQA 5IK2A 4MGIR 3CLVA 3L8YA 1M7HA 2B8TA 4JIMA 1QDEA 3PCRB 3F0TA 5FPHA 4JLAA 2NG1A 3GFTA 4C0JA 2ZJAA 1JAIA 4OQMA 3KQKA 2D2EA 5JS7A 3ZLJA 4LHVA 4B75A 4LI0A 3K0CC 2QT0A 3KJEA 1ESMA 2O8CB 1ODFA 1WCV1 4FCVA 4XOIA 2NPIA 3QEOA 1D9ZA 1VG8A 1J90A 3LBIA 3RYTC 3L0OA 3I72A 4B3GA 4XTCS 4TTQA 1ANKA 3UG6A 2GETA 2DB3A 1FW6A 2ZE5A 3HDTA 4JLBA 2Z83A 4RD3A 1Z6TA 1SZPA 3ZZ0A 1TU3A 1VHLA 5FFMA 1OT3A 3MG9A 3RC3A 5JJIA 2FEMA 3GD7A 3AVXA 1H8ED 3EZFA 5CLLA 4I1SA 5B64A 1MRSA 2BHRA 1R8SA 4JLMA 3U3MA 1KMQA 4US2R 2VL7A 2R6GA 1E2MA 3NIBA 2V6JA 4MA4A 4BFUA 2XOKA 4PQFA 2BIFA 3QKRA 1JPNA 4R71A 2CE2X 1SVKA 4CF7A 4JT2A 2J7KA 2ZI3A 4PC7A 1EWQA 1II8B 4JT4A 2XB2A 2J0QA 1E99A 2CDNA 5G53C 2ZXUA 2C9OA 4OHWA 3Q5DA 3HJNA 4F91B 3ZVRA 1VIAA 2NO6A 2Q3HA 3U6KA 2GXAA 3O47A 4I1UA 1E2FA 4B6FA 2A7QA 3TH5A 4W9MC 4HATA 1XEFA 4LWZA 5DIFA 3SJBA 5CDFA 4V0KA 3FKQA 2HJVA 5KTYA 1M2OB 4CEJA 1E9AA 1KSHA 5TXGA 4ARZA 1YVDA 2IYRA 2GDJA 3KJHA 4HZUA 2NGRA 2ZQ5A 5JJLA 4A9AA 3TUZC 4YMSA 5GVSA 1E32A 3OAAA 2CVFA 4Q4AA 2ANCA 1ZIPA 1OH8A 2E1RA 2VH5R 1X8KA 2VEDA 4HAXA 3K9NA 4Q7JB 1TF7A 2JIZA 1US8A 2OT3B 2XEXA 3AF3A 4WZ6A 1U81A 2F3TA 4OL0A 4NDZA 5JWOA 3TR5A 2O8BB 1E0SA 1G3UA 1L4UA 1XP8A 3K53A 1VG0B 3PUZA 4OKSA 1KZ7B 4Q1EA 2HEIA 2AXPA 2GJ8A 3U6BA 1HH4A 3SE0A 2R6DA 2IYLD 4Q48A 4R7ZA 1BIFA 2FA9A 4XWKA 2OXRA 4GL2A 5IK2D 4YMWA 3CF0A 2JLQA 4DB2A 3EWSA 3IKJA 1G8PA 1Q22A 3KKQA 2C98A 4WVFA 2ZSFA 2R62A 3EIQA 3L0IB 5C4MA 2ZJ2A 2B21A 3THWA 2O0JA 3KUCA 2IYXA 4PR0A 5DHFA 3FE2A 2HYDA 2W2XA 2WWGA 1FTNA 1Q3HA 4KFUA 2VYFA 4LYJA 1BS1A 1FUUA 1RIFA 5E7IA 1GL7A 3IILA 2AXNA 2J9RA 1KOFA 3NEYA 4MGYR 4NYIQ 1ZRHA 2PCJA 4B73A 1AK2A 2VHUA 2WBLC 2AN9A 1H8HD 1RVDA 1CBUA 4OK5A 3VR3A 3PEWA 2AWOA 2B7CA 2BKUA 4LJ8A 2QQ0A 3P4YA 2WWIA 5H1YA 3CRRA 2R44A 3ZDQA 3MRSA 4RZUA 4ESVA 3UWOA 5M04A 3GLIE 3VHLB 2HUPA 1IY2A 1XBTA 4BLRA 2O8FB 2F9LA 3IO5A 5FOUA 4DDVA 3I73A 2YINC 3AVPA 1P9RA 1ZM2A 3LO5A 3GCGA 1YU9A 5FTMA 4CVNA 1XZQA 4II7A 3T06B 1G9XA 4KLNA 1W2GA 2Q9CA 3GEEA 1P75A 3FMIA 3N2EA 5BYJA 4A36A 3OE7D 4IOJA 4V0OA 1S1CA 1TPZA 3BOSA 3D6TB 2PLRA 1VCOA 1XXHB 2REXB 1KKLA 4PTLA 4Q9JA 1F60A 4PXAA 4ZI3A 5A4JA 4FWTA 4P4SB 4RCYA 1A82A 5LD2B 4KLZA 5H8WA 1GRRA 4NKRA 2QM8A 4BEBA 3OAAD 4D4JA 3CNOA 1MO4A 4F7WA 5KNBA 2WWXA 3A8TA 1XF9A 2UVQA 1OB2A 4TTRA 1KY2A 3BH0A 1KI8A 4DCVA 4B48A 4JBXA 3CZPA 1R2QA 1Z0JA 4UJ3A 5DYIA 4HDQB 1ZINA 2QE7A 4UXIA 1H65A 1IBRA 4E07A 3OEEA 1W4RA 4PQRA 5EUMA 2PJZA 4PQYA 1YZGA 3ZQ6A 5IHPA 1N6OA 4HAUA 4X8OA 3U44A 4GMDA 2ANBA 2ZYWX 5JS8A 1E98A 2FFQA 3FMPB 4PFSA 1QG2A 3B9QA 4AYXA 3RS3A 3A4NA 3AVTA 2ZS8A 1DO2A 3ZH9B 3AVVA 1XMSA 2P0EA 5TVKA 2JJ2A 4AY2A 4URUR 4A8JA 3A6PC 3HU2A 1XD9A 4EUNA 2QORA 2FFAA 4KVGA 2DFNA 3LQRA 2FGJA 2C99A 1MABA 221PA 2W6JD 1SVIA 2V4ZA 3EA0A 1Z6YA 2GNOA 3CPHA 5H68A 5FTLA 3EIHA 4FCTA 5FUYA 5IDVA 5LB4A 3CWZA 2GF9A 4B3CA 3TQCA 4L4UA 3GLGA 5J4VA 1ZBDA 4IVRA 3VFDA 1TMKA 5CDFE 1G3RA 3E2IA 4OI1A 3A4LA 4C9BA 1T0HB 1K5GA 4KFSA 4LC1A 2ZRNA 4NYJQ 3C7KA 4P0TA 2ZYTX 4LUCA 3DL0A 5CM8B 1Z29A 3OESA 3T15A 4LOAA 1QHXA 2YC4C 4MQBA 3A1VA 5AJXA 1W4AA 4KSCA 3U60B 3GLFB 2BVNA 4PAOA 1MT0A 2V9PA 5FUXA 4Q4HB 2O8EA 3WRXC 2QTHA 2QQEA 4KJZA 3AVUA 3TGPA 4FMBB 1G21E 2GVZC 2BCGY 1Z0DA 1ZU5A 2AKAB 1NMXA 2R6FA 4CEIB 3OIVA 4QGGA 2XZPA 3DHWC 2R65A 2MMCA 1WQ1R 4M1YA 4DB4A 3K09C 2BDTA 1DTSA 4Y0AA 3AKDA 2O8DA 1BYUA 1W4BA 1SVOA 1D2NA 1JR3A 2AK3A 4M1OA 1N6RA 3EXAA 3ZVLA 1DAEA 2IYYA 4TMZA 3W8NA 4ZCIA 2P5TB 1F2UB 3SI7A 4B3BA 2BWJA 2IS6A 2OBNA 5FPTA 2QE7D 4LBYA 3RDPA 3K0FB 3L8ZA 1GNRA 4ZDIA 1YR7A 2REOA 1XD2B 3L0SA 2HJGA 4EPRA 1Y63A 1LY1A 3CF2A 1Z2AA 2CK3D 3THYB 1U0LA 2WZQA 2ZSDA 1GRQA 4JVMA 2CNWA 1Z6AA 3AF1A 1MR3F 3T61A 1X86B 4MDFA 4XD7A 1O3YA 1N0UA 2JJ2D 3KX2A 4JLVA 4LHYA 3TBKA 3T1TA 1UKEA 2ODNA 3D31A 4DLVA 2GK6A 3B8HA 2VPPA 5EQTA 4C2TA 3BJIC 4IVQA 3E5HA 3RRMA 1XJQA 4Q4JA 1ETUA 1UKYA 1P2SA 2BV3A 4HLUA 2XTZA 3WMEA 3CONA 2CHQA 4PHGA 3QJYA 1G19A 5K8TA 3RS4A 1FFHA 2RGAA 4XVUA 1Z22A 1XTSA 3FB4A 2XGJA 1Z0IA 5EXSA 1T3LA 5C18A 3KKMA 2FPKA 3QNUA 4XWAA 3WYGA 3TSOA 2C9YA 3IIJA 5AUQA 3AUYA 4FIDA 3UKDA 1KI4A 1E69A 4GT1A 4MYUA 4Z8YA 2C03A 5CJ2A 1L7VC 5A0FA 3QVUA 3RS2A 5SZHB 4C0QC 1YZTA 3U3RA 3B2EA 3T34A 4RKEA 4EJSA 3AP2A 4UXJA 2CCJA 2QMOA 4M21A 4LX0A 1KKMA 1G6OA 5DO9A 4HUQA 1G8HA 1R0ZA 1P2VA 5J5CA 4LYHA 5DE3A 4DLUA 2BKEA 4GRAA 1QHYA 4G5SA 2XITA 2OLKA 3CX7A 4IEEA 2RHDA 2OM2A 3PEVA 2LKDA 4D80A 3DO6A 1MO3A 1JR3D 5AR1A 4LBVA 1G20E 4HAZA 4QGHA 4EPYA 1SVLA 4NCHA 4JYBA 4PPQA 4U00A 1E1RA 2H18A 2WM9B 3MLEA 4US0R 1XCPA 3KQNA 1EFRA 4GPTA 4G0NA 5KO2A 3IUYA 2RAPA 4QHTA 1EG7A 3OHMA 4IOLA 1KAOA 1E9RA 4PHTA 4PZZA 4YXWA 2ZVPX 1E2KA 2CHGA 4ZDWA 2JLWA 1ZCBA 2BBOA 1OE0A 3D3QA 3GPLA 3RS5A 4B34A 4H9GA 3SDZA 4V0ME 4QNRA 1Z06A 3IGFA 3P20A 4PO8A 2ZM5A 3TKLA 2VLIA 3G0HA 2QENA 4BUJA 3CR8A 4PSVA 2OFOA 1IJEA 2CNWD 2BBWA 1Z28A 2CLCX 2QRZA 4XD7D 1W36D 2CJWA 1RYFA 4D6PA 3BFVA 3U5ZB 2IF0A 1E2IA 1NMYA 4NYIR 5D3QA 5L3RA 2XAUA 1XXHA 2WPDA 4D26A 1GM5A 3PVSA 2RGGA 5K8LA 3AVYA 4AG6A 4P4SA 3GJ8A 1E2LA 2D74A 4MRPA 1NRJB 1SULA 2JATA 2P6RA 1A2BA 4W7SA 1SQ5A 2DWQA 2ZJOA 1KTVA 1HYQA 2EVWX 5G3YA 2NPFA 4DRZA 1I4LD 3UWKA 5D3MA 3AQ4A 2HYIC 2N1BA 4NCJA 2OAP1 2NO9A 4QJ3A 1GG2A 4DIDA 3BE4A 2QZ4A 2QM7A 1JR3E 1OFHA 3NKVA 2P6UA 3M0EA 1KI1A 4BLTA 3I5YA 1Z8FA 4B2IA 1G7TA 1CJMA 3AF0A 1VIYA 3KB1A 3TK1A 3V00A 1XNJA 4KYUA 4M9QA 4XTRA 5FOSA 1DAMA 1ZM9A 4IDNA 1ZNWA 5FUVA 2PMKA 4HB0A 5F9HA 1SVMA 1W0KA 3GJ4A 3LXXA 1JJ7A 3ZGXA 4FN5A 1AGPA 1GL6A 2OBMA 3UG7A 1U90A 4HB2A 1S9DA 1IONA 4C0HA 1XJCA 1LVGA 2R2AA 4TLEA 4GDFA 3NVAA 1QBKC 3BXZA 2ZPTX 3U4QA 4CEJB 1SXJD 1T8UA 4ARZB 4L9SA 2QGZA 4HZUB 4DLRA 5AJZA 4JZKA 1N6LA 3TR0A 3KKOA 4MRNA 3SEAA 2IXGA 3KXIA 2EFEB 2A3RA 3BS4A 5GJWC 3KL4A 4Q4AB 4G3XA 3ADCA 1ONBA 2RB4A 4DLXA 1W0JA 4P32A 2X2FA 1PLJA 4YXWD 4JMPA 5FOTA 2BEKA 2GRJA 4A0FA 5G40A 3KJGA 1LS6A 3FHCB 3MWJA 2RGNC 1RRFA 3EIEA 3ZVMA 1C1YA 2RHMA 5FTJA 4C0KA 5DYGA 3KFXA 1R5OA 4BLOA 5JWRA 4JVLA 1P3JA 2P5SA 4QXAA 1JI0A 2B8WA 2F1HA 1RZ3A 1P5ZB 2FF7A 1R10A 3HYRA 4FMDF 4K81B 4Q1BA 4RD1A 2ZSEA 2WPDD 5AUOB 1N3BA 2JJ1D 1ZYUA 5EE3A 4YMVA 1XTKA 3WBJA 2IS2A 3K9GA 2PX3A 2BC9A 1COWD 1EK0A 4QM7A 3PUXA 4LV6A 5P21A 4NYJR 4PC2A 4DLYA 4OK3A 1L2TA 4XSHA 4UXHA 3UXMA 3T1VA 2KB0A 4NZYA 4WBSA 4GZMA 5CK4A 1GIAA 3WP1B 4HLQB 5ELXA 1YR8A 4TZ0A 1XCMA 4LY6A 1SXJE 3K0FA 2GJSA 1XTJA 1RYHA 3ZIAD 1AS2A 3QBTA 2WTUA 2OUKA 4Q1CA 2EFDB 1YQTA 4BLSA 3C5HA 3EWAA 3THYA 2OILA 2ZREA 5FTNA 3PEUA 2G6BA 1OXVA 3RLFA 1Q1BA 4C7OA 3DKVA 2TMKA 2GTPA 3U7GA 3C14C 4NYMQ 1JQJC 4R2HA 1XTRA 3CM0A 4A6XA 1JEDA 2YWFA 3QKTA 5HCIA 2GXUA 3BERA 4CT4B 4EQ6A 4ZI2A 4OJQA 1M34E 4KI0A 2ZRPA 3EPLA 1A4RA 4O3MA 4XIGS 5C46F 4G01B 1E4VA 2PX0A 3LXRA 4A8JC 2OCYC 1EX6A 2A78A 2WKPA 2JCSA 3WNCA 1KSJA 2OE2A 1GOTA 5JI2E 4AKIA 4BFYA 3CB4A 4WOPA 4HAYA 5EP1A 4MYHA 2VP4A 2GK7A 5DH9A 1TNDA 2CLDX 3SJZA 2QAGA 3BH7A 5KDLA 3I5XA 4FMCF 2QN6A 3DEFA 1XPUA 5FI0B 1W44A 2DFLA 1BMFD 2CCKA 3EARA 4JL5A 1H8EA 2AFIE 1XU4A 2Z5FA 3DM9B 1NBME 4X8MA 1RKBA 2VP5A 4G1UC 4DT1A 4NL4H 3U44B 4BE7B 1DS6A 4M1WA 5DGXA 3U3JA 4DBLC 2OESA 3LH5A 1EXMA 1UADA 5JCPA 3QXCA 2G88A 5BW8A 5L3SB 2QP3A 3EPKA 4LZZA 2YHSA 3N70A 4QM6A 2P3SA 3X1XA 4B43A 5FBWB 1AQUA 3RABA 3ZVNA 1MABB 3NC1C 3DOFA 1OLOA 3WYFA 5FR2A 1N0VC 1OJLA 1Z3IX 1YR9A 3I92A 5FBLB 1NN0A 1R0XA 3GLGB 3VU9A 5AUPB 3GLIA 4TL9A 3DZ8A 4A15A 4IVPA 4TLAA 1E0KA 1IN4A 1Z83A 1ZNZA 1Z08A 3Q5EA 3W8RA 4HSEA 1OH5A 3H86A 1G16A 4JYCA 4LRWA 3QPWA 2ZRGA 2IL1A 5KUTA 4OHZA 3BB4A 3X1DA 3IHLA 3NH9A 1GP2A 1Q1ZA 1YZLA 3CO5A 3IIKA 4RFSA 4BEJA 721PA 2CL7X 5JSZB 4TSFD 2NO0A 2UZ3A 2N42A 3DKPA 1AN0A 3F3YA 5J47A 1Q44A 3QG5A 3ZZUA 2QU8A 3M1IA 2O8EB 1TX4B 2ECKA 1D5CA 4JSYA 1DADA 3WHLA 2FX3A 2FGKA 1YE8A 3LDAA 4TMKA 1NN5A 3FHOA 2GXQA 1M7BA 2QROA 1NKTA 1X8LA 1Q20A 3TAHA 4JLNA 3ZD7A 1NLFA 2RKOA 3BRWD 1AZTA 2IBMA 2IS4A 2B6HA 4IKEA 4Q5IA 2O8DB 2VQSA 3ADKA 2V8OA 5AUNB 2PEYA 3SNHA 1H8HA 4C30A 4MRRA 3KB2A 3MJRA 2XJ4A 3TVTA 3SBDA 4EPXA 1RJ9A 1HA3A 4IDPA 4ZPXA 1JXOA 2GCOA 2VSOA 2KWIA 2ZAMA 2MSCB 2BMJA 3KTAA 2UZIR 4DEXA 3BBPA 3HWSA 4DDTA 1KGDA 2WHXA 5DI3B 3U7HB 4PSKA 2NIPA 1R5NA 3QY0A 2OSBA 1DPFA 2C04A 2BMFA 4V02A 1Z6XA 2RGCA 1CR4A 3K0EA 1TTTA 1Z0AA 2BJVA 4A0GA 4HEJA 2WOJA 3FDIA 4URYR 4D0LB 1W36B 2BBSA 1DELA 2W2TA 2ZJZA 1X8JA 1F5NA 3CW2A 2QA5A 3W3AA 4CGZA 3U2QA 2IC5A 3IPYA 1G18A 3OE7A 3LVRE 4IEIA 4Q4JB 1FNMA 5IRCD 4D81A 3NEJA 5C2JB 2JLVA 1K5DA 3R20A 4GOJA 2H7VA 3IQXA 1GITA 2KI5A 3K9LA 4QL3A 3A1WA 3PENA 4QNMA 4NE2A 1KK3A 1E4YA 1NVVR 1P72A 2QMEA 2ZETA 1EX7A 4JLDA 3WNBA 3OIYA 5UKDA 3QXHA 2NMVA 1VYTA 2XX3A 3KKPA 2VA8A 4I99A 1WP9A 2FH5B 3BFKA 1GNQA 2ONKA 3QG1A 1WXQA 3E1SA 5TMPA 3RAPR 2QI9C 5CLQA 4UKDA 4EJSB 3C4JA 2O5VA 1OB5A 2ZJBA 1CXZA 2G0NA 4L9WA 1UBCA 4JVNA 1M8PA 2ORWA 3ADDA 1G4UR 5HE9A 3SJCA 3P32A 1CRPA 4HUQB 4C0LA 3IEUA 2ZUCA 4E5UA 1XZPA 4Z51A 2IYSA 1JEEA 3AF4A 3FYHA 3ZS8A 2MMGA 3NC0C 1KK1A 1RW4A 1SVSA 2WMNB 1N25A 2W6JA 3FMOB 4MRSA 3UATA 4BFVA 4IFEA 5JLJA 4EPTA 3EC2A 2IUTA 2X8AA 3LX5A 4PHFA 3TLXA 2CHVA 1XD8A 4I81A 1E2DA 5FL7D 1E9FA 3V4RA 2QTFA 4M22A 4AWXA 5CB6A 2W2VA 2DHRA 2XB4A 1HUQA 2BBTA 4IXNA 4Q18A 2GBLC 3EPHA 5LD2C 2WJGA 3PUYA 2Z6VA 3W6NA 1PUIA 1R5BA 2G1KA 1HQYE 2Q9AA 3KKNA 4Q4LA 4ZDKA 4Q1DA 1KDOA 3VKGA 3C41J 2P67A 1O87A 1Z6GA 1E2EA 3EX7C 1NSFA 3UANA 4AD8A 3GJ3A 4K8OA 4MKFA 4N0DA 2XSZA 4MKIA 2MSDB 3Q72A 4FMDB 4ON9A 4CRWB 3LD9A 1W1WA 1W5TA 2CJWB 2IHYA 3AVWA 1GILA 5AK0A 3SR0A 4ZDJA 4L15A 1YKSA 4BFTA 4A2WA 2HT1A 1FP6A 1KI3A 2ZR9A 4L5BA 3JZAA 4M9SA 4UNRA 3Q7PA 1MH1A 1TADA 4BFSA 1FP7A 3GEIA 3UPUA 4CEHB 2ORIA 2ZYVX 1TU4A 3IIMA 5BXQC 2F55A 4LHZA 4A2QA 3B1YA 4M9ZA 1OIXA 2J41A 4E09A 3S1AA 3EAQA 5J4KA 1XTQA 2WJYA 5D3MB 4DLWA 1VDZA 2CVHA 4AK9A 4HZIA 1N6HA 2WKRA 4W5WA 3C8UA 1NL3A 1UJ2A 2V55B 2WAYA 3CPEA 2ZJYA 3X1ZA 4D4KA 1BOFA 2IUUA 5JBQA 2AL7A 3AVOA 4AYTA 3CX8A 4NYMR 2PZEA 5EP3A 3QQ5A 4IW3B 4AIIA 5FPYA 4S35A 1RC8A 2ZR7A 1K8RA 3AP3A 1G3IA 2CK3A 2PZFA 4GZLA 4CIDA 1NKSA 3I8XA 5BQ5A 1WDTA 1B23P 3FKSA 5E7JA 2IEZA 1TL7C 4KBGA 5L3SA 2P2LA 2LWIA 4RY2A 3VR6A 4C0AC 4C4PA 5KSPA 3NBFA 821PA 4DXAA 2A5YB 3VKHA 5FBVB 2G9NA 2W0MA 1AGRA 5HE8A 3AH8A 3BGWA 4URXR 2FV8A 4PPNA 4TYQA 4C3ZA 1GZSA 3NBXX 1T9HA 3U4QB 2YOHA 4LPKA 1UPTA 1NP6A 3CRQA 4AKEA 4HDCA 2X19A 4LJ4A 4QJ4A 4KBFA 4QG7A 4Q47A 4IOKA 4KFRA 4KXFB 4V0MA 1CLUA 3VKWA 3UMSA 2GEUA 5KNCA 1E2GA 3LBHA 4FMCB 3AEZA 3ZD6A 3VTKA 5HPYB 3OIWA 3B7GA 1F6BA 4FI3C 4LJ6A 3J81k 3BAFA 3G5UA 2ZSBA 3WXMA 3VR1A 3Q3JB 3B60A 2XTMA 1QZXA 1AS0A 1HTWA 1NF3A 1U9IA 1VYVA 2LCFA 4UQOA 1AA9A 5JSZA 4ASUA 4N3NA 2ZJ5A 1FZQA 4TZ6A 2XSZD 4MITA 4PC3A 4POAA 4B32A 3RS0A 2P6NA 3L43A 1VPLA 1AIPA 3VR5A 1KDRA 1EFTA 3QF4A 3DZDA 3CRMA 2BM0A 2GEDA 4IDOA 3PEYA 1W49A 2GF0A 1FL9A 2VRWA 2IWRA 2D7CA 4M1MA 3KQHA 1Q3TA 1E3MA 4LDJA 4BRUA 5FTKA 3U7FB 1ELOA 2A5JA 1AZSC 1ZC4A 2F7SA 3ND9A 1GKIA 2HXSA 1NJFA 4TLBA 3B85A 5EJEA 3RVBA 4CYMA 3K1JA 3QKUA 1VG9B 3R8CA 3W6PA 1T4GA 1ZP6A 2IW3A 5KPJA 2V7QA 3QPVA 2ZRJA 3HYTA 2BM1A 2NTYC 1F48A 5C1BA 2J59A 1KI7A 1D2EA 1EWRA 3QPUA 3GEHA 5DI3A 4ZV4A 4UNSA 5J40A 4FINA 1MV5A 2OFXA 2ATVA 4US1R
chains in the Genus database with same CATH superfamily
4KIGA 5EZ6B 4YP5A 3R2JA 3LGAA 4GMGA 3OPQA 4WADA 2BKVA 2AFRA 3TGWA 4WCFB 3HP1A 3Q7QA 3Q2OA 3SBEA 3HKDB 1YRHA 3FR7A 3NV9A 1IBMB 5CT6A 2AIRA 1U3TA 2OEPA 3ICPA 1RLTA 4M0PA 3UQZA 3RKRA 3WV4A 1OX6A 5JALA 3LX8A 3EJ6A 4ATNA 5DLDA 4KWCA 4BYGA 4IJUA 1NI3A 2RK3A 3DC2A 3GOQA 4B85A 1NVKA 1Q50A 2DMRA 2OY0A 4WKPA 4ZYWA 1YCFA 1N33B 1XFAA 5A7HA 3T1QA 5E9JA 1ZCZA 3EC1A 4Q02A 3F6SA 2GCPA 3BSSA 1CRWG 1YC2A 2WFLA 4BB5A 2FWRA 5JXWA 2CN1A 1OBOA 2B1RA 1PR4A 3K0CA 1UBOS 3LZCA 2C2GA 1X7ZB 4YCBA 3P52A 1Q0RA 2PBZA 3ER8A 4G2TA 2OENG 4M1KA 1NY5A 5AKJA 5GJVC 1SKAA 3REGA 2PZBA 2CUZA 3G68A 4LGMA 1BKSB 1SOAA 2P2DA 5DM0A 5I7HA 2ZE6A 2XOEA 3D5EA 4ID9A 3ZZNA 3FPAA 3O8RA 1K66A 1AKUA 1XFDA 4OTZA 2Y71A 3TFQA 5JO0A 3S55A 2Q46A 1O4WA 3O75A 1P4SA 4M49A 4YIHA 3WWCA 1SU4A 3H1GA 1Z8DA 3R0ZA 5EWMB 3IUSA 1FRVA 2ZYGA 4PRYA 3LE8A 1XX6A 3A3KA 4NHOA 2BEUB 5CVDA 3DD1A 5ECYA 4ALIA 3E22B 1AKTA 2HHJA 3PUKA 3ZOKA 1A5SB 3JQDA 3A32A 5DHTA 1N32B 2AUMA 4TLMB 1KDPA 1ZU4A 4BY9E 4BZZA 1FEZA 4OREX 3ZI0A 1QDUA 4B3XA 4I8IA 3GIWA 5SZKB 4A03A 2J6IA 5JXJA 4FQ7A 1RMTA 1U7WA 2F2TA 3VPFA 1Z47A 1VFPA 2EIXA 2P2SA 3VU9B 2IGBA 1M6VA 1JHPA 3CE9A 4IQ4A 4O4HF 3TRHA 4ZEMA 1AF4A 1F9EA 1C7QA 2AG5A 4FE4A 5HFNA 1G291 1IZZA 2O7QA 3GFOA 4YR9A 4RBNA 5AJHA 2O52A 5E6UA 2HL6A 1GUDA 3QK7A 3RNLA 3LUAA 2IHKA 4TV9F 4EWLA 2A5FA 3FPLA 3UVEA 3PIRA 4BO7A 1QWSA 3CTPA 3ZWQA 2GFIA 2X0NA 1DOAA 2DLNA 3H0KA 4MOWA 2P8JA 5CB0A 1Q95A 3UK0A 1TQ8A 4IAOA 4QDZA 3DW3X 5E3JA 3OEHA 2FB9A 5DHRA 1E6CA 2KBEA 1QJ4A 1T5LA 3E6AA 4EB3A 4BVLA 4MVJE 3GMDA 3E7FA 3U61B 2B1GA 3F6PA 3GGDA 3VV3A 4PGGA 3A0UA 4KMOA 3D3WB 3GWZA 1RRPA 1FUIA 3MB8A 1YE3A 3KP1A 5HILA 2ENUA 2UYYA 2D62A 3DF9A 3TXYA 4D45A 2A6PA 1HNZB 2JJ1A 1MAUA 1NSTA 2D54A 2YIJA 3O95A 1N2OA 2WMDA 3W5HA 4ZEXA 1A7UA 5BNWA 1GZVA 3IQFA 2Y0CA 3FMVA 1TF5A 3U19A 4PZEA 2F3SA 4TMXA 1HFJA 3BMNB 3ZHZA 4Q3LA 1SKYE 3W5BA 3KXLA 1N6KA 2Y8EA 5FKJA 2I2FA 3C5CA 2OWDA 4L7VA 4BNGA 4NBWA 4ENWA 2WE7A 3Q10A 3CLSC 4BBPA 3UT0A 4TT3D 4NTZA 5CVUA 2RBGA 2X5JO 1H5QA 4NMLA 4FUQA 2W43A 3RS7A 3MWLA 2Q5CA 5CFMA 3I9FA 1XCOA 1RJ9B 1GFZA 3AZQA 3D8UA 3NALA 1PSWA 1ONSA 2GCOB 3I23A 2PA0A 1JR6A 4WLUA 4D02A 1XPOA 1OU0A 1ZQ1A 3HADA 4FR0A 4TMTA 5CFRA 5HYVA 2CDCA 3OVMA 3T5BA 3CLUD 3OY7A 4MUJA 3WYAA 5JZMA 1EXDA 4F06A 4F92B 4A1OA 4CTMA 4UUNA 1P5RA 1YA4A 3GLRA 4UQPA 2BMVA 2FR8A 2GAIA 3QGMA 4RKFA 2YHAA 3UB2A 5DM60 5CVEA 4EARA 4OKNA 1U4OA 3MSXA 4KYTA 1ZL2A 5TV2A 4ARAA 1YK0A 1MPXA 1ONOA 4YEDA 2DVMA 4J1NA 4ZQBA 3VH4A 5KPDA 1Y5NA 3RYCA 2HWWA 2A0YA 3TTYA 3NT4A 4YHBA 1BO6A 2VAXA 3TVYA 2FE4A 1TVKA 2CDRA 4D0GA 3SBXA 3UH0A 2CDBA 2GRUA 3A6JA 1QNFA 3LXMA 3MSCA 1XEXB 4LJAA 1WKVA 3CW9A 3FNHA 4JS0A 5EY5B 1DEAA 4M54A 3PV0A 3MILA 2H4ZA 2PYIA 3H2GA 1XAIA 2JD1A 4GPAA 5DU2A 1SB8A 3DZGA 4N03A 1SVNA 4MYDA 2P5UA 2P9ZA 4G24A 2W6IA 5F23A 5LFAA 4Y1FA 3RRJA 5CVVA 3D3NA 4LZAA 1MG0A 2BGIA 2HD4A 3SU8A 4U2DA 3N74A 4B4KA 4ZCMA 3L7LA 1YRAA 5L3QB 1ABEA 2XDWA 2C57A 1V95A 3L4BA 4RNDB 3D4OA 1OI4A 3TL3A 1RKVA 1SIBE 3NJRA 2UXDB 3JD1A 1H2FA 2QIPA 1U04A 1UAGA 2HHCA 5GMOA 1ZAKA 2HXYA 3IBGA 2DSNA 2W2LA 4N0MA 3SY8A 3TDKA 4K9KA 2R3SA 5GZ1A 5DIZA 1EUCB 2ZAYA 2REQB 3A4YA 4LZLA 3KEGA 3VAZA 2P62A 4AJ9A 5AVUA 3L6CA 4X24A 4AO6A 3IP3A 3C15C 5ALIA 3MW8A 3C3YA 4GP7A 3KSRA 2P9QA 1M2FA 2GYYA 3ECCA 3OFNA 5HTKA 3VR6H 4NMMA 3C3EA 4KE9A 4C0WA 1IIBA 3F67A 4KGVA 5ER9A 5BV2P 4Q0MA 2AZXA 5ICMA 1CUZA 1VECA 4LWOA 5JPCA 4ETNA 1ZOIA 1WQ4A 5AVQA 3ZKWA 1RQGA 2AUNA 3MQ4A 3MWGA 1W4CA 2EERA 3KKEA 1MX5A 4WDQA 5KS2A 1B0ZA 4D9IA 2H9IA 3G2KA 3HUDA 2F3PA 1NUQA 3AT1A 1IE3A 3F4BA 2QXTA 4IO0A 5KYKA 4KFTA 3CGGA 2O2DA 4RMGA 3R3ZA 1SN7A 4AMGA 3UB3A 2DY1A 2BELA 2KYRA 1P7CA 3T5GA 4C6SA 3OQIA 4MAAA 3ZHBA 2OCKA 5KJ6A 4WK6A 1QH8A 4N5HX 3WK4A 3X43A 5IDQA 5AK4A 1Q0UA 3W3ZB 4AJ1A 4D3YA 2X13A 1Z74A 2R5WA 1JFTA 2J30A 1G6Q1 2O1EA 3VPXA 2O3JA 3BZWA 2IZ5A 1VCHA 1Y80A 1QGYA 2P2GA 2ZBRA 4MA5A 3THOA 2XCTB 1VHJA 1YRWA 1U0EA 2J45A 4AN0A 4IX9A 1FB5A 1MV8A 4NMHA 5DEOA 4CMAA 1ACLA 3LBYA 2VATA 1YHZA 1SO8A 4LC0A 5KU1A 3NUGA 3O4VA 2YMPA 3ID6C 4ZYVA 3ANTA 2V7TA 2MTBA 3THRA 4IHJB 3VYSB 2V7BA 3G0OA 1JB9A 1D5WA 2PNFA 3LSTA 4MEAA 1KRXA 2FZWA 4IJ6A 1FNNA 4J3JA 1VPEA 4TXNA 1GARA 5AW7A 4JY7A 4K1XA 4KKVA 3T3GA 1I3KA 3WRXA 1UKAA 3USES 1A8IA 1NHGA 1VE9A 2DT8A 2ECQA 3Q2KA 1DCFA 2UZ1A 2IUSA 2JRLA 1ODTC 2WSSD 1FFDA 3DLCA 4DIMA 1SA0B 2FR0A 2JA2A 1WVGA 4MYTA 3MCAA 3O26A 4D3XA 3MVEA 4BAUA 2AMVA 4F21A 4TM7A 5A5VA 2D06A 1UBLS 2J8ZA 1CDZA 3QSGA 1GADO 3GRZA 4E3ZA 1Z2CA 1E3TA 2P4QA 3NG1A 1XZMA 4WKGA 4ARUA 1FQJA 3EG5A 3AERB 1C1HA 1UEIA 1U94A 1ZRNA 4IIHA 3VNSA 1RS0A 4QTZA 4S0ZA 1ZRSA 3A7DA 3BRSA 3N2GB 1Z39A 2PRZA 2O0KA 3EXHB 4NV3A 4AY4A 4BRWA 4CFSA 1EDBA 1M1YE 1WNFA 4K6GA 1SOVA 1I5OA 3MAJA 4J1SA 5JMOA 1Q7RA 3GC6A 4IY1A 3IS3A 1S2NA 1XVIA 3UQYS 1ISRA 1T4CA 1WZIA 2JHGA 2Q29A 2R7AA 2XZTA 5B7NA 4HXGA 4R69A 3S29A 2PS3A 4XVRA 1KDTA 1KQGA 4FFPA 3BIJA 3DCJA 3OX4A 5LWHA 5FPKA 1GAJA 4RAOA 4EFNA 4P2GA 1I6WA 2EKZA 3JALB 4H6XA 1MG5A 1Z36A 3NHZA 1KHHA 3A3PA 1TMOA 4ZV7A 3OWHA 4ZEOA 4DCSA 4BJ3A 4E46A 1QP7A 2QDKA 5A6SB 5LZ8A 2BMEA 3E70C 4GX0A 2YUIA 4JNKA 1N77A 3ZGZA 1EGAA 3IE1A 1MP0A 1XRPA 2FSUA 3UA3A 1Q1GA 1B0PA 4IUCS 4DM4A 1IJBA 1D1TA 1VKJA 3AR6A 1N6PA 4EYOA 4PICA 4YCNA 5TPZA 4G9BA 2Q28A 4BB9A 4IRUB 2WAXA 2WINI 4RK1A 4RHUA 1OXXK 1PSDA 1JPVA 4CN9A 1RT9A 5I9NA 1LDBA 5LCXA 1T3SA 4F11A 1BKDR 1M6NA 1BNCA 4RETA 1QANA 2QMZA 1XMXA 1HWYA 3O21A 1TECE 4OM8A 2ZVDA 3OZTA 1FMLA 1NVBA 2HDOA 1NOJA 2D0DA 3PFFA 1EFPA 4ZTZB 4QUKA 3MB5A 1XL0A 5BSFA 1N1GA 3TL6A 3B1WA 4MKXA 3OJEA 2Q1XA 5BRNA 2JHAA 1AK9A 1PEDA 5T3YA 2V7XA 5BWNA 3CO0S 1FP4A 3AHHA 1C8BA 3HXMA 3I61A 5EAIA 1CPYA 1SQFA 2H1RA 4GP9A 4C4OA 2BCEA 4JJEA 4ND6A 1PS9A 2Q9UA 2X77A 4P3PA 2YJNA 4WECA 5BR4A 1DAHA 1KH3A 2VTVA 1RI1A 1U0GA 3H9JA 3B82A 2OD2A 1KA9H 4QELA 2F3RA 1G6KA 2ZT7A 4M7OA 1UH5A 2OO5A 5EEHA 3W6ZA 5BN1A 1UR5A 1PW5A 1L5FA 2R11A 4BGDA 2F3UA 4RTLA 2NU8A 1IUPA 4UHHA 5THQA 3T3PB 4CF5A 1HZJA 4ND1A 2HU2A 2OFPA 4ALNA 4CKBA 2FZEA 4ECAA 1SUCA 1OLSB 3T9EA 2GAAA 1PF7E 1RWPA 3N2LA 4IDQA 1QF9A 1VJ1A 3GLFE 2IKSA 2QPAA 2Y0DA 3B1VA 5CH3A 4EAAA 4QOSA 2EX0A 1PR5A 4PBRA 1JFLA 1VRCA 4MUXA 4MWCA 4C22A 4HDNA 3RK4A 3ZDBA 4L02A 4E51A 3IB3A 5HOEA 1KP3A 4UZEA 1OLXB 3LRPA 5T3UA 4HB4A 1K88A 2ZRKA 3MAAC 1H2ZA 2J7PD 2B1JA 2GTHA 2G6TA 3BFJA 5B1EA 5K8JB 2OMKA 4HWRA 3PC4A 4JP2A 4E15A 1SBCA 3T9BA 4MARA 1H2EA 2H2IA 4OMCA 2BY4A 4E5KA 1ECPA 1FVOA 5D86A 5DBEX 1Q84A 2ES4A 2XF2A 3CVXA 1CEEA 3FPSA 2FFJA 4OI2A 1CUEA 1D0VA 2ID4A 3V9PA 4EJSC 2YV5A 1YBVA 2QL7A 2IPNA 3LVQE 2PR2A 2F17A 3SBOA 5HIKA 4WK0B 1NNUA 2XR1A 3QU7A 1V8FA 2ZBEA 1DT3A 2AQHA 1YT5A 3E23A 5IAEA 4FFLA 3V7YA 3KFVA 4UTNA 1QX3A 5C0OE 3WHKA 4CMHA 6NULA 1YACA 3R6LA 4HGNA 4D56A 1IQPA 3OJOA 1U65A 2E4ZA 4RJJA 3BXGA 3IOYA 5F7XA 4MO2A 1WULS 3D02A 1JIUA 1QYRA 3LYHA 1S02A 4XWGA 3IIIA 1QZUA 1G1MA 3JQCA 3R7WA 1A4UA 4YFYA 5ADUS 1M9NA 3FCXA 2QQGA 5TC4A 1U2DA 1WSBA 3DAHA 4KQWA 3R9XB 3FVQA 4PLTA 4KV9A 1XKLA 2P9FA 4HJXA 2BKXA 1GCUA 3W8FA 3NANA 3PDUA 3DYVA 2HSJA 2OBYA 3W9YA 5GP1A 3I8OA 4PIMA 3ROPA 4R3WA 5JNTA 1S2IA 2Y1KA 2WW8A 4WIAA 3SFZA 1GAEO 1Y6ZA 3HTXA 5GIOE 2R48A 1RC1A 5A4FS 4E94A 2VRCD 1Z75A 2FMXA 3EVZA 4FGLA 1NR1A 1Y1QA 3O8BA 2IU6A 5TX7A 4LDPA 1KI6A 2VDMB 4CR6A 5CNKA 2FPMA 3VKVA 1GCOA 3WP0A 1YR3A 1HOXA 2ZROA 2L0XA 3ICQB 4B4UA 4QWWA 4KPFC 3H8WA 4G25A 1JDBC 1GRCA 5CFOA 1KETA 4NDNE 1FU4A 3SFVA 3VYRB 1ZVJA 3LRTA 2FEOA 2DX7A 4ISCA 4TQAA 3OT1A 4JI8B 3FGNA 4RELA 1FOEB 2PT6A 4YAFA 1U7OA 4MKRA 2YDYA 1NZJA 5LA6A 3JYPA 4DRXA 2H2FA 3BB1A 5DX1A 4FFOA 1OFUX 2AJBA 1DXQA 5HM8A 5K5EA 1N2HA 1EMDA 5DWQA 1T3TA 2EQAA 3W34A 5BV1A 3CR3C 1DLJA 4WNAA 3WL6A 1G5IA 1JDJA 3CRW1 4BEVA 5DCLA 1DC8A 3GH3A 2JNWA 3PFNA 4DNOA 3VC3A 2QGFA 3TZQA 1GL9B 4LZPA 1Y82A 5CYOA 3BWDD 4MZXA 3FTNA 3DE0X 4JBLA 2JGAA 2GPWA 1KE1A 5J4HA 3KQTA 4EKNB 3H11B 3JZIA 6Q21A 5LZ2A 3WDSA 1WBDA 4JI2B 1XZNA 3M6FA 4TWZA 1E1CA 3CJQA 1R7RA 2FLKA 2FR8C 1KVUA 3EXFB 4RNCA 3EQZA 3ZU4A 1B8VA 1Z0FA 1ZUNB 2ZWOA 2Q4OA 3P9PA 1A5ZA 2CV2A 3D59A 3BGSA 3KZXA 5ERXA 1E1NA 1U2PA 2R751 3LI2A 4WA7A 4YRFA 5AVKA 4NAHA 2ZIAA 4YQFA 1Y9DA 3M2TA 4L76A 4D99A 5LWQA 4C01A 3L07A 1ZD4A 4OHCA 1UJ6A 5CDSA 5FLKA 3D7RA 3X2SA 3MPUA 4ZK6A 5DWDA 2C59A 1VC2A 3TEMA 4RH1A 2LCQA 1VBFA 4AZTA 4AZVA 2UUCB 5DNDA 5DLQC 3R9IA 1E61A 2I8CA 3IHWA 5K3CA 1QOZA 3EGWA 4OGLA 4LF9B 3K2QA 2RBEA 1IJKA 1YWGO 4R7TA 1C9KA 1Y42X 4KO3S 4D9FA 3B9PA 2IDMA 3I09A 4C7JA 2H59A 5E2BA 5MN6A 2VQ6A 3WRYC 5JC8A 4I4TB 2VCHA 3NDPA 4ALMA 3GFPA 4GOXA 5A62A 4QDKA 3G02A 2QPLA 1IEQA 1FX0A 3TJZA 5HS4A 3ZXSA 3GEDA 5B6IA 4E33A 4A5SA 4BVJA 1N4DA 4LE2A 1QHGA 4OL9A 1J8YF 2ZTVA 1A3CA 1Z3CA 1HOTA 2H5EA 1POXA 5FBRB 2C5BA 2J31A 4X8HA 4NAUA 1YS1X 1Q11A 3HXLA 4B6EA 2ZR0A 2YNMD 4ES6A 1T2AA 1IEXA 2P0AA 3O0TA 5F73A 3DTVB 3TNJA 3NOOA 1FFXB 1CZKA 1DWOA 2RGBA 2HMUA 3UAVA 4LDAA 4MPDA 3BKWA 1LV7A 3JWJA 1DKQA 1Z5NA 1JPJA 1T8WA 2RBKA 2VBGA 2Z3VA 3CN7A 1T2DA 2ZRCA 2ZWPA 1F4PA 1WDWB 3JQ7A 4PGAA 1T8TA 2H7CA 2HJWA 4IDFA 3I5MA 4NENA 4WE3A 5FA5A 3ZOZA 4D82A 2BFDA 1YZYA 5HJ5A 1FQKA 1YZ3A 3AZOA 4P4TA 3ZVKA 3IJEB 2HREA 2X2EA 2XMDA 1C8KA 2PMEA 2VDRB 1ZD9A 1Y7LA 3TSYA 3NT2A 3GZNB 1X2EA 2L69A 4RQAA 1O58A 2R6AA 3LWZA 3EVNA 1S8NA 1BVYF 3AIMA 2W8ZA 3PGKA 2XBLA 1QZZA 1DRKA 3SYLA 4F3RA 4OUDA 1TQ4A 4O6VA 5K8VA 4ENPA 1UDWA 1JKIA 2WIAA 3I9LA 4HEHA 4BBAA 3NHMA 3PUHA 1S96A 4GNRA 2CXPA 1GKYA 1ESNA 1P1FA 1E6WA 3ZJVA 4CTNA 4D3SA 3K2EA 3OFKA 1DVRA 1K7YA 2BHSA 1NJ8A 1T6NA 2DXIA 2EFHB 2CMKA 1GV1A 2UZ0A 3K5PA 4O4HA 4X1KA 4AKGA 4LE1A 1E9DA 3BMCA 3GVXA 4Q3CA 2G63A 3PXDA 5FA6A 4AF8A 5IX8A 5JNWA 3PCXA 4IJQA 4R2IA 1CU1A 3G82C 4Q05A 3OJCA 4RMIA 5DT2A 4B3FX 1C3XA 3EA5A 4TV9A 5SZIA 2NU7A 4ZPJA 1QYXA 3IYLW 3COWA 3KZCA 3SEZA 4E2YA 4QRHA 1R6DA 3H5IA 1HQKA 1RBQA 1SD1A 3SXUA 3ENWA 4HB3A 4ZTBA 5FT9A 3EGOA 3CSDA 4ZN6A 1O0BA 4Y67A 1JU3A 1HE1C 3QEKA 5TDHA 1WHSA 1UF9A 2D3TA 1JHVA 4C08A 4EK9A 5CK5A 1SRRA 1MAVA 5IKPA 4R84A 2YWDA 3TLMA 2QW1A 2XT6A 4HXEB 2BD0A 4L75A 4CMJA 1I0LA 3JQGB 3SN6A 4JBYA 1FQWA 1ZFNA 4G8CA 4ERNA 4L57A 1ODIA 3BWEA 1OYVA 1JTVA 2WWHA 3FCEA 1OV4A 5D5QA 2QAIA 4MIEA 2VT2A 5CYGA 4HQRA 2Z30A 1MRNA 4NU6A 1TT7A 3IQZA 1JQAA 1P1CA 2IKQA 5NLLA 1SOWA 1DWPA 2ZRMA 4FHGA 2YH2A 1KU0A 3OKFA 1ZX1A 1DJMA 3RI3A 3B48A 4KLAA 4L5AA 1N2JA 3DG9A 1PYOA 2BJWA 5J2TF 5T4FA 4BUZA 3ZE7A 4NONA 2QR5A 3I2HA 5DSZA 5ES3A 1ZJ6A 2CXNA 1AV7A 2O3TA 3VVCA 1XTUA 4MPRA 1U5BA 4TXMA 3NM4A 3OKPA 2FZVA 3V33A 2R4TA 1WHTB 1L5OA 2VIIA 1U98A 3KWMA 4BB0A 4CIXA 1EDZA 1D1SA 4HX2A 1KNQA 3NBMA 3HRHA 3GLSA 5ELLA 5JSQA 3E9DA 5AW0A 1WZEA 2XKKA 1I7LA 3AW8A 3C98A 3DV9A 2A5GA 1PFYA 3K9QO 4K9DA 3SJUA 1E6UA 2FQYA 4EPVA 4OQQA 2ON6A 2F43B 5AVXA 5KOJA 2QNRA 3B6ZA 1B0UA 1CYDA 4LPSA 4RA6A 1S0UA 5T4BA 2QTWB 5KTOA 3LHSA 4EFLA 4B83A 3R41A 3HJRA 5DCUA 1J6UA 5AKIA 2Z2KA 3EY4A 2FWMX 2CLIB 2WZBA 3FIJA 3RYHA 4AZ0A 4DY4A 4F6RB 3OU6A 3VPDA 2O8BA 3BGDA 3HJCA 3FFBA 4REQB 2VTEA 4J1TA 2ZUEA 4B3RB 1DQPA 2WJWA 4E31A 1CLEA 4BIIA 5EIEA 3NP7A 1SUPA 3BIOA 2WT8A 2Z2XA 3WGQA 1XTIA 3Q1KA 1EFUA 4HK4A 1OWOA 1KO4A 1UOOA 3IAHA 1DTEA 2AGVA 1T8YA 2FSGA 2PDAA 3E1KA 2Q1SA 4HNQA 5B1IA 1DAGA 5CEJA 5LZ9A 1V96A 1VHWA 1S6YA 3GRUA 2OO5C 3NT5A 1U8ZA 3Q8XB 1SHJA 2DPXA 3H65A 4R2LA 2OBLA 3R7BA 1BC5A 4AX8A 4JU9A 2VQEB 2ZATA 1HEUA 3BTOA 1W2HA 3RVPA 5MFZA 1DCTA 1ZVQA 3G0DA 3P2JA 5K0LA 4FGSA 3MHTA 4C04A 1EQ2A 1FP2A 1B42A 2XE8A 3NHBA 4V3BA 4AQDA 1ZW6A 3PWSA 1TM2A 2CL0X 5E4JA 3ZW8A 4BLQA 5C7OO 1TUBB 3CXUA 4IKOA 3TMAA 2V45A 3O2NA 2ZI6A 3H5TA 2RCNA 2JFQA 4U7GA 5DW3A 2YFQA 4NBSA 4D25A 4AWBA 1CY1A 2FI1A 4H18A 4F4CA 2WIBA 1EVEA 1KMIY 5J4YA 3GLHA 1CZLA 4MUAA 4YUWA 1X74A 3VDQA 1N57A 5GPBA 4L0MA 4OH7A 5ES4B 2O8FA 1RWWA 1CF4A 1OFTA 4NRDA 5EN4A 2OLEA 4JVOA 5TSDA 5AM3A 4P35A 4TZTA 3VNVA 2ALJA 1ZM4A 1JGTA 3EXIA 3KKZA 1XZJA 2EG9A 3RRZA 2G09A 2PBLA 1PQWA 4CF3A 4LSZA 4HGYA 1YBAA 4Y0VA 3V8BA 3HB1A 4L16A 2AS0A 4RDIA 4RD2A 5FXMA 3W5CA 1QGZA 1OV6A 1E2QA 4ZU1X 3W04A 5CFLA 1HDGO 3UTCA 4X9XA 3RTCA 2KSQA 4I36A 2HU5A 3V8MA 2J48A 2P11A 3L0PA 2GNPA 3KWFA 5AOCA 5C7LO 3PRYA 2IYTA 2ZLBA 4E32A 4HDMB 1H2YA 4MW0A 2OGUA 2QG6A 4MICA 3V3TA 2XYQA 1U2DC 3LWBA 3M34A 5ENVA 3R3WA 4GL4A 5AI4A 2FMUA 3RJZA 5K0ZA 3INNA 3I32A 1IM2A 3DZFA 3B8EA 3HV0A 2VHTA 3SLRA 4C3VA 4RTRA 3LM8A 3IDFA 1B15A 3V1YA 1GA1A 1BH2A 1F5SA 2EZUA 1O95D 3SR3A 5EHGA 2YHIA 5HUHA 4P31A 5JYBA 2HF9A 4GQBA 4L9AA 5K6AA 1JJVA 3HNRA 1YQWA 4H7HA 3QOFA 1Z56C 1MJFA 3OTGA 3NDRA 4JUCA 1JEYA 1PUJA 1WW3A 3JQEA 3O3MB 3N58A 3NWBA 2FUG1 3RWMB 1UWKA 3A6KA 3ZYCA 3AP1A 4FT4A 3KQVA 2ZI7A 1O97C 4I7EA 4GKKB 5FWDA 5CNIA 2Y67A 3DNFA 4BNYA 1K63A 3L1HA 1OZHA 5EZYB 3DDNA 4QBFA 3GRRA 4M6WA 2H57A 1I24A 1J24A 1KY5A 4KYIB 2FFRA 2PXCA 1NXXA 1RXSA 1USWA 2TYSB 3PLRA 4J43A 5CPFA 1OWMA 2ABWA 2FUKA 1GL3A 2VXYA 2AQIA 2QTVB 3DKRA 3GGJA 4IMPA 2YN4A 4Q9LA 1UMBA 1TF2A 3LL4A 5TF0A 3O8NA 3TRIA 5IKMA 1AJEA 4MB6A 4OHYA 4NCNA 9LDBA 2GN0A 2VAMA 1G17A 1W35A 1IK4A 4HXYA 2YW9A 3W9SA 1CE8B 1KMHB 5IPFA 5BXYA 4H7EA 3QEMB 1E1RD 1EINA 2VHJA 3QFHA 2GD1O 5D1HA 3FF1A 1IH8A 4BFWA 2CJPA 2JDIA 2ZANA 3ADPA 2B98A 3KPWA 5EXXA 4O1HA 3KPVA 2W98A 2ZJ3A 4EFKA 2X6TA 2KHZA 3TIIA 5KHOC 3JTMA 5JYCA 2GHIA 5FWYA 4D3ZA 1ODKA 4AKHA 1W29A 5F76A 3V32A 2ATXA 2AC4A 4RZHA 2RFLA 3SC3A 5DGDA 2B1IA 3VZSA 4CM8A 3KLBA 4RDXA 2OD9A 4DDUA 1T1EA 4PANA 1BVUA 3C3JA 4YLGA 1HY3A 4E7PA 2CXRA 4WNIA 1X7WB 4Z9BA 1KQPA 3EEOA 3MN1A 2Z4RA 4B17A 1L5WA 2H4FA 1JVNA 3DBRB 3JSAA 1GGNA 2NSDA 4FKMA 4PSDA 2Q9BA 3S7TA 3N6VA 5LLDA 3QXXA 1U0BB 3RIXA 2VCYA 1D2CA 3P96A 3QYFA 4WFKA 3K0AA 3UEOA 1F17A 4BWGA 5ILOA 3AETA 2EGHA 2RHWA 3LCVB 3C24A 4MWBA 3R6TA 4R05A 3OQOA 4CEIA 2GPNA 3N3AC 1PJ8A 1RRCA 2XCIA 4WXRA 3OTOB 5CIWA 3EZ2A 1AV6A 5ALJA 4FNAA 2JFHA 2Q5OA 1K92A 2QTZA 4URFA 4ZO4A 3G2OA 3MMZA 1CJKC 4ITUA 5K0BA 5JVDB 1YSCA 1GTVA 1USGA 2ZBGA 4I1YA 4RMJA 2ID8A 1W5SA 1E1MA 1A76A 5FFNA 2X0DA 2VTKA 2X1MA 3DTTA 1AHNA 1FE8A 1M0WA 3EUWA 1X7YB 3F7NA 1Q1EA 3LYUA 4CMBA 3LC7O 3VX4A 3TFOA 2YRFA 5BQOA 4CW7A 3LY8A 1EFVA 2YC2C 2XNDA 3EMDA 1KHTA 3HWWA 4I5IA 5TMBA 4DMHA 1OH7A 2K2WA 1PDVA 2TS1A 2XQGA 2CMDA 1L5HB 2H16A 4WZAA 3VZCA 4CLHA 1V6AA 1YRQA 2QW8A 1O57A 4EW2A 3K31A 1CUJA 2RHJA 3NEPX 4PLCA 1K4KA 1XRQA 1RWQA 1KO5A 1TB4A 2HU7A 2QHXA 3EA4A 5A04A 5EJAA 2W58A 2EP5A 2IXEA 3K09A 3RHFA 3D2BA 2YHUA 2ZB3A 4X92A 1KYIA 3MT7A 1YZKA 4LTMA 4LSGA 4DN6A 1MJGM 1Z4QA 1CYEA 1OD6A 2IA5A 4YP7A 1OU4A 5TQ2A 3B1ZA 3KJZA 5ENDA 4GKBA 3DAPA 3GLUA 4YALA 4BZQA 4DA7A 3IUQA 3JQAD 5JOQA 4RZ2A 3STXA 3OFVA 2CHFA 3L9WA 3CWQA 5AI9A 3VOBA 3BORA 3GP8A 4UVGA 5EE9A 4OB8A 3P4XA 4IIBA 1DFGA 2R1ZA 2ZDQA 2SNIE 4BCBA 1DARA 2ZJ6A 3OZRA 1KQNA 4GAEA 3SF0A 3U4HA 3L79A 3WO1A 3O73A 3X0DA 1R6UA 1U9IC 1ZXBA 3DFZA 3NCHA 2UDPA 1V8DA 4UAVA 4B4DA 3E48A 5E8JA 4BKMA 1BW9A 3EOAI 2Z4SA 1ZK3A 3VPSA 5BN4B 1JEOA 3PX3A 2CVOA 3GJ0A 3GVIA 4MLDA 4LGVA 4YDHB 1V26A 3CRVA 3BSWA 1H2HA 1ZMTA 1BYIA 2L19A 2X5XA 3GK3A 1PP4A 3MRXA 1Q2XA 1WRBA 2GPSA 4GP6A 4ND3A 2AE2A 5C4GB 5LNK1 2I91A 1XZIA 5K3BA 4YP6A 3K32A 1U8AA 2DH5A 4X3PA 2I66A 4JJ8A 2B3TA 1OVGA 2PKQP 2CLEB 3VSDA 1QIGA 1QIIA 2EX1A 3V2UA 2JIBA 2XGGA 4H1WA 5LP6A 4LVCA 2CNKA 3RVNA 3DDHA 1GUFA 2PRSA 2UUPA 3OIUA 1VJGA 3EEFA 1J7JA 1SEVA 2CNOA 2Z5LA 1T3HA 3NH6A 3BMOB 1ZIDA 4IZ6A 3CX4A 5IUJC 1SG0A 3MWKA 4PVCA 1UPUA 4Q03A 3G8DA 2JEOA 1JLLA 2B4YA 1AXGA 3IPLA 5JNRA 2AR7A 4C88A 1IYZA 4UEQA 3II6X 3MM4A 4UHCA 4ITVA 4F3YA 2P9JA 2WQ6A 2WB2A 4DV7B 4LYAA 1BDIA 2WWVD 1U2QA 1W19A 4RPLA 5KNLA 1FNCA 1OOEA 2CXTA 2EU8A 3EOZA 3LY5A 4IYJA 4QRIA 1HKHA 3U09A 3RFTA 3VR4A 1Y6FA 4HAOA 4RSRA 4BP3A 1JB1A 2B8JA 3DCYA 1QHHB 3TOVA 1N3LA 1XEAA 2B9VA 2W00A 2IIVA 1YKGA 2V3CC 4PZLA 3ZHTA 4ZFNA 5EE5B 3O5AA 4MS1A 1J2TA 2H4YA 3PL1A 4HMPA 4I6GA 1EG2A 1G66A 4L5IA 2PYZA 2P9YA 2JBAA 1V5EA 4HNGA 4XPIB 1XKTA 2C1EA 2GM3A 3OZIA 2I3AA 2FMKA 5IK2A 1NJ6A 1NTOA 3FSGD 5KYYA 1QDEA 1XRRA 2JF0A 4XGNA 5FPHA 1CY6A 2ZIZA 4JLAA 4BV8A 3CEPB 3HB9A 1EM8B 1SHTX 2VT6A 2ZJAA 3DXYA 3KOZA 4IIJB 2D2EA 2X5OA 4OQMA 2KLHA 4LHVA 4LI0A 3RVRA 1KVQA 1JHDA 3FDZB 5FWXA 4AZ3A 4CKEA 2BEVA 2PAFA 1ESMA 2VPTA 3RC1A 1VB5A 1WCV1 4B4WA 4AIRA 1BCSB 3VVBA 3QEOA 2RK4A 2C4UA 3FLAA 3LBIA 4YN3A 5HGXA 1XVLA 3JD4A 4K9PA 3PHLA 3CX3A 3X44A 3D81A 3TDNA 5LQMA 5D3KA 2QV7A 3LPDA 1REQB 2XODA 1XTZA 3L6OO 3TOZA 2ZE5A 1D4OA 3CIFA 3HK2A 4BNUA 1MJHA 2WD7A 5C3UA 2ZSJA 1B6TA 1CZUA 1L5VA 1SZPA 3AR3A 4X63A 4S2UA 3WKEA 3LVFO 5JJIA 2OL4A 3I2YX 5J58A 4D5EA 5B64A 1KMQA 4US2R 3WQHA 2V9CA 1ZITA 1ZL0A 4GUDA 1E2MA 2V6JA 4N12A 1SBIA 3BJEA 3QVGB 1N7GA 3WGLA 4RTMA 2JW5A 2CE2X 1SVKA 4R71A 3CSUA 4CF7A 4PC7A 1HYHA 2CSUA 1CHDA 1II8B 2FDRA 2C3UA 4GEGA 3I64A 5EWJB 1E99A 4CQNA 5G53C 5HJEA 2H3EA 4CLXA 2NO6A 3U6KA 3CN9A 3FNGA 4HEA1 3OE5A 4B6FA 4EJ0A 2A7QA 4JP5A 3PB3A 2PGNA 3R5JA 4HATA 4UREA 1P1JA 3NKFA 2QTMA 1LLDA 1O8BA 1E9AA 4J03A 1OBHA 1YR1A 3BL5A 1S2LA 3KJHA 2GDJA 3Q87B 5ADWA 5L4NA 1RZVA 1JIQA 1A04A 5JAMA 3H7AA 3G2MA 5CTAA 4A6DA 1GRVA 3TUZC 1IRIA 2R1TA 1DEHA 4FHZA 3OAAA 4KGZA 2CVFA 3T3DA 4EB6B 1V9LA 2IZZA 5E9QA 4KNVA 2VH5R 1E92A 2XPCA 1X87A 3VDXA 2EEPA 1TF7A 2JIZA 5FORA 2OT3B 3AF3A 3NO4A 5BRJA 3ZU3A 3ZCXA 3VR2D 5EL0A 4V1CI 4MQMA 3DQZA 2PU7A 2QJOA 3H9CA 1E0SA 1XP8A 2NZ2A 3LCRA 1KZ7B 4CU2A 3NVDA 1Z73A 1HH4A 2GEBA 2J09A 2J3JA 3G2IA 2ZCJA 2IYLD 1D04A 1RQRA 2WT9A 2OXRA 3NGLA 3MS7A 1Z62A 1DKOA 3PKJA 3WRVA 2JLQA 4DB2A 5DDIP 1G8PA 1YVUA 4X60A 2AB0A 2HBYA 2JCYA 5IJAA 4TTTS 3AXSA 4Z4FA 1HZZA 2C98A 2D1TA 4WVFA 1QH0A 2V5VA 2R62A 3HEBA 1ZS9A 3QJ5A 4WX2B 1W34A 1ATZA 4JEIA 3OCJA 3THWA 2NTJA 2O0JA 1J2UA 4PR0A 4QGBA 5AIAA 3STYA 3ZBTA 4JLWA 4OOEA 4D0RA 3NIFB 4IIUA 3DNMA 3QQPA 1FTNA 1Q3HA 1ZSVA 2VYFA 1GCGA 4ZZ3A 4RPGA 5LSAA 3OCCA 3H83A 3PFHA 2J9RA 2Y1LA 2ZT6A 3CUWA 3WYCA 4HDKA 2CF5A 3EQ2A 5IVKA 4NYIQ 3KE9A 1K89A 4MIOA 2V0NA 3QLVC 5KC9A 1BXKA 4B31A 2AN9A 2GKGA 4QE3A 2B7CA 2BKUA 1LD3A 4R0MA 3ERCA 2BN4A 1BD4A 1KERA 2FK8A 5HF6A 3CRRA 1U8CB 3S2SA 3ZDQA 4IKPA 4RZUA 1SBZA 1SJ9A 4V24A 3UWOA 4C21A 2WYIA 1XYYA 2QVLA 5F51A 3VJKA 3WIBA 1AQJA 5BSVA 3R4VA 2F9LA 5FBZA 2XMPA 1J0AA 4DDVA 3NU1A 3ESBA 1ZM2A 1TKCA 2JB9A 4LK3A 1YU9A 1XZQA