4DVGA

Crystal structure of e. histolytica formin1 bound to ehrho1-gtpgammas
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
164
structure length
164
Chain Sequence
LKIVVVGDGAVGKTCLLLAFSKGEIPTAYVPTVFENFSHVMKYKNEEFILHLWDTAGQEEYDRLRPLSYADSDVVLLCFAVNNRTSFDNISTKWEPEIKHYIDTAKTVLVGLKVDLRKDGSDDVTKQEGDDLCQKLGCVAYIEASSVAKIGLNEVFEKSVDCIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rho-like small GTPase
publication title Entamoeba histolytica Rho1 Regulates Actin Polymerization through a Divergent, Diaphanous-Related Formin.
pubmed doi rcsb
source organism Entamoeba histolytica
molecule tags Gtp binding/actin binding proteins
total genus 51
structure length 164
sequence length 164
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2012-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dvgA00
3DL0A 3EZFA 2VP5A 5IHPA 4LHWA 1OHHA 2YYZA 3Q5EA 5BYJA 3A1VA 3UATA 3U6BA 1GSIA 5CB8A 2GJ8A 3LXXA 3ASYA 4LBYA 3AF1A 2CDNA 2JLRA 2DFKB 1BOFA 1XRJA 3UK6A 3I62A 4V0KA 5CM8B 3K0SA 2G6BA 5FOXA 5ELXA 2F55A 1U2RA 4LPSA 4YLGA 1M8PA 1W0KD 3M0EA 5IT5A 4F93B 1YU9A 2IYRA 2OUKA 4D4KA 3CRRA 1P62B 4MKIA 4XD7A 2ZM5A 2O8EB 521PA 4Q4HA 2AN9A 3B1ZA 2H92A 1X8LA 2JLYA 2GKSA 1CJMA 1YR6A 3DVLA 3E2IA 2V9PA 1G5RA 5JCPA 3AF0A 3AV0B 2IHYA 4A0HA 4W5WA 1S1CA 1JJVA 1EFUA 3H84A 3BFXA 1ZCAA 4X8LA 3SHFA 2AK3A 3K9HA 4JT2A 2XAUA 4LHXA 1ZBDA 4TTQA 3I5XA 4IJMA 1HQCA 4JLMA 2IXGA 2IL1A 3EZ2A 3V4FA 1Z0JA 5FI1B 1E2FA 3ONWA 3KTAB 3Q7QA 4JJKA 1Z2AA 3A1UA 1JR3D 2ODWA 2G83A 4MRSA 3U7EB 2HT6A 4JLNA 4OI4A 3O47A 4DDWA 5AWFC 4M2LA 1IXRC 4Q1BA 2G1JA 3JVVA 3UG7A 3UMSA 1ZD8A 4UNRA 1NY5A 2MSDB 5GVSA 5J5CA 3QF7A 5J4LA 1JQJC 1DBSA 4OL0A 4V03A 1G21E 1J2JA 4GI7A 5B2ZA 5JLJA 3EZ6A 4NBSA 4TL7A 4RD0A 3CNNA 5L3SA 3LXRA 4S35A 1G8HA 2QGNA 2UKDA 1MH1A 1JR6A 3QBTA 1TUIA 3SYLA 3AVOA 4HAVA 5FOTA 4BECA 2YKGA 3RS2A 4EPWA 2W0MA 2P5SA 3UG6A 3I92A 2OESA 1ZP6A 4DSUA 4TN1A 3M1IA 4JL6A 4M21A 1X3SA 2XX3A 1PUIA 2IUSA 3ND8A 1TQ6A 2PZEA 1PLKA 2J0SA 4MYHA 1Z0DA 4ZPXA 3T1QA 4Q19A 4DSNA 1TNDA 4BZXA 4PHTA 2Y8EA 4CRWB 3H86A 4HAZA 4RD3A 5KUTA 1CR1A 4N3NA 2YOHA 5FTKA 1VCMA 1Z29A 1Q21A 3B5JA 1KY3A 1ZM4A 2R6CA 1XP8A 3ZIAD 3P26A 5JRJA 1NG9A 1FTSA 2A3RA 3ADBA 4JVMA 1KMQA 2D2EA 1VMAA 4MH0R 1XMJA 3BJIC 4FWTA 1HT2E 1Q1BA 1U8AA 4F4IA 3ZVMA 4MITA 5B64A 1AKEA 4P4UA 4MGKR 1E99A 1D2NA 3QG1A 2BM1A 2KJQA 2WPDA 1CLUA 4ZIRB 4DUGA 2KBEA 1XPUA 4B34A 3V00A 3AGPA 4EFNA 1W4BA 1OE0A 1DAMA 1WRBA 2IYWA 4OI2A 3NBXX 2XZPA 4LJ4A 1IN8A 4FMDF 3PEYA 3Q5DA 2QY9A 3K70C 5FFMA 3I8SA 1N6KA 3IIKA 4C9BA 3ZZTA 4QM6A 1AGRA 2XJ4A 4HLDA 2JCSA 4G5SA 4Q7KA 3RYTC 4UJ5A 2ZAOA 3FKSD 1F48A 2Z83A 4C0LA 3U6KA 1AQUA 1VYVA 3CNLA 1G9XA 4Z54A 3I1FA 2XXAB 1LFDB 1RRPA 2O8BB 1OSNA 2DHRA 4M1TA 3JVUA 3RABA 2REBA 2ZRFA 5TB5A 3HR8A 4NU0A 3AVXA 4ARZB 3FDIA 4EQ6A 1FMLA 1CIPA 1XCMA 2HXYA 3RWOA 4OQNA 4AWXA 3RS4A 4B48A 3FMIA 3SBDA 2CE7A 4UXJA 4HLUA 5KSYA 3IBYA 3GMTA 1RC8A 1R0WA 3SJAA 2GRJA 4IOKA 2J45A 2BKUA 2VHQA 1E1RD 3UANA 4RZ3A 2FFAA 2NIPA 3BIFA 1VYUA 2BKEA 2P5TB 4V0LA 1II8A 1SULA 4JYBA 4UNPA 3RS5A 3IUYA 2BOVA 4HLUC 3GEIA 2AWOA 3L0SA 4F38A 2BBSA 5TDHA 1HTWA 1H8ED 3MD0A 1S2MA 5JJLA 1OW3B 1LF0A 1SKQA 5E95A 1CBUA 1L2TA 4EIWA 1RKBA 1XEXB 2PL3A 3P27A 3W3ZB 1E2IA 1QHGA 3GJ3A 4B3BA 4BUJA 2DCUA 1ZMXA 4XOIA 4WAUA 1F2UA 5C2JB 4JL8A 4B3GA 2NGRA 3G5UA 2OAQ1 4V0MA 2BIFA 2BVNA 3NWJA 1UF9A 4XIGS 5EZ6B 5BN5A 4G5RA 3QE0A 5K8IA 4PZYA 4IVRA 2FDCA 3AQ4A 4LBZA 3DZDA 4A6XA 3HWSA 1Z08A 4E07A 2DYKA 2EYQA 4NYIR 1KOFA 2OG2A 2XJ9A 3L43A 1OYYA 2XB4A 2JLXA 4ASUD 1SHKA 2CCGA 2FSIA 3VAAA 4P32A 3RLFA 3GJ8A 3IPYA 1KI7A 3K9GA 3GLHB 3TGPA 2RGGA 3QY0A 3OE7D 4KSBA 4DCSA 4JMPA 3OESA 5DISB 3QG5A 1E2KA 3RDPA 3FB4A 2IYZA 3U5ZB 3BRWD 3QOFA 4ACAA 4R2HA 2R2AA 5JZVA 2RKOA 1IY1A 2VTKA 2CLDX 1DG3A 2JJ8A 2QPTA 4GSYA 4LV8B 3S1AA 3NIBA 2CVHA 1KTVA 2A5FA 1ZM7A 2YWGA 3AUYA 5JCZA 4WZAE 2V3CC 5FUVA 1E32A 1CULC 1NVWQ 2Q3FA 2ZTSA 2MMGA 2Z5FA 3NG1A 1E2GA 1SVOA 2XOKD 2XZLA 1TU3A 1TF5A 3NTUA 1UEJA 2ZRHA 1XPOA 4URYR 4PAMA 3U3KA 2AD1A 5CYPA 1RJ9B 4HAXA 4M9XA 3IEVA 5CM9C 5KNDA 2IYVA 4D4LA 4G3XA 3L2OB 1UDWA 4OHZA 2ZRAA 1KKLA 1US8A 4C0KA 1WQ1R 2I4IA 3GLHE 1EXMA 3DM9B 4DT1A 2VP9A 2I1VB 2HXSA 4PHFA 2YWFA 4XWAA 1PJRA 3NHAA 4A0GA 2W6ID 2QG6A 2V6IA 1NLZA 1N6HA 1QHNA 1ZRHA 3CRMA 1DAFA 3ADDA 4Q9KA 1V43A 1SXJB 1ZNYA 2GVZC 4POAA 3EPHA 2FFHA 1EG7A 3PUYA 4X8MA 3KB2A 4Q1AA 5K8LA 2VYFA 3C5CA 3JZMA 1Q0UA 1S4QA 1S1MA 4Q7JB 4H1UA 1NN5A 2TMKA 3ECCA 5JRZA 2F1HA 2F43A 2OBLA 1YR7A 2D06A 1NI3A 1QHYA 2IS1A 2QI9C 4IXNA 4RKFA 1KI9A 3GPLA 4Q01A 4RD6A 4ZKDA 5LBIA 1KI6A 3I72A 2VF7A 4TQAA 4TMZA 1Z6TA 3ZS9A 1R8SA 5FPHA 4FMDB 1P60A 4G5QA 4HATA 4NCJA 1KDTA 3QF4A 1HT1E 1YZUA 4ABYA 2W2XA 1GRNA 4I1VA 5JI3E 1OXVA 1NN1A 1DAEA 2OXRA 1ESMA 4LI0A 4CEJA 1RYHA 3UMFA 5FPYA 1W47A 2ZVPX 1NBMA 5JJIA 3TKLA 1OT3A 4L9WA 3T1TA 2YWHA 5E3HA 3DOEA 4IDQA 3ICQB 3TAHA 4M53A 5CJ2A 2EVWX 2VEDA 1W36D 4N0EA 1Y3AA 2QBYB 4MDFA 4XTRA 4DWJA 1ZC4A 5AJVB 4LBWA 2PMDA 1ONBA 2R44A 3IPXA 1P72A 4H1VA 5SZIA 3IQWA 4GP7A 1TTTA 1KI2A 2OBNA 3B82A 3NEYA 4NPHA 4ZO4A 3A1SA 3PUXA 2IYTA 2OCYC 2BEJA 4CF7A 1KK1A 5EP3A 1AK2A 5J4YA 2BMDA 2ZR7A 1QHHB 3MJRA 3UMRA 2IW3A 1DPFA 1PLLA 2EWWA 4QBIA 4TWZA 2LKCA 2W0SA 3X1WA 4AG6A 2QORA 4IKEA 4JIMA 1YRBA 1VIAA 5CLQA 2VIIA 5L3RA 1RRCA 421PA 3A4NA 5DI9A 5D3MB 3LX8A 1IN6A 3LO5A 4URZR 3T1VA 2GZDA 3HPRA 4XVQA 3WMGA 4E09A 4TQUS 2ZU0C 5K8UA 4LZZA 2NO6A 4GL2A 3OAAA 1AN0A 2VHUA 2DFTA 2X19A 1NVUQ 2YC4C 1HYQA 2DWPA 2P65A 3AB3A 3A1WA 1BMFA 1UBEA 1W4RA 2QU8A 4L16A 4NYMR 2FEOA 1G3MA 4LC0A 1EGAA 1OYWA 4L9SA 2WWGA 2FSFA 2C9OA 4TT3D 3VR2A 2YVUA 4DCVA 1WMSA 3DOFA 2WKRA 4KLNA 1E0JA 3TE6A 3O8RA 3K1JA 1A1VA 1ZUNB 1COWD 1YE8A 2YOGA 4DIEA 4B47A 2FG5A 1H8HA 2P6UA 3AVUA 4TZ0A 4KFTA 2GCOB 1QBKC 3I61A 4BRUA 2O8CB 1AZTA 2JJ1D 3OZXA 5G3ZA 1SGWA 4LWZA 2QRZA 4DBLC 5FL3A 1OH8A 2WJYA 3KZ1E 1AIPA 1FX0B 4B3DA 4HSEA 4AC9A 2ZJBA 2JAQA 2V1UA 4Q9HA 4GBMA 3IIJA 5FBVB 3VHLB 1KSJA 3ZLJA 2ZYTX 3LAWA 3AP1A 4D82A 5GADl 4KFRA 3CPHA 5CLLA 5IK2A 2QMUA 4NYJR 2F6RA 3AGQA 5CDFA 4AI6A 5KPDA 2A30A 4URVR 1FMJA 3CLVA 4DLXA 2JLZA 3T35A 4C2TA 3NHBA 4DRZA 4LYHA 4B33A 4NYMQ 2GAAA 1P73A 2BCGY 1I4LD 1X8KA 4MYUA 2CEAA 3VR6A 3OIVA 2H1LA 4QNMA 2WM9B 2IYSA 3KJIA 1IXZA 1BS1A 1QHXA 4DJTA 3VNUA 3MLEA 1GILA 3EC2A 1F5NA 4KCGA 1Q12A 1E9SA 4IOLA 3GJ5A 3CF6R 4M9ZA 1F6BA 5SZJA 1KK0A 2OLKA 2XXAA 1TAGA 2JLQA 2R6FA 4GOXA 5CJPA 1GZSA 5EP4A 4JVSB 4MUBA 1XMVA 2ZI7A 3B1YA 1KDPA 1KI4A 3U4QA 2ZANA 4AK9A 4DDUA 1YZNA 1CS4C 1K6MA 1YZTA 3U44A 3T5DA 1Z07A 1D9XA 5TARA 1E79D 2BDTA 3CF2A 4XTCS 4NE2A 1G4UR 1G3QA 5KU1A 4KI0A 1IY0A 2IYLD 2CLCX 2V55B 3B9PA 4HB0A 3BXZA 1GG2A 1W0JD 1W4AA 2QAGA 5EE5B 2C77A 2JIZD 3K0AA 3WMFA 1CR2A 2P2LA 3D6TB 4TTPA 5G40A 4A9AA 2X77A 2IT1A 1XCGB 2G0TA 4TSFA 2A7QA 4B2PA 3THWB 4CEIA 4Z51A 3GLIB 1G3UA 2QAGC 2PCLA 2J0UA 4TZ6A 1OHHD 2OO7A 2QAJA 5DH9A 2B92A 4NDZA 4ESVA 2R6GA 3D8BA 3MRSA 2ZJ2A 5E7JA 4ZV4A 5JSZA 3B9QA 2D3WA 1U94A 3MGCA 1CKEA 2L0XA 2MMCA 1F2TA 5UKDA 1KO1A 4BE7B 2FSHA 5HKKA 2BBTA 3RNLA 1FUUA 2IUTA 4IEEA 1KSHA 1ZC3A 2FGKA 5C1BA 4PC1A 4XD7D 2J3EA 3RSOA 1ZNZA 5EP2A 1N2CE 2ZXUA 2GJSA 3QKSB 5GVRA 2BHRA 2BCJQ 2ZIAA 4KHZA 4LYFA 4HZUA 3DKVA 5AR1A 4TL8A 1IN4A 5DSZA 1DAKA 1KK2A 2IXFA 3LD9A 3SFVA 821PA 4NHOA 1YKSA 1KAOA 2WWHA 1E9AA 4M1YA 4P4SB 3FMFA 4QGAA 1DADA 2OE2A 4HUQA 2EFEB 5DE3A 3Q3JB 5FL7A 2OV2A 3ZVNA 3OIYA 4OJKA 2AD5A 2JDIA 3UXMA 3W3AA 3EA5A 3GLIE 4MYTA 2QSYA 4WOPA 4BQSA 1KK3A 2IS4A 4IVQA 4BGDA 3A37A 1MT0A 1E2NA 3NXSA 3X1DA 3NC0C 4TMXA 4DLTA 3RRZA 4G01B 1A2KC 3SS8A 5EXPA 5JJKA 1W1WA 3QEJA 2B8WA 2ZRLA 1J8YF 3MJHA 4MRRA 3TNFA 1T91A 4LV6A 4X8HA 3VKHA 3BBPA 2DB3A 1E0SA 2ECKA 1UDXA 5TY0A 2RCNA 3VU9A 1SVSA 4JBXA 3B1WA 3SQXA 3VKGA 2CHQA 2ERYA 2ASEA 1E94E 3VR5A 1OF1A 3ND9A 3I5YA 2QENA 1ANKA 5EZ5A 2ZR9A 2OM2A 1R7RA 3KB1A 1LS6A 1GL6A 5GJVC 3RC3A 1F3OA 2AK2A 3TRFA 1XU4A 1M34E 3WP0A 1GAJA 3RSLA 1KMHB 3ZVLA 4B35A 1ZAKA 4JLOA 4LCBA 2XEXA 1OFHA 4P31A 4C0HA 2BBWA 5EQTA 5EXSA 4D26A 2FJUA 4PSKA 3H2YA 1JQLB 2NZ8A 3N2IA 1FNNA 3AKCA 4IDHA 4S2EA 3IQXA 4JVNA 1I2DA 1IOZA 1G5PA 1PV4A 1E2QA 2IUUA 2YZ2A 4NCKA 2OFXA 1LNZA 4BZQA 4PPNA 1FNMA 3B85A 3SC3A 4RCZA 1ZM2A 2IEZA 1UEIA 3LW7A 3MCAA 4XSGA 2QPAA 4C0SA 4CYMA 2A5DA 3BB4A 3REFA 3DO6A 4F91B 2NO1A 2RGDA 2WPDD 5DNYB 2VHJA 2NPFA 4YONB 3K70D 4QRHA 4DUGD 3AKEA 2XSZA 2P6RA 3THYA 4Z1MA 2R6AA 2VLIA 4ZKEA 1KI3A 5F3WB 4US1R 4US0R 2Z6VA 4ACBA 1Q44A 4EPXA 1NRJB 4B2IA 4DLRA 3ASZA 4Q21A 5FBRB 4QHYA 1T6NA 3BFVA 4B75A 2ZI3A 3HR7A 4QJ5A 4EFLA 3KQUA 2W00A 5CK5A 1A82A 3Q7PA 4RZUA 3V4RA 4PZZA 3PUWA 4C2UA 2FOLA 3J81k 1T5IA 2WVJA 3BB1A 2EFCB 1AS0A 3SQWA 3KJEA 1T3SA 2ZSAA 3CZQA 2N42A 3EARA 3FPAA 5KO2A 1O3YA 3GD7A 3GLFB 4JZKA 3SZRA 1X1RA 1LVGA 2NTYC 1P2SA 1QZXA 3B8HA 4IFBA 2VP0A 3VX4A 3RC8A 3IIMA 3OIWA 3K0FB 2QGZA 4BLSA 2FWRA 3DPUA 4JL5A 1NF3A 4CDGA 3AEZA 1BO6A 2FA9A 4HYYA 4OKSA 3U3JA 2YOFA 4KSCA 4BLPA 1PVOA 4FXPA 3CX6A 2EW1A 2OEPA 2QL6A 5FR2A 5DN6D 2GEDA 5IDVA 4V02A 1QG4A 2H8KA 2PLFA 1CJVC 1G16A 4GZLA 2VO1A 4XH9B 2WMNB 3G82C 2OCBA 1C4OA 3A58B 1R5OA 1T0HB 1A7JA 1L8QA 1E96A 3C14C 3RRYA 2EQBA 2F1JA 1N6OA 1YJ5A 1ZW6A 2C8VA 3LBIA 4OK5A 4BEBA 1KJYA 2DBYA 4AKHA 2WJHA 5B58C 3VR1A 2XTNA 5C4MA 2B7BA 4LC1A 1XX6A 4B32A 2A5GA 2CJWA 5CITA 3BK7A 5AK0A 1HA3A 2ZRBA 1GUAA 1GNPA 4DLZA 4OJQA 2PMKA 1E2EA 2J1LA 3C16C 1MRNA 5D3QA 2IYYA 4R2IA 1G5TA 3WHLA 5HZKA 3RAPR 1N6PA 1H65A 1R0YA 2FFQA 1EX7A 1M7GA 4FI3C 4RFSB 3HU1A 2BBOA 4HAWA 3K0EA 3L0IB 3BOSA 3TAUA 4ZDJA 1W48A 1CR0A 1N6LA 2FH5B 2R8RA 2OXCA 4PXAA 2H5EA 4LYAA 1ZNXA 4IW3B 5B57C 3GFPA 2XZOA 4EUNA 3IILA 1XXHB 4MKFA 2RGBA 1E2MA 3FFAA 1SHZA 2IC5A 3W5IA 4E22A 2BWJA 4BPBA 1L4YA 3L82B 1U0LA 2BMJA 4QHTA 4F4CA 1C9KA 5CYOA 2QP3A 1U0HC 1G8FA 4JLPA 3ZQJA 1G8GA 5DLQC 1D9ZA 3VNVA 1X6VA 1ZVQA 3QXJA 3THXA 3LV8A 1Q1EA 2FGJA 1FPMA 3SOPA 3ZZUA 3QPVA 3B1XA 1U0JA 4KITB 3LW8A 5AJXA 5G41A 5LB2A 3FGNA 5AUNB 2DFNA 2ZRKA 2P67A 4AYTA 4C0JA 2FPLA 3P1JA 4Q4AB 3EIHA 2JLWA 1G6HA 2RGNA 3B1VA 1KSFX 3R9IA 5F9HA 4WXRA 4C7OA 4DVGA 4HAYA 4EKDA 1XJCA 2KI5A 4M0LA 3X1XA 2AWNA 2O5VA 3A6PC 4DB2A 1NKTA 1S0UA 5TVKA 1S8FA 5DHFA 5HE8A 1NNEA 1SVLA 2RGNC 2IHBA 3C7KA 2IX3A 1R6BX 1UADA 4ZI2A 2F3RA 4TYYA 3PUZA 2OLJA 2Q21A 4TLAA 1MABA 4QGHA 2VP4A 3OEEA 2Z43A 3EW9A 2IK8A 5H70A 1XXHE 3FYHA 5FR1A 3SI7A 3SHWA 5J4VA 1VG8A 2HJVA 1SVKA 3PJRA 3NEJA 2ZYVX 1WXQA 2G88A 3Q85A 1Q1ZA 5EE9A 1R0ZA 3LVQE 4H9GA 2G77B 1O87A 2GZHA 3BAFA 2J87A 5F98A 2ZE5A 2ZYWX 4FMBB 1DEKA 5HZHA 4A82A 2ZRMA 4DSOA 5DN6A 1B0UA 2CHVA 2ZE6A 3RS0A 1GFIA 2N46A 1W36B 3WNCA 1OXUA 2VL7A 1Z2CA 2P0EA 3GFOA 4B76A 4QBFA 4PANA 3CBQA 3TVTA 3RRNA 1XCPA 2PX3A 5JMTA 1M2OB 4GPTA 3EWAA 1FFHA 3F8TA 4YC7A 4YDHB 2CLSA 3TJZA 4A8JA 1X1SA 4OHWA 4B3XA 3AF3A 4OHYA 2QA5A 3W6OA 1HQYE 1KO7A 4LY6A 1E2LA 3FMPB 3OF5A 3CWQA 3I4LA 3IHWA 1TQDA 1Z22A 4BWYA 1NBMD 3FFBA 2JJ2A 4Q03A 4K8OA 1NY6A 2VHTA 4MQBA 4LJ7A 4MYCA 2RGCA 5L3QB 1YVDA 3CW2A 3L0OA 4BFYA 4A8JC 1MV5A 3OFNA 4A15A 1IN5A 2G1KA 4IOMA 3EX7C 2RGXA 4FCVA 1MR3F 3W34A 4DLVA 3LDAA 1T9HA 2QPOA 2F3TA 4G1UC 1ESNA 1KJWA 5CK4A 1ELOA 3U3RA 2VP2A 4CGZA 3QIAA 3U7FB 3TQCA 3WRYC 3HU2A 2O0KA 1KY2A 5FOUA 1HH4A 4I4LA 4Q4JB 1AM4D 1E0AA 3T5GA 4FW9A 3EPLA 3U61B 2GETA 5LDDC 1CU1A 3KJGA 5DYGA 1Z6AA 3SYKA 1KAGA 1Z6YA 4LV5B 3HP1A 4TQ9A 2O8FB 1VDZA 3P4XA 4JVLA 4JLJA 1FL9A 2AKYA 4M8NE 4D25A 1TQ4A 1Z8FA 1OPXA 2HLDA 4HDQB 5BXQC 3QKRB 1IM2A 2YHSA 2ZSDA 3OAAD 4CEHA 1E2HA 2V54A 4OBEA 3GLGB 2ONKA 1EFHA 4MA4A 5JECA 1BMFD 4QKQA 2B6HA 4JLBA 1E9BA 4RKEA 1MOZA 3F0TA 5GJBA 3KFXA 4MGIR 5FPSA 4DCNA 4O2LA 1I2MA 4KAXA 3QKUA 2VF8A 1XD2B 3LLMA 3LNCA 4KBGA 3CRQA 3VFDA 1Z47A 2F7SA 1EESA 1JXOA 2P6NA 1KNXA 4N1AA 4EJSB 4PPQA 1EFCA 5DI3B 2FPMA 1H8HD 4MDEA 3A8TA 3WYGA 2J46A 2BMEA 1GL9B 1GIAA 1Z0AA 2ZPTX 3GJ0A 3QBVA 4KV9A 4PO9A 1U99A 1CRQA 2QTVB 4D80A 2REXB 2GJAA 2GF0A 3DKPA 3GJ6A 2PT5A 3GEEA 2ZJYA 3CKLA 2VSOA 3Q72A 2WOJA 2FNAA 1KZGB 3MWYW 4JJZA 3OEHA 2RMKA 1NSFA 2XTMA 1GL7A 4CZ2A 1G3RA 4XVUA 4Q4LA 1GVNB 1AKYA 2DPXA 2CK3A 2NO9A 5FOVA 4D6PA 2HYDA 3WYAA 4B6FA 2C9YA 1OFUX 1KHTA 2ANBA 2C04A 3IO3A 3MMPA 5CIWA 3BGWA 3CRVA 5IK2D 2O52A 3K09C 2YWEA 2ANCA 4JYCA 4MUAA 2IXEA 3GLGE 1P7CA 3WNBA 1E2PA 1VG0B 2YNMA 1LY1A 2ODEA 2C2HA 3SE0A 2WMOB 3R7WB 4W7SA 4Q9IA 1UJ2A 3BD9A 1BKDR 1PUJA 3TK1A 4C0AC 1R8QA 4PO1A 2N1BA 4Q1DA 2Q9AA 3BB3A 3LBHA 5KPJA 5KHOC 2O8EA 4NTZA 3KDSE 2WIAA 4FD2A 4DCUA 2IWHA 1TX4B 5FOWA 4WXPA 3UKDA 2PCJA 3GCGA 2O8DB 4AKGA 1UAAA 5L3VA 5FTNA 2ODBA 2ZUDA 2ZRJA 4Y0VA 3EPKA 1ZCBA 5FUWA 1D2EA 1R5BA 2EWVA 5AUQA 2KE5A 4XVRA 2LWIA 1TUEA 2A78A 1AA9A 4M1SA 1U81A 1W49A 4LK2A 2J41A 2NO0A 3SNHA 4DEXA 3AVQA 2WBLC 3MWKA 1SXJE 3NDBB 3AVVA 4LJ9A 4FCTA 4UXHA 3WNDA 4FMCF 2WWFA 3KTAA 2ZE7A 2OILA 3H1TA 2GK6A 4Q7MB 4Q4HB 3TQFA 2IA5A 3AF4A 4M22A 1BH2A 1E98A 5KTYA 5BN3A 2YINC 4TSFD 1AJEA 3FHTA 4AG5A 3U3MA 3EZ9A 3KX2A 3W8NA 3WBKA 3KKOA 2IF0A 5FBLB 4LUCA 2MSEB 3EIEA 1IHUA 1KO5A 1AS3A 5JHGB 3BH7A 1DS6A 4L15A 3C8UA 5F2EA 5E7IA 3W5JA 4EAQA 4TYNA 4JSYA 1RPZA 4GMXA 5HKKD 3CONA 4OHXA 3PVSA 3B7GA 1D8TA 1X8JA 3NH6A 2VA8A 2OAP1 4HI0E 5JEEA 1Z28A 3MSXA 1NVXQ 3TUZC 4OHVA 3ZS8A 1WE2A 1ZIPA 3PFIA 5HCIA 2AR7A 1YRAA 4NCHA 4LRWA 3MWLA 1KIMA 1T8TA 3W8RA 3KXKA 3D3QA 2IS6A 5DYIA 4QGFA 4EPTA 3BERA 3LBNA 4RD4A 2Z4SA 4DB4A 1N6RA 1MKYA 1TEXA 4KO8A 3QXXA 1N5KA 4Z8YA 4F4JA 1KO8A 2ATVA 2WJJA 2XNDA 4U5XA 2X1VA 3Q9LA 1XD8A 3SBEA 4NMMA 5L3SB 4C3ZA 1P9WA 4II7A 2EYUA 5FL7D 3SJBA 1J70A 2HYIC 3BWDD 1D2MA 1NN3A 1Q3TA 2JDID 2VSFA 2X2FA 4RY2A 1OFIA 2QNRA 2RGAA 1UBFA 2IYUA 1W46A 4Q48A 1OJLA 2Z0MA 4ZIRA 1JNYA 2GK7A 2R9VA 1XMIA 3LWNA 3I8XA 2GJKA 1GP2A 1QVAA 1E1QA 2CBZA 1J99A 2ZI4A 5EXXA 3VX3A 2AFHE 4IRUB 1E9DA 1G17A 4OQLA 3KUCA 4AY2A 1G3IA 2KBFA 3KXLA 2Q3HA 1T8UA 3MFYA 1R4AA 2NG1A 5IF9A 4F7WA 1OH6A 4EPYA 2IBMA 2RGEA 2PT7A 3TMKA 2HDNB 3RANA 5A4JA 4YXWA 1U8ZA 1CP2A 2ORWA 3HYRA 4HZIA 1QF9A 5C46F 2O8BA 3TUJC 1Z6XA 3K70B 1YHNA 4BASA 1DARA 2J9RA 3L8ZA 1XPRA 2NMVA 3X1ZA 4ARZA 3ZQ6A 4R71A 3QXSA 2GILA 1WBDA 2ZRPA 4PPGA 2GWHA 1UKZA 4Q02A 1P2UA 1W2GA 1P5ZB 1GWNA 3PQCA 3DDCA 3NH9A 3MAAC 1VPLA 4NH0A 5HCNA 4HUTA 4E5UA 4PQRA 3TSOA 3N5CA 2ZSEA 1OIXA 4JS0A 5JS7A 1HE1C 2NO7A 2WSMA 2V7QD 2QM7A 1TF2A 2ERXA 4KU4A 4AKEA 3VMFA 4MRVA 4KFUA 3WHKA 1FP7A 3VQTA 2D74A 3TSWA 1Z5ZA 2XSZD 1LV7A 4TMVA 2ZEJA 1KI1A 4GFDA 2QTFA 1XEXA 4P0TA 3SU8A 1VTKA 4Z1MD 2GCNA 1DOAA 4IHQA 4TLCA 1OXTA 3P32A 2HUPA 2Q9CA 2C96A 3FHOA 4EQ6B 1OIWA 2FX3A 4PHHA 5HR5A 2GA8A 3WYFA 4JKYA 2VRWA 4HLCA 2FPKA 5BWMA 3QJYA 2W2TA 4PZLA 1Y63A 3ZD7A 1R0XA 3CNOA 2WHXA 1A5TA 4R9UC 1DAHA 4URXR 3W6PA 1II8B 2ZSFA 2ORVA 3CB4A 4MKHA 1CF4A 4U7DA 1MRSA 2WJGA 1OKKA 2XITA 4O2RA 1E6CA 1GITA 3M6AA 2AL7A 5KOYA 2PH1A 4A2QA 2BJWA 3ZJYA 3A4MA 4ON9A 3GLHA 4B2LA 4AD8A 1G41A 1NP6A 3AVTA 1XEWX 4FMCB 3SJZA 1QHIA 1XTQA 2W58A 3CF0A 5FUXA 2QMHA 3N2EA 2F9LA 2ZUBA 4W5HA 1F2UB 1NSTA 1EX6A 3VHXA 1IAQA 4TYQA 3BORA 1E3MA 1U9IC 1GRQA 1UKEA 4LBVA 2WWWA 4TLBA 3JZAA 5EUQB 4D4JA 1XTRA 2D7DA 2SHKA 2CMKA 2OBMA 2CVFA 3QQ5A 4PFSA 4Q66C 4UNQA 4Q9LA 1OIVA 2XTZA 1Z63A 2V6JA 3BH0A 4Q1CA 4O0MA 5JS8A 1IONA 2GCPA 1K5GA 4DEYA 3IEUA 1LF5A 2J7PA 3I3SR 2HF9A 1I4TD 1L4UA 4JLAA 4QGGA 3SYNA 3AKYA 3RHFA 1EFRA 2ZS9A 5FH9A 1RJ9A 3W6NA 2C9CA 1WCV1 3TIFA 1NLFA 2E9SA 4CT4B 2NQ2C 1Q3HA 3KQHA 1OLOA 4U00A 4XJXA 1G18A 1JR3E 1Z0FA 3I73A 3QEOA 3S1AB 1YR9A 1N0VC 1NMXA 1UM8A 2IYQA 5CIQA 2ZAMA 1XWIA 2VQSA 5EUMA 4D81A 1MO5A 221PA 4MRPA 2YC2C 4TL6A 2GTPA 2ZUCA 1S3GA 5J40A 3PXGA 3WY9A 1VHTA 4BZPA 3WMEA 4UXIA 3QKTA 3WBJA 5KDOA 2GXQA 4LX0A 4F92B 2ZRCA 1A2BA 3NBYC 1SXJA 4V0OA 1DG1G 3OIUA 1P61B 1XMSA 1TEVA 2OT3B 3P20A 4V0ME 3SEAA 3VR4A 1Z0IA 4ESHA 3T61A 2ZREA 4MGYR 5GJCA 5TXGA 3DZ8A 4LOAA 4R98A 2WSSA 5C4GB 3E1SA 4ZI3A 1GNQA 1SXJC 2V7QA 3K53A 3TVDA 2GXAA 2GXUA 2WJVA 4HAUA 3U2QA 4I99A 4M1WA 1Q22A 2X2EA 3CPEA 3QUSA 4TTRA 4YMVA 1DE0A 1US8B 2JA1A 5A5GA 4URUR 2HV8A 3SR0A 4US2R 4M1OA 2B21A 4GZMA 4ITRC 1VYTA 3AVYA 3ADKA 121PA 3A4LA 3Q8XB 2NZJA 3CM0A 3R8CA 3TSZA 4BLTA 4DT1B 2VP6A 1NVVQ 1L7VC 1W44A 1G291 2QRNA 5FBQB 4D0GA 2CNWA 1S9HA 1KSGA 1OH5A 1YR8A 1LTQA 1RFLA 5SZHB 2A2ZA 2OSBA 2PEZA 3N70A 1RVDA 1HEIA 2J0VA 4Q47A 4DDTA 1JEDA 2F43B 5H1YA 2QBYA 5LB4A 1K5DA 1E69A 5BYKA 1P2VA 2JATA 4B74A 3RVBA 1EWRA 4HDCA 1VCOA 1KI6B 1CJKC 4RSGA 5CB6A 3ADCA 4Z8XA 5E7MA 2QM8A 1CJTC 2JGNA 1J7KA 3OEED 4M1KA 1RIFA 1W2HA 2QSZA 2E1RA 1OH7A 3QF4B 4KFSA 2PLRA 4D0LB 1UBCA 1QHHA 4Q5IA 4DLWA 1KI8A 2ODNA 2VBCA 3LVRE 1PLJA 1JALA 3B60A 4CEJB 1Z0KA 2CL7X 2WV9A 4HB3A 2V4ZA 3O8BA 2QEQA 2O0HA 1XJQA 4Q7LA 4RD2A 4YQFA 3T34A 2QTHA 2GZAA 3CUEF 4ILEA 5D3MA 3TBKA 2IF2A 2DFLA 5TV2A 3AUXA 4PR0A 1SKYB 4PAOA 1E2JA 2FZLA 2G0NA 3B13B 4QBGB 3THOA 4IEIA 4QOSA 3W90A 4FN5A 2H57A 4NCNA 3LY5A 2W6JA 2H7VA 5F9FA 2J0QA 5FOSA 3CWZA 1NG1A 1FQJA 3EXAA 4UKDA 3PCRB 4NP6A 5KNCA 4GT1A 2ZSBA 3CPJB 2B8TA 2PZGA 1MO4A 4PO8A 2C95A 1UKYA 3GJ4A 1VHLA 3SDZA 2DWOA 1FZQA 2JJ2D 4XWOA 4QG7A 2GEVA 2ZVQX 2G9NA 3WXMA 3OFND 2W83A 1CRPA 4GRAA 2EFDB 3I32A 3HPQA 4QJ4A 3P4YA 2HCBA 2QE7A 5AUOB 2GCOA 4FINA 2JLUA 3GLFE 2ZRIA 2O8CA 1RRFA 4KODA 4KVGA 1U98A 1V5WA 1VCIA 1NLYA 4TLEA 4GDFA 1T5LA 3RRMA 5JWRA 4KJZA 4P4TA 1RYFA 1XNJA 4LJAA 1FX0A 1G8YA 3CH5A 1ZU4A 1RZ3A 1NBME 1JAIA 2ZJOA 2C03A 3CX8A 3FWYA 3LA6A 3SFZA 2ZJAA 4PHGA 4AKIA 2FSGA 1BYIA 1T3LA 3LRPA 3V9PA 1SKYE 4WZBE 1K8RA 3F3YA 3KKPA 3CH4B 3QVUA 5FUYA 4CT5A 5LD2B 4YDSA 1J8MF 3H0KA 4PSVA 1NL3A 3O8DA 4HLQB 1CJUC 4M1MA 1IY2A 4LJ8A 4AYXA 2J59A 4WVFA 2HLDD 4LHZA 1N5JA 3BE4A 4YMUA 5GJWC 5KSOA 2MSCB 1KNQA 4MRNA 2GAOA 3PV0A 1GRRA 4E03A 1YZLA 5E4FA 3GJXC 2JLSA 1II0A 3KQLA 3BC1A 5FTLA 2A5JA 4A0FA 4QHSA 4FCWA 1JEEA 3LX5A 5SZKB 2FEMA 3T06B 1P9NA 1R2QA 2GEUA 4K46A 3ZZ0A 5BN4A 1II9A 4M4SA 1M74A 2A9KA 1D6JA 3L0PA 2XB2A 5EE0A 1YZQA 2GJ9A 2KB0A 1KZ7B 3PEVA 4QL3A 3NKVA 3IKJA 4BFXA 4A1FA 4EFMA 3IHLA 1VG9B 3NC1C 2BC9A 1XEWY 3DEFA 2OFOA 4TL9A 5B30A 5JI2E 3LQQA 2Q6TA 3AVWA 1ZJ6A 1W0KA 2WAXA 2VH5R 1EWQA 5P21A 3OEHD 1GM5A 1XTSA 5C18A 1UFQA 3RS7A 3PEWA 1NJGA 2CL0X 1OXXK 1RE0A 1WF3A 3PUVA 4HB2A 4Q00A 2CK3D 2ZETA 4A4DA 5FPTA 3THWA 1IJFA 2WICA 4IDPA 4Q9JA 3GLIA 2AXNA 2WWIA 3R9XA 1YZGA 1N5LA 2K5UA 1S9DA 1TADA 1YZKA 3KFVA 2AFIE 5HE9A 3U4QB 6Q21A 5JEDA 4AURA 3U44B 3ZD6A 3AP3A 4O3MA 5KYKA 4A2PA 5M04A 2OCPA 1JXMA 2CE2X 3CR7A 3IO5A 2WIBA 1T4GA 3CR8A 4IDOA 2PJRA 4TLDA 1I4DD 3EZ7A 1BYUA 2QAGB 2YV5A 4MGZR 1JR3A 4PC3A 1GNRA 2CCJA 1ZYUA 2OZEA 3BH6A 3QXCA 4RD1A 3K0AB 1UPTA 3KQKA 3QKSA 2OFWA 3ZYCA 5JHHB 5CDFE 4EPVA 4TYWA 4EPRA 4A92A 1FUKA 1LS1A 4CEIB 3DMNA 2Z4RA 1XDBA 3PENA 3VR3A 2VPPA 1OB2A 3K8YA 4AIIA 4OQFA 1XTJA 3GFTA 3DHWC 2J0UB 4AYWA 4DCTA 1D5CA 2BMFA 3QXHA 4XSHA 5JWOA 3U7HB 2ZRDA 4P4SA 5JSZB 3AKDA 4UJ3A 3QI2A 5JWHA 3BS4A 3T12A 4TMTA 5AJWA 3TUIC 1UKVY 2RHDA 5DHAA 3UPUA 1F2TB 4GOKA 1EFTA 5FPKA 4B3CA 4KVAA 2DY1A 4DHEA 4KXFB 4B6EA 1TU4A 3B6EA 2ZU6A 3E70C 4M9SA 4YMWA 3GP8A 1JPNA 3HYTA 1NN0A 1E4VA 4XWKA 1Q20A 4HZUB 2IWRA 1GTVA 4W9MC 3DM5A 1G19A 2C98A 3MWJA 4ZDWA 2HEIA 4W5JA 4C30A 3GQBA 1P75A 2GHIA 5IRCD 3ZIAA 2YJTD 4I1SA 3TR0A 3EWSA 4KYIB 5L8VA 1ZM3A 5FI0B 2VSXA 1NKSA 2FV8A 3HDTA 5J4HA 2R62A 5AUPB 5KNBA 4HUQB 4PQFA 4RCYA 5KSZA 3LQRA 2ZJZA 2B7CA 1ZIOA 5A0FA 2ZRGA 1KKMA 2HJGA 3EIQA 4LSGA 1RRGA 5EE1A 1OB5A 4DKXA 4ZDIA 4JBYA 4RVCA 2REOA 1ZD9A 4P33A 1KMHA 1G64A 4B43A 4CW7A 1NMYA 1E2DA 4YMTA 2J7KA 2ZJ5A 2GVDC 4PX9A 1UBGA 2EFGA 5EP1A 4BLOA 4M9QA 1ETUA 4ZCLA 3PIRA 4V0NA 4URWR 1GDDA 3UIEA 1ZD1A 2XNDD 3VU9B 1M1YE 1XTIA 1M6NA 2WWYA 5H8WA 1G7CA 3QNUA 2AKAB 3RS3A 4NYIQ 4C4PA 1IXSB 4JLKA 2G3YA 3K09A 1QVRA 4PAQA 4OI1A 3FMOB 2WZQA 2WKQA 3FKSA 1QDEA 2ZI5A 2ZRNA 4Q1FA 5FBWB 3WRXC 2DR3A 4DDVA 4OK3A 4LJ6A 5J4KA 3AP2A 4A36A 1R5NA 2CXXA 2DWQA 2IYXA 3EAQA 4I1UA 4UNSA 3NVAA 1ZNWA 1CEEA 1XZPA 2C78A 2UZIR 2PEYA 1KO4A 2I3BA 1E1QD 4IFEA 621PA 2QP4A 1WDTA 1G6OA 2D2FA 1WA5A 2HT1A 1RW4A 3B2EA 1XEFA 4ZDKA 2ZJ8A 1E9CA 1Q57A 3M4YA 1N5IA 1G4AE 2BEKA 1G1MA 4OI0A 3ZGXA 1E1RA 1C1YA 2QMEA 3R20A 1Z6GA 4J0QA 3K9LA 3AF2A 1XFAA 2BJVA 2R6DA 3KKMA 5G53C 4MKGA 3L8YA 4YXWD 2V8OA 1BIFA 4U02A 1QRAA 3DMDA 1NIJA 4DZZA 4LJ5A 5EE3A 1H8EA 3REGA 2WWXA 2GBLA 1XD9A 1CR4A 1EK0A 1DTSA 3KQNA 3GLFA 1T0JB 4GMDA 1NIPA 4UQOA 3THYB 1QHSA 2KWIA 2QROA 2ZS8A 5HPYB 1B23P 3K0FA 2BM0A 1FP6A 2F1RA 3K0CA 4QBHA 2AHOA 2GBLC 4TMKA 1JI0A 1N0UA 1PZNA 3NDPA 2D7CA 2ZI6A 3CX7A 4I1OA 4ERNA 1VG1A 4EDHA 3CZPA 2X8AA 3CIOA 3K0CC 4TMWA 4O25A 1AS2A 3C15C 3C5HA 3T1OA 1KDRA 2GXSA 2QQ0A 2R65A 3QENA 5BW8A 3HJNA 3GJ7A 4OQXA 3X1YA 4ASUA 3EASA 1KYIA 2D4HA 3R8FA 5KDDA 3RWMB 4WZ6A 2FN4A 1F60A 2D62A 4JSTA 2BV3A 2ZYUX 3SJCA 3OE7A 2P3SA 1VKJA 4A0RA 1P4SA 3FKQA 1G7TA 4CVNA 4GOJA 3H4MA 1ODFA 1SVWA 1DAGA 1E0KA 4QM7A 4PPFA 3BFKA 2ORIA 1JPJA 3FOZA 3PITA 1IBRA 2FMXA 3IDQA 1FTNA 5DGXA 1OKKD 2XNSA 4RZXA 4RFSA 3TW8B 3AM1A 2LCFA 4JLVA 3ZH9B 1XZQA 2C5LA 2XOKA 3LLUA 3TR5A 4QJ3A 1A4RA 2O0JA 1W4CA 5FTJA 2HF8A 2QMOA 3TH5A 2FE4A 3AH8A 1M7BA 1XF9A 1S3SA 1XXHA 1AGPA 3EG5A 1OFTA 4Y0AA 2KSQA 3U7GA 4BLRA 2CJWB 1OXSC 1VIYA 4C0QC 1P9RA 2F9MA 1G7RA 1W7AA 1GKYA 2JEOA 2JASA 2I1QA 2OHFA 2C99A 4NL4H 3UWKA 1E9RA 1HY3A 1NMZA 4G5OA 4L8GA 2QT1A 3FE2A 5LPNA 1MO6A 5LD2C 2J7PD 2UVQA 1W5SA 5EJEA 1Z83A 1R10A 5TMPA 4PSAA 2W6IA 3FVQA 1DAIA 2AXPA 5AJZA 4HB4A 1DELA 1W5TA 1AZSC 1EFRD 4JKIA 4Q4AA 4UNNA 1SZPA 2OCAA 4KLZA 5AJYA 1KGDA 3E5HA 2XGJA 2E87A 3PG5A 4DLSA 3W9YA 4BRWA 2ZQ5A 1VCNA 3OHMA 3ZVRA 4HEJA 2Q3MA 2RH5A 2PBRA 4B71A 3G0HA 1JJ7A 3D31A 1LW7A 3AVPA 1GKUB 1M7HA 4JLDA 5H68A 4N0DA 4PC7A 3THXB 4K81B 2GF9A 5J47A 4YMSA 2RAPA 5JBQA 2J5XA 4D2IA 3CRW1 1G20E 1HE8B 1Q1QA 1IQPA 1J90A 3PEUA 4RFVA 3IGFA 4QNRA 1TQ2A 3SN6A 3VKWA 1SXJD 1E9EA 3LFUA 1TPZA 4CIDA 2QN6A 4D4MA 3KKQA 4JBWA 3IBGA 1QG2A 4PC6A 2GNOA 4C7OB 4I81A 2WTUA 3F5FA 2WSSD 1TF7A 2ZITA 4NKRA 1JBKA 1TL7C 1Z06A 1TMKA 3KXIA 2WOOA 1X86B 8OHMA 4HDOB 3EPJA 1P3JA 2ONJA 3C41J 2ZR0A 2ATXA 1MABB 2ZI9A 1W36C 5KSPA 1OV4A 1FQKA 2EU8A 2NPIA 3FTQA 1HV8A 2PX0A 4NYJQ 4OQMA 4OK6A 4OYHA 2JLVA 1XBTA 4LDJA 4TYPA 1N6IA 2CNWD 2Q0HA 1CTQA 2VHCA 2ZS7A 5L3QA 2CCKA 4A6PA 1IN7A 4QFMA 1SVMA 2IEYA 4LYJA 4BEJA 1G7SA 4R7ZA 1GOTA 4ZCMA 3NBFA 1HURA 5ANRB 2FFBA 2W2VA 4JT4A 4G0NA 1ZUIA 1YQTA 3NBZC 1FW6A 4BFUA 1KJZA 1U9IA 1HUQA 2UZ3A 4NCIA 4A8JB 2Q9BA 3QPWA 1CXZA 4BLQA 2GESA 4BFVA 4D0NA 4KBFA 1SQ5A 4Q4JA 2RHMA 4WBSA 3VTKA 2CHGA 4TT3A 3KJHA 3KL4A 4NZYA 5DIFA 4BFZA 4PQYA 3A1TA 2QUZA 2O8FA 2QT0A 1ZINA 4LGMA 4C0BA 2GDJA 2F1IA 3TLXA 4B3FX 1COWA 1VECA 4Q1EA 4IOJA 1XJ0A 3KKNA 3PR1A 3TW4A 5DO9A 4BFWA 3QKRA 3LH5A 4PC2A 2IS2A 2JJ1A 3GLGA 1JB1A 2W6JD 4BFTA 4B44A 1ZUHA 5EXTA 5FTMA 1N6NA 3U3OA 1XB2A 2FZ4A 4IXMA 2H17A 4WA7A 5JFGA 4L4UA 3ETLA 1S96A 1U90A 4WW0A 3UWOA 1ZM9A 3ICEA 5BQ5A 3O8CA 3EA0A 3K9NA 4QC2A 1P6XA 4DXAA 1MO3A 2QQEA 3QVVA 3R9WA 1DO0A 1XD2A 3GEHA 3T15A 4QXAA 2H16A 3QSYA 1WB9A 1NVVR 4EJSA 4WIAA 1T3HA 5DI3A 2ZE8A 2QZ4A 2A5YB 2QE7D 3CO5A 4Q18A 5G3YA 2ZROA 3C4JA 4FWIB 1NJFA 2RB4A 4CEHB 1AQYA 2PJZA 3D7MA 4EJSC 3MG9A 1FOEB 1G8PA 4RZ2A 1U8YA 3HU3A 4L5BA 3ZDQA 4B73A 1JECA 2WKPA 1DVRA 4RJLA 4DLYA 4GNKA 4X8OA 1JAHA 4G5GA 2HCJB 3U60B 1N3BA 2EFHB 3KUDA 3QPUA 1DO2A 5KDLA 1KDOA 5K8TA 2QP9X 3A36A 4DSTA 1GKIA 2PZFA 3WP1B 2V1XA 2WJIA 1LB1B 3EC1A 4ZCIA 5HTKA 3FHCB 2LKDA 1E9FA 1XTKA 3B78A 1E79A 3R7WA 4DIDA 1Z3IX 2WAYA 1WP9A 4FIDA 1P2TA 4LHYA 4NONA 4A2WA 4DC9A 4P3YA 4LPKA 4GP6A 4KYUA 3X2SA 1W0JA 4IDNA 1SVIA 4LHVA 1WBBA 2CL6X 2FF7A 2JIZA 1N25A 2H18A 2O8DA 1E4YA 1N0WA 1IJEA 2AX4A 2FU5C 4DLUA 4PTLA 4BFSA 1ZU5A 3MUFA 4IVPA 721PA 2NOAA 4LJYA
chains in the Genus database with same CATH superfamily
3DL0A 1OD6A 1Q0PA 1J09A 2YIVX 2FN9A 1TT5A 2W37A 3PHCA 4LHWA 3ZDFA 5KYYB 2I6FA 1QUFA 3A1VA 1QV7A 1VHDA 5EMNA 3NBUA 5CB8A 2GJ8A 4OJTA 1GPH1 1DKRA 1U5CA 2GB4A 3AILA 2CDNA 4YYZA 1XRJA 4QYWA 3UK6A 3I62A 1I6LA 3AINA 4OU4A 3MB5A 3HKBA 3PDJA 4EY3A 5FOXA 5FWXB 3K0SA 3NDRA 5F4BA 4DOMA 5ELXA 3UW1A 1FXWA 1R12A 4BO2A 1PNRA 1OC2A 4TV8B 3M6MD 2EJVA 1TUGA 3E7DA 3HBFA 4MKIA 2O8EB 3VI4B 1YA4A 5FAKA 4Q4HA 3B1ZA 4WDRA 3SAJA 3FZEA 1N5DA 2GKSA 2WUVA 3OT1A 2Q8NA 4ZCQA 2JLYA 3DVLA 3KDPA 2DBRA 3H6HA 2V9PA 4R2JA 1XLWA 5JCPA 6ABPA 3ZY4A 1Z39A 2PPLA 3AV0B 1RWBA 2BFCA 4E5NA 4CQNA 1QYRA 1DI0A 3DONA 3SS9X 4QJIA 5KNDH 1DEXA 3WAGA 2JK1A 1Y4UA 2XUKA 1ADCA 1L0BA 1ZCAA 1H42A 2DM6A 2BGLA 1Z7BA 1UC8A 3KAJA 4MWBA 3ZV6A 1AO0A 1D0SA 3HKCA 1W85A 1Z0ZA 4WEQA 2J3HA 2P9BA 3KE8A 4HQKA 1NW6A 5BXYA 3MIZA 2PV7A 5B2EA 3HL0A 2QX8A 5TMBA 1HFJA 1YGYA 3HJUA 3MK31 3U4HA 1I3CA 5AKHA 4H17A 2JJYA 3OZDA 2IFTA 4ZRNA 2FHPA 1IU9A 2C83A 4ZOLF 2B4RO 5DB4A 4ZMSA 4QDTA 1OLUB 3W2EA 3ZGYA 2C7OA 4M2LA 4Q1BA 3RREA 2G1JA 5AVJA 3K94A 3H0CA 5K4AA 1QWSA 4G4SO 3VR3D 5GVSA 1FYFA 4YFYA 5AK4A 1SCUB 4F9EA 5LP6A 4LQDA 4OYYA 4IIGA 4LXQA 1OLXA 2Q99A 3EZ6A 2FK8A 2X5NA 4GEKA 4ROSA 2J5QA 1NVGA 4RD0A 1N92A 3CNNA 2HQSA 2F64A 4S35A 1FVXA 1G20A 1G8HA 2UKDA 4JJEA 1MOPA 3OUUA 3QBTA 4TQGA 2L17A 1UDCA 3EGXA 4PTYA 3BTOA 3SYLA 1UBSB 3OPQA 4B6JA 4BECA 4ND3A 5LP6C 5SY4A 4EPWA 2W0MA 2P5SA 1Y7PA 2ASVA 3I92A 4L4ZA 4XR9A 4ECAA 1PGOA 1A5SB 2RHHA 1DB3A 3HN7A 4FZJA 4JL6A 5EPOA 1YK0A 3GZTB 1D1QA 3I2IA 4L0MA 5DGTA 1TQ6A 3LYLA 4OQQA 1PLKA 2A1UB 2YJ5A 2X8JA 2RFLA 4N8DA 4H7EA 4ZPXA 3ZWVA 1LQ2A 1TNDA 2VJMA 4KLRA 1IK4A 5HIJA 3GK3A 5GZ1A 3UOGA 2AJBA 4Q9NA 1EWVA 1ACJA 3M5PA 2YOHA 5FTKA 1VCMA 4BKMA 3B5JA 1ZM4A 3O8QA 5DULA 3L0CA 5JRJA 4D5GA 1H2WA 2WJPA 1CQIA 1MB9A 1NBOA 1GGNA 2D2EA 1U8UA 1XZ8A 2CN1A 3IAS1 4PG5A 3RSFA 3T8YA 1SA0B 2WKWA 4HNRA 1Y7TA 4NZMA 4FWTA 3N76A 3H8VA 1HT2E 1Q1BA 2AVDA 3ZU4A 3KD2A 1O96A 1QRRA 4F4IA 3ZVMA 3ZV7A 3D2BA 2R8PA 4P4UA 1XQ6A 2QYOA 3AIIA 3H3FA 4ILKA 1ZR4A 1D2NA 1C29B 3QG1A 3NWBA 2WFLA 4NQZA 1YF3A 2DTEA 4DUGA 2KBEA 4G24A 1DCMA 1G60A 1XKLA 2XR1A 2F2TA 4MQLA 3V00A 1W4BA 4AF8A 5JYDA 1DAMA 1WRBA 3LUPA 4N9QA 4S0XA 3TS1A 2WC1A 4G09A 2XZPA 3LE8A 3D4BA 3R7NA 1X14A 4IKPA 2WI8A 3TZKA 3PEYA 1FRVA 1M6YA 1RWWA 3K70C 3BGDA 3SC4A 2BZ1A 1Z6ZA 1N6KA 3IIKA 1BXZA 1WHSB 2C61A 3HKEB 1SCKA 4IINA 3ZZTA 4BNUA 3WX0A 4QM6A 4FS3A 4M1ZA 4ENWA 3DT8A 4HLDA 1Y8AA 1KBQA 3EE6A 4G5SA 3G8AA 2ZAOA 5CW1A 2VT6A 3DBLB 3FKSD 5BW5A 3U6KA 4LXGA 4C0LA 2HR1A 3N7UA 2OVBA 5DHPA 4U7WA 3E23A 3H7AA 1VYVA 5THKA 1KRHA 3L79A 2R60A 1G9XA 1SOVA 1QV9A 1WDLA 2FUKA 4Z54A 6PFKA 1VL1A 2XDQB 1C1DA 3AWIA 2HMWA 2XADA 5I4CA 3BWXA 3N8KA 4M1TA 1GGEA 3F9RA 1T9DA 5ALIA 2ZRFA 1N9KA 3C2QA 4HFJA 3FBWA 4NU0A 5TB5A 4KX3A 1NUHA 3WZMA 5JYCA 2YFQA 4XAQA 4B3TB 3AVXA 3DA8A 4F2HA 4HF7A 4HH3C 4AWXA 1F7VA 1AKWA 4DCMA 3GZNB 4DLPA 2CE7A 2XLCA 5IZCA 4FFWA 3FLEA 4F6RA 4KPGA 1TKCA 4NOMA 4WI1A 3VHRA 4IOKA 2J45A 4GOMD 1ZVKA 1P4AA 1W96A 4OA8A 5KYWA 2WUDA 2P5TB 2WR8A 4I0WB 4P3KA 1SULA 3E7WA 3GAFA 3JTEA 4XEUA 3RUCA 3RS5A 3TR6A 4BLVA 5JVDF 2W70A 1UXHA 2R1ZA 2I3AA 2OCIA 3GEIA 3L0SA 4E7OA 5IZCC 3OJ0A 2YVLA 3N8IA 5TDHA 1XTBA 4C01A 1UOPA 3BMCB 4MUGA 4WZAB 4MUYA 3L0DA 3MD0A 4EHFA 5JJLA 4CCAA 4WN3A 3SLKA 3R75A 3E9MA 4J6FA 3JALA 4YREA 3W78A 5A6SB 4RA6B 4FTWA 4B3BA 1M54A 2XF8A 4BUJA 2FCRA 4XOIA 4F2PA 1ZXBA 3DXYA 3JQ7A 2JFVA 4P0QB 4M36A 4YJFB 3T52A 3URKA 3G5UA 3L7DA 3C5VA 2BIFA 2VTVA 5B1IA 3FNBA 4RMIA 1SOMA 1JHOA 2FDCA 1UBMS 5BVHA 1C9EA 3AQ4A 1L1FA 3COSA 4CETA 3DZDA 1E1KA 4XDGA 1LKZA 1Z08A 5FNVA 3EFOB 2AS0A 4E07A 4IIEA 1R8JA 2DYKA 1OROA 2EYQA 2ONZA 1KOFA 4PG4A 1W34A 4TUYB 2OG2A 3WLIA 1YK1A 1KWGA 5K3DA 1OBVA 2JLXA 1P2FA 3DZJA 4IQFA 1EVIA 1JR4A 3VAAA 3WJ1A 1IY9A 5ALVA 3R5SA 4QUGA 1AGNA 1T15A 4NLLA 3ENKA 3IPYA 1KI7A 5C37A 3GLHB 3TGPA 2RGGA 4ZCSA 4EATA 3QY0A 1PN3A 4NSNA 1XNHA 2F3UA 4Z99A 4X20A 3RDPA 3K72B 3V8BA 5IFLA 1QRUA 3U5ZB 5LXTF 3QOFA 1GGHA 1MDBA 2P69A 2R2AA 1R18A 1IY1A 2VTKA 2DHDA 4O4JF 2JD2A 3NIBA 1RDFA 1F9AA 2CVHA 1KTVA 5LQRA 1MOSA 1WV0A 4BWVA 4P7KA 2YWGA 5EIBD 2H00A 2NXCA 1N7GA 3OCJA 4YAKA 2ZIVB 4WZAE 2OP0A 3EWIA 5JDIA 3ENNA 2PIDA 2Q3FA 2FEXA 4QVIA 2Z5FA 1Y6JA 3QV1A 4H77A 4OGGA 1E2GA 1NXVA 3LC0A 4QDUA 3RRFA 4PIMA 3M2PA 4IIDA 2XZLA 1NYTA 3NAQA 2VJYA 3ZCSA 1Y5LA 4PG7A 4IMPA 3RG8A 3ZHRA 1ZJ5A 5M2QA 1VE6A 4NRDA 3V5NA 4DY4A 4DA7A 3QMWA 5LQUA 2IH4A 1U2QA 1GCUA 1C5KA 3E2MA 3OUTA 4HAXA 3NFRA 5LR6A 2JKZA 4PPYA 1RP7A 3R0ZA 1YDFA 2IYVA 4FT2A 4D4LA 2Q2VA 2RGWA 2WT8A 5HF9A 5ISMA 5MN4A 4DCJA 3ZDEA 4I8XA 4MVJE 1DOZA 5HXAA 1KKLA 2X40A 4C0KA 3ND7A 2F3SA 4XIIA 3GLHE 4TXHA 4DT1A 3R7DA 1O4WA 3PGKA 3PNOA 4XJSA 1Q91A 1JDSA 3D2LA 4YQZA 4KWHA 1NLUA 2R5FA 1N6HA 4X3CA 1MG0A 1Q77A 4OFBA 2O1WA 2ZATA 5A9TA 1V43A 3FWNA 3WLRA 4UCWA 2NYVA 4POAA 3GOHA 4CCWA 5EFZA 2QUHA 1V39A 3PUYA 3QEMA 3ZVKA 5EJ7A 1EGHA 2PK3A 3KB2A 1Z25A 3MBKA 4Q1AA 1K7FB 1NOIA 1S4QA 1VA4A 4H1UA 3M9XA 5JRZA 1NDHA 2F43A 2WUWE 1PK7A 1YR7A 2D06A 1NQVA 1QHYA 1XALA 2IS1A 2QI9C 1SC9A 4NBVA 4RKFA 3GPLA 5BRAA 1E62A 1L7PA 3CG0A 2QN9A 1KI6A 5IVDA 1UZMA 1UXGA 3W3AH 3NBMA 2ZWMA 2JHFA 3ZS9A 4AJEA 4EMUA 1XWFA 2Z9BA 4ABYA 1YZUA 2FWMX 3PHBE 4CM4A 4D8XA 4WCFA 5BO5A 3TN7A 5JI3E 1DIOB 1NN1A 1DAEA 2EGGA 3ECAA 4OMUA 1KYZA 3UMFA 4TSRA 2O3QA 5TMEA 4RYDA 4DEVA 2Y3IA 1OT3A 3UMMA 1CD5A 1HZZA 2YWHA 2QXYA 2ZBUA 1LWOA 3DOEA 1ONPA 4H0FA 4H15A 4IDQA 4MQEB 4WCFC 1FFAA 3TAHA 3ICQB 3C3WA 3K5HA 1BXGB 1LSOA 1W36D 3GAMA 4N0EA 1Y3AA 4OMCA 3PFHA 5B12A 1ZC4A 4ND6A 1M33A 3DVSX 4Z4EA 2NTVA 3DLCA 1ONBA 3PQ7A 3A3YA 3HXMA 4H1VA 4KQKA 4AUMA 1NZFA 3GVPA 3STYA 4Z4CA 1HZZC 1YJQA 2QX7A 3BWMA 3IQWA 4EGFA 4P0PB 2OBNA 3B82A 1OU0A 3CS3A 4ZO4A 1X94A 3O3NB 5I9MA 3C5EA 4OCZA 4BAZA 3PUXA 2KHZA 2BEJA 1KK1A 2CUKA 4Q3KA 4ZHQA 3D3NA 1ZMBA 4QUKA 1H2EA 2GEJA 2WJ4A 2ZR7A 3D3EA 2Z8XA 5CNKA 2QRPA 4AMUA 3MJRA 3NHSA 3CH6A 3RARA 1WCIB 3FOBA 3GDGA 3G0GA 4QBIA 1ZI8A 4FILA 4CMHA 4ZGGA 4TS4A 3UQYS 4KR2A 2ZYRA 1OREA 2P68A 1DKOA 3FPHA 3OJWA 1JFSA 4FE3A 3PJEA 5L3RA 421PA 3LY7A 1PV1A 2W8BA 3MGAA 3LX8A 4XQCA 5D3MB 4F6CA 5LN1A 1BCSB 1ZIDA 2GZDA 5ELLA 4UTPA 3LYAA 3TZEA 4XVQA 3GWZA 3NDJA 1R4NB 3OPVA 4CUJA 2NO6A 1JKJA 1D8AA 3E22B 2VNKA 5EN4A 2VHUA 3PXXA 1NVUQ 2ZPAA 5FH9A 3PF9A 1ZD4A 3AB3A 3A1WA 1BMFA 2GPTA 1SEVA 1X13A 2QQFA 1FYWA 2EAUA 4BRSA 5EJ4A 4GPBA 3FPSA 1PG5A 3O21A 5KBYA 1VRWA 3PFFA 2QD3A 5KKAA 3ZBTA 4EHJA 4H7DA 4EB0A 1E63A 3BDIA 3ROGA 1EGAA 1OYWA 2NN3C 4L9SA 4A7PA 2FSFA 5BRJA 1RTKA 2GARA 2JIBA 1ISSA 4K86A 2IH5A 2A6PA 4OD0A 2OC9A 1CZOA 2IPAB 3SNKA 3GVIA 4ZYUA 1NVAA 2I7VA 3O8RA 4JQOA 4OXQA 3JQFA 1IN1A 4DIEA 4OGLA 4MI3A 4B47A 2Q1XA 3BWYA 4W7HA 5ECYA 3AVUA 2P6UA 3THSA 4E2ZA 5G4KB 2GCOB 5JD5A 4EGAA 2IHTA 4G6ZA 4K6KA 3KLPX 5G3ZA 3OZXA 1C4WA 4JBHA 1WF6A 2YHIB 3TD9A 1PQWA 1ABEA 3RE1A 4E08A 3JQFC 5LKRA 5CHYA 5K6TA 1A1SA 4JR0A 4Y8VA 2DQYA 2QYTA 5DGHA 2ZP1A 1NE7A 3KPYA 4JP2A 1ZGGA 4Q9HA 2P2ZA 2VPTA 3CXUA 3E35A 3FDXA 3W6ZA 1LPAB 3N0WA 3VHLB 3ICPA 3KVRA 1K7EB 1RWQA 2EV9A 4IMIB 4UARA 3LAWA 4KE8A 4Y1RB 1J0XO 1Q84A 4ZZ1A 5IN4A 1ZFNA 5REQB 2KLBA 5GADl 2VHYA 3CPHA 3KSDO 4LE2A 2QMUA 5CLLA 5CX4A 3ILYA 4NYJR 1RXUA 3O4JA 3L05A 3QMVA 3CISA 3R3ZA 5KPDA 1Y5RA 2A30A 1FMJA 2R6JA 3CLRD 5E2BA 3T35A 4URVR 3NHBA 4MW9A 4CG1A 4LYHA 1RJWA 4E5DA 2GAAA 3CUUA 2V59A 3LDHA 1EVLA 2VNSA 4O8ZA 4QQFA 4F0JA 5H80A 3TJMA 4DILA 5A9SA 2B94A 3OIVA 1CIJA 2H1LA 5D6NA 2DERA 2G6TA 4TZKA 4E0BA 2HRRA 2QRLA 1IXZA 3KJIA 4IG9A 5HILA 4JI7B 3K15A 3PEFA 5KHAA 2OECA 3EJ6A 3ITEA 5JS2A 3WO1A 2XODA 3SLRA 3HY6A 5KNCH 4X7MA 3LY8A 3TINA 3GWGA 1JFRA 4IOLA 4HJXA 2JJQA 4KR9A 1QPZA 4GQIA 5SZJA 2XXAA 2QLTA 2RHTA 3B52X 2R6FA 2JLQA 5BN4B 4Q0MA 5L4SA 1IDOA 3GRCA 4JYPA 4MUBA 2ZI7A 4MI1A 5AO9A 4BN4A 1A9YA 2W6CX 1UR5A 4X84A 1JIKA 1KDPA 1KI4A 2I5PO 3JQPA 3OLQA 4AK9A 3SVLA 1L5SA 4ARAA 3N87A 2FP3A 4CF6A 3U44A 1A27A 1V47A 3DVAA 1ENYA 2SKEA 2IYNA 4JUFA 4XTCS 1G4UR 3LHFA 1FDTA 3PWKA 4XGQA 1K89A 2R3SA 2DQ4A 3MTQA 1FJGB 2B8JA 2ZYAA 1GG2A 1Y4AE 4IUBS 1LPSA 5IT4A 5LOVF 4J3JA 1K98A 4KOEC 2C3UA 1Z6QA 4ZEXA 3FCUB 2HQ1A 4OSOA 5GM1A 3A27A 3HE3A 5KJ6A 2G0TA 4RXUA 4I4TB 1MAVA 4TSFA 5AOAA 4B2PA 4CEIA 2HM7A 4Z51A 1O6CA 2EDAA 3LQ2A 4QUEA 2WTMA 1E5TA 2BP7B 3W8FA 3I39X 1N57A 3VGJA 4P9NA 1GTZA 2OCXA 2M1XA 5DH9A 3WGQA 1WBJB 2MJLA 4Q3EA 4OP3A 3AM3A 5AKGA 4XPIB 2VAPA 2PS0A 4X1IA 2O57A 3UCFA 1A77A 5JPCA 3PCTA 3VU0A 5UKDA 1KO1A 3NMUF 3TG8A 4ZVTA 4AJ1A 2IUTA 2J4CA 2P9GA 3L7JA 1X8XA 1Y3BE 3L92A 3MHPA 3QTTA 1SCQA 1T4BA 2JFQA 4XD7D 2WRZA 2J3EA 2XRFA 3AR8A 2X1MA 5BSUA 5SY9A 1ZNZA 2NUTA 4WBNF 2H63A 1J7JA 4LYEA 3PQEA 2B1GA 1PBNA 3B89A 3JCZA 4HNAA 5B53A 3ZV3A 4DANA 1N32B 2VYND 1CUXA 5LJLA 2Z6UA 2CLHB 1EM6A 3BYZA 3D7SA 3B1FA 5C3UA 5BSEA 2AFRA 4FGLA 4TL8A 1RXEA 2C3MA 1LX7A 4M0EA 2WK1A 2IQIA 821PA 1K4KA 1YKSA 3ETHA 2G80A 4OQYA 4JI4B 2C54A 3CT6A 4M1YA 3NHKA 4NNJA 4P4SB 1DT3A 1SHUX 3FMFA 3D6JA 3G2JA 4HRAA 4ALIA 4QGAA 4DMRA 2PBLA 1E1NA 3UGTA 2OE2A 4RLQA 4D9KA 1ULTA 4PSUA 2AIRA 2NVOA 3H05A 4PYNA 1S2DA 4OJKA 4LZPA 2JDIA 2AF3C 2B2XA 4LG1A 4NAHA 5F33A 3QU5A 4NNPA 4MTLA 3ORYA 5A02A 4XYLA 1Z2OX 4J2TA 4MYTA 2YXNA 2H0RA 4IVQA 5DSXA 1CUEA 3A37A 2GN9A 3GCXA 1THMA 4OMDA 3X1DA 4EJFA 2BTOA 4D4GA 3T7AA 4YCDA 4JB0A 4KNWA 2B8WA 2ZRLA 3R77A 3DH0A 4MCIA 5I45A 3K6SA 2HIGA 2I62A 2CF5A 3KT8A 3GQBB 1E0SA 2ECKA 3RFFA 1UDXA 4DV2B 1KZ9A 1EGVB 1H1LB 1P8AA 1XNGA 2DUUA 3CR3C 4HX5A 1HI9A 5ADHA 3SQXA 1RXIA 1LTKA 2ERYA 4JVOA 1E94E 1WCWA 4ZU6X 4BB5A 4C0WA 4R40A 2C20A 4GIBA 3ND9A 1BEZA 3I5YA 1AKNA 3ESCA 2TMYA 2ZR9A 1R7RA 4RDXA 4F4CA 1ZH0A 1LS6A 4B4OA 2D1QA 5FEUA 1GL6A 2EC5A 4C20A 3LUFA 3JVIA 5ENDA 4AXXA 1TMOA 5LDGA 5CFRA 1JWAB 1DZ3A 1JLRA 1MT3A 3K9QO 4MUXA 3WP0A 5JISA 1DJMA 3VOBA 4QYSA 5JZ9A 4JLOA 4LCBA 2XEXA 3MJFA 2C8LA 1TQ8A 2F1OA 2CXUA 3PRYA 5EKTA 1M73E 3GLQA 3BE6A 3I30X 3IHTA 4D92A 2FJUA 1KQFA 4PSKA 3O3MB 4ZYYA 4LIPD 4S2EA 2O59A 2X0RA 4JVNA 3F6YA 2X0FA 1LEHA 4DIFA 5AK6A 1D03A 2H2WA 3DOCA 5SV2A 1HEUA 4L0DA 4NCKA 4BMNA 2JLAA 3HVUA 3A11A 4RCZA 1JU9A 1ZM2A 4HC4A 1JEQA 1GQYA 3DFFA 2FR8C 3KOWA 4CIBA 3BN3A 1KS9A 3EXEB 2AYYA 5ITZA 4C0SA 1BRTA 1LJ8A 3E5MA 1E7RA 2A5DA 3W6UA 4RF3A 3ESZA 2O2YA 1KP9A 4RXTA 2OZKA 4QRHA 3AKEA 3AETA 1X7HA 4Z0NA 4BB6A 4QATA 4EEKA 5K20A 3T9EA 1SBZA 4DCPA 2ECPA 3C7DB 2OHHA 4ZAYA 1NXSA 4KTTE 1CDZA 1L6IA 4Z1MA 3S2UA 3HXQA 1VIVA 2VLIA 3ZN2A 2K4MA 3IP3A 1KI3A 2TECE 3SKYA 1IZYA 4BCBA 1R16A 4US0R 5CDTA 2Z6VA 4RL4A 3F73A 3T3OA 5CCDA 2Q5CA 2YXPX 3AFNA 3TFWA 4FHDA 4DLRA 2XT0A 2DP4E 1W4LA 5KYVA 4Q21A 3L93A 2VJNA 1QXSA 1T6NA 2HDOA 3BFVA 3LBFA 4O4IF 2DR0A 3V6LA 3WICA 2ATIA 4DR7B 3C39A 3PC8A 5C7IO 3JAWA 3UCXA 3WWPA 1ISPA 4RZUA 3V4RA 2EKLA 3EFHA 1XRSB 4F84A 2R7AA 4IH9A 3RT1A 3BB1A 4B7AA 3I1YA 2IYFA 4KPUA 3J81A 2VT3A 2G71A 2UXCB 6AT1A 3EH1A 3OF2A 1LSSA 3TFQA 3UJ8A 3OLXA 3PC8C 4IYRA 3ABIA 4XZ3A 1UQTA 1SCJA 4BLUA 4BQOA 3GLFB 1X1RA 1QZXA 4ZVSA 1W94A 3RC8A 3H1EA 1H2FA 3IIMA 4W82A 3SXJA 4BO7A 3OKCA 1AXEA 2WHYA 4RTOA 3SQNA 1F1JA 2QGZA 2Z4TA 4BTLA 1QZUA 3AEZA 1FYEA 5AQ1A 5K3CA 3VZDA 4HYYA 3WSWA 1I3OA 5C1OA 1EGQA 2YOFA 4BLPA 5G0TA 2R5NA 1ZS9A 4ZEVA 2OEPA 1XVIA 2IXBA 2D0IA 5DN6D 2GEDA 1QG4A 2H8KA 1F1BA 3W2GA 2VO1A 4QYTA 4XH9B 3STWA 2VR1A 3LT2A 3IAHA 2ETXA 4BYGA 2D13A 2RK3A 3QE2A 2VTDA 2FZKA 1A7JA 1W87A 2GFQA 1E96A 5IWAB 4I50B 2HCTA 2CDBA 3MLBA 2EQBA 2ABWA 2FPSA 2C8VA 2P11A 1D1TA 3FSGA 1SCIA 2VSQA 1MO2A 1B00A 2P91A 1MXFA 1MW9X 1A3CA 4YRLA 3EZGA 5EJ2A 1R6AA 1XX6A 4ZAWA 5TNXA 1XCOA 2VYVD 1MX1A 4WY5A 2JFBA 1EFAA 4DLZA 3HYNA 4N40A 4QRIA 4NMXB 4MVJI 5HIMA 3ER6A 3RUDA 3PX2A 1IB6A 4RQBA 4B6RA 3MILA 1G5TA 2GLXA 3UJAA 3RAPR 2D5BA 1H65A 5F12A 3WHLA 1MLDA 2FMIA 1ZWKA 4NEGA 4EY6A 1A7KA 1XLVA 1M7GA 4YACA 2OBXA 5D5QA 1PSWA 3HU1A 1BGXT 4PYOA 3SSNA 3K0EA 5TX7A 4F60A 2JI8A 4FQ5A 2I7CA 3BOSA 1HKHA 3GMDA 3ZQ4A 4ZDJA 2WNSA 1CR0A 3WYDA 5DU2A 2FH5B 2R8RA 4NZOA 4PHCA 4D43A 3K71B 3UUEA 2OXCA 4OQZA 1TLLA 2H5EA 3U4GA 1ZNXA 3E3LA 3AG6A 2IV3A 5HF5A 3GFPA 2XZOA 1DTEA 3OLWA 3IILA 5AOBA 2RGBA 1FP4B 2IC5A 3U1BA 2UYCA 3A2LA 3CVUA 3DB2A 1Y7HA 3GIWA 1AHNA 3BA1A 1EG2A 1XJ5A 3NUZA 4QHTA 5A4IS 2QP3A 1G8FA 1OASA 1J56A 2HK9A 1G8GA 2R0QC 1YRYE 1FS6A 2XGOA 3N6RA 4G36A 2QVYX 3PRKE 4OB7A 3ZOKA 5ADUS 3CVYA 3U4MA 1QTNA 3NCHA 3NYIA 4KC0A 2HLHA 4EENA 4RK4A 4MV1A 3VU8A 3WLQA 1EJ0A 3UKOA 2G63A 1U0JA 2ZFUA 4IBOA 4UU1A 2IE0A 4X6YA 3FGNA 5LZ9A 1BEEA 4HVLA 2P67A 4V0QA 1AQNA 4XYBA 4L27A 5E0OA 3WLNA 2PIAA 3EIHA 4IF4A 3WB9A 4BAGA 3PK0A 2RGNA 5T5QA 4EO9A 2JLWA 3R9IA 5F9HA 4NZNA 4WXRA 4FLFA 4HAYA 2I8CA 1V3UA 1XJCA 1C8KA 2DBVO 5L6LB 4CN8A 2O5VA 2VBGA 5LA6B 3JAKB 3MGGA 4G26A 4K6FA 4U9HS 4F56A 5DHFA 4TTSA 1Y7IA 5KC8A 4QQRA 3P2JA 4N03A 2RGNC 5IM5A 2FPIA 2IHBA 1W19A 4R2WA 4ZI2A 4EITA 1QE5A 1NULA 5L4LA 1JA9A 1F6DA 2C9BA 1PP4A 4PEVA 3EVFA 5K6AC 4QGHA 4O6VA 1Z15A 3UYLA 4EUKA 2VP4A 3EYAA 5E4YA 3RYIA 4C4YA 3EW9A 1HNNA 3PUJA 4N47A 3OBIA 5FR1A 1J2EA 3OBBA 3SI7A 4PF1A 4FJ1A 1RSZA 5DIZA 4BKQA 2G88A 1I5EA 1V4NA 5EE9A 2INGX 1L5FA 3EN0A 5IC6A 4JYZA 4H9GA 5KQMA 2ADFA 3LPCA 1FDRA 3BF8A 3IDZA 3YASA 3SX4A 3S8MA 1T4CA 1TRHA 3OLZA 1P29A 4W8HA 3BSFA 3T1YB 3WQSB 5BP7A 1VI5A 2WP0A 2UUBB 1R0BA 2AG6A 2DBZA 3ML1A 4L8LA 3RVJA 2EKPA 1KYYA 2FN3A 5TJ9A 1WM1A 1HL7A 3E58A 3TCNA 3UMGA 4B76A 4GKVA 5LDHA 2QLBA 2W43A 3G9XA 5JMTA 5KYXB 1QGAA 2HWKA 1FFHA 3EWAA 3G5LA 4YC7A 2CLSA 4A8JA 4LFBB 3EXG1 4NF2A 1SBNE 5DBHX 1JIIA 4LRQA 2P1RA 2F17A 1TQDA 4H4DA 1M2NA 5B1YA 1Z22A 1NBMD 4GU5A 2B1IA 3A1EA 1NY6A 1DRKA 1S01A 4LJ7A 1YVDA 3VPAA 4Z4IA 3GPIA 1QGYA 4A8JC 2Z30A 2DJ5A 5F1PA 3WOHA 4BVGA 3HKDB 1TB4A 1ZICA 2G1KA 2GN1A 2C5EA 3QXGA 3N6XA 3RBZA 1Z7YA 4DLVA 1DQRA 4MWGA 2IU4A 3LDAA 5JZOA 1A5ZA 1LVUA 4FHCA 2CFTA 4MS4A 1J5XA 2F3TA 4JSRA 2LIPA 4G1UC 4G07A 3AX6A 1KJWA 1OZAA 5CK4A 5J9FA 4QBTA 3RUPA 3U7QA 2UUCB 4B3SB 1SK8A 2V9CA 1TO6A 2BFDA 2I2CA 4MW0A 1WUKS 2PUGA 4K6OA 1LLUA 1RPAA 2O0KA 1BX0A 3KYCA 1KY2A 2QVZX 2B3DA 3NIWA 2A14A 4MUMA 4I4LA 2ZYSA 3DV0B 4MI9A 5SY6A 3I6IA 3RB8A 3S68A 3TNDA 4Y7DA 3U61B 5HQ3A 4ZARA 3I9V6 5E6RA 4GRIA 3F4BA 1CU1A 2WSLA 4MHOA 4DMGA 3TDNA 1U9YA 2W11A 1U3TA 2O8FB 1WB4A 2D1YA 1VDZA 5DLYA 3C3XA 2IJGX 5CCEA 4CTKA 5BUCA 3GG9A 1RM4A 3NKLA 3OZVA 1FL9A 2AKYA 4JLJA 2BI4A 1G8SA 1JZSA 1ZUWA 1QLWA 1YBAA 4J0FA 1TQ4A 1FSSA 4RK6A 4CQLB 4RM3A 4Z49A 4HDQB 5K0FA 2ZSDA 3M4JA 5KQPA 3GLGB 4MA4A 1E20A 3EY4A 1T9BA 4KJXA 5CYFA 2MINA 2B6HA 3L06A 3IUBA 4MS3A 5JPDA 3R8XA 3DZHA 3L6DA 2BI7A 5DM2A 3DO8A 4RKEA 4F1WA 5GJBA 1RYYA 1YU6A 3KFXA 4MGIR 1WHTB 2GCEA 1DV2A 3ZWOA 5JIBA 3K35A 3TIXB 5ICGA 2F7SA 3M6WA 1H5QA 4RCVA 2JI4A 2P6NA 2ZT8A 5FA8A 2OMKA 2P6MA 4G0QA 1GNLA 4N1AA 1H2ZA 4PPQA 4QQNA 4UUQA 5IN5A 1ZDMA 2XQKA 3F5DA 1TJ4A 4YV7A 4MDEA 3A8TA 2J46A 3KB6A 1GIAA 3GJ0A 2FG7C 3PXUA 4KV9A 5BNIA 2X1LA 2QTVB 2BFPA 2YIDA 2VCEA 2REXB 1A9XB 2GJAA 2WP8J 3FX2A 4B0PA 4UU8A 5FJIA 2PT5A 1A97A 4ZN6A 3IR7A 3R5JA 4IZHA 4UBJA 2PS1A 4Q3OA 1RP1A 1XDGA 4XGNA 4ZEMA 3HY3A 3DKIA 2VQ6A 2P9JA 4CZ2A 4WUVA 1ZMRA 1QQTA 4Q4LA 1GVNB 5AYVA 2ATCA 1TRKA 3KR9A 3WYAA 2C9YA 4NDAA 1OFUX 2ZR8A 4HADA 4LXUA 1LH0A 1YB5A 3IO3A 4RDCA 1BG6A 1FFEA 4FYMA 3MYYA 3OTWA 2EX4A 4RQTA 4R1OA 3ZW7A 3H1FA 4B7ZA 3G2OA 3P52A 2IXEA 1YI0A 3GLGE 3NOXA 2R66A 4P58A 1VG0B 1BHSA 4F72A 2ODEA 1KQOA 1G21A 3SE0A 2WMOB 2AZMA 2MYUA 1KDYA 3NIFB 2OZPA 3B5IA 1MW8X 2Z5GA 4X61A 3V8PA 1ZZGA 5AM0A 5CHEA 1V4VA 4ER0A 4Q1DA 2XMDA 2Q46A 3F98A 2UUOA 3IR6A 2JFXA 5KC9A 1T0PA 1TX4B 3UKDA 5LNK6 2PCJA 1DMSA 3OZWA 2G4LA 3LUHA 4WX2B 1TFRA 5EWMB 5B6PA 2GM3A 4R5MA 1UAAA 2PTHA 4UVGA 1ZCBA 4ZOCA 3OTIA 2RK4A 3GBPA 4R16A 2KE5A 2IY7A 4M1QA 4ERXA 2LWIA 4NV1A 3RU2A 1NASA 3V8NA 2YFYA 3K4QA 3L7LA 4NJOA 4ZI7A 1Z8NA 3AERB 5EE5B 1GUZA 3L8CA 1O7JA 1W49A 1QP8A 4BDSA 2J41A 1E6MA 3GJQA 3FVRA 3TIGA 5CW2A 3ZU5A 4UU7A 1CB7A 2WBLC 2BTQB 3EISA 1K27A 3EUFA 3P96A 4YX9A 3I04A 1AUQA 1EFPB 2YYYA 4GLLA 2DLCX 3TL6A 2WD9A 3IMFA 3DHVA 1GNTA 5JAMA 1U2TA 1UMDA 3OG9A 5ALGA 5TE9A 4M88A 2RDMA 4S24A 4JR1A 4UASA 3T7IA 3R41A 2JHPA 1E98A 2UYYA 2Z2XA 2OZLB 3ORQA 2JIRA 3R3VA 3GB9A 3PD7A 1RQGA 3UAVA 2E4YA 3ER9A 3AHGA 2G36A 2GTHA 1VJRA 1T4DA 1FLNA 3KX2A 3S44A 2HA6A 1AUVA 5FBLB 1DC4A 2NU6A 4M83A 5GINE 4LUCA 2GLUA 4O3FA 2AV6A 1Z4IA 1JTVA 2D5CA 3G7NA 5DXJA 2LW7A 3BBLA 2AFHB 2VZ0A 4LDQA 3BH7A 4CN9A 2YASA 5F2EA 3W5JA 5E7IA 3DPSA 4FQ7A 2WJ3A 3HYSA 3CONA 2FZCA 4E5VA 4O2AB 3OETA 3E1GA 3HCWA 1YCFA 3PNYA 2VA8A 2ZXFA 3RVDA 3PGMA 5TMDA 5EMKA 5JEEA 4LXIA 5L7TA 2HMTA 1NVXQ 3RVOA 5EINA 2JIDA 2QV7A 3ZS8A 2X6RA 1K7SN 3DE5X 1ZIPA 4Z7OB 3MWEB 1FYVA 5BWLA 2VEOA 1YB2A 4LRWA 3MWLA 1B0PA 4BFCA 4CQMB 1ULUA 1TCBA 5DYIA 4XYEA 4MA5A 3MUNA 3LBNA 4HAIA 2DLNA 2H2HA 3UJPA 2WYWA 4MS1A 1K66A 5JARA 3RU3A 4G0VA 3A05A 1N5KA 1R0SA 1KO8A 1W25A 2ATVA 2WJJA 2HSDA 4G65A 4U5XA 3SBEA 3CEPB 1B14A 4KHPB 2UV8A 3LHDA 2BZ0A 3KKKA 4K5QA 5E0KB 3U3XA 3BHMA 2R7MA 1A4IA 1J70A 1BVRA 3BWDD 3C45A 3VZRA 1XELA 1TW3A 2X2FA 3WGVA 2X0NA 3EDCA 3H5AA 3W2HA 4TWJA 2GN4A 1G55A 3GAAA 1UBFA 3KUXA 4I4IA 4ZZ0A 3KSZO 3W05A 4QD3A 4RULA 1JNYA 2R9VA 1BNCA 3GG2A 2Q4BA 5AW4A 5IF3A 1RQLA 4PQEA 1Q0RA 1GP2A 3QTLA 2ZI4A 1VSUA 3R5XA 3RG2A 5LBTA 1K9VF 5IAGA 3VZSA 4INAA 5I7RA 2PUEA 1HQDA 3NLLA 3FOWA 4UULA 2AFHE 5CDUA 4QG3A 1F0NA 4DJJA 1UDAA 1UXKA 2EP5A 4I3GA 4Q9DA 1BX3A 3UJ6A 3JARA 5A9RA 1OAOC 3M6LA 4QULA 4OQLA 1PR1A 2RSLA 3HWRA 3ZWBA 1M66A 2E48A 3GA0A 3CEJA 4REQB 5I7SA 3KXLA 2VF2A 1T5HX 1R4AA 2PSFA 1LLCA 3I2JA 4KXVA 4F7WA 1ZCZA 3AHFA 2Q3CA 1C8BA 2PT7A 3TMKA 3RTEA 3UMBA 3TLMA 6YASA 3GPBA 5IYZB 1Z4JA 2P90A 3TZHA 3UZUA 2WQZA 1CP2A 1O97D 2ORWA 1Z6PA 2XWSA 3NPMA 2W2LA 4TYMA 1XZMA 3TUJC 1NW8A 4X6XA 4MIYA 1PAUA 2YV2A 1VJDA 2AR9A 4BU0A 4QXOA 5JXGA 2NMVA 1B8PA 2RC5A 2O2HA 2WT9A 3GNTA 3LF2A 3S2ZA 5KJ1A 2I1WA 2ZRPA 4PPGA 5KJFA 3U19A 3GFSA 3VSAA 1LRLA 2G06A 2DWUA 3KD3A 3R5TA 2IBSA 1KXZA 3BHJA 3FNRA 5IVPA 3AK4A 3DDCA 1SURA 2JGLA 1VPLA 3PQCA 4BBAA 4E5UA 1DRJA 5ALFA 3EHEA 1F0YA 1GJRA 2QS9A 1RYEA 3ZWKA 2XE7A 5BV1A 1DJNA 2V7QD 4WASA 1TF2A 3MGKA 4KU4A 4CF5A 1SQFA 3QNWA 1NHGA 3EF1A 3D5QA 3VMFA 2ZW9A 1PTKA 4KFUA 4PO3X 4RV9A 4CT0A 1GQFA 2HWYA 3DWIA 1USVA 2GS9A