4DVGA

Crystal structure of e. histolytica formin1 bound to ehrho1-gtpgammas
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
164
structure length
164
Chain Sequence
LKIVVVGDGAVGKTCLLLAFSKGEIPTAYVPTVFENFSHVMKYKNEEFILHLWDTAGQEEYDRLRPLSYADSDVVLLCFAVNNRTSFDNISTKWEPEIKHYIDTAKTVLVGLKVDLRKDGSDDVTKQEGDDLCQKLGCVAYIEASSVAKIGLNEVFEKSVDCIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Entamoeba histolytica Rho1 Regulates Actin Polymerization through a Divergent, Diaphanous-Related Formin.
pubmed doi rcsb
source organism Entamoeba histolytica
molecule tags Gtp binding/actin binding proteins
molecule keywords Rho-like small GTPase
total genus 51
structure length 164
sequence length 164
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2012-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dvgA00
3IEUA 1W1WA 5JI3E 2A5DA 2F1HA 3P32A 1F3OA 1D8TA 4UXHA 5G40A 3AEZA 1XTKA 5EZ6B 1FQKA 3MRSA 3LFUA 2JCSA 3GFTA 3IO5A 2IUTA 3DMNA 1XXHB 2WOOA 4G1UC 3ASYA 4D80A 2J7KA 1Q12A 5EP1A 4CEIB 4C4PA 1F2TA 3GLHA 3TK1A 3K9HA 2OCPA 1UDWA 1TL7C 2OFXA 3RRNA 4R2HA 2P3SA 5FBWB 1FNMA 1KK2A 2IXEA 3CIOA 4Q9LA 4TZ0A 2OESA 5F9HA 3HU2A 5CK5A 5DLQC 3M0EA 2WJYA 2V3CC 2NTYC 3LNCA 3ICQB 3ICEA 1XEWX 3BORA 4PHFA 1H8ED 3NDBB 2JLVA 4PC1A 4TT3A 1S8FA 3CF6R 3IHWA 1XXHA 1ZCAA 3KDSE 2JIZA 3C4JA 3THOA 2ZVQX 4CT4B 4LWZA 4PC3A 2O0KA 4JT2A 1G8YA 4BEJA 2CHGA 3FMFA 1G3QA 3QF7A 4OK5A 5FOTA 3ZZUA 2IC5A 2NPFA 2ODNA 1XTJA 1ZW6A 1U2RA 3A58B 2FU5C 4M9SA 3A1TA 2MMCA 2XNDD 4B43A 3GEEA 4Q02A 3I92A 1GVNB 3U3OA 5C18A 1MABB 5JRZA 4CGZA 2XTNA 1HURA 1U99A 3G82C 2B21A 3AKCA 4IFBA 2J0SA 4CIDA 4L9WA 4B3CA 1II8B 3O8CA 2ORVA 3RRYA 4KITB 5HE9A 4BFWA 4Y0VA 3FHOA 1OLOA 3QSYA 3E1SA 1VMAA 2CVHA 3KTAB 1OHHA 4KAXA 1FOEB 3DM5A 1G4AE 3EW9A 4TMTA 1SVLA 1LF5A 4DIEA 1OB2A 4MGYR 2GRJA 2H8KA 4DKXA 4OI0A 4Q7KA 2R6DA 1TU3A 1S1CA 2WV9A 2WTUA 5A4JA 2GEDA 5KYKA 1KDRA 3K0CC 2AK2A 1UM8A 1N6HA 1Z0IA 1E4YA 4KV9A 3CRRA 4LHXA 4QGAA 1UJ2A 4HLDA 4PC7A 4NE2A 1UKEA 4DEYA 3U61B 3CONA 1Q21A 4LJ9A 3BH7A 5LB4A 1KO7A 5E7MA 3THYA 1KI6B 4M2LA 4MA4A 1T0HB 5KU1A 1FX0B 2QPAA 2WICA 1M7GA 1OXXK 4DLSA 1IBRA 1P2VA 1E2IA 4O0MA 1F6BA 2J87A 5EP3A 1EX6A 2XOKD 1CS4C 1P60A 3SN6A 4HAZA 2I3BA 2CE2X 2H17A 1MOZA 1Q1ZA 2VP2A 4HYYA 2F9LA 4KLNA 1TEXA 1ZC4A 4CZ2A 3RS0A 3C14C 5K8UA 1QG2A 4DCUA 4Z1MA 4EPVA 3K1JA 1Z83A 4BZPA 5CITA 1XCMA 1N6KA 1IN5A 2W2XA 2I1VB 2B7CA 1VG1A 4FCWA 4AKHA 3HP1A 4FWIB 5KO2A 4A92A 1ZNXA 1GNQA 3V9PA 1OXVA 1E9FA 2O8EB 2EFEB 1UBCA 4QBIA 3WYFA 2P2LA 4PTLA 1R10A 4OQNA 3WHLA 4US2R 4URVR 2HCJB 3AVOA 1H8HA 1E1QA 2WJVA 5E4FA 1R5BA 4ZPXA 2QG6A 1FTNA 4NHOA 1TAGA 2J0VA 1CIPA 4JJZA 1GRNA 3QXHA 3VR1A 5HPYB 3MWJA 1NIJA 2IW3A 3GJ4A 4I1VA 1Z22A 3MGCA 4RSGA 3SBEA 2NPIA 3RVBA 4IW3B 3NEJA 1FP7A 4FXPA 3ZDQA 1TF2A 3A4NA 1AQUA 3LD9A 5L3QB 4D4JA 1NVUQ 1G3UA 4ZCLA 3KXLA 3TH5A 2GCNA 4G5QA 4ZDWA 4HSEA 1ZINA 3CW2A 2JLSA 4GT1A 4J0QA 4URXR 4DB2A 4RVCA 3Q7QA 4AY2A 1RJ9A 2HYDA 3GEHA 4QBFA 1W4AA 4US1R 3RSOA 2OXRA 4RJLA 2ORWA 3A4LA 3I8XA 2D06A 3UK6A 1FFHA 2G83A 3FVQA 1XMSA 1ZD1A 4NL4H 1XEXB 1KGDA 1LFDB 1N6OA 2WAYA 2IYRA 2ZRBA 3MJRA 3KJEA 5H68A 1UADA 4S35A 2YJTD 1WBBA 3KB2A 1XCGB 2REOA 1Q1EA 2QNRA 3AUYA 3GFPA 1TUEA 2WOJA 5EZ5A 5FTKA 5B57C 3GLGA 4I99A 3X1XA 3L0OA 4A9AA 4DZZA 1E96A 1CULC 3UANA 2D2EA 2RCNA 3BK7A 1NSFA 2ZIAA 4Q4HA 4TQUS 3A6PC 2AFHE 5D3MB 3PR1A 1PLLA 4PZZA 4JVLA 4ZO4A 3NDPA 4EPRA 4TMVA 4E09A 1NG9A 3UMSA 4W5JA 5SZJA 4KCGA 5A5GA 1P6XA 2J9RA 3GCGA 4IVRA 3GLHE 3Q8XB 3NVAA 3NC0C 4NH0A 4D81A 3SBDA 1TU4A 1BMFA 3HPRA 3TUIC 4A8JB 1KI3A 5KNDA 1E2NA 4XOIA 2V6JA 2QA5A 4M1YA 3TR0A 3KQNA 4JVSB 4PC2A 4IOLA 1EFCA 4LV8B 2O5VA 4I81A 4D0GA 3OFNA 4NYMR 2BBTA 1MH1A 2PMDA 3BGWA 4QNMA 3FB4A 1DG3A 4YQFA 4G5RA 3CLVA 4X8OA 4FWTA 2X19A 4JL5A 2O0JA 4XSHA 1ZNZA 1ZNWA 3AVVA 3MJHA 1HYQA 2ZRNA 3SQWA 4KFRA 2PT7A 2OAP1 5AK0A 1NBME 3EZFA 2J5XA 2OV2A 5AUNB 1ZCBA 3P20A 3CH5A 5BYKA 1O87A 2OO7A 1ZM7A 3QPWA 821PA 3W9YA 3EWSA 4AKGA 1E9SA 3WP1B 221PA 4GNKA 3DMDA 2BHRA 4Q00A 5FPSA 3MLEA 1T3LA 2K5UA 3NBFA 4FW9A 1G7TA 1COWD 4IXMA 3B9QA 1ZM3A 1KJZA 2GILA 2C95A 5DYGA 2QP9X 1KDTA 1G5PA 1ELOA 1XP8A 2OBNA 4Q7JB 2G77B 1SVMA 2RGBA 3ETLA 4A36A 4EKDA 3AUXA 3W6OA 1G41A 2NZ8A 1A2KC 2A9KA 4E07A 1AQYA 1QDEA 1NMYA 2OBLA 2OUKA 3AKDA 3D31A 1M6NA 1UF9A 2VSXA 2CHQA 4B48A 4CEHB 1X1SA 4TLBA 1XBTA 3F8TA 3LW7A 3QY0A 4LDJA 4WBSA 1JXMA 2CLSA 2RGNC 4BZXA 3GJ7A 4RKFA 4XD7A 3R9WA 5AR1A 3LBIA 4Q19A 1F2UB 2J0UA 3MAAC 3ZS8A 1E2HA 5GJCA 2A2ZA 2PCJA 5DNYB 4G3XA 4OYHA 1XTSA 4I1UA 4DDWA 1EFRA 2P6UA 1OXSC 2ANBA 3HPQA 4BQSA 2FOLA 2J3EA 2XGJA 2A5GA 1CJKC 2XZLA 4NYIQ 1O3YA 2A78A 4BPBA 5LD2B 2WKQA 1ETUA 4MYUA 2XJ9A 2G6BA 2PZFA 3AGQA 4WXPA 3RRMA 3MWYW 3VR3A 1OXTA 3ZIAA 3N2IA 1W2GA 2WJJA 4QXAA 3ZJYA 1TNDA 2VHQA 1XJCA 1B0UA 1CR2A 3UATA 4V0LA 4M4SA 2BBWA 2ZVPX 4DLXA 1EWRA 3FKQA 1J99A 2AKAB 4DSOA 1N6PA 2IX3A 1E2KA 4GRAA 4MDEA 3RC8A 1N5LA 4JIMA 4M8NE 2IEYA 3GLIB 1T9HA 2BM0A 2E87A 3VFDA 1P2UA 1OSNA 1R6BX 5FI0B 1I4DD 4A6PA 3AVPA 4O3MA 2BEJA 2F6RA 2H92A 2IYYA 1M7HA 3WRYC 1S3GA 2WPDD 1QHHB 1RRFA 3TE6A 1E99A 2V7QD 3JZMA 5HZHA 5TDHA 4GP6A 2WSSD 1OKKA 1GUAA 4CEHA 2ZRAA 3OFND 5B2ZA 1XEFA 2WZQA 1MO5A 4IJMA 3EARA 2ZJ2A 2H1LA 5A0FA 2B92A 4F4IA 2VO1A 1EXMA 4AYXA 4F93B 1GM5A 4PX9A 1BO6A 3GJXC 3WMGA 3MFYA 3LDAA 1L2TA 5AJXA 2J46A 4TLDA 3QXJA 5IHPA 1DG1G 2PMKA 2GBLA 2YYZA 2HEIA 1UBEA 4A0GA 2Q9AA 1E9EA 1VG0B 4NCKA 4BLTA 5EJEA 1XD2A 2DFLA 4GP7A 3RNLA 1I2DA 5AJVB 2AWOA 4FD2A 3ZVRA 4BRWA 4JJKA 2FPLA 1IQPA 3RDPA 2J0QA 2ZJ8A 3P1JA 1CJMA 3PUXA 5CIQA 1P5ZB 4BE7B 2C78A 2YZ2A 1KK3A 3CNNA 4OQFA 3AF0A 3TSWA 1LTQA 1ESMA 4MGIR 1NLZA 3D7MA 2WWYA 4S2EA 2W0SA 1UKVY 3R8CA 3SFZA 1YQTA 1VECA 3EASA 3BH0A 2VL7A 3LQRA 3TBKA 3THWA 4KVGA 5KUTA 3VU9B 2BJWA 2ZJ5A 4POAA 4FMCF 3A8TA 1NMXA 4PXAA 2KWIA 4PR0A 3X1YA 4IDQA 2GA8A 2VBCA 2GF9A 2R65A 2X8AA 1TEVA 1RYHA 4HDQB 2BBSA 1FL9A 2GEUA 3OEHD 1YR6A 2NZJA 1JJ7A 2Z4SA 5FOWA 5J4KA 2FFBA 3HR8A 1VYVA 1GSIA 3I62A 2VIIA 1ZJ6A 5FPKA 2ZPTX 4A0RA 4IFEA 3RS5A 2RAPA 1U98A 3QG1A 4L5BA 1E6CA 1UFQA 2DR3A 5CLLA 3R9IA 2CL7X 4KLZA 4TL6A 2Z4RA 1R4AA 2BV3A 1L8QA 2QT1A 4Q66C 1JEEA 4DDUA 3DOEA 3SS8A 2E9SA 1UKYA 1YR7A 4GZLA 1MRSA 2NO0A 3MWLA 3I3SR 2KBEA 1XMJA 4L9SA 2V1UA 2EQBA 4Z8YA 3VR5A 5H1YA 4LI0A 2QE7D 3OE7D 1AGRA 1XF9A 4Q1FA 4EPXA 1J90A 1Z6YA 1ZIPA 3MG9A 4DT1A 2NIPA 2O8DA 5HKKD 1X8KA 1E9RA 2CJWA 3WBJA 4PAMA 1Z07A 2CLDX 1YU9A 3THXB 4X8HA 1WQ1R 3DO6A 1J8YF 4CYMA 1JQJC 1QF9A 3EA5A 1JR3E 1NVXQ 1H65A 1OFTA 1XTQA 3AP1A 4FCVA 3RWMB 2YNMA 1G8GA 1T91A 2XEXA 5LD2C 2C9OA 4EQ6B 3IBGA 2WPDA 2I1QA 5K8LA 3LY5A 1SVSA 2GTPA 4EFNA 1SXJC 2IT1A 2PLFA 3ASZA 4M21A 2YOHA 4URYR 1OKKD 3SFVA 2W6JA 4OBEA 1H8HD 1G8FA 1D2EA 4NCJA 4F7WA 2QENA 1Z6AA 1RRPA 2ZSEA 2JLUA 3CWQA 4LPSA 2WMNB 3SJAA 5FTMA 1GKUB 2ZU0C 4OI2A 3FMIA 4UNPA 5EE5B 5JCZA 4HAYA 3U3MA 1N3BA 2ZSFA 4BFSA 2FNAA 5ELXA 4BLSA 2G0TA 4Q4LA 3VHLB 1ZAKA 3IEVA 2BBOA 2FMXA 3BBPA 3CUEF 3CZQA 2QTHA 1FQJA 1JR6A 1E32A 2WKRA 2YVUA 4JT4A 4M1TA 1MKYA 1NN5A 3KUDA 4DCVA 2D2FA 2FSGA 1OH5A 2DPXA 1NLYA 5JJIA 1E0SA 1S3SA 3CKLA 4JYCA 4B3XA 1F60A 2AD5A 2NO1A 2C03A 2D74A 3IKJA 3QXCA 4Q18A 1KNQA 3NHBA 4GPTA 3L43A 1D9XA 4FI3C 2NO6A 3B1WA 2F7SA 4Q9KA 4Z51A 3T1VA 4FMCB 4YMWA 1S9HA 2O8FB 4MITA 1XD2B 2AWNA 2VH5R 4LHZA 4P33A 3FPAA 4LRWA 1NP6A 5KDDA 1EFTA 2HF9A 4KFUA 1DPFA 1XFAA 2JJ2D 4UXIA 1R8SA 1KI9A 3NG1A 1W44A 3NTUA 4H1UA 1YZTA 2G1KA 3L8ZA 4TL8A 2C9CA 3WNCA 1CR0A 3GLFE 2BVNA 5DHAA 5LBIA 3T35A 4TZ6A 1XNJA 1U90A 1DE0A 1FUKA 1NRJB 2FPKA 2BDTA 5FUXA 5E95A 4HDOB 4LYHA 5DHFA 4L15A 621PA 2WWXA 3WNDA 4YLGA 4A82A 5AWFC 5J4VA 1IJEA 4M9XA 2GETA 5CIWA 2P5SA 2GCOA 1IHUA 2KB0A 4P0TA 2QPTA 2ZJAA 3NC1C 4BLQA 3HU1A 5TY0A 1LS1A 5G41A 5JJKA 4TMXA 2AFIE 2WWWA 5EQTA 1W0KA 1YHNA 4Q01A 3ZLJA 5EXTA 4C2TA 2C99A 4TSFD 3EPHA 1NKSA 1E2GA 4GOXA 3VMFA 5EE0A 3GPLA 3U5ZB 1KO5A 1EFRD 1IN6A 2FWRA 1RFLA 3MCAA 5F2EA 3EPKA 2XITA 1PUJA 4NYIR 3UPUA 4DLRA 1HE1C 2VP9A 1GRRA 1KHTA 1ZYUA 3NBYC 1IXSB 1E1RD 1FZQA 3I72A 3EG5A 3QKSB 1CJVC 4RD3A 3ECCA 3ADDA 1W0JD 3PENA 4EPYA 1D2NA 4ZIRA 1IN8A 2H57A 1WB9A 1IY1A 1ZUHA 3TLXA 3BJIC 2D4HA 3OHMA 5EP4A 1SKQA 5AJZA 3T5GA 4KHZA 1SULA 3RC3A 3EZ9A 3ZVLA 4M0LA 2H18A 3O47A 3TUJC 3VQTA 4RZXA 2OG2A 3U3JA 2FZLA 2W6JD 4C0QC 3QBTA 1FNNA 5DE3A 1FMJA 4LHVA 3TIFA 1RIFA 3T1OA 2PBRA 2ZRJA 2P6RA 4HUQB 3CF0A 2OCYC 2KJQA 4C0HA 1MO6A 1NLFA 1HE8B 1KSGA 2Q21A 5LPNA 1LVGA 5UKDA 4TTPA 4ZKEA 4AIIA 4C0LA 5BXQC 1VCIA 4UQOA 2BMJA 1AIPA 4OHYA 3K9GA 3EAQA 4QHYA 1E0KA 1N0VC 1WA5A 1PLJA 3CX7A 1E79A 4OQLA 1SVWA 1Z0AA 2OLJA 1VIYA 2QEQA 2XZOA 2PZEA 1W4CA 5AUOB 1W46A 2PLRA 1E3MA 2C2HA 3IDQA 1JQLB 1HH4A 3RAPR 4ZIRB 4BGDA 3U7GA 2GJKA 4HUQA 3KUCA 3RS2A 1DO2A 5TMPA 2J45A 4XWAA 4Q4JB 4U7DA 1IY0A 2OT3B 1FTSA 2B8TA 5KHOC 4PFSA 3M4YA 2A5JA 5FBLB 3CRMA 4TYPA 1DOAA 4PSKA 1G6OA 5HCIA 2JJ2A 4NP6A 2AXPA 2ZJBA 4XVQA 2C98A 2GDJA 2HJVA 1NKTA 4PO9A 3LLMA 5KNCA 1QZXA 2O8BA 4DT1B 3QUSA 3W5IA 2MSEB 2IYSA 4DDVA 2YC2C 5JWOA 4XIGS 4Z54A 2IYZA 1W47A 3U4QA 3O8DA 2ZYUX 3I73A 1E2FA 2GXSA 4AG6A 2W00A 5AUPB 2VEDA 1E1RA 5L3QA 4ABYA 1WBDA 1U9IA 2ZRFA 4NMMA 1DAMA 3CNOA 2O8DB 4BLPA 5JSZB 2ZE6A 2ZSDA 2ZETA 3B9PA 1NMZA 4GI7A 3FMPB 4NONA 4E03A 4WZ6A 3TSZA 2DHRA 3THWB 5F9FA 1CF4A 1GDDA 2GZHA 3PUWA 2OBMA 1DELA 1XJ0A 3Q72A 5JECA 1M2OB 3HWSA 5EE9A 2J59A 5JMTA 4LYJA 3H2YA 3MD0A 2BKUA 2ZRHA 4XTRA 1Z0JA 3V00A 2ATVA 1Z3IX 1OH6A 1BYUA 4WZBE 4DHEA 3CM0A 4LUCA 4A8JC 5JS7A 5L3SA 1AJEA 2IEZA 2YINC 1EK0A 1YE8A 1U8ZA 2ZXUA 2IYUA 2FGJA 4CRWB 1QHXA 4AI6A 2W2TA 2NQ2C 2P0EA 3RLFA 1UDXA 1E0JA 1U8AA 3QQ5A 1TQDA 5FI1B 4BLOA 3LA6A 4B6EA 5KPJA 3T61A 1P73A 2FF7A 2QZ4A 3OESA 2QSYA 3Q85A 3QF4B 4OL0A 4Q1BA 2GF0A 4IVPA 3VU9A 1Z63A 2IS2A 2HLDD 2E1RA 4A2WA 5DI3B 1AS2A 2VF8A 2GHIA 3L0IB 1OH7A 3T15A 3PEWA 1RRCA 5LDDC 1KTVA 2WJGA 1G291 3Q9LA 1JNYA 5HR5A 2V1XA 1GFIA 2HV8A 1NIPA 3R7WA 3DL0A 3LBNA 1XEWY 4NCHA 1UBFA 4PO1A 4WIAA 3RWOA 2XNSA 5IK2D 4CW7A 4HLQB 4L8GA 2ZRDA 1E9AA 4P31A 3NH9A 2RHMA 2FG5A 3K0AB 3A1WA 1KMHB 1RKBA 3N5CA 3P4YA 2OFWA 2RGAA 2BOVA 1T3SA 5J4YA 4TTQA 2ZRCA 1ZVQA 4UJ5A 1ZBDA 3RS4A 1TQ4A 4B47A 4QKQA 4A2PA 3DZDA 2CK3D 3CZPA 1JALA 1ODFA 1QVAA 2DFNA 4D25A 4LJ8A 4HB4A 4Y0AA 2QTVB 5EXPA 4F92B 1P2TA 2FDCA 3IPXA 3R9XA 2CEAA 3DOFA 4P4SB 4C0BA 3E2IA 4KSBA 1RVDA 4CEJB 1HEIA 5EXSA 1SXJB 1F2TB 4M1KA 2XX3A 3KKPA 3NH6A 1CU1A 2YWGA 5G53C 1D2MA 2G0NA 2IYLD 1XD8A 1OXUA 5CDFE 3TGPA 5BQ5A 3U6BA 3WYAA 4HZIA 1S1MA 4YMVA 3E70C 2ODEA 1ZIOA 3ZVNA 1XZQA 2RKOA 2F3RA 4MRSA 1UAAA 1NJFA 3KXIA 4LPKA 5JBQA 4F91B 4MUBA 1OIWA 4HB2A 5FPHA 1A82A 3BFXA 3DDCA 2FPMA 3K09C 3Q3JB 1GIAA 4B2PA 4PHTA 1ONBA 1YR8A 3WY9A 1PZNA 2QMEA 3Q5DA 1FW6A 4HAVA 4XWOA 4HDCA 1CTQA 1LY1A 5FOUA 5KTYA 2ZS9A 1N5IA 1SVOA 4AKEA 4Q9HA 1XB2A 2GJAA 3QNUA 2C8VA 1X86B 1EFHA 3T1QA 3AKYA 3LX8A 1CJTC 4GBMA 5KDLA 4LX0A 2QQ0A 4AURA 2OILA 2W58A 4G5GA 4LV5B 1W0JA 2ZJZA 4RY2A 2LWIA 2JLRA 4U5XA 1SKYE 3K09A 4HAUA 1VYTA 5C2JB 1KAOA 3TW8B 1JR3A 5CLQA 1AS3A 1HT2E 4TYQA 3IO3A 2Z6VA 5BN4A 5TV2A 2G3YA 4D2IA 2IWHA 3OIWA 2GAOA 3TAHA 4KFTA 2PEZA 4G5OA 3U3KA 4UJ3A 3KB1A 4LYFA 3QKRB 2W6IA 1P7CA 5B30A 1QG4A 4JLBA 2BMFA 4QM7A 3TKLA 4NU0A 4ACBA 4WA7A 4O2LA 3D8BA 2KI5A 5JS8A 1EX7A 2VP0A 4XTCS 3I5YA 3EC1A 3EXAA 4M9QA 2RGGA 2DYKA 4GFDA 1G1MA 4DWJA 5L3SB 3GLGE 1BS1A 2DY1A 3DHWC 3DVLA 5SZKB 5JZVA 4QHSA 1RC8A 2F43A 1VG9B 4UNSA 4JBYA 4JLVA 4QJ4A 4FMBB 4B2IA 2BIFA 3D3QA 2GZAA 3CRQA 4M1SA 4TWZA 4DIDA 4DSUA 3AKEA 1DAEA 3UKDA 1GTVA 5FTNA 3OAAD 4B33A 4EDHA 4Q03A 4GOKA 1KO4A 4A6XA 4PZYA 2DWQA 2L0XA 1G8PA 1XWIA 5KOYA 2GEVA 1CLUA 2FJUA 3QKRA 2XXAA 2IUSA 3P26A 1ZNYA 2ZR9A 4FMDB 1R0XA 5CYPA 4B3FX 2ZYTX 1AGPA 2FFQA 3U3RA 3T1TA 3U44B 2J1LA 4FIDA 2FV8A 4MKGA 4D0LB 2AR7A 1S0UA 5G3ZA 1JPJA 4JBXA 1SVIA 2CNWD 3SJBA 3EX7C 4BFTA 2CHVA 2J7PA 1CP2A 1DARA 1QBKC 1Z28A 2WM9B 3K53A 4D82A 4MYTA 4G0NA 2Q3MA 4HZUB 3QBVA 1WCV1 2JLYA 4QGGA 1AM4D 1Q0UA 4YDHB 3A36A 2CL6X 4O25A 5CJPA 2X2FA 3B1YA 4A1FA 5FTLA 1LW7A 2ODBA 3Q5EA 2ZEJA 2PT5A 1MR3F 1M1YE 3ND8A 3MUFA 4OK3A 2AD1A 4QHTA 1G8HA 2CCGA 3J81k 3FFBA 3GD7A 4BASA 5CB8A 4DRZA 1R0WA 4KO8A 4F38A 2HCBA 4JL6A 3OIYA 4OJQA 4R2IA 3RSLA 3FDIA 4Q5IA 4QG7A 1SXJE 3A1SA 4I1OA 3BD9A 2IBMA 2ONKA 2VHUA 4GZMA 4ITRC 2HT6A 3EZ7A 2O8FA 4NBSA 2LKDA 3IQXA 3L2OB 1GNRA 3CR8A 4GMXA 1OHHD 2BEKA 5EUMA 3H84A 3ZH9B 4ASUA 4BWYA 1VKJA 1Z6TA 1K8RA 2WKPA 3ZD7A 4M1OA 4II7A 2IS1A 5DN6D 2UKDA 3KQLA 1Z8FA 2IYXA 4A2QA 4N1AA 1OH8A 3EA0A 4H9GA 3ZYCA 4EJSC 1NY6A 1G3IA 1U94A 4AC9A 3QKUA 2WVJA 3REFA 2BWJA 3GLFB 1E79D 1E2MA 2ASEA 1II8A 4YMUA 4C0AC 3U4QB 1VG8A 2DWPA 3PUYA 5EP2A 3CH4B 4FN5A 5FUVA 2D7CA 4JLDA 4OHZA 3BS4A 1AZTA 3ZZTA 2F55A 1T5LA 4QC2A 3FHTA 4B74A 2RB4A 3BOSA 1M34E 4HLUC 3TR5A 121PA 2QU8A 5JJLA 1TX4B 1II0A 4OJKA 3W3ZB 1OIXA 4IKEA 2JLWA 4R9UC 1T3HA 1E94E 3SR0A 2IYQA 2ANCA 1AZSC 1YZGA 2WIAA 3Q7PA 2GNOA 5J40A 4RD0A 1PVOA 5FTJA 3EZ2A 1R8QA 2PJZA 4W9MC 2WAXA 2KSQA 2JASA 5FL3A 1G5TA 1DO0A 4X8LA 4MYHA 5TXGA 3P4XA 4RD6A 1Z06A 3BRWD 1E1QD 1FP6A 4XD7D 1ZC3A 3B78A 4RCYA 1P4SA 2QM8A 1GL6A 2FEOA 4JKIA 1BOFA 5JI2E 2QTFA 3FOZA 1DAIA 1JPNA 3PFIA 5FR2A 4XVRA 4DC9A 1W4BA 4C7OB 3K9NA 5CK4A 1IJFA 2ERYA 3L82B 3ZGXA 4A0FA 1HV8A 5KSOA 2AHOA 4BFXA 4A8JA 2BJVA 3VKWA 5JCPA 4Q4AB 2GXAA 2EU8A 1XJQA 1DS6A 2F3TA 1C9KA 2J7PD 2ECKA 1OIVA 3UWOA 4B3GA 4E22A 2CNWA 1E2DA 4RCZA 3IQWA 4LHWA 4KVAA 2JLZA 1DAKA 1ZU5A 2QT0A 3H86A 4V0ME 3TUZC 3ADBA 1C1YA 3OEEA 4MYCA 4AK9A 2H5EA 3FYHA 1R5NA 3GLFA 2ATXA 2FSFA 1GNPA 1D6JA 1KSFX 1KI2A 4JZKA 4KU4A 4LJ5A 4Q48A 2WHXA 1BIFA 4D26A 1Y63A 3SDZA 1QHIA 1N6IA 3QEJA 2D7DA 4ZCIA 2ZRGA 2YWEA 1G21E 1JXOA 1KYIA 3I8SA 3GJ0A 4AD8A 4TMWA 2XTMA 1RYFA 3LXXA 1UKZA 1XU4A 2V7QA 1U81A 4Q7MB 3BB1A 3R8FA 3U7EB 2ZS7A 4TSFA 4DLWA 2IS4A 4BFVA 2GAAA 4JSTA 2ZAMA 3B6EA 5DI9A 4R71A 3AF2A 4TLCA 3RS7A 3N2EA 3AGPA 1J7KA 3QPUA 4LZZA 1Q3TA 4XJXA 1GRQA 3TVDA 2Z83A 1SGWA 2PH1A 3LLUA 1BMFD 2SHKA 1QHNA 4JLMA 2J0UB 5DN6A 1W49A 2DWOA 1GKYA 1TTTA 2GWHA 4QJ5A 5L3VA 1L4YA 2JAQA 2W83A 2ZREA 1JR3D 1G18A 2QGZA 4Q1CA 4Q9IA 3GLIE 1G3RA 4MRPA 2P5TB 1N6NA 1YJ5A 1VIAA 3AVYA 2GXUA 3C5CA 3VR6A 3PVSA 1JJVA 2ZUCA 4I1SA 2CVFA 2YOGA 2VQSA 3M6AA 3W6NA 1J70A 1KOFA 5DO9A 5TARA 1CRQA 4C0KA 2ORIA 4Q7LA 4FMDF 3SOPA 2FX3A 3T06B 4QRHA 2R6GA 4QFMA 2H16A 3IILA 3ZQJA 1IXZA 1N25A 4Q47A 1OYWA 1XPUA 1E98A 1US8A 2OCAA 3CB4A 3CPHA 1NG1A 2WIBA 4AYWA 1G7RA 1H8EA 6Q21A 3RABA 4QNRA 2FSIA 3UG7A 4B32A 1OE0A 4IOJA 2VSOA 2O8EA 5GVSA 2ZUBA 2QN6A 1XZPA 4HATA 4DLZA 3AP3A 2HT1A 2NG1A 2QBYB 2XXAB 1DAHA 5TB5A 3AVUA 4PQYA 2V4ZA 2JIZD 4PSVA 3W8NA 3EC2A 1WF3A 1K6MA 1W36C 1A7JA 1XMVA 1NN3A 4O2RA 4P4TA 1NN1A 3KFXA 2C96A 3I32A 3TW4A 4KJZA 2GESA 1US8B 2REBA 1G9XA 3A4MA 3ADCA 2A5YB 2P67A 2WBLC 2ONJA 1QHHA 4BUJA 2F1JA 4IHQA 3WMFA 2ZI3A 4EUNA 1I4TD 1DVRA 1FX0A 1HQCA 1KI4A 1U9IC 2XB4A 3V4RA 2XB2A 721PA 4LBZA 1IN4A 5JFGA 1ZD8A 1W36D 2IS6A 3PV0A 1Z5ZA 5BW8A 1Z0DA 5CB6A 4MKHA 5J4HA 5KSZA 1DADA 3TQCA 1LF0A 2G88A 3AVQA 3CPEA 4BEBA 3I1FA 2FE4A 3VNVA 2ZRLA 5JSZA 5L3RA 3K0FB 3LX5A 1N0WA 1FUUA 3AVWA 5TVKA 3GMTA 3PITA 3ZD6A 2PL3A 2RMKA 2CJWB 4DCTA 1XTIA 3QI2A 4PPNA 4XSGA 4JS0A 3F3YA 3LVRE 1YZUA 2B6HA 3PEVA 2G9NA 2Y8EA 4ESHA 4D6PA 3B5JA 3NBZC 1AN0A 2ZM5A 1IY2A 1BH2A 1AA9A 3GFOA 4PHHA 3K70C 1XRJA 1GG2A 3B2EA 3C8UA 3BH6A 5GVRA 5E3HA 4DSTA 5HKKA 2HF8A 3RHFA 1E2LA 4LHYA 5FPTA 3HJNA 4QBHA 2QP4A 1SHZA 2FGKA 5FPYA 2QI9C 2BMDA 1SXJA 1E2EA 3B8HA 5JWRA 2AL7A 3W8RA 2ZRIA 2XJ4A 3BERA 3KL4A 3RYTC 1L7VC 2BC9A 4RZ2A 3SYNA 5BN5A 3X2SA 4GDFA 2D62A 2WWHA 2P6NA 3SNHA 4JSYA 1WE2A 3H0KA 1XMIA 2N1BA 4IDHA 4GMDA 1F2UA 1AK2A 1M74A 2R62A 3K0FA 1AKYA 1RE0A 2CDNA 3IIJA 1UPTA 1OYYA 2HLDA 2P65A 2DBYA 3QVVA 3B7GA 3G0HA 4JLNA 2AN9A 4UNQA 1I4LD 1U8YA 1T8UA 3IUYA 4A15A 2IF0A 2IL1A 3C5HA 3QXXA 4UXJA 1L4UA 1Z08A 5EXXA 4D4MA 3H4MA 5AUQA 3W6PA 5B58C 1JB1A 2GKSA 1ZMXA 4QL3A 2ZANA 5KSPA 3B85A 2CLCX 2QQEA 2DFKB 1YZKA 2HUPA 3LXRA 3NIBA 1ESNA 5KPDA 4Q4JA 1LNZA 2XSZD 3KQKA 1KMQA 4RD4A 1Z2AA 2WMOB 3JZAA 3DKPA 4N0EA 4AKIA 1TF5A 4TYWA 3BB4A 3UXMA 2VYFA 4BFZA 3CBQA 3QVUA 4ZDKA 3THXA 1SZPA 2V6IA 4IOMA 1TMKA 5FH9A 5DSZA 1P9WA 1PJRA 2ZROA 3MMPA 5DI3A 1XPOA 1HT1E 1ZRHA 1P3JA 4LJ6A 1NBMA 2PX3A 4RD2A 3SU8A 2JA1A 1X8JA 3BFVA 4DLTA 3BC1A 1G64A 4V0KA 1YKSA 3UMFA 3L8YA 4BFYA 3SE0A 3FGNA 3A1VA 4YMSA 2RGDA 4MRNA 4PANA 3LQQA 5GADl 1JBKA 1QHYA 2TMKA 4CF7A 4JL8A 1WXQA 1VCMA 3IIMA 3AV0B 2ZI9A 5FBRB 4ASUD 3C15C 4NZYA 1HQYE 4TMKA 2QRZA 4HB3A 4LJ7A 3NHAA 1CXZA 1W5SA 2QMUA 2HYIC 3VKGA 1W0KD 2QE7A 2WWGA 2C77A 1G19A 5H8WA 2Q3HA 3ZZ0A 1GP2A 4WVFA 5D3MA 5F98A 4UKDA 3GJ3A 4NCIA 4B35A 2VF7A 3GJ8A 3U7HB 1G3MA 4ESVA 2PEYA 1RPZA 1E9BA 4HI0E 2UVQA 1W36B 1VCOA 1LB1B 3KJHA 1XDBA 4TN1A 4LC0A 4RD1A 4DDTA 3AVXA 1A1VA 3WYGA 3X1DA 4OKSA 1GOTA 3EZ6A 3BIFA 1KDOA 3KZ1E 1HTWA 4ZKDA 2O8CB 4BZQA 1VTKA 2JGNA 2RGCA 3D6TB 4AWXA 2QBYA 4ILEA 2QY9A 5DH9A 4DXAA 3JVVA 4JBWA 4MRVA 4U00A 3QG5A 4NTZA 4D0NA 3EPLA 4ZI2A 3SQXA 2PZGA 2ZI6A 1M8PA 2ZYWX 4RZ3A 1CBUA 1HY3A 2XZPA 3SI7A 5EE3A 1ZU4A 2ZQ5A 2Z5FA 4TLAA 3ZVMA 4NYJQ 1S96A 5E7IA 4B73A 2QPOA 3F0TA 4QJ3A 4FINA 1KMHA 2A5FA 1A5TA 5G3YA 4Q4AA 4IEEA 3K0AA 1RRGA 5B64A 1M7BA 3GJ5A 5SZHB 3AQ4A 3KKQA 1II9A 1NNEA 4NYMQ 4W7SA 2HJGA 1Y3AA 1T5IA 3QPVA 4C0JA 4C7OA 2AK3A 2WWFA 1KI1A 1QHSA 3FKSD 4KODA 1G7CA 1UBGA 1Z47A 2JLXA 4WW0A 1ZM2A 4K81B 4IDNA 4US0R 3PUZA 1Q3HA 2QMHA 4PZLA 4WAUA 4BLRA 4QOSA 4XWKA 2QM7A 2ZR0A 4NDZA 1ZM4A 2JDIA 3X1ZA 2XAUA 2BCJQ 4JLJA 4EIWA 4N0DA 2JJ1A 4MKFA 3K9LA 2LKCA 1SVKA 2GK6A 2IHYA 3CF2A 2NGRA 2WSMA 3HYTA 3VR2A 1EESA 1G7SA 4PAOA 3VX4A 3O8RA 4M1WA 1XTRA 4C0SA 3AF4A 4A0HA 2KBFA 1YRBA 2GZDA 3K8YA 2QRNA 4EFMA 1MRNA 2VHTA 2I4IA 4KXFB 3VX3A 4HEJA 4HLUA 4LGMA 3W34A 2ZUDA 4G5SA 1MT0A 4Q1AA 4IVQA 4DJTA 3AM1A 3KJIA 5IDVA 1R7RA 2XTZA 2CE7A 1YZQA 2C9YA 4B76A 1G17A 4PPQA 1VHLA 3HR7A 1E2JA 4GOJA 2YWFA 3A1UA 3I4LA 4LJYA 2CBZA 2UZIR 2NO9A 4JKYA 2N42A 2R6AA 2REXB 4YONB 2GVDC 3BB3A 3KKNA 1GZSA 5FL7D 3X1WA 3PUVA 3KQUA 3CX8A 2VRWA 2V9PA 5HZKA 3FMOB 3QE0A 4LY6A 1VDZA 4URZR 3E5HA 4R7ZA 1GWNA 2QMOA 2CL0X 3KTAA 3LBHA 5LB2A 5CM9C 5HE8A 2ZE5A 2OXCA 3GP8A 1NN0A 2RGEA 2VPPA 2NMVA 1LS6A 3PXGA 2VHJA 2ZRMA 3ADKA 2YHSA 1V5WA 2VSFA 4B3BA 2JEOA 3RRZA 4ARZB 4MGZR 3M1IA 4LBVA 2QAJA 4OHVA 1UEJA 2ZYVX 1NVWQ 4F4JA 1G20E 1XD9A 1P9RA 1R0ZA 3CWZA 2ZRKA 1S2MA 1XXHE 3C16C 4KI0A 5C46F 3GQBA 3B82A 3TNFA 2CXXA 3CRVA 5BN3A 3U7FB 2C5LA 3UMRA 4CVNA 1KKLA 3IBYA 4CT5A 3SYLA 1R5OA 1Z2CA 4WOPA 3VAAA 1QVRA 4XVUA 1J8MF 2ZJYA 5DIFA 2YC4C 3KKMA 4PPGA 2QORA 4LYAA 1YZNA 2IYVA 1OFIA 1KJWA 3T5DA 1G4UR 4EPWA 4IOKA 5AJWA 3K0CA 4V0NA 2EYUA 3HU3A 2JJ8A 1EG7A 4IDPA 4TT3D 5CM8B 3LV8A 2B7BA 2IHBA 5FUWA 4CDGA 4JMPA 1Z0KA 4RKEA 2ZE8A 5HCNA 3JVUA 4IRUB 3PG5A 2YV5A 3QKSA 1W2HA 2EVWX 5FBVB 4RFVA 2EFHB 2GCPA 5JWHA 4AG5A 4EJSB 3IGFA 3KXKA 4MGKR 5DGXA 3SHWA 3IIKA 2GXQA 4B75A 2QL6A 3AB3A 2ZITA 3CNLA 4P32A 3PEYA 3N70A 5C4GB 1DTSA 4B2LA 1OJLA 3B1XA 2BMEA 3C7KA 1WDTA 3PEUA 1KI8A 2JJ1D 5J47A 1A2BA 1KY2A 2GBLC 1D9ZA 1NL3A 2PCLA 1OW3B 2Q9CA 3T34A 1CKEA 2ZAOA 3SHFA 2FH5B 2HXYA 1IXRC 3PIRA 1GL7A 4C9BA 3RANA 1D5CA 2GJ8A 3KJGA 3OEHA 1COWA 3A37A 3EWAA 2FFHA 2IF2A 2ZSBA 3KQHA 2EFCB 5DYIA 1TQ6A 4ACAA 1P75A 2FEMA 3DZ8A 4IDOA 4V0MA 1KI7A 3WHKA 1LV7A 3LO5A 4MDFA 1E2PA 2AXNA 2EFDB 2VHCA 3LWNA 1F5NA 2HDNB 2EYQA 2RGNA 1HA3A 3GLGB 521PA 5FL7A 2A3RA 2VLIA 3BE4A 3PJRA 1G6HA 2QGNA 1NI3A 3U6KA 3MSXA 1E69A 4XH9B 3QKTA 1R0YA 3H1TA 3TAUA 4B44A 1KK1A 2O52A 5F3WB 1Q20A 1HUQA 3BXZA 1JAIA 4P4SA 4F4CA 1F48A 3FHCB 3HYRA 2W6ID 4FCTA 4L4UA 5E7JA 4B34A 3WXMA 4C2UA 3LRPA 2O8BB 1VCNA 4HB0A 3OF5A 2RHDA 1Q1QA 5FOSA 4WZAE 3ZIAD 1U0JA 4NKRA 3U44A 2W0MA 3ND9A 1C4OA 5ANRB 1YVDA 5AJYA 3SZRA 4CEJA 2OLKA 2OAQ1 1U0LA 1E2QA 2NO7A 4M9ZA 2W2VA 3SYKA 4DEXA 2LCFA 2OSBA 3SC3A 1GITA 4B3DA 2MSDB 4JYBA 5EE1A 1MO3A 1JEDA 2RGXA 3KKOA 4KBGA 5IT5A 1BYIA 2X77A 2RH5A 4MUAA 1SQ5A 2CCJA 2MSCB 2GK7A 4RFSB 2AKYA 5CYOA 2R6CA 2VP6A 3NXSA 3OZXA 2OCBA 4YC7A 4EJSA 1W48A 3SJCA 1N5KA 4MRRA 2MMGA 2Q0HA 1EWQA 3HDTA 5KSYA 2ZI4A 4ZI3A 4OHWA 3VNUA 3QIAA 4TYNA 4EPTA 1DEKA 4YXWA 4M53A 3FKSA 3BAFA 3FTQA 4CEIA 4JLPA 5IRCD 3IPYA 3ONWA 4UNRA 3GLIA 3T12A 4PAQA 2JDID 1WRBA 3VHXA 1P61B 3S1AB 5C4MA 1B23P 3FFAA 3BWDD 4HAWA 5CJ2A 3PQCA 2ZRPA 5JEDA 4RFSA 2QSZA 3DM9B 1EFUA 2DCUA 4R98A 3KFVA 2CK3A 2ZS8A 1S9DA 5IK2A 2X2EA 2VP5A 1KNXA 1N0UA 1KY3A 4KBFA 2HXSA 4Q1DA 3B1VA 3WMEA 3QJYA 1JI0A 5FUYA 4KSCA 3EIHA 1KI6A 5L8VA 1YZLA 1W4RA 3TJZA 2CCKA 1CR4A 1OT3A 1T4GA 1Z6XA 4JLAA 3ZQ6A 2J41A 1WMSA 5BYJA 3IHLA 1U0HC 3K70D 3CRW1 1RJ9B 3U60B 1V43A 3NBXX 3GLHB 4W5WA 2KE5A 3AF1A 4D4LA 4DLYA 4ERNA 4H1VA 3MWKA 5J4LA 3I61A 4WXRA 4MKIA 5FOVA 3OIUA 4YDSA 5K8TA 2ZI7A 3TRFA 2ODWA 3B13B 1DAFA 3NWJA 2IXFA 1MABA 4GSYA 2OM2A 2QROA 4LK2A 2GVZC 2R2AA 1ZUNB 2WSSA 1XCPA 5DISB 3ZS9A 3B60A 1KZGB 4V0OA 1CJUC 2R44A 2H7VA 3UG6A 4Q4HB 3CR7A 1JAHA 2ZTSA 1T6NA 3LVQE 5JRJA 1FPMA 1OFUX 1SXJD 1TPZA 1E9DA 1SHKA 3WNBA 4DBLC 3G5UA 4KFSA 1T8TA 3GEIA 5JHGB 3AVTA 2Z0MA 2CMKA 3L0PA 2UZ3A 2DB3A 2O0HA 4PPFA 4C3ZA 4Q9JA 4LOAA 4ZDIA 3TSOA 1I2MA 1PUIA 1W7AA 2Z43A 2QAGA 1G5RA 2WJHA 4C30A 3K70B 4HAXA 1ZM9A 4M22A 1VYUA 1Z6GA 3EPJA 1DAGA 1X6VA 1KO1A 3V4FA 4OQXA 1XX6A 1XPRA 1NF3A 2F9MA 1NVVR 2YKGA 3L0SA 1K5GA 2V55B 3CX6A 4DVGA 3R7WB 3QENA 4JVMA 1YRAA 1VPLA 2DFTA 4K8OA 2B8WA 4U02A 2F43B 4GL2A 2XSZA 2VP4A 2IA5A 3WBKA 3S1AA 1IOZA 1AS0A 1Z0FA 421PA 4E5UA 5FFMA 3FE2A 2IK8A 1MO4A 5BWMA 4LSGA 4Q1EA 4K46A 2X1VA 4OK6A 1RZ3A 2YOFA 3SJZA 4DLVA 2Q9BA 1KO8A 2QAGC 2O8CA 3KX2A 1NY5A 1OB5A 4PHGA 2D3WA 1JECA 4B6FA 3OIVA 1X1RA 5GJBA 4TMZA 5JEEA 2EFGA 1IONA 4PQRA 1P72A 1KKMA 2QUZA 3GJ6A 4LC1A 4EQ6A 2YWHA 4P4UA 4W5HA 3K0EA 3CO5A 3QOFA 3O8BA 3OAAA 1NBMD 1Q22A 4HUTA 4QGFA 4UNNA 3I5XA 5J5CA 1A4RA 2C04A 4TLEA 2BM1A 3UIEA 4JLKA 4LJ4A 2WJIA 3TQFA 3OE7A 4OQMA 1CEEA 3AP2A 2OEPA 5H70A 1SKYB 4ARZA 1N2CE 4OI1A 1ZD9A 3W90A 1BKDR 3TVTA 4X8MA 5IF9A 4DLUA 1PV4A 1CRPA 2EW1A 2ZJOA 1R2QA 4KYUA 3NKVA 2R6FA 4DUGA 2G1JA 1EGAA 1N6RA 4DCSA 1MV5A 3W5JA 4L16A 4ZDJA 1X8LA 2IUUA 1WP9A 2V54A 1E4VA 3TMKA 4BFUA 1XEXA 2ERXA 4RZUA 2ZU6A 1PLKA 4PQFA 2ZE7A 2GJSA 5JLJA 2XOKA 4OHXA 3DKVA 2F1RA 5FR1A 4TTRA 2PX0A 1KDPA 5KNBA 2R8RA 2R9VA 4BECA 8OHMA 4DUGD 4I4LA 4NPHA 3K0SA 1GAJA 1NJGA 5FOXA 5KDOA 4EFLA 2AX4A 1N6LA 2QP3A 3VKHA 1J2JA 4IXNA 4TL7A 4TQ9A 2BKEA 2ZSAA 4ON9A 4OI4A 2OFOA 2ZR7A 2Q6TA 4LCBA 2PJRA 1KJYA 4ZV4A 2A30A 5D3QA 2OHFA 2A7QA 1P2SA 3C41J 4JLOA 3UWKA 3QEOA 2V8OA 4Z8XA 3VR4A 3CPJB 1GILA 3QF4A 1OV4A 3VTKA 4BRUA 3FWYA 4TYYA 3DEFA 1K5DA 4DCNA 2FA9A 4Z1MD 1NVVQ 1N5JA 1Q57A 1OPXA 3AF3A 3EIQA 1KK0A 4NYJR 4A4DA 1KZ7B 1OF1A 4PO8A 1G16A 2VA8A 3F5FA 3P27A 1KSJA 2JATA 4LBWA 1X3SA 3BFKA 1VHTA 1YR9A 1GKIA 4LJAA 1FMLA 1TUIA 4QBGB 5JHHB 3RS3A 1TF7A 1Q44A 2QAGB 2NOAA 4QGHA 3REGA 2GJ9A 2FN4A 2OZEA 4URWR 4V03A 1RW4A 4AYTA 2JLQA 4YMTA 4YXWD 1DBSA 4MH0R 2IYWA 2BCGY 2FZ4A 4Q21A 1QRAA 3B1ZA 3PCRB 4HLCA 4IEIA 4KYIB 2XNDA 5P21A 1IAQA 1QHGA 4G01B 4NCNA 4ZCMA 4P3YA 1KAGA 3EIEA 4N3NA 4MQBA 1Q1BA 3NEYA 5SZIA 1UEIA 5GJWC 4DSNA 4TQAA 3W3AA 1ZP6A 1NSTA 1OFHA 3DPUA 4JVNA 4LBYA 2FSHA 4B71A 4QM6A 1KIMA 5C1BA 1T0JB 3U2QA 5M04A 2WWIA 3OEED 3R20A 2EWVA 1KSHA 4TL9A 5GJVC 5CDFA 2F1IA 1Z29A 4HZUA 4EAQA 2IWRA 3LAWA 5K8IA 1AKEA 1CR1A 4V02A 2IYTA 1TQ2A 4PSAA 2N46A 1IN7A 1P62B 3WRXC 2ZI5A 5HTKA 1E0AA 1S4QA 2VTKA 2FFAA 1E9CA 3QXSA 1W5TA 3THYB 4D4KA 3WP0A 5FBQB 3SEAA 2EWWA 4PC6A 2Q3FA 1IM2A 2OE2A 1TADA 2IXGA 1ANKA 2GCOB 1GL9B 3LH5A 4M1MA 4URUR 4DB4A 3LW8A 4LV6A 3AH8A 1ZUIA 5EUQB 1P9NA
chains in the Genus database with same CATH superfamily
1W1WA 4NNJA 2YL2A 4L57A 3VZSA 2XVXA 4EKGA 4YUAA 5D3ZA 3BUSA 4XKJA 4FUTA 4PVDA 4RZHA 2GKGA 4UXHA 4RX1A 4H4CA 4WK4B 5EZ6B 5T3UA 4RNDB 2WJAA 2PUCA 3N8HA 3F1KA 3Q7RA 3L7DA 3Q3EA 1OFGA 3DMNA 2XUKA 5C0OE 3ASYA 1U8XX 2YFQA 2H5IA 2B20A 2J7KA 2B5WA 1FIUA 3GFQA 3MUOA 4UTOA 1EFPB 1F2TA 1MMFB 3TK1A 3K9HA 4ID9A 4C6HA 2XRZA 4CMKA 4KHPB 4R2HA 1PG5A 1SVUA 2GZ2A 5FBWB 1KK2A 4BEWA 2WSIA 3RHTA 3TLZA 4EKNB 4KV7A 1T9GR 4F3KA 1DCKA 5F9HA 3HU2A 1D7AA 3M49A 5CK5A 5K4HA 3E5RA 3UKJA 3RIHA 2V7GA 3FFWA 1XEWX 3BORA 5DGIA 1PZMA 1YZHA 3UV3A 3HKEB 2GA9A 1CJCA 3O1LA 3IVAA 1H8ED 3Q2KA 2ZB8A 1QYXA 4M6WB 5BVGB 4N76A 3NDBB 5JQGB 1GPWB 1N4AA 4TT3A 4IH4A 4UOEA 1S8FA 2GH1A 5IUNC 5CXXA 5ALFA 9MHTA 3CF6R 3BA1A 3HA2A 1NMSA 1XXHA 4L0QA 1XCJA 4I2NA 2JIZA 2HA7A 4GP9A 1YH3A 2X1MA 4LWZA 4X9XA 2O0KA 3BXXA 4FR0A 4JT2A 1BJTA 1LGYA 3KTFA 2O7QA 3AQIA 3G2PA 4KDCA 3ZZUA 1GAQA 3V1TC 1WPXA 1XTJA 4FLMA 3L5OA 4E5VA 5KVCA 1C9YA 4FT2A 4IHJB 2CW5A 4MS3B 2V3WA 3G2OA 1SOMA 1LCIA 2Y0BA 5AVXA 4ZEVA 3HBMA 4Q02A 2TS1A 2HO4A 1QK4A 1BCSB 1FLAA 3OFKA 3U3OA 2GEFA 1RT9A 4NY1A 2AOTA 1Y81A 1ISGA 1QZUA 2VCYA 3BIWA 2YVLA 5ALOA 4CGZA 3ON5A 4HWOA 4FBMA 1MQ9A 4A8TA 1YBMA 3WYGA 4TXNA 2YXLA 1II8B 4RZIA 4F2WA 5JLAA 3FOFC 1N32B 3ONDA 2BGTA 4DA7A 4KITB 2CC2A 1M2VB 4Y0VA 3E8MA 5CB0A 3NAMA 1VMAA 1PG0A 2EV9A 1IUPA 2ISSD 1L7NA 1FOEB 4TZTA 3DM5A 1QGAA 1Z4MA 1G4AE 4ZCPA 1SVLA 4DIEA 2XYPA 4BWVA 2HRZA 3RVSA 4GOLD 5L4SA 3VU1A 2CF5A 3HS3A 1JIQA 2WDPA 4H3KB 2G4VA 2PVCA 3DZHA 4G4JA 5C1IA 1BVRA 1I7NA 4P6VF 5KYKA 4Z0TA 3DE6X 1MOPA 2XB6A 4IZIA 2H6EA 4J8PA 4LDPA 3N5KA 3MTGA 5DM0A 3SLKA 1P1JA 2MT9A 3CRRA 4G8DA 4LHXA 1JLSA 5KTPA 1UJ2A 4EHLA 4HP8A 2I3DA 2ZYHA 2YYSA 3BTSA 1FF9A 2HI0A 2PAAA 2JLCA 3HBFA 1BXZA 1D07A 1MX1A 4FOLA 3BH7A 4K1XA 4WT7A 1EDZA 3AEUB 1GXSB 2CMHA 3K9BA 3TLBA 1GDTA 2QD2A 2WFMA 1Y7PA 1QLJA 5E7MA 5LB4A 5TS3A 5C7OO 1NW7A 2XYQA 1KRWA 3ELDA 2VXYA 4UAUA 3BK2A 3LP5A 2Q1UA 4MA4A 5KKAA 4EYGA 3G6WA 3AUAA 5KU1A 1E92A 2I2WA 2ZQYA 1M7GA 4QZVA 3LF1A 4C3OB 4D3XA 1C3OA 2DMRA 1DAOA 2I99A 4KQ6A 4D9HA 2XCSB 4PZUA 3MS7A 5HRUA 3T4PA 2J87A 3VU0A 1RAGA 3H5LA 3P0RA 1MOZA 1Q1ZA 2J09A 4CF4A 4N0QA 4AU1A 1YQEA 5A6VA 2OHVA 3SD7A 4KLNA 4EG1A 3AIOA 3K5WA 3ZWXA 4C43A 1JFTA 3GDGA 2WM2A 3UAOA 5T64A 3TZKA 3ZLUA 1GZUA 3EYAA 5B7QA 1J5EB 3RS0A 3O21A 3FCUB 3N74A 4TKZA 1UKAA 1Z2EA 5EOVA 1KVTA 4Z1MA 4U8GA 4MYRA 2WG2A 3SSOA 4BZPA 1HT3A 3AXTA 5LOVF 1VG1A 3HP1A 2CSXA 1V4VA 1WJGA 3AHGA 1XP5A 4YT2A 1I9CA 1ZNXA 4PSCA 1GT91 3KPVA 1EGVB 2Y1FA 2VUUA 1G9SA 3FAZA 4D8XA 3AB8A 4FYMA 2EFEB 4QBIA 1AUPA 2PX5A 4WA8A 1KIFA 1EGMB 2P2LA 1XTZA 1E3DA 2IHVA 2RC5A 5I5GA 3OF2A 3Q3IA 5ALVA 5E4FA 1AD2A 2E4YA 1TAGA 4RVUA 1CIPA 3OH8A 2Q0QA 1DUVG 1ML4A 3VR1A 3QXHA 3JWHA 4GHWA 3MWJA 3EZGA 4V39A 5KHLB 1M10A 1EDOA 1P1RA 1WZIA 1CEYA 3DPSA 2WHRA 5TJHA 1Z22A 1FNDA 5KJFA 2VTBB 1URPA 2D1SA 2D59A 5HA5A 4C22A 1BEZA 2QIOA 3H17A 4IQGA 4IW3B 1FP7A 2RG7A 4IIJA 4C4SA 7REQA 3D7RA 4PRYA 4OXYA 4RXUA 1Q92A 4HVAA 3OHSX 4N3BA 1MIOB 4ZCLA 1ZK1A 1RAAA 4D4JA 3KUKA 4F85A 1FNBA 4ZDWA 2A33A 3HI6A 1ZINA 1VMDA 2FZKA 3CW2A 4HSEA 4J0QA 3W3AD 4RVCA 3Q7QA 1S7CA 3LU1A 1OTYA 3SF8A 5BW4A 4WX2B 5LJLA 2UVPA 2J6BA 1RBQA 2WJ6A 5KZMB 5B3AA 3I28A 2IIPA 2LGJA 4YIHA 3A4LA 2H06A 2D06A 4ZVUA 1WUIS 2FRXA 2JFQA 2FXIA 3ELYA 4G4SO 4QWMA 3UUGA 3AYZB 3UJ6A 1VJ0A 2FQYA 3DW1X 1KGDA 4R31A 2XYRA 3ABZA 1N6OA 4X7MA 2ZRBA 4S24A 1R74A 2CXUA 3VC1A 1Q6ZA 1K6IA 3HEMA 2B94A 2ZYIA 4S35A 1F8YA 4LQ4A 4YP1A 4B6OA 1WBBA 3KB2A 5HFNA 3FZGA 1VL8A 2REOA 2QNRA 3GLGA 1TUEA 2B83A 2WOJA 5EZ5A 1YULA 3DTVA 5FULA 4I99A 3HKDB 3ZWQA 3NU1A 3X1XA 1EUYA 4GOND 4A9AA 4BMZA 5JARA 5E2AA 2QRUA 4H4EA 1GPYA 5JQGF 1CULC 4V0QA 4KIWA 3JWJA 2V5VA 1Y9JA 2QRQA 1OLSB 4Q4HA 4TQUS 1MRZA 3WGGA 1DP4A 4MO9A 3CVJA 2QYHA 1RTTA 3CX3A 2BUCA 1TVCA 3BG5A 4KX3A 4LRQA 3M1AA 1BFUA 5ALZA 4UM5A 2NU8B 2Y76A 4P92A 1GTZA 1FS6A 2Q1YA 3IVXA 4AUEA 4IVRA 3EG9B 3GLHE 3Q8XB 3LFHA 2OPHA 1FXSA 3PNQA 3NC0C 4QLAA 4D81A 3SBDA 5KNDA 1BMFA 1JAZA 3HPRA 4A8JB 3RJTA 3KT8A 4P3KA 1G21A 1ENPA 4OX9B 2QA5A 2W43A 5K2OA 1H2ZA 4IOLA 2GBIA 1GUBA 2O5VA 5A3JA 4BNJA 1ONOA 4GNRA 3WLHA 3ZU2A 3OFNA 4NYMR 4HNGA 2Q2QA 3HKEA 4HEQA 4PZCA 2PBZA 3BGWA 3RE1A 3FB4A 4ETMA 3NDRA 4G5RA 3MERA 1PKEA 1MC8A 1DV2A 1RC0A 2O0JA 2X19A 2XBLA 2FRDC 1SG0A 1AVTA 1EAYA 5MN5A 5BSHA 2ZRNA 2CNNA 2Q2OA 4J4TA 3G3EA 4O8ZA 4RIHA 3SQWA 5T5QA 1EMDA 2HQ1A 5DEIA 1UMBB 3EF0A 1T9DA 3I2FA 3CVXA 2OV2A 2CF6A 4RLSA 1ZCBA 1KPHA 1O5OA 3H3JA 2OO7A 3KHSA 1F0PA 1PK7A 1Y37A 1JDSA 2O2GA 3C5VA 3W9YA 4C5AA 1LBTA 3WP1B 2GCGA 3TTVA 1V26A 3E9ZA 3F5DA 1PSDA 1W8IA 1W1IA 1YJBA 5FPSA 4ZT3A 1EEXB 2KW5A 4ZGWA 5DM2A 4ZC1A 1LVUA 4FW9A 5AW0A 2C9ZA 4M1ZA 5IC6A 2V7TA 1AUXA 2WI8A 1YAHA 3FRJA 1EHIA 2B4TO 2C95A 5DYGA 4R1PA 2QP9X 3PHGA 1A98A 1G59A 1XNGA 1ZH0A 2E1PA 1LPSA 1YOVA 4I08A 5KTKA 3FKJA 4KMSA 2H07A 4C3VA 2RGBA 3ETLA 3JQBC 5BUZA 3AL3A 3AHCA 3AJ9A 4E15A 1VC2A 1G41A 4J1QA 4FJ1A 2NZ8A 2A9KA 2PGNA 3M3HA 3FNGA 1AQYA 5E1DA 1NMYA 2OBLA 4ZV7A 4HWSA 4E07A 1UF9A 2VSXA 2CHQA 4JX8A 4MLPA 1S89A 2PRJA 2W6OA 3LW7A 4IILA 3C6ZA 3LZDA 2ZIFA 2CLSA 1XZDA 4WBSA 1F8GA 2E21A 4WCFC 2JZCA 1T5TA 2AYYA 3GJYA 5D1NA 3NBKA 3R9WA 1VJGA 1SC1A 1YIOA 2BH9A 2XE8A 5B6PA 2XQFA 2A6PA 3ZS8A 1PP4A 1GQ2A 4HS4A 4R8LA 3NWOA 2ZWVA 1EP1B 4OUKX 4ARUA 1K7CA 4DMFA 2FK8A 2LIPA 5BN5B 1P0IA 1EFRA 3KZVA 3MD9A 3JYNA 3RS9A 3VJRA 3QHPA 1XDDA 2O7RA 3ML1A 4FIZA 3CPSA 1N33B 4X1KB 2IH5A 3LYUA 2A5GA 2XZLA 2PMBA 4NYIQ 1O3YA 5AJHA 2WKQA 3J7AC 4I6JA 2YASA 1P77A 1UPUA 1H2WA 3UC9A 1O6CA 1G0NA 3U4GA 5A5FA 3RRMA 2YICA 3VR3A 3FPHA 3SAJA 3N2IA 1CS0A 4R8VA 2P2NA 2WJJA 4QXAA 3ED5A 2CVPA 1RI2A 1XRNA 2D1RA 4F4HA 5I7UA 5JY1A 3BPSA 1MXFA 3OZWA 2LD4A 1B0UA 1CR2A 3UATA 2QI9F 2RHJA 2BBWA 4PLYA 5E8JA 5JZOA 1MNAA 2A9RA 1L5FA 3PU6A 4FHZA 2FLKA 4AURA 1J99A 5ICGA 3GP3A 1XZ8A 4GRAA 2O1WA 2IX3A 3RC8A 4F97A 1N5LA 1C1XB 2HHLA 1CUEA 4JP3A 5J2TA 3OC0A 4MSUA 1V71A 3L7BA 3LPLA 3GLIB 3F6RA 1FCJA 3VFDA 4V0RA 4HAOA 4C3UA 3QUBA 1I4DD 1PRYA 2OFPA 4HDNB 1C30B 3MTEA 1NOIA 2IYYA 5IARA 1M7HA 2V45A 4UHDA 3FNIA 2PYZA 4LF9B 4IR7A 4UBMA 1QHHB 4PO3X 4KPUB 3ZYZA 2XQKA 2V7QD 4B4VA 4BB5A 3UMYA 4TKVB 5JXIA 2REQB 3M6UA 3ZV7A 4YX9A 3HB9A 3FPSA 1HF3A 3A4VA 1RM3A 3AEKA 3CZMA 4GP6A 4GXTA 4YJFA 5DJ5A 5ALDA 3R8XA 4CEHA 1DFIA 1FUYB 2G04A 5CD9A 2NP7A 3O82A 1M0EA 3A6HA 3DUFA 2ZJ2A 1FMCA 2Q5EA 5CFRA 1EXMA 1YCFA 1ZGJA 4KQ2A 4PX9A 3RQIA 3ZW9A 2ID7A 1IU9A 1BD3A 3JQAB 1L2TA 3E9MA 2C83A 5AJXA 1HR0B 4GXNA 3RU7A 3QXJA 4WKBA 3A9WA 2Y05A 3CYFA 3WL4A 3MMXA 4A0GA 2ISQA 1VG0B 1NKVA 2BRUA 1Z5UA 3RNLA 1JLLA 4ND3A 4UVEA 4FD2A 1E6KA 2FPLA 1YVEI 1VXRA 4K6FA 2AEMA 4QU0A 3PTZA 5CIQA 2ZP1A 2Y4NA 3CSSA 2OZKA 3FPFA 2C78A 4NS1A 3TSWA 1KC1A 2DLNA 3NHYA 3ETDA 4BBAA 4MGIR 1RC8A 3IEMA 1MHPA 2GEKA 3C5EA 2FR1A 4KZKA 2F4NA 1C8VB 5AW2A 3W6ZA 1NYTA 2VL7A 3LQRA 4HBZA 5F7JA 5KUTA 4PGGA 1QO0D 3TTSA 2MOKA 1CY7A 4POAA 3G88A 2XH8A 1R50A 3JSAA 3MZ0A 3A8TA 4FMCF 1X9IA 3B12A 3WNVA 4H1TA 2KWIA 1Z15A 2GA8A 2QW0X 4MZXA 1PK9A 3EQ2A 1ZLXA 2O2IA 3RYFB 3T9CA 3PPIA 3ZE9A 4PF1A 3LL4A 2AMVA 2Z5LA 2Z4SA 4QUKA 2BISA 5BYAA 1U8UA 1OLXA 3DLCA 5H0IA 1RPNA 3KR0A 1FXWF 3FUXA 4EF4A 5DNVA 1VB5A 1KQPA 3PCTA 1F6DA 4NWIA 3SVLA 3W2IA 2OXEA 3CEJA 2GBPA 1UFQA 4GMGA 3U9TA 3K6SA 1PZGA 2A4KA 9ABPA 2WZBA 2I2FA 1FP4A 2QD3A 4IWXA 3PFHA 3C3MA 2Q1XA 1M6HA 2BV3A 1L8QA 2RGRA 3FFXA 5ECWA 4E3WA 1JEEA 4RL6A 4J49A 5CM2Z 2E9SA 5EIWA 3SS8A 1RM4A 4DTCA 2I4RA 4HMQA 2NO0A 4Q15A 1J07A 4E51A 5BURA 5F35A 2RDMA 4LHEA 2VOEA 4UHBA 4ZZ2A 3W4JA 4B9AA 1P4HA 2IODA 2IYAA 2EX1A 3MCWA 1IEVA 2QVZX 1YE3A 3OE7D 4ZP1A 3RU9A 3ZV6A 4Y6RA 2O8DA 1FLNA 3N2LA 4JEMA 3IE1A 4PZ0A 3BICA 4YAJA 3G5MA 4O4IF 4UDNA 1JU4A 4ZT6A 4CMIA 3IP9A 4MVXA 1L9KA 2P5UA 4JELA 3D3NA 4O2BB 5C34B 2UYYA 2BKVA 2BFEA 4UUOA 4MEBA 3C3JA 2DSTA 1JR3E 1OFTA 1XZKA 3D9QX 2QZPA 4GR9A 4DYDA 4YPFA 3KT0A 4FYJA 1T91A 4EQ6B 1A9RA 3K5HA 4PYLA 1QVVA 1E1MA 1PWHA 1TTPB 1K7SN 1OILA 1X9GA 3G23A 3K15A 2VRBA 2Q9UA 3HC7A 1LLUA 3TBFA 1SVSA 3JQBA 5K8LA 5LYJF 2CXRA 3LUCA 3K2EA 3NCTA 3GRAA 4M21A 5AW4A 2YOHA 3D7KA 1RXYA 1Y5RA 2R1TA 2E7ZA 2W6JA 3HVKA 1SKAA 4Z4CA 5KSWB 1JLKA 3GUCA 1L6RA 2ZWIA 1WXEA 4V1CA 4NCJA 5ILQA 1ODKA 1YQWA 3D4LA 3FLAA 3HYNA 3OT5A 4LW8A 5EJGA 2ZUSA 1TYZA 2JEYA 5LQCA 2RH9B 3AR7A 1L4GA 4LTMA 5EE5B 3UJ8A 3FMIA 4LXQA 3DAOA 1KEZA 3ZBQA 4HAYA 5IKEA 3KYBA 3LQ1A 3N58A 4H35A 3WNZA 1QWSA 2ZSFA 3PHHA 5ELXA 4LDNA 1V45E 5CLGA 3PC8C 1K5PA 1QAOA 3L7KA 4UTXA 1DDOA 2OD7A 1E32A 2B61A 2YVUA 3EH1A 1ML3A 3F9IA 3JY6A 4NE9A 1DJPA 1J9ZA 1IHDA 4XDYA 4TROA 5EXEA 5HIIA 3F6SA 3D8NA 1C0EA 1NLYA 1UDAA 3D8HA 4FFRA 3HVJA 3HZHA 3RJ9A 3ESDA 2IOFK 2O3TA 1NT2A 1Q11A 4RK1A 3GIDA 2C03A 3JQAA 1HYEA 4Q18A 3EGXA 3QXCA 1TLLA 2VDNB 1VI2A 3I9LA 4Z9XA 3GUVA 3VJMA 3ZWBA 1BWQA 4E70A 2JVKA 4FI3C 4H15A 3GJQA 1VA5A 1ZO8A 2F7SA 2JAHA 4S1TA 3T1VA 2A0KA 3EE6A 4M38A 2IEIA 4JC8A 4S1VA 4RZQA 5EHQA 2VH5R 3WLIA 3DT9A 5KDDA 4LRWA 4BNTA 2E18A 2HF9A 1A2QA 2P9HA 5IXJA 4KFUA 1DPFA 4KRXA 4OP1A 1XFAA 3WLKX 2AGVA 3P9CA 5EL0A 1DOZA 2AVNA 1U9JA 2M1XA 3VGPA 5DHAA 1QRRA 4TZ6A 3D2AA 4CTKA 1NBIA 4H7FA 4NDNE 4HDOB 1VJTA 2WWXA 1R1DA 5LMCA 3MQ2A 4F84A 1IJEA 4N8SA 4EGFA 1ZR4A 4IGKA 3BGIA 1EVJA 3ODPA 2QD1A 1QJ4A 5IHXA 3HU1A 1LS1A 2EKZA 2N9UA 3GEGA 4NAHA 1A27A 3ADPA 1RKUA 4TMXA 3S27A 2WWWA 4DXHA 1P45A 3FYSA 2ZR8A 4ZXFA 5KTOA 3FOEC 5GV7A 3ZLJA 1X1AA 4LWPA 1QX4A 4TSFD 1T36B 1MEEA 4FMPA 1PJ3A 3GYBA 3EPHA 1NKSA 2QTZA 3DMRA 1E2GA 1V4NA 2HO5A 3LT2A 4GOXA 3VMFA 2C5AA 2XR1A 3JU3A 3L6UA 5LQJA 3GPLA 1LQTA 3KRTA 4P9NA 3EPKA 5K03A 4M8SA 4NYIR 4U7GA 4JFRA 1KHTA 4NJEA 3S1LA 5F77A 3EUEA 3EG5A 4IO1A 3WL5A 2FVXA 3I53A 3O83A 3KB6A 4J2HA 5DNAA 3TEFA 4ZIRA 5HHTA 1NBHA 5CBPB 2IGTA 2YY7A 2D4HA 1KYTA 1UQUA 3OHMA 1U6KA 2QXUA 1U4SA 2WV7A 3L92A 3NQ41 4XM0A 5EP4A 1LW6E 4L5YA 4G0UA 2FW1A 1JNXX 1NYQA 3EZ9A 5A5VA 1AE1A 2H18A 4KTVE 3R76A 1UMCB 3ZLBA 3U3JA 1KRHA 1YQ9A 4K2HA 5D7BA 1V4BA 4ONEA 1L3BA 2G9UA 4TV8A 3D6NB 2V58A 5DE3A 4YP6A 5BPHA 2IPNA 4KDRA 4GQBA 1IHOA 4LHVA 5SY9A 2HJRA 5CUQA 2ZRJA 1Z62A 1UOOA 2BHTA 3EWNA 1KJIA 3KFLA 4YPVA 1VRCA 3NX4A 3ZQUA 1SJ9A 1HE8B 1KSGA 5LPNA 2B0CA 2BEVA 4AIIA 4YCJA 4C0LA 1JU3A 2F00A 3VTFA 4QT4A 5BXQC 2V7PA 5JROA 1AIPA 3DL2A 2R8YA 1Z8DA 1LEHA 1X7XB 3QOYA 1E0KA 3OC6A 1DDIA 3RU3A 2BGWA 3OQBA 4EMBA 1KQGA 3RREA 3RRBA 3PDIA 3Q98A 4I3FA 1DUSA 4M7WA 1CZHA 1SUBA 1OX4B 1ZVKA 2H3EA 1MORA 3H1EA 1VIYA 3HLKA 1Y5NA 5I8WA 2PZEA 1FFGA 2QRJA 2XUHA 3EGOA 3BX1A 1ESEA 1H2AS 1AUQA 2WJ4A 4PTZA 5LU9A 1SBCA 5SYNA 1N2CB 5TMBA 3U7GA 4IIVA 2B1QA 3ZN2A 3L6BA 2GJKA 4KQIA 3RM3A 1TIBA 2Q41A 3AUTA 4ZYLA 4OHCA 4WTOA 3OKPA 4R0NA 3PI7A 3UT5A 3HADA 2ROQA 4U7DA 3MTIA 2YJ6A 2B8TA 4R0VA 2E6UX 5DVZA 3RASA 3ENVA 2M1ZA 1T5DX 3CRMA 3HZRA 1K8YB 1DOAA 4NICA 5ECGC 1NQWA 5HCIA 4FX2A 2O3UA 2VPIA 2FI1A 3ZBTA 1ILWA 5FWXB 1CDZA 3GA5A 4TXJA 2ZJBA 3IEIA 3RC1A 4A73A 1D04A 4PYJA 1EIWA 1HOTA 2HJVA 3QBEA 1FRQA 1QZXA 4MGEA 3QUSA 1I1QB 3TLGA 3W5IA 2HCRA 5IEJA 5AKYA 2H4WA 2PKRA 3ITEA 3Q40A 4GZ3A 4LA4A 3X2EA 2OHOA 3GN1A 4NOKA 1PJ2A 4PLPA 3HV0A 3DLHA 1E3JA 4RQUA 3DGFC 2FFRA 5DHRA 4RH3A 2BTEA 4LJLA 3VKFA 1AQ6A 2ZYUX 2V7XA 3UJAA 1E2FA 1UPAA 4AG6A 2EF1A 4HDNA 1N2BA 4AROA 5GGXA 1E1RA 1WDKA 4ABYA 1WBDA 2BFNA 1U9IA 2VDOB 3U3DA 3QPCA 5JSZB 2RGYA 4LF8B 2ZE6A 4GI7A 5EEGA 1NMZA 2FEWB 4WZ6A 4YUWA 1KJQA 3JQ7B 1EP3B 4ERXA 4K9RA 1P80A 3THWB 4C1BA 3RVQA 2B4YA 2GZHA 2JGDB 1P3DA 4QGBA 3NI2A 3GOQA 1MXHA 4FYWA 3F7OA 4IMPA 2OBMA 1E3WB 1JW9B 1YVUA 2XDYA 3B9RA 3KWJA 1V8DA 2WT4A 4E08A 1TGVA 4J2OA 1F06A 2X40A 4LYJA 3H2YA 4WECA 5K9ZA 2EZ9A 2ZRHA 3FWNA 1Z0JA 2BMVA 3QNMA 2ATVA 1Z3IX 3QM1A 1MAWA 2XOEA 3LQFA 1BYUA 1XK6A 1YKGA 4RS4A 1TZCA 3OPNA 3AIKA 1AJEA 1E64A 3RFXA 1Q95A 1QIJA 1QGUB 1DEAA 2GGSA 5FAKA 4J4BA 4AI6A 2NQ2C 5EWJB 3VDRA 3RLFA 1UDXA 3TFQA 4CGYA 1RQ2A 1TM3E 2Y1XA 4I9UA 4BLOA 3HP4A 3ZHVA 1MZPA 3LA6A 4B6EA 1CF2O 3OESA 1GSAA 1C0KA 2P9CA 5JYEA 4IVPA 1F8UA 2E1RA 3FDFA 1JSXA 4HNAA 3EPRA 3MCTA 2FG7C 4IL5A 3UZUA 4LJKA 3L0IB 1BDBA 2HQRA 4KXVA 1SK8A 2AFHA 4Y1EA 2DQKA 5CNKA 3T15A 3PEWA 1RRCA 1R6TA 1KTVA 1ZR2A 1H69A 3Q9LA 3K32A 2WU0A 4OGWA 2ENUA 2V1XA 4NNOA 3VXKA 4X3CA 4B40A 6CHYA 2HV8A 3AYXB 4NBNA 3R7WA 1EZ1A 1MGOA 3KOOA 2IS2A 4NCHA 1XEWY 4PO1A 3RSGA 4UVHA 4WIAA 2XNSA 4KWCA 1NW6A 4N65A 4AUMA 1DSSG 4GVXA 3BN3A 3NH9A 1MW9X 2RHMA 2OAEA 4BU1A 1NM5C 2WIFA 3A1WA 4JJ6A 3VBEA 3VI3B 2HL6A 2BOVA 1T3SA 3EGWA 3HE3A 5BSRA 1Q6YA 3WWEA 1Z4PX 5EIHA 3R4VA 1Z45A 5HKLA 1Q84A 4Z3OA 2IW1A 2R68A 4QKQA 3L7JA 1R6DA 3DAYA 2FPPA 1C7QA 2C57A 4GE0A 5ITSA 4KO2S 1IOWA 1JALA 1ODFA 4N49A 4Q3DA 4D25A 4HB4A 4Y0AA 2QTVB 3OCWA 3DDHA 5BQOA 1UBJS 1EBBA 1E6LA 1ISFA 5BR7A 5AXDA 3KO8A 5EESA 4PG4A 1P19A 2VJCA 4TLMB 3KAPA 4M89A 4Y98A 1HEIA 1ZK4A 4N9QA 4YRFA 2HU8A 5LM3A 3A2LA 4BCCA 2NSHA 4X94A 1CU1A 4OM8A 3KVVA 4ENRA 3DV2A 4BQPA 1OXUA 5MDHA 1WAMA 2R7AA 3TGPA 1PR5A 1RWOA 5K3AA 1ZESA 3U6BA 3C3EA 1BKYA 2F90A 4WEQA 1MPXA 3PD0A 1ZIOA 1XZQA 1N2OA 5F7ZA 3O8LA 3IBTA 1OIWA 4HB2A 2D2VA 2OCDA 1PHPA 2G9ZA 2YWRA 2FPMA 3B5IA 3KVNA 2VDLB 3Q3JB 2VHXA 3VKUA 2XCUA 5TF4A 4B2PA 1EG2A 4FEGA 3O7MA 5JZSA 3WY9A 1PZNA 2QMEA 2R66A 4XCVA 4DC0A 4YT8A 2Q49A 1FW6A 5A0VA 4XWOA 4OH1A 4AG3A 5IULC 3QFTA 2ZS9A 4L1KA 3JASB 1SUSA 1D1QA 3TCNA 3QNUA 3M1YA 2C8VA 4IG4A 3C8ZA 4G4GA 3T1QA 1RQGA 5JMPA 3AKYA 4PU0A 5JPDA 4KR2A 1EU1A 4GBMA 4GMKA 5KDLA 1MG5A 3IPCA 5JDCA 1ONPA 4N7BA 4OXQA 3L02A 4CM5A 5TE9A 1EFKA 2FJPA 3D4BA 1BFDA 4CUJA 3H11B 4D45A 4JBIA 4U5XA 2OHXA 1ESZA 3BWVA 3K09A 2O05A 4KXNA 1OVGA 3E7XA 3H5VA 3NCHA 5IVKA 4OSEA 5CLQA 2AG8A 3DKIA 4GQIA 2Z6VA 1TRKA 3QITA 2E85A 3PXUA 5TV2A 5HX7A 2G3YA 5C1DA 5JSUA 5CNJA 5AFSA 1MQ8B 3CV3A 3QVOA 4KXWA 2ZWAA 5DK4A 2GCEA 2JGRA 2RHGB 4UJ3A 4LYFA 3DZJA 3QKRB 4MQFA 4M0KA 3CVYA 4I5GA 2AE2A 1SOVA 2IPAB 2ZM6B 2J6CA 2PH3A 3T3IA 1RWXA 2H8GA 3V8MA 3R6LA 5JS8A 4FM9A 2KI5A 2VP0A 1ODSA 4Z4FA 3OD1A 3L4SO 2I6SA 3FNRA 3N2GA 3EZLA 4GFDA 2FF5A 4L5IA 1EKXA 1Q77A 1ZOOA 4UUMA 4DFDA 2YHIB 5L3SB 3GLGE 2QJOA 2NP6A 3C3KA 4UE2A 2F43A 5K4AA 4B2IA 4GSKA 2BFBB 4FMBB 1PBNA 4WMLA 2JNWA 2GZAA 3CRQA 3D3QA 4TWZA 1ZL2A 3BWBA 4BWFB 4TPKA 4EDHA 5ICSA 1X15A 2B8JA 1JE0A 1KO4A 3JWPA 3PA8A 4ETWA 1IWBB 1KAHA 1G8PA 5AQEA 4KNWA 2UYHA 4ARIA 4B4UA 2AFHB 4ALIA 3OUZA 1ISJA 3ABSB 1HZZC 1GXSA 2CDRA 3PP8A 5BORA 1F2DA 3CB2A 1DG9A 3U40A 4X63A 3AOEA 5CYPA 5IT0A 3WQRA 1W85B 1AGPA 3D6AA 4MVJG 4LOKA 4CMEC 4L7QA 2BFCA 2XGMA 3MK31 1RXUA 3E8SA 1QIEA 3C98A 4MKGA 4I6GA 3HCAA 4QBTA 5GTDA 2WYUA 1XDWA 4OFWA 3HBJA 1G5QA 1SVIA 4Y9UA 3VSCA 4BFTA 3OG9A 2CVOA 4B4WA 5LMNB 1IWPB 1IAVA 3N87A 1DARA 3CW9A 4TXHA 4GWGA 4W8GA 2Q5LA 3OTIA 3ZJ4A 4WWHA 4NAUA 3T3DA 5JXWA 3WIOA 4QXRA 4V0SA 4UFOA 2J9XB 3QBVA 3IERA 1SRQA 1X7YA 1AM4D 1Q0UA 1AGYA 2GLTA 3IMEA 2CL6X 4O25A 1DQNA 5CJPA 2C7GA 4A1FA 3HUFA 2QNBA 3Q5EA 5FTLA 2DERA 1SCKA 2PT5A 3I5UA 1J2RA 3BK1A 3H0EA 3QKSB 3RVLA 1ISRA 4OK3A 2AD1A 2FY8A 1KR2A 1USKA 2AV6A 2N3ZA 5T6MA 2I4LA 5M7EA 2Q4RA 3FFBA 3GD7A 2AXEA 4K87A 2GM3A 4BNDA 2JG3A 1R0WA 4POOA 1M6VA 1N9ZA 1E6EA 3S8EA 2OBYA 4D3SA 3RSLA 3MT7A 1XLVA 5AVZA 1J1UA 2BGLA 2Z95A 4C6TB 1XQ6A 2PT9A 2IBMA 4X1OA 2VHUA 5C7IO 4GZMA 4LCJA 2HT6A 3EZ7A 5BW6B 4XWYA 1FYDA 2LKDA 4BO4A 1K3TA 4IO0A 3ZZ1A 1GNRA 3FHJA 4LSMA 3CR8A 4RJ2A 1OHHD 2ZXFA 2NAPA 2R87A 4HRXA 4BWYA 2J3HA 2R8PA 1RPJA 2WUGA 5EJAA 4HQFA 1IB6A 4II7A 5LOVA 2IS1A 1A9OA 1TO2E 1TOAA 4OAQA 1Z8FA 4XYLA 1UP4A 1ZA1A 3P9XA 4N1AA 2OTCA 3EA0A 3ZYCA 4EJSC 1S4MA 5TPWA 4AC9A 2EHJA 4Y6PA 2BWJA 3CUTA 2CL5A 2CFOA 3EMVA 4ARBA 5KYTA 3MTQA 2E5LB 3DSRA 1A4IA 3U4QB 3PUYA 2YCLA 4JQYA 1E2UA 5ALWA 2P4QA 2VCEA 2IIQA 1O77A 3BS4A 4JCCA 3ZZTA 2F55A 1QFYA 1ZUD1 2F8SA 3PPVA 3FHTA 3HFJA 4DM4A 5IABA 1ECLA 4BNLA 4HLUC 5JJLA 4WLUA 4E14A 2PKQO 3H5RA 1PGPA 1QORA 1I2CA 2EEPA 1E94E 3SR0A 2IYQA 3A4YA 1AZSC 1EUDA 3EVAA 4D5EA 1PVOA 3E3LA 2PJZA 2DQ4A 2WW8A 3OZIA 4W9MC 4MI1A 3FVTA 3MT9A 1R3DA 2P68A 3LBAA 5JG7A 2VDRB 5ALQA 3OE1A 1P1KA 1OXMA 3F67A 2H7YA 1CQIA 1R4MA 2FWIA 4IJWA 3P4XA 4NJEB 4R1SA 4X8LA 5TXGA 1Z06A 3VH2A 4L8FA 4D3ZA 4NK4A 3S2YA 5KNDH 2UUAB 4N40A 4RUKA 5JD3A 2CFSA 4OEHA 1HDGO 4RCYA 1GL6A 1NJSA 1U8CB 3DUWA 3UGQA 2HWKA 3COVA 5I9MA 2QTFA 1A5BB 3UENA 4CCYA 1DAIA 1JPNA 1WG8A 4MWCA 5KKCA 5FR2A 1TRHA 1GPUA 2GERA 4C7OB 2NU9B 4DNOA 1VBKA 3K9NA 5CK4A 2FUG1 1IJFA 1LSOA 2I0FA 1K0FA 3C8HA 3HGMA 3KTDA 1G21B 2FUNB 1HV8A 1P2DA 3L82B 4J07A 1O4WA 3N2KB 5CPFA 4BFXA 5KYNA 1KYVA 2I9KA 1HKHA 3IQGX 1SA0B 1LDEA 4KIUA 1DS6A 3QVKA 1KMCA 1ATIA 2ECKA 5BYBA 4B3GA 1X7WB 2W9XA 2Q0XA 3X0DA 3KZMA 3RIMA 2JLZA 1DAKA 3A6JA 1ZU5A 5T8KC 3H86A 3S7ZA 3S8YA 2PPVA 5CYGA 1R5NA 5LBUA 4DV6B 5DEOA 3KJNA 1JIIA 4ESEA 3V7UA 3HVRA 1KI2A 4AKTA 1Z5WA 4C7XA 5ELMA 1WZEA 3ZUGA 4KLAA 3SDZA 1QHIA 2IELA 2LZ0A 3IDAA 5AKIA 3DHNA 3O26A 2D7DA 4O4JB 4PICA 4H59A 4Y2TA 1PEKE 4K9SA 3U4AA 5BQPA 1E6WA 1I30A 1OY1A 1G21E 3DAHA 5IU6A 1KYIA 4AD8A 1OGJA 2ZGVA 1A7KA 4TMWA 4CODB 1RYFA 2H2HA 4DCMA 4A8PA 2ZWMA 4YBZA 3VC2A 2H29A 1LZLA 1W87A 2KLHA 3HCBA 2FSVC 3MWFA 2PWAA 3EFBA 3WRXA 1LK7A 3R8FA 1DBPA 2ZS7A 1K9VF 4IIJB 5BOVA 1Q50A 4FYKA 2GAAA 4BFVA 2P8SA 2B8NA 3STTA 5G2OA 3S4YA 1SUFA 2QD4A 4OLJA 1JWBB 3NALA 4R71A 4ENWA 3RS7A 1E1CA 4F1WA 1T5HX 3ABOB 3TQTA 3ZTTA 4HT3B 3UAVA 1ZSNA 3LLUA 1C1DB 3Q7IA 1M1NA 3W4IA 3IJEB 1CZUA 5K3BA 3O1HB 3KSDO 1W49A 1A5ZA 3G9ZA 3IKMB 2FWNA 2C58A 4XEHA 4DHWA 3P9QA 1XN4A 2EX4A 1C9MA 4IZHA 1YS4A 3W1VA 3RYCA 1O8BA 1XA3A 1P33A 3OQIA 5CAEA 3KVOA 4KE7A 4JCOA 3BDIA 4GPD1 4Q9IA 1G3RA 1GFWA 1XHLA 2IZ0A 2P5TB 2OCXA 4K6MA 5BRAA 3AHJA 4JWTA 3L01A 3EOBI 3COYA 2Z8ZA 3VU3A 2ZUCA 2UV8A 3LO8A 3Q3CA 4BMXA 4TRNA 2VQSA 5BSVA 2GO1A 2YDYA 2CVZA 4HWPA 4JI5B 4C0KA 3BWEA 5J59A 3NIDB 2PVPA 2FX3A 3D6HA 4U39A 4RKWA 5DWQA 1LK0A 2H16A 1BGXT 2L82A 1ZMRA 4PGAA 4WD3A 2RH4A 4F3CA 4Q47A 2C1ZA 5HNKA 3WB9A 4QPZA 2C2WA 2OCAA 4WBNB 1BU5A 1OX4A 2WIBA 4XGKA 6Q21A 2BF4A 3RABA 3U1TA 4I55A 4B32A 1OE0A 3AWIA 2VUTA 4DNPA 3D0QA 3L8GA 1PWYE 1EFAA 4KQXA 4BQEA 2J67A 2HT1A 3AJAA 2RSLA 3AVUA 1PFVA 1TZJA 1DWOA 2PMWB 4R9NA 4DCJA 2YS7A 3GDFA 1R37A 4D4GA 3EBOA 3H99A 3UH0A 1YB2A 3GBPA 2HA0A 4DTIA 1NM5A 1NN1A 3WOVA 1IOVA 2G1UA 1UC4B 2RKBA