4DVGA

Crystal structure of e. histolytica formin1 bound to ehrho1-gtpgammas
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
164
structure length
164
Chain Sequence
b'LKIVVVGDGAVGKTCLLLAFSKGEIPTAYVPTVFENFSHVMKYKNEEFILHLWDTAGQEEYDRLRPLSYADSDVVLLCFAVNNRTSFDNISTKWEPEIKHYIDTAKTVLVGLKVDLRKDGSDDVTKQEGDDLCQKLGCVAYIEASSVAKIGLNEVFEKSVDCIF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rho-like small GTPase
publication title Entamoeba histolytica Rho1 Regulates Actin Polymerization through a Divergent, Diaphanous-Related Formin.
pubmed doi rcsb
source organism Entamoeba histolytica
molecule tags Gtp binding/actin binding proteins
total genus 51
structure length 164
sequence length 164
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2012-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dvgA00
4A2PA 2IS2A 2ZJBA 5JZVA 1SVLA 1EESA 5TVKA 5KHOC 3C5CA 4B48A 4GOJA 3SI7A 3BFKA 2RH5A 3TVTA 1TQ6A 2B8WA 1JALA 3IGFA 4J0QA 2ZE7A 2FU5C 2J7PD 2XTMA 4O3MA 1OPXA 2JAQA 2VP5A 4RZXA 2IS6A 4QXAA 4M2LA 1F60A 4ZPXA 3KKPA 3L43A 4GZLA 4TLAA 4C4PA 1U2RA 5DO9A 1N5IA 2C8VA 4NBSA 4XWAA 3PITA 4B44A 2ZE8A 2NO9A 3AH8A 3ICEA 3M1IA 3GMTA 4OI1A 2EYUA 4Q5IA 3C16C 2REBA 3LD9A 2IUUA 1W5SA 1IY2A 2F1HA 4LC1A 1R6BX 1HE8B 5EZ5A 2GXAA 1EGAA 3W5JA 2P3SA 1GRRA 1M8PA 3U3RA 2GKSA 1TQDA 3WMGA 5JSZA 2X2EA 2V55B 1OH8A 1ZP6A 2ODEA 1VCOA 1W1WA 3I62A 4XVUA 4GP6A 5KSPA 4HB2A 4K81B 1JAIA 4XJXA 4FIDA 3LNCA 3LLUA 3Q9LA 5DYIA 2V7QA 4Q4HA 4XSHA 2ZXUA 3Q85A 5BQ5A 4HDCA 1DAKA 1US8B 2W00A 1M2OB 3KFXA 2FGJA 5CDFA 3ETLA 5TY0A 4G5OA 4GMDA 4IHQA 4LV6A 5ELXA 1DG3A 4KAXA 4RFSA 3RS4A 3AVYA 5D3MB 4EFLA 4G01B 4QBIA 5CJPA 2NZ8A 4MRVA 3RS7A 1Z6GA 3DZ8A 2HJGA 1Q1EA 1P4SA 2Q3MA 3B1YA 3LH5A 4P4UA 4JL6A 1FUKA 1MR3F 3SDZA 4AD8A 4IEEA 2PX3A 1Q1QA 2I1QA 4ZIRB 2DB3A 2WIBA 3BOSA 3KXIA 1G6OA 4QG7A 2GVZC 2GEVA 2RGCA 2QG6A 2YOHA 4XWKA 2PZEA 5FTKA 2P2LA 1KZGB 2C03A 2PT5A 3IKJA 4QBGB 4D4MA 2ZAMA 1S3GA 3AKDA 3JZMA 2VL7A 4G3XA 2NO0A 2RHDA 1W36C 2C98A 1C1YA 5B58C 1NBMA 3IPYA 3RS5A 2ORVA 1T0JB 1XD9A 3U3KA 1R7RA 3UG7A 5C4MA 5HZHA 3RS2A 4ZDJA 2Q9AA 1R10A 1E2QA 2BM1A 2ZUCA 2QPTA 3I5XA 2DFNA 1GUAA 3DL0A 1JI0A 3ADCA 3UG6A 4IFEA 1N6LA 1E1RD 1U9IC 4LJ7A 3HR7A 1EFUA 3QG1A 3KKOA 5FL3A 5E95A 4JSTA 3VU9A 1UKZA 4FCVA 4OK5A 4U00A 4OHVA 1P2TA 4PC3A 4MYHA 2JLRA 3K0EA 1BYIA 4PC1A 1G5PA 5KNDA 1RIFA 5A5GA 2OBNA 2IXEA 4LHYA 4Q1BA 4DKXA 3CBQA 1XEXB 4GP7A 4XIGS 1XCPA 1X8LA 4A6PA 2H8KA 2QSYA 2JLYA 4AKHA 1WF3A 4LHVA 1EFTA 1XTRA 3CLVA 4E09A 3EPLA 4GL2A 1II8A 1DAIA 4NTZA 3QKUA 4WOPA 2KI5A 2ZROA 5FOSA 4AWXA 4JVNA 1P7CA 2KBEA 2OBMA 3FKQA 3OESA 2A30A 2R9VA 1Z29A 3NH6A 4LZZA 2B6HA 2IYYA 3KQLA 3ZD7A 5KDLA 1YU9A 3N70A 1NIPA 4MYTA 1AK2A 3RRZA 1OIWA 2ZVPX 221PA 4E5UA 2ZJOA 2QN6A 2Q0HA 4ASUA 2PLRA 3QPUA 3QSYA 4XSGA 4F38A 1D5CA 4Z54A 4Q7MB 1KGDA 1XP8A 1KKMA 1T5LA 3FMOB 3KDSE 2JJ2A 2A5YB 5SZKB 2ZUDA 4G0NA 2HLDA 3U7GA 1KZ7B 3NIBA 3NDBB 3D8BA 3OFNA 4PFSA 4KVAA 3ZVNA 4US2R 1LTQA 4QOSA 2J1LA 2CCJA 1VTKA 1XJQA 4JYCA 3AVTA 3B9QA 3AV0B 3W5IA 3VU9B 3X1XA 1XX6A 1YZQA 1OB5A 2A5GA 1D2MA 3LO5A 1BIFA 4YDHB 2WOJA 3KXLA 3K09A 3VR2A 1E32A 2DFKB 2F3TA 2SHKA 2C2HA 2A5DA 2OCYC 3S1AB 4ZKEA 1XD8A 2BEJA 5KSZA 4BECA 5FBVB 2ODNA 4GNKA 1G1MA 2NZJA 1E9SA 3CONA 3CRVA 4FMCF 2P6NA 4QNMA 3BRWD 1COWA 4U5XA 1HQCA 4P32A 5DSZA 5JLJA 1F5NA 1ZMXA 4JLOA 1RE0A 3L8ZA 1GL9B 4TMZA 2CCGA 4BRUA 3OIUA 1JXMA 2BV3A 5CM8B 2O8FB 3KZ1E 3B7GA 2ZRJA 2WWIA 3LVRE 1P9RA 4FI3C 2J59A 1RFLA 3QKRA 2QY9A 3AF0A 4RCZA 2UKDA 5C2JB 1L4YA 3DEFA 1VHTA 5KPJA 1PLJA 4URVR 2R62A 5FOXA 1H8HA 1YZUA 1NKSA 4NCIA 4C0BA 4DB2A 4M1TA 5E7JA 1IM2A 1E0JA 1Q57A 1UEJA 2B7BA 3KJIA 3DVLA 4XOIA 2GJKA 2PH1A 3K0CA 2OAQ1 3EA5A 3SFZA 3ICQB 3TUIC 3NXSA 1VCMA 4HAWA 1CJKC 1W4RA 4JVMA 4X8OA 3FHTA 1GVNB 2HT6A 1AS2A 2WOOA 4Q7JB 5G40A 5J4YA 3BJIC 4OHXA 3X1ZA 721PA 1E2FA 4IOJA 4NU0A 2OO7A 1Z08A 3R8FA 2BKEA 1Z6YA 3U7FB 1VIYA 3PUYA 1P6XA 3R9IA 2Q3HA 3TR0A 2CK3D 2V1XA 4YDSA 4C7OB 2FPLA 3RHFA 2WJHA 3R7WB 5CIQA 4Q7LA 2NO7A 3NKVA 3B78A 2WWGA 3CNOA 5UKDA 3A36A 1AKEA 1NY6A 2BMEA 1EFRD 3A4NA 3LQQA 4TWZA 3TE6A 3U3JA 5DN6D 2IHBA 4JL5A 1KK1A 4OK3A 1JEDA 1M7GA 2FN4A 5EE0A 3VX3A 5K8TA 3EPHA 3K0SA 2DY1A 2OFXA 3GEIA 3VR6A 1YHNA 4MITA 1YRBA 4NPHA 2CLDX 4JLNA 4ZO4A 2ORIA 1MOZA 1J90A 5GVRA 5J4HA 2G1KA 5CM9C 1MO3A 4QGGA 3GJ8A 1E94E 4QRHA 2XJ9A 1GRQA 3B9PA 3KKQA 5FTMA 4C0QC 1F2UB 3U6BA 1OXXK 1MABA 1JPJA 1UBEA 3HYTA 3G0HA 5SZJA 1R5BA 1KDPA 1IAQA 2JATA 1XJ0A 4OQXA 3GJ4A 4UNRA 4PXAA 2ZSEA 1T3HA 4NZYA 4MQBA 1P9NA 1YR9A 4URZR 4MDEA 5F3WB 4R98A 2W6ID 2FDCA 4TMTA 3SE0A 2QORA 4DDVA 4QHSA 2IHYA 3RRNA 3GLIA 4FXPA 1G64A 1OV4A 3EZ2A 1UDXA 3SEAA 2J5XA 5CB6A 3U6KA 2GZHA 4AYXA 3ADKA 4PQFA 1ZD1A 3W90A 5KTYA 2XX3A 3IBGA 5FPSA 4Q03A 5CLLA 2QP3A 3GLHE 1G5RA 2DYKA 4BRWA 2OG2A 2JLVA 2NTYC 2ANBA 4P3YA 3B1VA 1T3LA 2G0TA 1VG1A 2ZYVX 4CEJB 2IS4A 2IYZA 2MMCA 1AQYA 1G291 2Z4SA 4RY2A 2PMDA 4G5GA 5FBLB 1ZNZA 1GKYA 4C0KA 2JJ1D 2BDTA 4LPKA 1MABB 2QM7A 4EJSA 2IF0A 4NCHA 3TRFA 4BFXA 1S2MA 4FCTA 4D82A 3I92A 1NLZA 1N6IA 1Z2AA 2C04A 4B6EA 4M9QA 3THOA 2PL3A 2RGNA 3RRMA 4OI2A 3WYGA 3MMPA 2F6RA 1IXRC 4X8MA 2RGEA 1IHUA 1G41A 3U61B 3TSOA 3AVPA 2ZPTX 3R9XA 3DMNA 4TZ6A 4QFMA 1LFDB 4R71A 4OL0A 4PO9A 4LY6A 1E2IA 3OEHA 1ZM9A 4DCUA 4Q4AB 5EQTA 2XB2A 3AVUA 1AGPA 2ASEA 1YKSA 4DSUA 4B3XA 4TSFD 3C4JA 5DIFA 5TARA 4D2IA 4F4JA 2FFHA 2ZR7A 2ZRDA 2NO1A 4LJ4A 4QGAA 4G5QA 3Q5DA 3SBEA 4GDFA 5A4JA 2FSHA 3IHLA 4DIEA 1HUQA 1E2GA 5DISB 4HZUB 2XNDA 4B35A 1FX0A 3L8YA 3X1WA 4Z1MD 4JLMA 3KXKA 1KO7A 3GFTA 3Q72A 4TYYA 4LJYA 1QZXA 1GILA 3ZZUA 4DDTA 3AGPA 4NL4H 4EJSB 3EZFA 1E2PA 2NGRA 3CR8A 4I4LA 4Q1EA 1Q0UA 5B2ZA 1IY1A 4XVRA 3OHMA 3X1DA 4TMXA 3I3SR 1RW4A 1E3MA 2BMFA 2CDNA 3WYAA 3E5HA 4A0RA 4HAZA 4PHHA 5JS8A 2RGBA 1NJGA 1JBKA 3V00A 1UBCA 4KCGA 2PEZA 3HYRA 2BBSA 3BERA 2ANCA 1OE0A 2Z0MA 1XFAA 3TKLA 3F3YA 4MGYR 3WBJA 1HURA 5JEDA 4NYMQ 4B6FA 1P5ZB 4OHZA 2W0SA 3BIFA 4DEXA 3W6PA 1NN0A 1FP6A 4X8HA 3TGPA 4S2EA 3TSWA 2IL1A 1U8AA 1UAAA 3EW9A 1XRJA 3SHFA 5J4KA 1JR3D 2OAP1 4OQMA 2V54A 5FPYA 3CPEA 1ZM4A 3FFAA 4OK6A 2D7DA 5P21A 3C14C 4TMVA 4C2UA 1N5KA 5KDDA 1VCNA 4A2QA 1J2JA 1TADA 1MRSA 1W0KA 2W6JA 2X2FA 3QNUA 4JVSB 3N2IA 4KHZA 1CF4A 4KBFA 3W9YA 2ZSBA 1TTTA 5BW8A 1ESNA 2IXFA 5L3QA 2TMKA 4O2LA 1ZD9A 2KE5A 1E96A 3GP8A 5E4FA 3LW8A 5DHAA 4PQYA 1CR1A 2QTFA 2IF2A 4ZKDA 4KVGA 1FX0B 2VHCA 2YV5A 4JBWA 2QAGB 4A8JB 1R0YA 4I81A 1SVMA 4IDNA 3FMFA 4M1YA 1VIAA 2ZSFA 1KKLA 3DMDA 2YOFA 1IN6A 1G4AE 4HEJA 2K5UA 1U8ZA 1J8MF 5FPHA 1SXJD 1U9IA 2KSQA 1R0WA 3ND9A 2BIFA 2GWHA 2BOVA 3T5DA 4C2TA 4DXAA 4ESVA 1H8EA 3K0FB 4BFYA 3VTKA 5J47A 1GDDA 5J40A 1IQPA 2J0UA 1OKKD 3NEJA 4LJ6A 3RNLA 2VHTA 3T15A 1G8PA 3FOZA 4CEHA 1AA9A 4Y0VA 4GT1A 1N6OA 5LDDC 1I2DA 5GJVC 3QF4A 2W58A 2F55A 1XNJA 3WXMA 1A7JA 2BMDA 1RRPA 2XZPA 4M9XA 1X86B 3P20A 4KODA 2ZTSA 4GSYA 1QRAA 4P4TA 1B23P 1FQKA 4FMDF 3KX2A 2WJIA 5JCPA 3BC1A 3OE7A 1GRNA 3ZJYA 2W0MA 3K0CC 4H9GA 4DCSA 1WMSA 2O52A 2WJVA 3EARA 5FBQB 2FG5A 3R20A 4UKDA 3K9LA 4IDHA 1MO4A 3MWKA 1E9DA 5AUQA 2WZQA 3FKSD 4V0ME 4IVRA 3FFBA 2I3BA 2AXPA 1Q1ZA 3LW7A 4HB4A 2V6JA 1J70A 1EFHA 4FW9A 4TN1A 1Z22A 1R0XA 2PCLA 1K8RA 1KJZA 1W2HA 1G6HA 1KMHA 4FCWA 4QHTA 2MMGA 1KSHA 1RJ9A 2GILA 1OLOA 2FSFA 3NBYC 2QZ4A 1XEWY 2NPFA 1XZQA 3BORA 3U2QA 1GNQA 3ND8A 5FTNA 1BMFD 3CRRA 4RKFA 1G17A 1NIJA 1A2KC 2GCPA 2QM8A 2YINC 1D8TA 4RD0A 3B13B 3WBKA 4DLUA 4QBHA 2DHRA 3AEZA 2AKAB 3QXCA 1EWRA 4CEHB 3EIQA 2Z6VA 1ZNYA 5HPYB 3QF4B 1TQ2A 1GFIA 2V6IA 1AZTA 2FPMA 3EZ6A 2R6GA 5FOVA 2CCKA 1BOFA 3U7EB 2PBRA 5EXSA 1GNPA 3GLGB 4BPBA 4PAMA 2CVHA 3RS3A 3GEEA 1G3UA 2D2EA 3PUZA 2H57A 1JAHA 3CWQA 5AR1A 2EFDB 1FQJA 2ZEJA 2XXAA 2CJWB 1LB1B 1NN1A 1VG0B 2BWJA 3MWJA 4KO8A 5HE8A 3QI2A 4EQ6A 1RKBA 3EXAA 4HLDA 3O8DA 4B76A 2N46A 4DRZA 3K70D 3BH6A 2VPPA 3K9GA 1KO1A 3A1SA 1OFUX 3HJNA 3GFPA 3QXSA 1R5NA 5EXXA 2WWHA 3GLGE 4W5HA 4QKQA 1YE8A 3I8XA 1G7RA 5F9HA 3KB1A 1TF5A 3KQKA 2GEUA 2ODWA 2ZSDA 4PR0A 4C0AC 1Q3HA 3JVUA 1FNNA 4I1VA 4Q4JA 2Z4RA 2QAJA 3REGA 2WSMA 4JBXA 2ATVA 2J0VA 1SVSA 3AKCA 4H1UA 4UNNA 4FWTA 621PA 2MSEB 3VKHA 4DC9A 3DHWC 3OAAD 4XH9B 1W5TA 2JLUA 4Q01A 3A8TA 3E70C 2GJ8A 1S0UA 2HEIA 4R7ZA 2JDIA 1XCGB 3OEHD 1G7TA 2HUPA 4TYPA 4Q9HA 4DWJA 4XD7D 2V4ZA 4LBWA 1I2MA 2QMEA 1JEEA 5JI2E 2GNOA 3ZD6A 4MUBA 2WVJA 2JA1A 3D3QA 1IY0A 4OKSA 4L9SA 4EKDA 1YZTA 2EFGA 3CIOA 2PMKA 4HZIA 2ATXA 2RGNC 2ZU0C 3ZVMA 2YKGA 1ZM7A 2OILA 1YRAA 2FEOA 2GZDA 1P61B 3K1JA 1KI2A 1E2NA 3PVSA 2OFOA 3T12A 3EX7C 3TIFA 4RD4A 4ILEA 2IC5A 4DLZA 5DH9A 2VTKA 5D3MA 2XITA 1NMYA 4HATA 1Z0JA 4KFSA 2D74A 2UVQA 2ZITA 3WYFA 5DI3A 3AGQA 2BBOA 2P65A 4QJ4A 1R5OA 4B43A 4Q4JB 2GBLC 4LK2A 4ZIRA 1XJCA 1CU1A 4LJ9A 3IEUA 4CF7A 3THXA 1G20E 5HKKA 2AK2A 4GOKA 2QGNA 2N1BA 4LOAA 5CLQA 1CRQA 1GNRA 3CR7A 2XOKA 3A1TA 3N2EA 4C30A 5AWFC 2OLKA 3ZS9A 1HE1C 4BLRA 1NSTA 4HAXA 4D4JA 3T1VA 5GADl 4TL7A 1CJUC 4A36A 4AYTA 3LRPA 2QAGC 1I4LD 1X3SA 4I1SA 4A8JC 4Z8YA 4OQNA 2Q21A 2OXRA 1P9WA 2HF8A 4OBEA 4R2IA 1G3RA 2UZIR 1U90A 1NNEA 2J7KA 3BWDD 3CPJB 1VHLA 3PENA 3B82A 5B64A 1PLKA 1LNZA 3Q8XB 1W36D 3IDQA 2JLSA 1XTQA 2ZSAA 5JHGB 1FZQA 3AVOA 1ZJ6A 4Q9KA 3KJEA 1FNMA 2IYXA 1RYFA 2WPDA 3AKEA 1DELA 1AQUA 1ZD8A 3BAFA 1XEXA 3QIAA 5CYPA 4YMSA 3GPLA 1G7SA 2F9LA 2QP4A 2VP0A 3CUEF 2MSDB 1N2CE 5DI3B 3AP2A 1E9FA 4CZ2A 2GF9A 3I72A 3VNUA 4ARZB 1NVXQ 3IUYA 4IVPA 2WSSD 4I99A 4PC7A 4AYWA 4PZLA 2JLXA 1XMSA 4TLDA 3TJZA 3THXB 3CKLA 3LXXA 1RRFA 1OH5A 5F9FA 4LYFA 1E2MA 1W4AA 4JJZA 1VECA 1TEXA 3K0AB 4YONB 1KO5A 1XXHE 2G0NA 1SVIA 4IKEA 2IX3A 2O8EA 1RPZA 1U81A 4KXFB 2R6AA 1G3MA 4US1R 4BFZA 1TF2A 2O8BB 4Q00A 5CITA 2WJYA 2GESA 4RSGA 1KI8A 4RZ2A 2YVUA 2RB4A 4RD3A 3T35A 2PLFA 4O2RA 3J81k 5JWHA 3FB4A 1KNXA 2A5JA 2I4IA 3TUZC 2RMKA 3UMFA 3PEWA 3LX8A 1MH1A 4G5SA 4P0TA 1U98A 2O8DA 3WY9A 5F2EA 3FHOA 1YZLA 1AN0A 3QJYA 5TDHA 3TVDA 5FR2A 3S1AA 1WQ1R 3OIWA 3VAAA 3VR4A 2AX4A 1FMJA 4MYCA 2O0HA 4RVCA 3WNDA 4AKIA 1CP2A 4UXHA 3AVVA 2IYLD 4IW3B 5IK2A 3CX8A 1LY1A 2WBLC 4PX9A 3TH5A 2KBFA 3D31A 2JJ8A 3BH7A 5EP3A 2ZR0A 2OV2A 2XSZD 3LY5A 2W2XA 1VYVA 2IEYA 3EWAA 1AM4D 2O8FA 2C5LA 4QC2A 3IIJA 5G41A 1L8QA 3ZVRA 5B57C 4AKEA 4RD1A 4NH0A 3QBVA 4DT1A 1DE0A 2F1JA 1C4OA 4A9AA 2ZI7A 4M1SA 2D4HA 1IN7A 3IBYA 3N5CA 4II7A 5G53C 1ZINA 1DO2A 4A0HA 4Z51A 1ZU4A 2O8EB 1V5WA 1VPLA 5AK0A 4BFVA 2F1RA 3BGWA 1U99A 3CB4A 5IF9A 2E1RA 5JHHB 5GJBA 2AL7A 3H84A 2YZ2A 5FL7D 3U44B 4YXWA 1GZSA 1KK3A 3QENA 3AF3A 4LCBA 3NDPA 3SBDA 4LJ5A 1KIMA 4PZZA 2F7SA 4JT4A 4EIWA 2V3CC 4JT2A 3VR3A 4UXJA 1UM8A 1NG9A 3P32A 1UDWA 4L9WA 4NCJA 2O8DB 3U60B 3T34A 1XD2A 4W7SA 2W2VA 1EK0A 3ZZTA 3IHWA 3VR1A 1OIVA 2IYVA 3LLMA 5FTLA 5FBRB 1UEIA 3BE4A 4C7OA 4AK9A 4TYWA 4HB0A 4NMMA 4C0HA 1E2EA 1BH2A 2QE7A 4LHZA 2WWYA 4IXMA 2QMOA 2RCNA 2AD1A 1Z83A 3FWYA 2PJRA 1QHHA 4Q1DA 2QRZA 4DLWA 1ZW6A 3NBZC 3BB1A 4US0R 6Q21A 4OI0A 1GSIA 1DS6A 1Z0AA 2OUKA 1KI9A 4D0GA 4DIDA 4DT1B 1DAHA 1TUIA 3W8NA 3A6PC 3FTQA 4C0LA 1CBUA 4G5RA 1A2BA 5JWOA 3QEOA 4YLGA 4HI0E 5BYJA 5IT5A 1KSFX 3CRW1 1F2UA 1NL3A 2F1IA 1W47A 4B2PA 421PA 1NY5A 1W44A 4KFTA 3WNCA 1EWQA 4HAYA 1II0A 4B34A 4WA7A 1S3SA 2FMXA 4OJKA 3SYNA 2LKDA 3NEYA 4WAUA 1G9XA 1HYQA 3KKNA 3QPVA 1S4QA 3AF2A 1PV4A 4M53A 4MRRA 1PUJA 4BLQA 4CVNA 1OXSC 1E2HA 1XD2B 3MUFA 3SZRA 1VDZA 3O8RA 1XPRA 5AUPB 1JXOA 1DAMA 1OT3A 4TL8A 3NVAA 3SN6A 1OHHA 2ZRNA 3GFOA 4YMTA 1NLYA 5JECA 5LPNA 2JIZA 3D7MA 1XPOA 2YNMA 3L82B 1NKTA 3UIEA 4CEIA 2FF7A 4JLAA 1QHYA 1QHHB 1MT0A 1NSFA 3KQNA 2GXUA 3FPAA 1ZUIA 5C46F 1WBBA 5EJEA 1L4UA 1TUEA 4NHOA 2CNWA 2OBLA 4BLTA 2NOAA 4JLPA 5TV2A 4BFTA 5E7IA 2WJGA 1T8UA 1UJ2A 5A0FA 4CEJA 5FI1B 4FWIB 2OCBA 3CPHA 1QHXA 2CVFA 5L3RA 1UKYA 1KO8A 4LBZA 2EFHB 4PPQA 4JZKA 3WP1B 2V8OA 2Z43A 3KQHA 1SVOA 4DUGA 3E2IA 2QT0A 3PEUA 1IXZA 3C7KA 2CE2X 3EASA 2V7QD 1P72A 2DFLA 5EE5B 1XPUA 3UMSA 3GLHB 5DLQC 3WRXC 1P2SA 3D6TB 1QVRA 3UANA 1GIAA 3MD0A 3O47A 4DZZA 4DCVA 3O8BA 1AS3A 3HWSA 1DPFA 1QHNA 3M4YA 1ETUA 2WPDD 2EWWA 4DLXA 1GL7A 1JR3E 1ZU5A 4LPSA 4R9UC 1VG8A 3LA6A 3KUCA 5HE9A 3EPJA 3THYB 2X77A 5KOYA 1EX6A 2J9RA 2YOGA 4Q4AA 2G3YA 2IBMA 2VIIA 4CEIB 4EPYA 1OW3B 4KYUA 1JPNA 4LI0A 1OFHA 3QF7A 1XTIA 3ASYA 1CRPA 3LV8A 1SXJB 1SGWA 5KNBA 3VQTA 1OB2A 1MO5A 3ECCA 3EAQA 3GLFB 1TMKA 4S35A 2FX3A 4N1AA 1NMZA 3H0KA 4AY2A 3BBPA 3IQXA 1A5TA 2V1UA 4BLSA 1ZRHA 1YQTA 3T61A 2DWOA 3A4LA 2PX0A 1OXUA 3FHCB 2ZRPA 5K8IA 2GRJA 4TZ0A 1HT2E 1P2VA 2G9NA 1FL9A 4TT3A 5H8WA 4NONA 3ZS8A 5JJIA 4HZUA 2QP9X 4IOLA 1DVRA 1XZPA 1NBMD 4L15A 2D3WA 4BASA 4NP6A 4XVQA 4CT5A 4TLEA 1SQ5A 2B8TA 1CXZA 1E4VA 4W5JA 2JLWA 4FMDB 1SXJE 1NP6A 3GLFE 1LV7A 5JFGA 2GA8A 2PT7A 2REXB 3RWOA 2R6FA 3OEEA 1QHGA 3NC0C 2F3RA 3BFXA 2YHSA 1CTQA 2WMNB 2QL6A 2WM9B 3I1FA 2WKQA 1DARA 4LV8B 4LYJA 821PA 3K53A 1ZIPA 3LBHA 1FUUA 2ZRBA 2IUSA 4QL3A 2VQSA 2IYSA 3JZAA 4TMWA 2QRNA 2ZS8A 5TB5A 2OHFA 5HZKA 1W0JA 2ZRCA 3RVBA 3IQWA 2XB4A 1JR6A 2GBLA 2X8AA 4LWZA 1YR8A 2A9KA 2H5EA 1YR6A 2Q6TA 1GG2A 1A1VA 1Z0KA 4LJ8A 3ZIAA 3DDCA 2KJQA 1Y63A 4PC6A 1EXMA 4DDUA 3H1TA 3MFYA 2ZANA 1NG1A 4CYMA 1Z06A 4LDJA 3I61A 2EWVA 3PEYA 4ASUD 2ZETA 4LV5B 5L3SA 1E1QA 2ZVQX 5EXPA 5FOWA 2J0SA 3ZH9B 3WNBA 1SVKA 2QAGA 2JJ2D 3BB3A 2IWHA 1ANKA 4X8LA 1PVOA 2DBYA 1Q21A 4A8JA 2OEPA 3BD9A 2HLDD 1GL6A 2RGAA 4CW7A 4TL9A 4KFUA 3OFND 2IEZA 3PXGA 5FH9A 1ZNWA 1XWIA 1E4YA 2C9CA 5DYGA 2J46A 2GF0A 1E99A 4YC7A 1NN5A 1KY3A 1DEKA 3RLFA 2PJZA 3FGNA 1W48A 5BXQC 2O8CA 2CHQA 3K0FA 4BFSA 4UXIA 3K70B 1UBFA 3K9NA 5CB8A 4JKIA 1QG2A 2GHIA 2GXQA 4JLDA 2XAUA 4RD2A 4V0MA 3ZYCA 2J7PA 4NYMR 1COWD 2V9PA 4M0LA 1RYHA 2VO1A 2ZR9A 1KAGA 3BH0A 5M04A 1P2UA 2G83A 2NMVA 1G18A 4TTPA 2ZJZA 4DBLC 4A15A 2ORWA 3CF2A 1G8HA 2GEDA 1BKDR 3BK7A 5D3QA 2HYIC 2WKPA 1RC8A 1XF9A 1F2TB 1UBGA 1TEVA 2W2TA 3NBXX 3Q7QA 1S9DA 4UQOA 1XMIA 4WZ6A 4HUTA 1E2DA 4CRWB 5L3SB 4F93B 3KKMA 2ZYWX 3DKVA 1NVVQ 4D4LA 2WIAA 3REFA 2BCGY 4NCNA 2JLQA 4PC2A 1H8HD 2ZJ8A 4C9BA 1G5TA 1LS1A 2BBTA 4PHTA 3R7WA 3UWKA 2C77A 1YVDA 3OZXA 2HYDA 4O25A 4Q9IA 4FN5A 5AUOB 5G3YA 1GOTA 3CRQA 4AC9A 3CF6R 1OH6A 3PJRA 2VBCA 2R8RA 1FW6A 4M1KA 3PFIA 2ZJAA 4LHWA 5FUXA 2FSGA 4B2LA 2ZRGA 2QMHA 1E79A 3KFVA 1KYIA 1CJVC 1TAGA 3GD7A 2D7CA 2O8CB 4XTRA 1Z47A 3R8CA 1NN3A 3MSXA 521PA 1KK0A 1VCIA 2IYRA 3V4RA 3B60A 2H92A 3CO5A 4E07A 1LF0A 3QQ5A 3ADDA 1Q20A 1Z28A 4PTLA 3W34A 4QHYA 1Z5ZA 2HCBA 3VR5A 4WZAE 4BWYA 4GPTA 4V03A 3GLGA 3RC3A 3NH9A 3GEHA 1D2EA 3EC1A 1S1CA 4AURA 2ZUBA 1RZ3A 4KSBA 4EPWA 4L4UA 1J7KA 2CJWA 3KTAB 3FMPB 5EE1A 1ZM3A 1KSJA 1ZUHA 1W2GA 5IHPA 1XU4A 1HT1E 1XMJA 4KBGA 4IXNA 4LBVA 2WWFA 2YWGA 2IYTA 2J3EA 2CXXA 4DUGD 4TLCA 3RDPA 3SJAA 5JJLA 3B1XA 1KDTA 4MH0R 1L2TA 5LD2B 1CULC 1WB9A 4F92B 2AD5A 2ZRIA 2ZU6A 5J5CA 2VSFA 1FPMA 5JCZA 3WMFA 1HY3A 1SXJC 1E1RA 4B32A 2ZRFA 3EZ7A 1CEEA 2CHGA 4I1UA 3UMRA 4FMBB 4WBSA 1ODFA 3MJRA 2B21A 2GK7A 2GETA 5DGXA 1XTKA 1CR2A 4PANA 1N6HA 4FINA 1XCMA 1TNDA 1U0LA 1U94A 2CL6X 1E0AA 5GVSA 2C99A 2I1VB 3AUYA 3F8TA 4ESHA 4ZDKA 1ZCAA 4PO1A 4MKIA 1JJVA 2IW3A 1Z3IX 1DADA 4Q1CA 4DHEA 4A6XA 4B75A 2R6DA 2QT1A 4U02A 3ZQ6A 3CH5A 2IYWA 5EP2A 4D6PA 2J87A 3KJHA 3NC1C 3P4XA 1ZUNB 3AP1A 4B3GA 2XJ4A 4PHFA 3CZQA 4Q18A 2ZQ5A 2OCPA 4B3FX 3KL4A 1HQYE 5HR5A 5JWRA 4M8NE 4ZI2A 2BC9A 2FZ4A 1OH7A 5SZHB 2C9OA 2JCSA 3W3ZB 2W83A 3F5FA 4WXPA 2BJWA 4XWOA 4OQLA 1S1MA 2HCJB 2RGDA 3SHWA 1ZM2A 3TMKA 4OHWA 2P6UA 4TQ9A 2FE4A 3AQ4A 1X1RA 1M1YE 1Q22A 2XZLA 2VSXA 1SHKA 4LC0A 3TBKA 2GXSA 1E69A 2HV8A 2X19A 1T91A 1P75A 1OXVA 4BZPA 1P62B 4NDZA 1HH4A 4MKHA 1IXSB 2IUTA 4UJ5A 3EPKA 3I32A 5FOUA 1GP2A 4HAUA 2JEOA 3UK6A 1F48A 1JB1A 1IJEA 2IT1A 1N0VC 3QE0A 1Q3TA 3PUWA 2ZM5A 4A0FA 4A92A 2J45A 3MLEA 1ZIOA 2J0QA 5CK4A 1D9XA 4BEBA 5L3VA 4AG5A 1D9ZA 5C18A 2QMUA 4RJLA 5JEEA 2ZI4A 4EFMA 4AG6A 2ZI6A 1CJMA 1G7CA 1Q1BA 1GAJA 4IVQA 2ZS7A 2RKOA 5AJVB 1S8FA 1OFIA 2XNDD 4B71A 1TQ4A 1TU3A 1A4RA 3G82C 4LUCA 5BYKA 1P60A 3R9WA 2ERXA 3K70C 4IOKA 5CJ2A 3MRSA 1QG4A 2ONKA 2YC4C 2ZRHA 4Q7KA 4DCNA 4TL6A 1NRJB 4ACAA 3ONWA 5EP4A 4DCTA 2IYQA 1ELOA 2NPIA 1XXHA 3UATA 4PO8A 3C15C 1O3YA 2OFWA 5KYKA 1Q12A 3P4YA 4Y0AA 4NYJQ 1V43A 2CHVA 2YWFA 3GJ7A 1T5IA 2VHJA 4ARZA 1PLLA 3CW2A 1AIPA 2X1VA 3CH4B 3QVUA 4N0EA 1JNYA 1E0SA 4IDOA 4NYJR 3RAPR 3TR5A 1N5LA 3DZDA 2VEDA 5JS7A 4F7WA 2RAPA 1IJFA 4URXR 3V4FA 4URWR 3K0AA 1JJ7A 2CK3A 4FMCB 1Z8FA 3CX6A 2EW1A 2BCJQ 2O8BA 1FFHA 2P0EA 3OIYA 1KJYA 1NVUQ 3P26A 1N0UA 1BS1A 1PZNA 1W0KD 2W6JD 3CM0A 4IRUB 2OE2A 1N5JA 4GOXA 1EFRA 2GVDC 5DN6A 3IPXA 1MO6A 2WTUA 3QBTA 1Z07A 3UPUA 1ZYUA 4P31A 4A82A 4IJMA 1W4BA 2IXGA 1I4TD 2IK8A 3PCRB 5C4GB 3CWZA 5FOTA 1RRGA 4RZ3A 1W7AA 3U4QA 3AF4A 4E22A 2ZYUX 3B85A 4QJ3A 2G77B 1W46A 4EFNA 2VH5R 1NVWQ 1KI4A 3QG5A 3EIHA 5SZIA 1IN8A 3A1WA 2QQEA 1E2JA 1XXHB 4BUJA 5J4VA 3BXZA 4Q9JA 4TTQA 1T0HB 5DI9A 2ZE6A 4DB4A 2H18A 1E79D 2D2FA 3GJXC 1E0KA 1YJ5A 4FD2A 1H8ED 3RRYA 4B33A 2RGGA 4Q66C 1WBDA 2KWIA 1DTSA 2W6IA 4YMUA 2VP6A 1GITA 1ZC3A 3G5UA 5KU1A 4K46A 3T06B 4MUAA 1M6NA 1SULA 1N25A 2XEXA 2FFQA 1JECA 2QU8A 3BS4A 3GJ0A 4BZXA 1KI1A 4TMKA 2WICA 4ZCLA 2EYQA 2C96A 1KDOA 3OE7D 3U44A 3B1ZA 4QM6A 2QBYA 2VP9A 1SKQA 5LD2C 2CLCX 1MV5A 1A82A 4ZCMA 1S96A 3HU1A 3A58B 5KUTA 1OJLA 1N6NA 4MGIR 2ZRAA 2ZJYA 3ASZA 3U4QB 1UKEA 5EZ6B 3RYTC 5IRCD 2FJUA 1IOZA 3A4MA 1Y3AA 2VP2A 4DSNA 3TAUA 2IYUA 5JSZB 4JLVA 3DKPA 3PR1A 2QGZA 2PEYA 2ZJ5A 2JJ1A 4HAVA 4BE7B 4LGMA 4G1UC 4PAOA 3DM5A 2E87A 1SZPA 2RGXA 1NLFA 2FFBA 4JVLA 3AVWA 4A2WA 2QTHA 5KO2A 3TW8B 4GMXA 4Q4HB 3OF5A 3HR8A 1UFQA 3NHBA 3WHKA 3WP0A 3RS0A 3P1JA 3HPQA 1OYYA 4MKFA 2JLZA 2WV9A 2WWWA 3TUJC 3SYKA 1M74A 2GAOA 2ZYTX 4LSGA 1WE2A 5HCNA 4RFSB 2FEMA 1AS0A 3WRYC 2CE7A 4DLRA 3K9HA 4URYR 3SNHA 2VYFA 2ZIAA 3IIKA 2GJSA 1UF9A 3DM9B 4TSFA 3EA0A 4W5WA 4YQFA 2BVNA 2REOA 2YYZA 4XTCS 4B74A 1WDTA 1E98A 1TU4A 3DOEA 2QBYB 2R2AA 2BJVA 5CDFE 1DOAA 2BKUA 4TYNA 2LWIA 3FMIA 4OQFA 2EU8A 4PSKA 2OZEA 3L0PA 1AGRA 3QKSA 4KSCA 3SQXA 1ZVQA 5K8UA 4Z1MA 2ZJ2A 2FOLA 1JQJC 3MG9A 3LAWA 3QPWA 1HV8A 3IILA 1N6PA 4Q1AA 1E9EA 5H1YA 2GDJA 5BN5A 3LWNA 3LXRA 3B2EA 2CL0X 4DSOA 2OLJA 1YZKA 2O0JA 4B3CA 5KPDA 2EFEB 4DSTA 2FNAA 2F43A 3CF0A 5E7MA 4PQRA 2WAYA 4IDQA 4UJ3A 2MSCB 4I1OA 5AJXA 2VA8A 5L8VA 2OXCA 2QSZA 4Q9LA 1E9RA 5LB4A 4JMPA 5FUWA 3TSZA 3UXMA 2RHMA 1NBME 2JDID 4QGFA 4DLTA 3C8UA 1G8GA 4HUQA 2GJAA 3TK1A 1J99A 2NIPA 2Y8EA 4MDFA 5KDOA 1JR3A 4MA4A 3SJBA 1II8B 4HB3A 4D81A 2IWRA 5FPTA 4AI6A 4JS0A 4YMVA 3DPUA 2DWQA 4Q47A 5HTKA 3VNVA 4B3DA 5FPKA 3U7HB 2WKRA 1E9AA 1XTSA 1TX4B 1CLUA 1LW7A 4MRNA 4HLCA 1PUIA 3GLHA 2L0XA 3T1OA 3U5ZB 5FUVA 1II9A 2O5VA 3ZLJA 1T8TA 4EAQA 1R8QA 3QKSB 3SFVA 1XB2A 1H65A 2VF8A 3EC2A 2F9MA 4KITB 1KI6A 4JJKA 1TL7C 1ZNXA 5AJYA 2CLSA 5GJWC 4BFUA 4DLVA 5JRJA 2XZOA 1FTNA 3TQCA 4ZDWA 3PQCA 1EG7A 2DWPA 4MYUA 3THYA 4UNPA 3M6AA 2FH5B 3V9PA 1K5GA 4NYIQ 3SC3A 4BZQA 3IEVA 3O8CA 3SYLA 4Q48A 2R6CA 5EUMA 2F43B 1W4CA 4ITRC 1SXJA 4IEIA 4O0MA 3GLFA 2FPKA 3AVXA 1XBTA 3CX7A 4NYIR 3NG1A 2WWXA 5HKKD 4Q19A 2PCJA 2B7CA 3VHXA 3VX4A 1DAGA 3I5YA 3U3OA 1NJFA 2A5FA 2UZ3A 3PV0A 4HLUC 3U3MA 3T5GA 4DVGA 1CKEA 2XOKD 3RSOA 3Q5EA 4JSYA 4AIIA 4EPRA 1ZCBA 1OKKA 2OCAA 1WCV1 1DG1G 2FZLA 4D25A 4HUQB 5CK5A 1IN5A 5EE3A 2FFAA 5G3ZA 3H86A 4JIMA 3UWOA 3SOPA 2XTNA 2A78A 1HEIA 3MWYW 3QXXA 5J4LA 4N3NA 3TLXA 2ZI9A 1SKYB 3GJ6A 3SR0A 3KQUA 1BO6A 4ZDIA 3UKDA 2N42A 3VKWA 3X2SA 2WMOB 2E9SA 3NWJA 1N3BA 1SHZA 2QROA 3A1VA 4KYIB 5H68A 1JQLB 1KSGA 4ABYA 2P6RA 5CYOA 3T1TA 3QKRB 4RFVA 2XTZA 4POAA 4D0LB 3RSLA 4KFRA 2J41A 4ZV4A 3FKSA 2R65A 4EDHA 1KI6B 2Q9CA 4MGKR 2VHQA 4PZYA 4C0SA 4R2HA 3AKYA 1IN4A 3DO6A 1SKYE 1G16A 1KI3A 1YZNA 1QBKC 3CNLA 4JLKA 4ZI3A 2ECKA 4BEJA 1YR7A 4UNQA 5KSOA 3HU3A 3GJ5A 1ONBA 2GJ9A 2PZGA 1LS6A 3THWA 4LJAA 2H7VA 3KUDA 1KHTA 4U7DA 3PUVA 2ZI3A 5AJWA 2HJVA 2FV8A 4LX0A 1N6KA 3KB2A 1BMFA 5KSYA 2ONJA 5EE9A 121PA 2G6BA 5AUNB 3NHAA 1HA3A 3MAAC 4HDQB 1XDBA 3F0TA 1P73A 1U0HC 4DDWA 4F4CA 1KY2A 1FMLA 4ZCIA 3A37A 1FP7A 1K5DA 3I8SA 2GTPA 1R4AA 4PPGA 1Z6XA 3K8YA 2YJTD 3AVQA 3A1UA 4H1VA 2VF7A 3QXJA 3PG5A 4Q1FA 4CGZA 3KJGA 4TQAA 2NG1A 1W49A 1U0JA 1DAFA 2O0KA 4IFBA 3HDTA 2JASA 4RZUA 2OESA 5FUYA 1VKJA 4B3BA 4DLSA 1VYUA 1MKYA 3Q3JB 1Q44A 4NCKA 4DJTA 4M9SA 1T3SA 3L2OB 4AKGA 1Z6TA 3C5HA 4LBYA 2AR7A 1B0UA 4JYBA 1WP9A 2GCNA 5B30A 5IK2D 4MKGA 3ZGXA 3IIMA 3PUXA 5DNYB 1N6RA 2DCUA 4B73A 2P67A 4P4SA 2AN9A 3LQRA 2LKCA 4KLZA 1Z2CA 4TTRA 2QTVB 5CIWA 1E9CA 3THWB 1NMXA 1QDEA 1WA5A 4TLBA 4F91B 1G3QA 1WRBA 2FGKA 1F2TA 1KI7A 2QQ0A 2YC2C 3ZDQA 1UPTA 4V0KA 3GLIB 4LYAA 1XEFA 3MGCA 2QPOA 2P5TB 2AFIE 2QA5A 4IDPA 4M1MA 4PSVA 3QY0A 3OAAA 3SQWA 1Z0FA 4M21A 3RWMB 2DR3A 2H16A 1VYTA 4QGHA 2AWOA 2ZRMA 3L0SA 3E1SA 1D2NA 1PJRA 2OT3B 1KJWA 1XEWX 4XD7A 2VP4A 3IO3A 2CBZA 4YXWD 4B47A 3VKGA 4P33A 5HCIA 2D06A 4Z8XA 2CMKA 4ERNA 4WIAA 1CR4A 5F98A 2KB0A 3AB3A 3QUSA 4LHXA 3ZVLA 1IONA 3GLIE 1SVWA 3PEVA 3LFUA 2QI9C 2OM2A 2IS1A 3H2YA 4CT4B 1T9HA 4QM7A 3VMFA 2ZAOA 3C41J 4BGDA 2A7QA 2OSBA 1MRNA 1OFTA 1X6VA 3H4MA 2XNSA 2C9YA 2BMJA 1DBSA 1KDRA 3PIRA 2C95A 1N0WA 4LYHA 2QE7D 3DOFA 4QBFA 4C0JA 2YWHA 3B8HA 4URUR 5FI0B 2AK3A 4OI4A 1KTVA 4A1FA 2XGJA 4P4SB 1E2KA 1AZSC 1CS4C 4EPXA 1EX7A 1G4UR 1GWNA 1NI3A 2ZRKA 1J8YF 3KTAA 3LVQE 4DEYA 1E9BA 2VSOA 3FVQA 3FE2A 1XTJA 4PAQA 3MWLA 5JBQA 1KAOA 5FBWB 2GZAA 4BLOA 2DFTA 4M22A 4N0DA 4YMWA 1RVDA 3MJHA 4EPVA 4GI7A 8OHMA 1FOEB 1IBRA 3LX5A 3SS8A 4BFWA 2ZREA 1UKVY 3ADBA 1R0ZA 5TXGA 1NVVR 2R44A 3I4LA 1CIPA 4JL8A 2FA9A 4V0NA 5KNCA 5JJKA 2Q3FA 1GM5A 1G3IA 4L5BA 1X1SA 1C9KA 2WJJA 4D4KA 2ZRLA 4L8GA 1GKIA 2Z5FA 4OHYA 4KU4A 4QJ5A 1VMAA 4QNRA 3T1QA 1RRCA 2D62A 4GRAA 2HT1A 1M7BA 4Q21A 2DPXA 3WHLA 2QEQA 3K09C 4OYHA 5H70A 2Q9BA 1AJEA 1OHHD 2A3RA 3L0IB 5JI3E 1ZC4A 1G8FA 2JIZD 4E03A 4B2IA 1KNQA 2FSIA 2EVWX 1CJTC 1TPZA 5FFMA 4C3ZA 2ZI5A 4PHGA 1F3OA 1E2LA 2GAAA 4IOMA 4OJQA 1OIXA 1OF1A 1OYWA 4KV9A 4M9ZA 4M4SA 1LF5A 2CNWD 1K6MA 4GFDA 3VHLB 2WSSA 3QOFA 3VFDA 1HTWA 2ODBA 4ACBA 3HU2A 5JRZA 5K8LA 1BYUA 1T4GA 1T6NA 3BFVA 3WMEA 4GBMA 4Q4LA 4PPNA 3TAHA 2C78A 2CL7X 3L0OA 3QXHA 1M7HA 2P5SA 2NO6A 4BQSA 2HF9A 4HSEA 2JGNA 1YZGA 5C1BA 3AUXA 4BLPA 1KK2A 3LDAA 1OSNA 3W3AA 2HDNB 2WHXA 4L16A 1R8SA 4MRPA 1VG9B 3B5JA 4LRWA 3SJCA 4EPTA 3I73A 1GKUB 3HP1A 1F6BA 2LCFA 2YWEA 5ANRB 4V0LA 5L3QB 1TF7A 2BM0A 3TW4A 2G1JA 3AF1A 1E6CA 3CZPA 3MCAA 5FR1A 3RC8A 2EFCB 1FTSA 4GZMA 4WXRA 1CR0A 2HXSA 3M0EA 2BBWA 3EWSA 1I4DD 1Z6AA 1L7VC 1U8YA 4V02A 4CIDA 4TYQA 5LB2A 1W36B 4JBYA 1R2QA 3SJZA 4WW0A 2AHOA 3JVVA 1QHIA 3W6OA 2QENA 2VLIA 5AJZA 3TQFA 2AXNA 2QNRA 3X1YA 4A4DA 2BEKA 1ZBDA 2ZE5A 3B6EA 3OIVA 1P3JA 1ZAKA 4M1WA 1M34E 4NE2A 1LVGA 3GJ3A 4JKYA 3CNNA 3AP3A 1D6JA 3W8RA 3EZ9A 4PPFA 2XSZA 1X8KA 4D0NA 1WXQA 2H17A 4CDGA 4HYYA 5BWMA 4JLBA 4TT3D 2AKYA 2J0UB 1DAEA 3AM1A 1EFCA 2VRWA 5IDVA 1AKYA 4HDOB 3W6NA 3LBNA 3QEJA 4RKEA 1KMQA 1OXTA 1S9HA 3QKTA 1X8JA 4MRSA 2B92A 4DLYA 2QUZA 3ZQJA 1QHSA 2CEAA 5FL7A 3RANA 4JLJA 3BB4A 4KI0A 3OEED 3ZZ0A 3Q7PA 1KOFA 2GCOA 4PSAA 3RABA 2A2ZA 4K8OA 3GQBA 2QPAA 2AFHE 3EG5A 3IO5A 4NKRA 5FTJA 4EUNA 5E3HA 5EP1A 4KLNA 4F4IA 4HLQB 1G21E 4WZBE 1O87A 1Z0IA 2HXYA 2ERYA 4M1OA 1QVAA 4WVFA 4W9MC 1XMVA 2WAXA 1W0JD 1KMHB 4ON9A 1G8YA 1QF9A 4TQUS 1RJ9B 4RD6A 3QVVA 2G88A 2IA5A 2EQBA 2GK6A 2ZS9A 5DE3A 5BN4A 3ZIAD 1Z0DA 3B1WA 2H1LA 2Z83A 4HLUA 2FWRA 4UNSA 1KO4A 5DHFA 4MGZR 3FDIA 1E1QD 5EUQB 2BHRA 4Q02A 5LBIA 3TNFA 5TMPA 4D26A 1DO0A 3SU8A 3EIEA 3P27A 4A0GA 1GTVA 4KJZA 1Z63A 2NQ2C 3HPRA 4V0OA 3LBIA 4EJSC 2AWNA 3NBFA 4RCYA 4D80A 5EXTA 3NTUA 2PZFA 3CRMA 3FYHA 2VHUA 5JMTA 5BN3A 2XXAB 2GCOB 1NF3A 5GJCA 4EQ6B 1UADA 3GCGA 1G19A 1ESMA 1US8A
chains in the Genus database with same CATH superfamily
4A2PA 2JF0A 2Z2IA 1GPLA 2ZJBA 3IVMA 4JQOA 4S1TA 5JZVA 4WERA 5IHXA 4MI9A 3G8AA 2XD4A 4GR5A 1T24A 1DQYA 3SI7A 2WE8A 2RH5A 5MFZA 3TVTA 1JQ5A 3ONVA 3SSAA 3CE9A 2H08A 2BJHA 2ZTMA 1FJXA 3COVA 4Q3EA 2FU5C 2Q8PA 1BS2A 4BMOB 1XMQB 3E7WA 1PQWA 1R4NA 3HS3A 1IVYA 1E6EA 5B6IA 4XJSA 4QSHA 3RTCA 1WNFA 3TDNA 3RASA 1COZA 3DZIA 4PEVA 1EQUA 1QKJA 4WA8A 1IMOA 4NICA 1ZS9A 3AQIA 3CCFA 4ZAXA 5K7SA 3GIWA 4EUFA 4NBSA 4W9NA 4EW6A 1J8DA 4YAGA 1T2EA 1UBRS 3PRKE 3K0HA 2IU3A 3GMTA 3O0DA 1LJ8A 2OO5A 3GMIA 3AONB 1F20A 3I9LA 4MICA 5LA6B 3C16C 4CQMB 4FYHA 4Q6BA 3LD9A 3M3HA 4ND3A 2W6QA 2IUUA 4BO1A 3WK6A 3NJ4A 1DQSA 4ZAGA 1NQ5A 1A77A 1T6BY 5K3FA 3I9FA 3QE4A 2F1HA 4LC1A 1O6FA 1XKLA 3KJXA 3V97A 5KTOA 3S4YA 4KK4A 1EGAA 2P3SA 1EWKA 4LTNA 3TVDA 1JYFA 1TQDA 2MSWA 4KYTA 2O57A 5FBKA 3U3RA 2QYHA 2BGLA 3KAQA 1LUAA 1R3DA 1UJNA 1JJAA 2VNHA 1WXEA 1H2FA 3LY9A 3OG9A 3PGKA 4HB2A 4K81B 2XCUA 5I51A 4FIDA 5F3DA 3LLUA 3E7PA 1NNUA 2YIJA 3ANYB 3FGPA 4F9FA 1DKMA 2DFPA 2H5JA 3RFCA 1V71A 4XSHA 5SY4A 3BRSA 3G88A 1US8B 2NXJA 3T99A 3F6EX 1P29A 1TM5E 5DX8A 4PRKA 4RE5A 4ND4A 4G5OA 5TY0A 4GMDA 1UK8A 4IHQA 4N0QA 2ZBDA 5TGDA 1ZBQA 2GCIA 4EF4A 4F2DA 3TNDA 5ELXA 2WD9A 1DG3A 4M0UA 3VU3A 13PKA 2O3RA 5K4AA 3TRJA 1FDIA 3HJCA 3F6SA 4QBIA 4EFLA 3OKCA 3RYIA 4BO6A 3O31A 2Q3MA 3PDHA 1UXHA 4WGFA 3LH5A 1FUKA 2H4XA 1MR3F 3O4FA 4IEEA 1RFGE 1XU7A 2Y92A 1FPQA 1L9XA 2ORED 3A3PA 4HVTA 2I1QA 4ZIRB 4YJ2A 3FXAA 2DB3A 3KXIA 3H9GA 5FYDA 3SJ7A 3M1LA 2GEVA 3WYCA 2YOHA 5B2FA 3RTEA 2ZAGA 5I8PA 2HMSA 1KZGB 2HRZA 3E48A 3IKJA 3FPGA 2ZAMA 1S3GA 1UZNA 4CIXA 4CKEB 4EH1A 3ZXSA 1C29B 2CY0A 2PD4A 2ZUVA 4WPGA 3VPFA 1TA0A 4X6YA 2H2FA 3RCBA 1CYEA 1LK7A 5CDTA 2E85A 3UG7A 3IPYA 1XD9A 1SKUA 3LVFO 4E5MA 1NNI1 3LGSA 3RS2A 4ZDJA 2GN8A 1R10A 3C97A 1AKRA 2ZUCA 4YRPA 1OYOA 3FHTA 1GUAA 5A5FA 3LGXA 2WHEA 3RUPA 1JI0A 5L7WA 3HUUA 3ZY4A 4JXZA 2RSLA 5FL3A 2Y1CA 4JOQA 4CODB 5TC4A 4OHVA 3MT8A 1TD1A 2JLRA 2A1UA 4WLEA 1G5PA 1POWA 2VUUA 4YUXA 1L1RA 2I29A 4CNQA 3ENZA 4DTCA 3E9YA 4KLRA 4Q1BA 1BWSA 2OHGA 4M87A 4ND8A 4DKXA 3LP6A 1YRYE 3FZYA 4GEGA 1Z6QA 2VNSA 3IE1A 3LZ6A 3A9SA 1ABFA 2G40A 2YQ5A 2VJDA 1XTRA 1RPAA 2UAGA 2QW0X 3CLVA 4E09A 1II8A 1DAIA 2AG1A 3ZHSA 5CD1A 3EPLA 4WOPA 2ZROA 3BIWA 4AWXA 4JVNA 1P7CA 3WL5A 2YCLA 2NQTA 5DOVA 5A5VA 4IFIA 1KA9H 3K72B 5ENDA 4D3ZA 3ORHA 4PR3A 3DZGA 2JBHA 3H1PA 3AL2A 4HRVA 1REQA 2JVIA 1GT6A 3I0NA 3ND6A 4Q3KA 5JYDA 4CL8A 4ESOA 2QN6A 4TSRA 4HEHA 2PGDA 3A1EA 4XSGA 2RBEA 2XBMA 1NJ1A 2X5KO 2XYQA 3W6ZA 2ZKIA 1FTYA 1W96A 1XP8A 1T8WA 3EF3A 4UD2A 3ROTA 3N7UA 3KDSE 5AHRA 5DBOA 3ACBA 2A5YB 3PC3A 3OF3A 2ZUDA 5DJ5A 1TT7A 5ALPA 5EJFA 1KZ7B 1O95A 2K87A 3WFZA 5A7FA 3OFNA 3MUNA 2PZLA 3BK2A 3FNEA 3OZGA 3ZVNA 1E6LA 4H31A 1DBIA 4IDEA 4QOSA 2C5GA 1X42A 3AR3A 1AF4A 1NBOA 1QIGA 3I6YA 5E2AA 5IF3A 4GM0A 3RPEA 3WVNA 4JI7B 1AHNA 3VC7A 4HGQA 3W5IA 3X1XA 1WP4A 3UGJA 3JQGA 1DMRA 1CDEA 3EUFA 3HEMA 4OH1A 4J0HA 3U26A 3ZHXA 5IXSA 3SKVA 4MJ3A 2WOJA 3K09A 1Z37A 3JATB 5M2QA 2DFKB 2F3TA 5HX7A 2W7TA 2OCYC 1AQNA 4CG0A 1T1JA 1XD8A 3CJTA 4I9FA 4FMCF 5JAZA 1I4EB 3J81A 3BRWD 2CXHA 3ONFA 3LUDA 2G09A 5DSZA 1F5NA 1M6WA 3BTOA 1PV2A 2BLLA 4FB4A 3EXHA 1ISJA 2CCGA 2XOXA 4I1RA 2P41A 3DXFA 3OIUA 4HDKB 2AR9A 3JD1A 3SZLA 3GAAA 3SFTA 5IVKA 2O8FB 4RTJA 2ZRJA 1IM8A 5BMVB 1NXWA 3LVRE 2UUBB 4FI3C 4MVCA 4WY8A 1QAMA 1T1EA 4R2MA 1ZISA 2ONZA 1CZNA 2VAVA 4RCZA 3AF0A 3K9QO 2UKDA 4J75A 1YL7A 3DEFA 3N0TA 2I55A 2VDWA 4Z9AA 3ROEA 3O1LA 4PCUA 2Y3IA 4FKBA 1PLJA 4REMA 2R62A 2A33A 5I01A 2FSPA 3OBIA 1H8HA 3FCCA 1QTRA 1YZUA 4FQ8A 4DB2A 4YACA 1IM2A 1UEJA 4WDQA 1PZMA 3KJIA 3DVLA 3V32A 1N4AA 3SC6A 3ZUGA 2ZB2A 2OAQ1 4C5BA 4EY8A 3LPNA 3ET4A 3NXSA 1NW6A 1QXSA 1ZH2A 4RACA 3AHJA 4I2VA 2ISQA 2XDWA 4LDRA 4KZPA 2OHIA 2PMCA 2OXTA 2WFMA 4FTWA 4LNUB 721PA 3SLKA 1FRVA 1CUXA 1TGVA 2WHYA 4IOJA 4IIEA 4QGSA 1M6VB 3DMRA 2OO7A 5KYUB 2PZBA 4GXNA 5BW4A 2BKEA 4GOMD 3U7FB 3U4CA 3A31A 1P6XA 2GD2A 3GPBA 3NT4A 3UJDA 4PZDA 4QODA 3TR0A 4DMGA 3PFNA 1X7WB 2FPLA 2CJXA 3D5EA 1P0QA 2Q6KA 3DMYA 4KHPB 3B51X 1GARA 2OWDA 1U65A 4J29A 5TR9A 2WWRA 2WWGA 2B0CA 3EK2A 4X85A 4W8HA 3A36A 1NY6A 2BAGA 3A4NA 4MYRA 3IXLA 3FZQA 1KK1A 1U0FA 3LE8A 4KWIA 4OK3A 1P4RA 2O07A 4GLOA 2EHDA 2RHWA 2QD4A 4M0EA 4CIYA 1M2GA 1T9BA 2QTWB 1NVKA 1YRBA 2WWTA 3LUPA 1KZ9A 4NPHA 2NSYA 2ORIA 2GERA 5C7LO 5JAIA 4L3OA 2G1KA 3IP8A 4RE6A 1E94E 1JLLA 3HM9A 2PYZA 3EH2A 2X2PA 3WLMA 1PJAA 1QUEA 4MNTA 4CM1A 3TCNA 4C0QC 3DDHA 4JBGA 2I3GA 2G1UA 4P35A 4DGQA 5B3LA 5CEEA 4QT0A 2MSNA 1JPJA 1RTTA 5AI9A 3T3IA 3H4IA 4WESB 2XUOA 3G0HA 1TB4A 3SIXA 4HNUA 1QANA 4S1PA 1XJ0A 1SQSA 3GJ4A 4UNRA 3QMWA 1X1TA 2QN3A 2ZSEA 3GELA 4HTFB 5D8DA 1Y7LA 3RQIA 4AJJA 3ZX5A 4B4KA 4NBLA 4H1WA 4URZR 3ZDEA 1Z9BA 3A0RB 4R98A 3RJZA 1O4WA 2WDZA 4KO3S 3SE0A 4BS9A 2DJ5A 2OO3A 4BNWA 2PSFA 3RS7A 2A4MA 1U5CA 1CPYA 1XL0A 3JYPA 1HI9A 4FXPA 4BFCA 1XCJA 2HQOA 4K6KA 1UDXA 2PKEA 1HK7A 3GNQA 2O4CA 4MR9B 5C7OO 3U6KA 1KMNA 3P2MA 4MK4A 4AYXA 3EBOA 1GZUA 3ORQA 4NS4A 5CNKA 2X3FA 1HLPA 1YJBA 3CEHA 5FPSA 4YRNA 3E5RA 3F6YA 3CYFA 3FWKA 4Q03A 3A10A 5CLLA 3USCS 1K9SA 5AVZA 2VP3A 2P62A 3WE7A 1YL6A 2MDTA 2WD8A 4UU8A 2OG2A 3TQSA 4Z9XA 1H3NA 1W52X 2NTYC 3OC0A 3I83A 4Y2HA 2H1HA 3E9ZA 3IT2A 4J7XA 4YYEA 2IHVA 5AOBA 4NDNE 4HDSA 3UYLA 3IDOA 1VG1A 4FDVA 4OREX 4ZOQI 2IS4A 3FCEA 4WY2A 2VTDA 1C30B 2W2PA 5KVQA 2MMCA 2WABA 4I5GA 4DM4A 3TRIA 4G5GA 4BNYA 3N7AA 5FBLB 1ZNZA 1E63A 3U7RA 1GKYA 4MIEA 4EJSA 1MA0A 1ZGAA 2HU5A 3WGOA 1U7PA 3QU4A 3TRFA 5I9BA 4BFXA 3QGMA 4FCTA 1PEYA 3NKLA 4HWSA 1BXRA 1DC5A 1N6IA 1NLZA 2IV7A 5CAEB 1AB5A 1FQOA 2BGUA 4B6EA 3VPSA 4C20A 4KWEA 4Q12A 3HZZA 4LY9A 1I0ZA 4YO8A 1ISRA 1IHUA 4CGYA 3U61B 1GZ7A 3Q2KA 1KVSA 3IBFA 2PD3A 2ZPTX 5IYZA 2X5XA 3R9XA 4OP2A 3S2YA 2G07A 3RSQA 1EBBA 3H3FA 1BEZA 1ISHA 1K3FA 4QXMA 2JRLA 3NBQA 3SR3A 2RAVA 5IM4F 1GY8A 3OQOA 1PCXA 4ZFNA 4KN5A 1E1DA 1VMEA 3UPDA 1QP8A 1Q2UA 5JW6A 1E2IA 3EMDA 3HXOA 2VAPA 3OEHA 4RQBA 5E0KB 3VU0A 5BPFA 3HDQA 4F4DA 3KSBC 2Z56A 4YJHB 1XZFA 3EEFA 2QVXX 3GPIA 4HNSA 4AUEA 5HM8A 4B79A 5C7YA 3BXOA 5DIFA 2CNOA 3X1JA 5B37A 5JYEA 1GGMA 3F8SA 1EA5A 1E20A 2H07A 2ZRDA 3EODA 3MTDA 4IIDA 4QGAA 5B55A 1O0BA 1J97A 5DNDA 3ZWMA 3ANNA 4XCXA 3C5EA 1AO0A 1EUYA 4LGVA 4MR7B 1QC5A 2QVZX 4E11A 4AUNA 1HDXA 3H8VA 4MVJP 2I65A 5KOJA 2E1PA 4TYYA 1GZHB 4MTLA 1IATA 3T9DA 3ZZUA 1YQWA 3AGPA 6REQA 3CUVA 1E2PA 3T1NA 4B7ZA 1OAOA 1BQEA 2NGRA 3TLBA 1Q0UA 2MINA 2BMAA 4P92A 3AZOA 3JQAA 3WADA 1RW4A 1W5EA 2FPWA 5AOVA 1RCFA 1GD1O 2CDNA 3E5HA 3MF4A 3WKDA 4IL5A 3H97A 3QVMA 3LOUA 4J16A 2ECFA 4NZNA 1GA1A 4D44A 1Y8QA 4FZVA 4KCGA 2PEZA 3CWCA 2EW2A 3CUYA 3HYRA 1W87A 1AC5A 4G85A 1I01A 1N2HA 2PSJA 1OE0A 3BN3A 2GO7A 1XFAA 3CS3A 5JEDA 3GLKA 1HURA 4J7CA 3T95A 2J9XB 5M5BA 1EVQA 1P5ZB 1XAGA 4L4SA 1G55A 1YK1A 4FFBA 3A27A 3LQYA 4TV8F 1FP6A 4X8HA 1DKNA 1U8AA 3E81A 5EPOA 3EW9A 3I28A 2F3QA 3T3DA 1JR3D 1ZOPA 3WTBA 1XHEA 5LXTA 1CIJA 3CPEA 1YJAA 1M73E 3GIDA 3C14C 2HW8A 2FQ1A 1C8KA 5HGXA 1Z62A 1N5KA 5KDDA 1J2JA 3LFHA 2FZWA 4G0ZA 1KEEB 4KHZA 2QZZA 3T7IA 3W9YA 1G8JA 3ZOKA 1XF1A 4CBVA 1TTTA 4DR7B 1M34A 1UBHS 3DMTA 5KEIA 4J0JA 4IDAA 1PVDA 2EGUA 4WT7A 2GYVA 5I7RA 5J43A 4QXOA 4PQYA 2C2BA 1CR1A 2J5RA 3ULKA 4NEHB 5E2IA 3O2SB 2JIDA 2VHCA 5CM2Z 1XV5A 5CDHA 3CLSD 3TE7A 1KEVA 3IP3A 2QAGB 4LIPD 4P9NA 1C3JA 4LC9A 1VIDA 3O4JA 4BAZA 4B7AA 4TT8A 1VB3A 3HJAA 4FNAA 3FMFA 5ALLA 2ZSFA 1KKLA 3DGEC 5KYVA 3K2BA 4RYDA 4JI8B 1TO2E 3A6JA 1EFVB 2JD0A 5AK5A 2ZIZA 2K5UA 1S8AA 5CVVA 1U9IA 2R1TA 1R0WA 2WF9A 2OP1A 2UU9B 1IUPA 3GRUA 4DXAA 2QTLA 1BFKA 2RARA 1RSZA 3K0FB 3KK0A 4Q3AA 2P4UA 3DR3A 3F3KA 2OFFA 1Z75A 1LRKA 3H9BA 4HXYA 1GDDA 1XDWA 3IAS6 1BHSA 3OJLA 4UU7A 5C8YA 3RNLA 2XCSB 2AFHA 1P7ZA 4NECA 3OF2A 1C7FA 1I2DA 3NTRA 3CU5A 3FHJA 3WB0A 3DTTA 3QF4A 2W58A 5CFQA 2F55A 1XYYA 4F96A 1L5ZA 4L6IA 4LXYA 2BMDA 1RRPA 2BRUA 2XZPA 3E3AA 4MV1A 3VKFA 2RK3A 1UIMA 2AFRA 2QIOA 1Z7GA 2ZTSA 3HU5A 2X2OA 2AZXA 2G70A 3SIRA 3M83A 3U37A 4TTIA 4Q7QA 3S2ZA 1FUYB 3K0CC 3ZEAA 4ZHSA 4LOKA 4WLNA 5JSYA 5JBNA 5LP1A 5MDHA 3QLUA 1PNQA 1TYDE 1YBFA 4XJVA 4EG1A 3AY7A 3EWIA 3K1YA 1YUMA 1E4OA 2CL5A 1S4MA 1SOUA 4FDUA 3GJQA 4Z7OB 3FKSD 4GSLA 1JKIA 2I3BA 4BE4A 1MQSA 1XRLA 2Q3DA 1JZQA 1DJMA 1Z22A 2PCLA 3FPHA 2DBZA 4FE7A 1K8RA 3LM8A 4B4VA 3KELA 3PEEA 1LK0A 3QE2A 3D7NA 3PI7A 2HAEA 5ERGB 1W2HA 4UE2A 3V1MA 2OGSA 4R8MA 3WOVA 1CEYA 3B2QA 1FXWF 2H1WA 2MMGA 1K7EB 1OLOA 3IVXA 3QFFA 4NOLA 2QZ4A 1XEWY 4X5OA 1EFAA 1WXXA 3BORA 1MNQA 4PICA 5CRIA 4C1NA 3RLIA 5CXUA 2O2DA 1CIVA 1WPXA 1BMFD 3U1TA 3JQ9C 1NQOA 3C3BA 5AXAA 3B13B 2YZKA 4M46A 4QBHA 4Q37A 2ZWAA 1Q7BA 1CK4A 3I4CA 4BAGA 2DECA 2Q1XA 3EIQA 5I7VA 3EZYA 1KVUA 1ZNYA 1KAQA 1ZQ9A 2AYYA 2JZNA 2ZPUA 3EIXA 3JARB 1TQ2A 3QEKA 1G1AA 2V6IA 3Q0TA 3DOOA 3W8EA 1K8XB 1AZTA 2FPMA 2I78A 4ZEWA 4Q93A 5EJGA 1X13A 3N8HA 1V9LA 1GNPA 2NQ8A 3E15A 3TOSA 4FHGA 1UP7A 4PAMA 5FULA 4AM8A 4W8GA 3RS3A 4D99A 3GEEA 3GLGB 4BPBA 2HA2A 1Z7WA 2H57A 1JAHA 3OLQA 1YH3A 3BJMA 5FV7A 1JG3A 2GEJA 4CUJA 4D5GA 2ZEJA 1XK6A 2CJWB 1LB1B 1VG0B 5JYBA 4ADSG 3DVQX 1E3JA 1L3BA 4GDMA 4K6OA 4OIFA 3PTLA 5AT1A 4HLDA 2RC5A 3T3EA 2PHZA 4CM3A 3K70D 1K7SN 2ZIGA 3DNFA 2VPPA 3K9GA 3IUQA 3NEPX 4FQ5A 4Y9DA 4W99A 4OKNA 3BHIA 3QXSA 2E4YA 2FDRA 5EXXA 2VDLB 1NU8A 1X1BA 4HQOA 3KJFA 4PZAA 1XKQA 3VDQA 3KB1A 1CVIA 1TF5A 2FJ0A 1XNQB 3QVWA 4JFAA 4GKVA 2JCYA 3I3OA 1NJ2A 2CLIB 2ZSDA 3IAHA 4IHJF 4PR0A 4Q05A 2I9KA 1Q3HA 2G9VA 3C6BA 1RYBA 4R2LA 4J6FA 3RC7A 2ATVA 1SVSA 1U7OA 2A88A 2BONA 3AKCA 3C3KA 4RM2A 1ADJA 3C70A 1TZBA 4HMQA 4FWTA 1Y6QA 4HDRA 4R16A 4JQSA 4L6AA 2R4UA 3VKHA 2JLUA 1GGEA 1PR1A 4P93A 1RXVA 3GRKA 5ERYA 2H48A 2YHIA 3CNHA 3E70C 5A7HA 2D5LA 2HEIA 3W4JA 3OUUA 4G8BA 1FP4A 1NV9A 1S01A 2A9OA 4TYPA 4K2AA 1QVVA 5ERXA 5CH3A 3IAFA 4TUYA 1U2GC 2V4ZA 4LBWA 1D7OA 1I2MA 4NJMB 3ZD6A 3T4UA 3VVBA 2WVJA 3EEQA 3N0WA 3QK7A 2EFGA 3CIOA 4NLLA 3G5AA 2ZBQA 4JP3A 2PMKA 1JDUA 3R4VA 4H7HA 3TEFA 2RGNC 3ZPXA 3PVZA 4ZCTA 4F06A 1KI2A 4H1TA 3GNLA 1SURA 4UEQA 1TYCA 1BJRE 2R7KA 3TPZA 3GUUA 2IC5A 2HRQA 5CX4A 2J9FA 2PPVA 2QDKA 4EGSA 5AFSA 3I76A 1R9JA 4MWDA 3TZ6A 5FFFA 5TIIA 4PE5B 5E6RB 4HATA 3I30X 4JEIA 4K03A 5DI3A 1P7VA 1RMTA 2P65A 2CJPA 2XADA 3BICA 4B43A 4C6TA 2EZTA 4FUQA 4XEHA 4XE5A 1A71A 1M1NB 4IYRA 5ALIA 2C4WA 3RIMA 4DXDA 4X9XA 1KYVA 4LK2A 1ZEJA 1MVOA 3PPXA 4YIHA 3IEUA 1Z4JA 1G20E 2FUNB 3MTIA 4WVLA 1P31A 1F8GA 4RUKA 5AVWA 1CRQA 4C30A 1AZWA 2B8EA 4RTSA 1MF7A 4YVFA 1L8LA 2X58A 4BLRA 4B4DA 1NSTA 1Q3KA 5KWEA 4D4JA 1NPYA 3B20A 1CJUC 5DNEA 4AYTA 4BZZA 5GADl 2QAGC 3N6VA 1X3SA 1E3TA 4DR4B 2Q21A 3TTYA 3HM2A 1YUBA 3V8NA 1CQIB 2POQX 4XYGA 4B4WA 7REQA 4GECA 1TM7E 1TKCA 1MB9A 1G5FA 3H1FA 4OBEA 3T3MB 3Q88A 5I7AA 2D0DA 1G3RA 3ESRA 2FB9A 2Z5VA 5AW9A 5JOQA 3ID6C 3IEIA 1PQPA 1U90A 3VVMA 4ZC8A 3RVOA 2P2SA 3CPJB 1VHLA 3JWIA 3B82A 3PENA 4PNHA 5B64A 4YP7A 5DN9A 1U3DA 3OQPA 2C31A 5DXFA 4KXNA 4HBGA 2VR1A 4I4TF 1ULHA 2ZSAA 1HRKA 2D8AA 3QTBA 5FADA 4HXEB 3CY6A 2XEDA 4ZCLA 2C5AA 1DELA 1KE1A 3DEAA 5AK4A 1R18A 3KEGA 4NEQA 3DZJA 3ZCTA 2QJFA 5EGNA 2WQZA 5FAKA 5KZMB 1E9FA 3U5TA 2OSVA 5G4KB 1A88A 3VHQA 4AIRA 1FFBA 2ZB4A 1WCIA 2DPGA 3G59A 1YB5A 1JI3A 1PS8A 1SA0B 1GNLA 1QR6A 4J0KA 2WSSD 4MYDA 4PC7A 4AYWA 1NYQA 5CNIA 2JLXA 3RJMA 1CUZA 2BFBB 2MCFA 3RFXA 2WYHA 3THXB 3CKLA 4ZK6A 4E70A 4G8CA 4F7DA 3ZZMA 1OH5A 1DLIA 5JT1A 4QEZA 2YJ6A 2GM3A 3LC7O 3KJZA 1BS9A 3C4QA 1KO5A 1XXHE 4IKEA 3E9NA 3FRJA 4HVLA 2O8EA 1RPZA 5B6JA 5CA1A 1U81A 4HXGA 3DKRA 5FRDA 3HV2A 4AB1A 3DTVD 1BCRA 4I8IA 1EZ1A 1IHXA 1HE5A 1QFZA 1NVGA 2GK3A 1K8QA 2GWRA 2W2QA 2V3WA 3Q40A 2IZ1A 2X4LA 4K6FA 3QPAA 1ZMTA 1L1EA 2GYYA 5TMEA 4EYEA 5A1JA 1WVMA 2XGSA 3MTGA 3P9ZA 5FLKA 3S8EA 3TUZC 4I50B 4ZTBA 2XLBA 2FMUA 3IUEA 5CW1A 1QU2A 1XA0A 3H3XA 1XNHA 4HCJA 5EUBA 4BX8A 3PEWA 4NESA 1W25A 1XNRB 4QYIB 1T3TA 5K2MA 4C29A 2MHCA 3FHOA 1YZLA 3QJYA 3G0OA 3GT0A 3VR4A 3ZWCA 3VAAA 1F2VA 4OQDA 1FMJA 1N1DA 4RVCA 2PYDA 2ID9A 2Y4OA 1ZMOA 4JR1A 4UZSA 2BFFA 5IK2A 1N0HA 3ZU6A 1SIOA 1ISIA 4YCBA 4GPD1 1LY1A 1DAPA 2AJBA 3OBBA 3W2IA 3BM5A 5K09A 2JJ8A 4XGNA 3HUTA 4BBZA 2ZR0A 3NASA 2RCYA 3GP3A 1V37A 4JKOA 1VYVA 2IEYA 2Y71A 4DR2B 5CVDA 5G41A 3OQJA 4ZZ0A 4QQRA 5FX2A 2DULA 4NH0A 1QO0D 4UZEA 1YNSA 4CFZA 4DMFA 3ZLBA 1DE0A 3SWWA 2C3PA 1PR9A 1QKIA 2XH8A 1UINA 4II7A 4NAUA 1L7BA 4ZC1A 3ESQA 3BCUA 2X9VA 3JQ8B 3KEMA 4G2TA 5U4QA 3MNFA 4G0WA 1WMBA 3HL4A 1NP7A 4QU8A 2RGRA 1ETHA 1T4MA 3CZ4A 2P91A 2B78A 2V4UA 4RV4A 2CJYA 3B6KA 2P27A 3E22B 2ZOSA 3IOMA 3ITKA 2H0QA 2WJZB 3QMMA 2PTGA 5GJBA 1DZ3A 3H84A 3U44B 1RDFA 3MILA 1ZOSA 5EA2A 2BHLA 4YXWA 1LBSA 1Q7RA 3I0MA 3KS9A 3AF3A 1RYMA 2F8TA 3QSGA 4H27A 3SBDA 4GZ3A 4RCVA 4RLSA 1KIMA 2W37A 2XV1A 2F7SA 3DDUA 2GNPA 3QBDA 1PJ2A 4IRXA 4ODIA 4JT2A 4PZZA 4UDNA 3V8MA 1BJKA 3NR2A 4RK4A 3IHWA 3JY6A 1XTZA 2IYVA 9ABPA 3WIUA 1Y1TA 3OU6A 4C7OA 4YRJA 3MFYA 2V96A 2DXIA 4HB0A 4C0HA 4UFOA 1E2EA 4DIFA 4L8FA 1JEYB 1NULA 1APBA 1RP1A 1E4EA 1T3ZA 1M2FA 2R48A 4IXMA 2N0SA 4LEIA 4YWHA 5A71A 4Q1DA 2VXYA 4DLWA 1L7DA 1U02A 4HUJA 1UQRA 3LKZA 3ZDBA 4KWCA 1JHXA 3KOXA 3QBEA 2COEA 1ZRNA 3DBOB 4GH5A 1LEHA 4AG3A 4CM9D 4OI0A 1Z0AA 1Z0SA 4CQMD 4XDGA 2I2WA 2YYAA 5K8JB 3A14A 2G4LA 4DIDA 4KXWA 3CLTD 1SAYA 3DCIA 3DT6A 3A6PC 1L5HB 4GLFA 1K6EA 1WUIS 1RQLA 1Q7TA 3UHOA 1NW9B 4LOIA 1C9DB 1JQAA 1W47A 2FPUA 5F51A 3ZI4A 1FVXA 3RB8A 4G6ZA 3ABRB 4B0PA 2ZCJA 4RH3A 3UT5B 1EWQA 4HAYA 4BLUA 3R0ZA 2O3SA 3PCXA 4F4HA 3ZXXA 2HQRA 3PC8C 4UE6A 4OU4A 3WBFA 1FF9A 2OECA 3ESBA 4WV3A 3KSRA 3QFSA 4XM2A 5CB4A 1NFRA 1YFZA 2GD6A 1IIBA 3HZOA 4WAUA 3QPVA 1GQRA 2E4ZA 1KQOA 4G9EA 4MWTA 4UM5A 4WNYA 4I3HA 1MFZA 1PV4A 1PUJA 2P5UA 2QYSA 4P08A 1A9TA 4UQPA 3L1HA 3IAUA 4CVNA 4YUZA 2FQQA 2ZT5A 3P71T 4PBTA 4WXMA 3O8RA 4DBLE 1V5FA 1JXOA 2X1MA 4TL8A 1OHHA 1QOZA 2H52A 2DPYA 5JECA 2JIZA 3LUJA 1EJ0A 3SQOA 2IYPA 3OWXA 1JQ3A 4I5EA 4ITUA 1IOLA 2CKMA 2ETVA 2Q5OA 4CEIA 1RLTA 4Y2PA 3LQ4A 4MIKA 1F51E 3L7DA 1MT0A 5FTWA 2CWDA 1OCEA 1FFAA 2H11A 2VTVA 1L4UA 4B8WA 4NHOA 4FN4A 2HXGA 2WJAA 5FKJA 2GRUA 5JC1A 3TDMA 1SPBS 1JIJA 1UPUA 3MOGA 5CR9A 1DKLA 1L3IA 1SBNE 2B6NA 5GGYA 1YULA 4V0RA 3NJ8A 1EZ4A 4G1MB 4CEJA 5FI1B 1EX1A 1Z5PA 3CBGA 1QHXA 5B2EA 3AEXA 3K1AA 2EDCA 3MRTA 2XMGA 2A67A 4RK0A 4LBZA 3ZLTA 2BN4A 3UWMA 4IMJB 4KE7A 1QQ5A 1NXPA 2AOTB 2V8OA 3A4TA 4O1HA 1I6MA 4FCCA 1UMDB 4Z9BA 3E2IA 3I6BA 5DCLA 5DV9A 2I6GA 5BYAA 3NHFA 5BSVA 1M2VA 2X9GA 2JVJA 2NO4A 4FR2A 2YWJA 2YWDA 4WFKA 2G17A 2IXTA 3EA4A 2CSUA 3V2IA 4LF4B 4EHIA 3GLHB 1J00A 3IDSA 3D6TB 3NW9A 3UANA 3MD0A 3O47A 5ES4B 5JXWA 2X8WA 1L0BA 3O8BA 1RE1A 4G67A 2XYRA 3HVUA 4GOLD 4MRMB 2EBHX 2C57A 4IDDA 1ETUA 4J0EA 2WPDD 1GL7A 1JR3E 4LPSA 2BM9A 3IQHX 4I8DA 4YHBA 1B42A 2VQDA 2ZTUA 3DBHA 3KUCA 4X61A 1A9YA 1BGXT 2OCLA 5KOYA 4Q4AA 2VIIA 3REQB 3ICPA 4JQZA 3PPIA 3HY4A 3UBMA 2P30A 2VWQA 3MCUA 1L4EA 1ZJ4A 2CFRA 1N32B 3TTSA 5DSXA 4KP7A 3SICE 4KAFA 3VQTA 2H1VA 3EAQA 2VWHA 4EGQA 3GARA 2RE8A 2Q1SA 3QBJA 5BXYA 4BJHB 4D9KA 3HO1A 4BLSA 1ZRHA 2DWOA 5DLPA 2ZRPA 2FUCA 4TZ0A 4Q4DA 1KYZA 1FL9A 1V8DA 2P0YA 3R0XA 4GQIA 2G9NA 4NONA 4YRSA 3LL4A 2JAPA 2XWPA 3K32A 4IOLA 4ZVOA 1VZ3A 3O26A 4P53A 4KDEA 2D3WA 4BQEA 4OB6A 4AW9A 1CXZA 4WASA 3U3DA 5JAOA 4G4JA 2PIAA 2Y1FA 5G02A 5EKSA 1O57A 4GBJA 1EFLA 4RU1A 2REXB 1L7MA 1IYZA 4HEA6 5HQTA 1FMFA 3JVEA 3ACDA 4CKBA 1QHGA 1QGUB 3BFXA 3NC0C 3LBYA 3RD5A 1NTOA 3URMA 2DGDA 5COBA 5KNDD 3OSUA 1Y9ZA 3K53A 3KAJA 3TR6A 3DYVA 1UQUA 1SVUA 1PJ8A 1FUUA 2FPGA 4MV6A 1EUCA 3EVCA 4EB8A 3S8YA 1XZ8A 2YVQA 1RC0A 2VQSA 3ETEA 3NU1A 4IQGA 4RY8A 3SK0A 1NSYA 1Y7IA 5F1PA 3UAXA 3PQ4A 3WYDA 4ZD6A 2QRNA 4JI3B 1I32A 2W6ZA 1KJQA 3LKBA 1JTEA 1VE9A 2OHFA 5TB5A 1W0JA 3IV6A 3SD7A 2ZRCA 5AKHA 2C59A 1JR6A 4H4EA 2GBLA 3HWX1 3I6MA 2Q5IA 1UM9A 1YR8A 2B5VA 1NLUA 1YR6A 2H5EA 2Q6TA 2X0JA 3Q7EA 3QWAA 3VNBA 4CMEA 1O0SA 3DDCA 2AN3A 3O83A 3QWIA 4KPFC 1S3FA 4EG0A 5BWLA 1EXMA 4DDUA 5JH7F 1ADFA 3H1TA 3VR4H 3G0DA 3EZLA 2ZANA 1NG1A 1OWPA 1PF7E 1VHJA 1RYNA 2EWVA 1PU2A 3BJEA 4LDJA 5SY9A 1OAKA 1YB4A 1ZRSA 2ZB3A 3C0KA 5L3SA 2ZVQX 5EXPA 5IKXA 3ZH9B 3SF0A 3K15A 1R37A 4LRYA 3QJ5A 7MDHA 2RH8A 1RAGA 1YVRA 2ZRQA 3HCRA 3PQ6A 2PM8A 3O03A 3O3CA 2I8AA 4A8JA 5CMLA 2QTMA 2IDKA 4ECEA 2IH4A 4YT2A 1K7CA 3KEOA 4F3KA 3M4XA 3PXGA 4AS1A 1R16A 1H3EA 4O4IF 2JJYA 2GF0A 2X4IA 1E99A 4YC7A 1LDEA 5ITSA 2Q3JA 4OGWA 1ZA2A 3H2BA 3P4UA 3SIPA 3L7CA 5DWDA 4DMUB 3N59A 3ER8A 3OUTA 2VJYA 5CFPA 4DE5A 1XZKA 1GZ5A 3ND5A 3VR2D 2A3NA 1OU0A 1UBFA 1R0CA 2AC7A 3WISA 1T5HX 3UV7A 4OP3A 3ZZ1A 5CB8A 3OPYB 1NE2A 2GHIA 2GXQA 1V1RB 4BPRA 2V8BA 1Q6YA 1TK2A 5FV4A 1EGMB 4V0MA 4IDFA 3NNNA 5FHRA 1COWD 1RXWA 1MO2A 1RYHA 1KAGA 3BH0A 3CURA 2ORYA 4MQLA 2JJMA 4PM4A 1TFRA 3KLBA 4G07A 4IHJB 1G18A 5EKDA 3STUA 3LCMA 4JIGA 3C39A 1C3OB 1XDUA 3BK7A 3P9YA 1BDIA 2JFNA 4W1PA 2X5JO 5BNWA 3JYLA 5IM5A 4CU2A 5JNWA 4LY3A 3WZ2A 3OTIA 1GXSA 2OG1A 5K51A 1YTUA 3FWHA 1QK5A 2W2TA 3JWGA 1Y3IA 3Q7QA 5FPPA 1V8OA 1G38A 2O54A 2UUOA 4JMLA 4CRWB 1G66A 4ARAA 4E6PA 4F93B 1E5DA 4HWOA 4FOTA 4QWMA 3D3WB 1XPJA 4NCNA 4Q6WA 4UPDA 5FLEX 4HNGA 4UVIA 4C9BA 1E6MA 4HQNA 3AINA 5BR8B 4KR3A 2VYVD 1NR1A 1LSOA 3OZXA 1XZDA 2HYDA 2J3HA 5AUOB 1RYDA 4L51A 4CU5A 3PXBA 3L8EA 1OWMA 5G3YA 1X80A 2A35A 4F56A 4MS3B 4BMXA 5KQMA 2FZGA 4XUCA 1ATZA 1THMA 2H0RA 3ICWA 4FGWA 4R2WA 1LPSA 4LYDA 3F3SA 3GAMA 4L57A 4LRSB 5FUXA 4B2LA 4W5QA 3RYHB 4UU0A 3KZOA 4XD2A 3QA3E 3AEKB 4AT1A 1TAGA 1IBMB 3UN1A 1YSCA 5K20A 3HRIA 1X0VA 1Z47A 3MSXA 3MTBA 4XTRA 1MAAA 4JVOA 2W2LA 5TS2A 1HYGA 4O1MA 1G8AA 3FYSA 4IV5A 2LV8A 5G0VA 2YY7A 3PKJA 3QQ5A 1TVKB 2OK8A 4JEHA 1QE5A 2RHLA 1BWQA 3W34A 5AQ1A 1Q50A 4LJLA 2HRDA 3VR5A 3WLEA 1OI3A 3JAKB 4CQLA 1G21A 4BWYA 4TS4A 3ZHCA 4J0FA 4DG8A 1EK6A 3ZBTA 5AHKA 1AKTA 2WF6A 4AMVA 3SEFA 3KSMA 3ZE8A 4V03A 5KCZA 4FBMA 4LCEA 3TXYA 3GEHA 3UXHA 1D2EA 2EKBA 4BLVA 5KBYA 4CM6A 4A16A 2CUKA 5BSEA 3C98A 4P7GA 4EJ2A 1L4MA 3FAZA 1DRVA 3UC9A 3I2KA 3M6WA 3QH4A 1NXQA 5K3SA 1ZUHA 3MQFA 1K2WA 5ED4A 1W2GA 3WHPA 3TTUA 4YXFA 5IHPA 4K9RA 4ZEXA 1XJ5A 1P4JA 4FC6A 2AJ8A 4UCQA 4N03A 1GSOA 2J3EA 3G1WA 3Q7RA 3ZK7A 1XTUA 2A14A 1ECJA 1BDJA 2OD2A 4OIMA 2ZAIA 3HE3A 4WXYB 1EFDN 1QPBA 4QD3A 1QZZA 1DG9A 1NW5A 4DQKA 3B1XA 1KDTA 4KQCA 2EXXA