4DW0A

Crystal structure of the atp-gated p2x4 ion channel in the closed, apo state at 2.9 angstroms
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
330
structure length
330
Chain Sequence
GTLNRFTQALVIAYVIGYVFVYNKGYQDTDTVLSSVTTKVKGIALTKTSELGERIWDVADYIIPPQEDGSFFVLTNMIITTNQTQSKCAENPTPASTCTSHRDCKRGFNDARGDGVRTGRCVSYSASVKTCEVLSWCPLEKIVDPPNPPLLADAERFTVLIKNNIRYPKFNFNKRNILPNINSSYLTHCVFSRKTDPDCPIFRLGDIVGEAEEDFQIMAVRGGVMGVQIRWDCDLDMPQSWCVPRYTFRRLDNKDPDNNVAPGYNFRFAKYYKNSDGTETRTLIKGYGIRFDVMVFGQAGKFNIIPTLLNIGAGLALLGLVNVICDWIVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords P2X purinoceptor
publication title Molecular mechanism of ATP binding and ion channel activation in P2X receptors.
pubmed doi rcsb
source organism Danio rerio
molecule tags Transport protein
total genus 82
structure length 330
sequence length 330
ec nomenclature
pdb deposition date 2012-02-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.940 Mainly Alpha Orthogonal Bundle Helix Hairpins atp-gated p2x4 ion channel 4dw0A01
2.60.490.10 Mainly Beta Sandwich atp-gated p2x4 ion channel fold atp-gated p2x4 ion channel domain 4dw0A02
3H9VA 4DW1A 4DW0A 3I5DA
chains in the Genus database with same CATH superfamily
3OTFA 3CMEV 3LNMB 3ZMTA 3OE7G 2H94A 5EC2C 1ZL8B 5LHIA 3SYPA 4O4LA 1HNXB 1VF5B 1YCIA 3IFXA 3RYIB 4E2LA 5H6QA 2ZDIA 1VEWA 1BQ0A 3CRRA 4X64O 5IYBO 4EFBA 1QQCA 2ODMA 4K0KB 5B1BC 1K97A 2NN4A 2K9PA 1TVKA 4TQFA 2P4KA 4DW1A 4NKGB 2W0XA 1S5HC 3UT5A 5GTIZ 1I7FA 4DV7O 3OEHG 3DGEA 3HKBB 2WAMA 1I0HA 1UFIA 4R8CA 1TVKB 5JQGA 1R6TA 3BPZA 3L72H 1MOFA 3JARB 5LL6Y 3A0HZ 4AQYO 2A79B 1IBMB 3CJHA 1BQZA 3SPIA 1WB8A 3ZBHA 4LF5B 2PF4E 1R1BA 5JQGB 3C90A 2ZE8A 1Q43A 4DUYO 1ZLZA 1BT8A 2DE0X 3BRCA 4KUMA 1Q90D 1N33B 1NVPD 2GTSA 4BW5A 3ZS8C 3S3WA 4DV5B 4MVMA 3KKYA 3T1HB 4LR3A 3FYIB 3K57A 1B6QA 1OCRB 4NXNO 5CA1B 4ZKIA 2VRZA 4R7CA 1RSOB 1PNMA 5IJ0B 2ZIMA 4L87A 1KBHA 2EIKC 1N4CA 3W7UA 4FLYA 3JALA 1AJNA 2WA4A 3RFRA 5KUMA 1HWYA 5GTHZ 3K04A 4GKKO 2QM8A 1S5LZ 2EX3A 2LW7A 4ZBMA 3RWRD 1EN4A 4RWUA 5J2TB 2Q0OC 5A9GA 4OX9O 5LHGA 2ADQB 4NXMB 4YJ3A 1J5EB 4I4TB 4LF4B 3MAQA 4W4KA 2Q7HA 3ABUA 3ASNC 1D5NA 3L73H 2EZOA 1EM1A 1SRYA 4TV9B 1BHAA 4JGSA 3QNEA 4MW8A 1K92A 3QTCA 5IYZA 4DYLA 2JJ1G 3CS5A 5LXTB 3T4DA 5L3FA 1E79G 4DV4B 2QWOB 1AILA 1GH6A 1Q82W 1LUVA 2PI5A 4JYYA 3U0ZA 2X6AA 4GLXA 3SPJA 1QU7A 3QO7A 2YIDA 2QDOA 1FXHA 3CRAA 2WLIB 1H2GA 3ML0A 5E1AC 3OTOO 2W6IG 4MW3A 1PNLA 4UB6Z 2GBOA 4FFBA 2N74A 3N2KB 3ZHUA 4DV7B 2QE7G 3FKSG 4MVUA 2AGAA 3LDDA 1NQTA 1SETA 4JYCA 4J7KA 2R9RB 4LF6O 3JCUZ 4X89A 4AQYB 2K1EA 3S3XA 4WBNB 2XNDG 2PGGA 1FYJA 3W7XA 2R9IA 4I55B 5TISZ 2QEXV 2RMKB 4JF3A 4X1KA 2N05A 3I55V 1JOYA 3FD9A 3BAAA 4DO2A 2YUAA 3CRMA 4NXNB 3QF7A 2DWDC 4PA6A 2LO1A 2WLLA 2JGDA 3F7VC 2MW2B 1K8AW 1VARA 3JAWA 1Q8IA 5JJJB 4UUJC 4LF7B 2FL4A 2ZD9A 4GKKB 3FYEB 1TA8A 1SQVH 3AG2B 1JCHA 3NR7A 1M90W 2ZM6O 4IIJB 1H2KA 2IU3A 1RP3B 1JX9A 4OX9B 3JAWB 4LH7A 3ETQA 5L3GA 4FPPA 4W4LA 3SR2C 1HNWO 2BE3A 3C3SA 3T4ZA 2BOCC 2P06A 1VF7A 2D3OW 1XI1A 3F5WC 1SQXH 4I9QA 2WA3A 3CCJV 1I94O 2JEXA 4ZOLB 2ZQMA 1SS3A 2Z5UA 4CS3A 1LUWA 4D7SA 3CCMV 2FYUH 1XOUA 1SQFA 4FM0A 3K03A 1FD9A 5CB4A 1AJPA 2Y69B 3JAKA 3GWKC 1FXVA 4D6TH 4JI8O 4WFFA 4JI4O 1XMOO 1MZFA 5FPOA 1I08A 3W7SA 1Y4MA 3JD0A 3F5TA 1QR8A 4ASUG 3K5NA 2PTMA 3OTOB 4HAMA 5BY1A 1Z2GA 3ZRVA 4UVCA 1YJWV 4HYOA 1GN3A 1FAFA 1HNZB 4BIUA 2ADPA 3K5OA 4DRXB 3ZHRA 3GVMA 3LSUA 1R3KC 4UCUA 2YIBD 3N2GA 4IL6Z 3JATB 4CBCA 1VF6A 3CC4V 1Y76B 2EBOA 1RPOA 3THOA 1S5JA 1SERA 2O57A 2XTAA 1Q86W 1R73A 4OPHA 2L6LA 1NJIW 3K06A 3JD2A 2F66C 3N2GB 2IM9A 1YHQV 2OCCB 4B7EA 3B4SA 3A0BZ 2ZE6A 3M7MX 3CCVV 1CPYA 4DR3B 5LMNB 3GWOA 3RYHB 5B1AC 3P3PA 3GB7C 3CE2A 1H2SB 1EZVH 3WG7C 2QKAA 4O2AA 5E79Z 3OMAB 2ZINA 3OGIB 4MTXA 4JTCB 5H5NA 2HLDG 3B2EE 2XAGA 1DGSA 3BA9A 5CA3A 3ETGA 1K7DA 1HNWB 4FK5C 4X1YB 4UCTA 4O4IA 1K4DC 2LGWA 5J2UA 5CN0A 4B7KA 4PI2A 2A9HA 2DW4A 3QVNA 4GUNA 3AK1A 2ETNA 4X65O 5J2UB 4U3JA 1YTFD 1V9PA 1NTMH 3VQVA 5CBFA 3HR0A 1KECA 2XUMA 2Q7EA 1E1QG 5JH7B 4DV1B 4PDVA 3ABLC 2B1IA 2WPDG 3VQXA 2BSKA 2KG7A 5FNVA 4YIOA 1M56C 4EEQA 2B1GA 4TT3G 2XHBA 2E76B 1XMOB 2CAZC 5IJ9B 3ZHTA 1YDXA 2YEVA 5FL7G 4DV3O 2VWKA 3WB0A 2CDYA 2RNBA 2E75B 3JAMN 1ZSPA 4X20B 2NNUA 4LBEC 1XUQA 4XDKA 4RQEA 4Q6GA 2WLJA 1GMGA 3JASA 2FB5A 2Z0AA 5KHJA 5DN6G 4JZ2A 1WPXA 1SQBH 3KCYA 1YZBA 1GKFA 2M7WA 3K9SA 1SQPH 3CB2A 2ATKC 3G4SV 3JASB 1SF9A 3OUSA 3E8HA 5CMUA 1TUBA 1AI4A 4E4EA 5LHHA 1SA0B 3A2FA 1XNQO 2UUCB 2QTSA 3EVKA 3RYFA 1VIBA 4DV6O 1R3LC 3VQYA 5BMVA 1EN6A 1KYOF 3AK2A 2F1MA 4CH3A 1KKDA 3I5DA 1Q7YW 2PYJA 2AZ2A 2GUZA 2Q4PA 2ZXWC 3ZIAG 1OCCC 3RGBA 5BMVB 3SYQA 3FAVA 1FFXA 3SYCA 1YSCA 3ZMZA 3BY6A 2NLJC 1XDCA 4K8XA 1W0KG 1QVFU 4UXNA 1BHBA 3CCLV 3K5MA 3G71V 4PA9A 3FX7A 3HPLC 1K73W 4MT8A 2WSSG 2W6JG 2FKXA 3APQA 4X66O 5CBHA 2UXDO 4XDJA 1NR7A 2OTJV 2IH3C 1XEQA 2AHZA 1M5IA 1VQ8V 1AI5A 1VQ7V 1XILA 5D5PA 2QWQB 3M99B 4X65B 4ICGA 3WFVA 5KAIZ 1JPXA 4H44B 1AJQA 1EBOA 3RVZA 5EZYA 4DV2O 1TAEA 1FKAO 3G6BA 5BZBA 3F7YC 3K3WA 5AG2A 1WLEA 3H1HH 5D5QA 1F4NA 2DYSB 4J11A 3E2EA 1VQ6V 1MA1A 4BIOA 1H38A 2AZ0A 3SGIA 4DV3B 2AXTZ 3L75H 1YJNV 1NI8A 4CC6A 4H33A 3CCRV 4O4JB 2DYRB 4ZI7B 2IW5A 4F6EA 4FM2A 4ZHQA 4DV0B 3G80A 3H1KH 1VQ9V 2DN9A 4PA3A 1H2LA 4J9YB 2HR3A 2QWPB 4B3MO 1T5EA 4UCSA 1AR5A 3D3QA 1GM7A 4DW0A 5KHIA 3TGUH 4PA4A 3SYAA 2Q8VA 4JI7O 5CA0B 1YITV 1ROPA 3G6EV 1GM8A 3TXQA 4F6RB 1GK9A 3OMNB 2Q69A 4XDLA 1ENVA 1YJ9V 3ASOB 1MSWD 4DV6B 1THZA 1ZX3A 2IH1C 3AG4C 1F23A 1AR4A 4O4LB 5IY5B 3W7TA 4PD4F 1H8HG 2HP8A 1LR1A 1KD1W 5IYDO 1WA8A 1PV0A 2QJ1A 4KFMA 4WCEV 1XBLA 5B3SB 1LNQA 2XASA 3UT5B 4WFAV 3LUTB 2UUAB 1DK1A 4PI0A 5ITZA 1NBMG 2JRIA 3O9OA 4X66B 1NU1H 1AP5A 2UXDB 1NS1A 2A06H 2UXBO 1SZXA 2XT9A 1YI2V 2UXXA 3K0DA 3CJHB 3CXHF 1NT2B 4LCUC 2X6CA 1BGYH 2PY5A 2PZSA 1E1RG 2QKCA 3HKDA 4JV5O 2ZT9B 4QPJA 5LP6C 1M93A 4UB8Z 2EJRA 4QIWF 4C7UA 3X2QC 2XAJA 3HKDB 4FFKA 3JALB 3JSNA 2JK5C 3UO2A 2EINB 4MVZA 2Y4UA 1XHZA 1V54C 5EBLC 4PJ0Z 3B40A 2ZR2A 2UXCO 2QM4A 1VP7A 1VQ4V 2HKOA 4YHHB 3OM3B 3AG3C 4FLWA 2FTKA 1D5AA 2YXHA 4YJ3B 5GONA 1QLEB 3AG7A 4B3MB 2JJ2G 1GRJA 2KQXA 3CSXA 1R3JC 3FB5C 3IGAC 4CS4A 3OMIB 2AHYA 4BR6A 4JI7B 2MK3A 1N34O 4LF9O 3CP1A 4FLUA 4U3FH 4K8ZA 3D36C 1PP9H 3OW2U 1P49A 3CYOA 5IYZB 5B1NA 4X64B 2HVJC 1K5QA 1AROP 2CTPA 2EILB 1TGOA 2HJFC 5LA6A 2F95B 1SQQH 1OCZB 4MVQA 1RM1C 3JD3A 3AG1B 2ZCEA 4CS2A 5LOVA 1M57C 3ZHSA 1MG1A 1SC5B 1N0NA 3RW0A 4X1IA 2WLKA 4FFBB 2ITCC 3OD4A 5EYPA 4X62O 2X7RB 4WF9V 4DUYB 4H0LB 5DM6V 2F93B 2Z3YA 1I5XA 4RUEA 2HG5C 4H37A 4JI5O 4J9ZB 1N8RW 4X1KB 5B1BB 1BMFG 3RN4A 3ZRWA 3RYCA 3CD6V 1IXBA 4JV5B 1N32O 4R50A 1QBZA 2PYLA 1WP7A 4MS2A 1JMKC 4G27B 3H1JH 3UQ8A 2WLLB 3DC6A 2JGDB 2W0FC 4GX5A 2RCVA 2UXNA 2OTLV 1FXKC 2ILMA 4IYHA 3R65A 4JI0O 3JD1A 2UXCB 3BVOA 3ZMUA 4DR4O 1XNRO 1D2DA 2ZE7A 1KUQA 4B3TO 3QO5A 3TCUA 4GKJO 1Q6HA 5IDJA 5KX5A 3OUFA 1S76D 4PELA 4JZGA 4FLTA 4DK0A 4MSWC 2EIJC 2QKSA 1URFA 2QTOA 3I56V 2CTQA 2EIKB 1N34B 4Q20A 4LF9B 4J80A 1AB3A 4DXWA 3JYCA 1RFYA 3Q4HA 4TQDA 5CB4B 3JAKB 1QHTA 4FJCC 5KMGA 5J9PC 4LFAO 4J7JA 1QR9A 1AP6A 3CXCU 3ZRSA 2IU0A 4PHZA 4BIZA 4LFCO 2ZNIA 5IYCO 1QVGU 1JFFA 1KP2A 3ASNB 4GX2A 4IYIA 4OPAA 1M9NA 5JWPA 4JAUA 2DWEC 4I9WA 1K9MW 3D36A 2YXLA 4O4HA 4LF6B 2A0LA 1JFFB 4X62B 3CC7V 3ZX6A 4FZ1A 2OIEA 4X88A 1V55C 2QGNA 1TUEB 4PV1B 1S3JA 1FJGO 1OCOC 4A5UB 1US6A 5LYJA 1QLNA 2CH7A 2LJ2A 4NTXA 1BZKA 4QPKA 4Z1VA 2XOKG 2Y0PA 5GW7A 5H9CA 4JI5B 2Q68A 2CTRA 1IDSA 2Q0AA 2Q67A 5EC1C 2GHYA 2HEPA 3LSSA 4P9PA 4NTYA 5KA5A 1R3IC 3CPWU 1GN2A 5DEDA 5JJNB 3J81N 1WB7A 4FZ0A 2ZM6B 2F4VO 3U11A 4BWAA 3E8BA 4JI0B 4O2AB 2YICA 1KKCA 3L74H 1M1KW 4JI2O 3CX5F 4DR4B 1XNRB 2WLMA 1Y74A 3E35A 1KP3A 2FMLA 4B3TB 1I94B 3P3NA 3SYOA 4JYAO 4GKJB 3ICXA 3ABMC 3CMAV 4YXWG 3J7AU 4O4IB 2VQFO 1BCCH 3JD4A 1WJZA 4LC1A 3VQWA 1XREA 4LH6A 1Q81W 1BL8A 4JTDB 1NH2B 2EIMC 3DXRA 4I0XA 1NTZH 5L3DA 4HZ3A 3TXSA 1FXKA 2IJKA 4GX0A 3E22A 3ABKC 4U3JB 1VQPV 5IE9A 2OCHA 3HKCA 4JI8B 4JI4B 1O9GA 3SPCA 5CBGA 2BSKB 2KG7B 1DLBA 1K33A 4HBNA 5FNVB 1HDJA 2Y0IA 3HKCB 4ABMA 3C3TA 3CCQV 1JJOA 2YEVB 4Z1MG 4UCRA 1HW7A 3FB7C 4JAAA 5BR8O 4RAIA 4CH4A 2ZR3A 2ITDC 1PM9A 3IC9A 1DTOA 2ZDIC 4JI6O 3KCXA 4FIPC 4LFBO 3LNNA 4DUZO 5KHKA 4CZZA 3APOA 4FM1A 3R66A 1FJGB 3H1LH 3CCSV 1TUBB 5C8YA 1OZ0A 4QE9A 2VQEO 1SESA 5LGNA 2VWJA 1IBKO 1UJWB 1FFTB 2HVKC 3A0RA 3RYFB 2RQ6A 2Q9LA 4RQFA 4QNHB 5C8YB 2KB1A 4KHPO 2XAHA 2IJIA 2P22C 2L35A 2GUZB 1OCRC 1F51A 1VQOV 2F4VB 3FAVB 3O65A 1FFXB 2D2CB 4I5SA 3B8MA 1GTOA 4LWSA 4DR5O 2HHHO 1EN5A 3KG2A 4JI2B 2P7TC 1MABG 2JS3A 4J10A 4JASA 3ZHQA 3AEIA 3OR6C 1H8EG 2V4DA 1ZUQA 2LGQA 4PDLA 2JGUA 2R70A 3B77A 1PNKA 4TV8A 3ZRXA 3EFFK 2A3QA 5B1AB 3DSQA 4UCVA 1Q3EA 3TJTA 3SJCC 1B3QA 4AILC 4X9QA 3WG7B 5F2VO 4I50A 3UCSC 5EZYB 1NR1A 4LP8A 4IT5A 1QNMA 2ARHA 2V7QG 2JDIG 3U10A 2AW9A 4PDRA 4KP4A 4O2BA 2M6YA 4HNAA 5BR8B 5FPRA 4DR7O 2IJHA 4NTWA 1NTKH 4ZHQB 4WFGA 1NVPB 3CRCA 5JJEB 1G1XB 1MNGA 4NYKA 4JI6B 3ZMVA 2UU9O 4LFBB 2QA4V 4DK1A 1Q6UA 3ABLB 1XNQB 1L0LH 1M56B 5KUKA 3MD0A 4YIPA 3W7WA 3IC7A 4F4LA 2VQEB 3RYIA 3UO3A 4EB6A 2V1DA 2OIGA 3BEHA 2N04A 4DR1O 1IBKB 1AI6A 5B5EZ 1EZJA 1PD3A 1PPJH 4DV4O 5HFMA 2Y4TA 2YXYA 4KHPB 1AI7A 2DQ0A 3D3IA 4EB6B 5EBWC 1YEWA 1S0VA 4DR2O 4UVAA 4PDMA 3OT7A 1S77D 3HKBA 5JCOC 1WA8B 1GN4A 5K1XA 4UFZA 4DR5B 2HHHB 3JARA 4J7ZA 1JR9A 2YC0A 3E83A 4QE7A 2R72A 5L3EA 3AG2C 4NR1A 5ITZB 1BSMA 1JQ0A 4PA7A 4GT1A 2Y48A 4XBFA 3SPHA 3ZHVA 2QWRB 3IJ4A 3EHBB 1SZTA 5IWAO 3LSQA 4MVRA 3FB6C 4RO2A 4RUFA 2IJJA 3EXAA 2ZXWB 1L1FA 1OCCB 5CA1A 3NXSA 3DC5A 3HKEA 3RBZA 4DV2B 1RSOA 4I7ZB 4KL1A 5IJ0A 2E5LO 2Q5ZA 1L8DA 4UCOA 3LDEA 3BA8A 3P30A 1P7BA 3HKEB 3K5LA 3H1IH 2LFSA 2XAQA 2B5UA 2Y69C 3JCZA 5J2TA 3SJQC 1H2MA 3CRQA 4LF7O 4D7TA 1MZEA 4TWKA 3K08A 1YVWA 2ZNJA 4I4TA 4DR7B 3OEEG 2JVDA 5LGTA 1H2NA 1Y67A 4TV9A 2PI4A 1G6UA 4K35A 4JI1O 1X59A 2UU9B 5GONB 3K9AA 1S72V 5LXTA 1DF5A 1WPBA 2R9AA 1XHXA 3K79A 1IVSA 1VQMV 2X0LA 3P32A 1M4UA 1XMQO 4DR1B 1IXMA 4KXRA 1Y6XA 2LFRA 4GCZA 5H2FZ 2WLIA 3FFQA 1SQGA 4DR2B 5B1OA 5EIBD 1QCEA 5LA6B 3N2KA 1VF6C 2Q73A 2OCCC 3BABA 1MSDA 2DJVA 3OR7C 2JEUA 4LF8O 5LOVB 2P90A 3E86A 4P30A 4DR6O 3G67A 4WBNA 4X1IB 1Q5OA 2UXBB 3M8AA 4UV8A 5EYPB 1HNZO 3T1YO 2CTWA 1WP8A 4I55A 3A8TA 4YY3O 4H13B 4AI8A 3AG4B 3CEIA 4CC5A 3TETA 5IWAB 5LMUO 3ETEA 1IZ3A 2F43G 5H6RA 2ZIOA 4K3AA 4BAYA 5JCOA 1YIJV 4NVPA 1Z5VA 2RN9A 1Z5WA 2BCCH 3CCEV 2E5LB 2YS8A 3ZRWB 3RYCB 4CH6A 2CK3G 3JSLA 5K1PA 1EFRG 5DECA 3ZN1A 2DOSA 2GTAA 1U96A 3ETDA 4JI3O 5LMNO 4DR3O 4L8JA 4IIJA 1NKDA 3PJSK 2YIBA 5IT9N 1N36O 3STZC 3WB2A 1K5SA 5C93A 3BFRA 1U97A 4TSFG 5LP6A 4GYCB 2BOBC 1OHHG 4UVBA 4ZOLA 2QM7A 4TOIA 1OJHA 4N23A 4R6ZA 1HR0O 4JI1B 1K34A 5KX5B 3QG5A 5JVDA 1P7GA 2CGOA 5LP6B 2P4VA 2ZE5A 4GX1A 1K3EA 1KQSU 3T1CA 3X2QB 1WNSA 2QWNB 5FLXN 3AK3A 3K59A 3T2MA 4WFHA 1BS3A 2RJZA 2EULA 5JVDB 5KA6A 1XMQB 4NB5A 5B66Z 1N0JA 1V54B 5EBMC 2Q6AA 4FLVA 2Q7GA 2OT5A 3Q4HB 4DV1O 4B08A 2YIAA 5KMGB 2LQTA 3ABTA 1FPOA 3AG3B 1SKVA 4WFBV 3H01A 4J42A 1Q6IA 2NR5A 2PUSA 4P9OA 3SJAC 1IBLO 2H8PC 3B09A 4FVMA 2WLHA 4LF8B 2E74B 1K4CC 5BXZA 3DTUB 4DRXA 4DR6B 4O4HB 1YTFB 2C2AA 3T1YB 1CEZA 3JATA 4YY3B 2A7WA 1Y76A 4JYBA 3N27A 2YSUB 5LYJB 2F23A 2CH7B 2DMXA 5LMUB 2E3CA 2HFEC 3OFNG 3K58A 1RPRA 2KKWA 2UUCO 4IGGA 1N32B 3BCCH 1G4YB 1MMMA 1XL6A 1AR1B 1RM1B 3QO8A 2EJ7A 3ZMSA 3RYHA 4MTGA 5LGUA 1M57B 1IURA 1O9HA 3FB8C 4JI3B 1JA8A 2P5OA 2P6JA 3ZJZA 1A32A 3L9DA 1F7YA 2CUGA 1N36B 1VQNV 1HP8A 2DYSC 4FLXA 1ZWIC 1NZ6A 3CHXA 5LBQA 4X1YA 1G8MA 1VMGA 2LW1A 1R6KA 1VQ5V 2EZPA 1Y74B 4MVSA 2P67A 3CC2V 2DYRC 3ZCCA 1FS0G 1HR0B 3MDSA 1R6NA 2RDCA 1DF4A 4MTOA 3UKMA 2B9ZA 3OGCC 5JH7A 3BHPA 4U7NA 4B3SO 2KSDA 3DXRB 3OAAG 2WLNA 1CP9A 4I0XB 2UUBO 4LFAB 1FXKB 1B06A 3E22B 1YXBA 4AHCA 5IJ9A 4LFCB 1CXZB 4TUYA 2BTOA 4LNUA 4Z2WA 2X6BA 5L3BA 1GAXA 4X20A 3E8FA 1BE3H 1W59A 2YDEA 3ASOC 1VQLV 4U7OA 1XL4A 4TUYB 1JVMA 4LNUB 4FMTA 5IY5C 1IBLB 3ZEDA 5KHGA 3E8GA 3LDCA 2OYQA 4YJ2A 4FLZA 3J80N 2GV9A 2EIJB 4B3RO 4DV0O 4N21A 2ZKOA 2HJDA 1WN7A 3H9VA 3MHHC 3ZN0A 4MVOA 4YJ2B 3CWBH 1SA0A 4CH5A 5B3SC 4MTFA 1KC8W 2G38A 1GO3F 2YI8A 2LP7A 3B8NA 1PKXA 2GSMB 5KAFZ 1HNXO 1L0NH 2QSAA 1WAZA 1NH2D 1GM9A 1W0JG 1ZAUA 1X4TA 4BW9A 3D8CA 3RVYA 3UM7A 5KLVH 1PL0A 4K0KO 3E89A 2OWOA 4JAVA 4G2KA 3VOUA 4JTAB 3SDLA 1KU9A 1V55B 1YF2A 3IAYA 5EIBC 2QR4A 4QJFB 2H3OA 2DQ3A 1GN6A 1OCOB 1PL4A 2CGNA 4LWSB 3VBBA 4JYAB 2BTQA 3SPGA 2EINC 1IBMO 2UUAO 2CE4A 2VQFB 4ZIBA 1ZTEA 4LF5O 4G28B 1P84F 1KB9F 2BTQB 4QGPA 1KMIZ 3WB1A 1N33O 4JPRA 5A2QN 2VS0A 4DV5O 1F4MA 3T1HO 1QLEC 4WFEA 4EKWA 3STLC 4TV8B 4X8AA 4B3SB 2UUBB 1B04A 3L71H 4GZRB 5KHHA 2JS5A 1P4RA 5EK0A 4EFEA 3MHSC 4I50B 3SJBC 3K0GA 2WWWA 4IHJA 3CCUV 1W2BU 2IBZH 2JIZG 4O4JA 4ZI7A 5L3CA 3PN1A 3ABMB 1AVMA 3RT3C 1Y66A 1OV9A 4IHJB 1UPGA 1JJ2U 4P2ZA 2EILC 4NXMO 2XAFA 1COWG 3WU2Z 1J5EO 1XQ8A 4O2BB 1IX9A 4HNAB 4LF4O 4B3RB 2EIMB 1OCZC 4DUZB 1ORQC 3AG1C 4YHHO 1VQKV 1J95A 3TK1A 3KZIZ 3L70H 4UV9A 4OXSA 1I5YA 5CA0A 3ABKB 4OGQB 2YI9A 4J41A 5HFLA 1ZL8A 2GDSA 3HB3B 4F6RA
chains in the Genus database with same CATH topology
3H9VA 4DW1A 4DW0A 3I5DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H9V A;  4DW1 A;  4DW0 A;  3I5D A; 
#chains in the Genus database with same CATH topology
 3OTF A;  3CME V;  3LNM B;  3ZMT A;  3OE7 G;  2H94 A;  5EC2 C;  1ZL8 B;  5LHI A;  3SYP A;  4O4L A;  1HNX B;  1VF5 B;  1YCI A;  3IFX A;  3RYI B;  4E2L A;  5H6Q A;  2ZDI A;  1VEW A;  1BQ0 A;  3CRR A;  4X64 O;  5IYB O;  4EFB A;  1QQC A;  2ODM A;  4K0K B;  5B1B C;  1K97 A;  2NN4 A;  2K9P A;  1TVK A;  4TQF A;  2P4K A;  4DW1 A;  4NKG B;  2W0X A;  1S5H C;  3UT5 A;  5GTI Z;  1I7F A;  4DV7 O;  3OEH G;  3DGE A;  3HKB B;  2WAM A;  1I0H A;  1UFI A;  4R8C A;  1TVK B;  5JQG A;  1R6T A;  3BPZ A;  3L72 H;  1MOF A;  3JAR B;  5LL6 Y;  3A0H Z;  4AQY O;  2A79 B;  1IBM B;  3CJH A;  1BQZ A;  3SPI A;  1WB8 A;  3ZBH A;  4LF5 B;  2PF4 E;  1R1B A;  5JQG B;  3C90 A;  2ZE8 A;  1Q43 A;  4DUY O;  1ZLZ A;  1BT8 A;  2DE0 X;  3BRC A;  4KUM A;  1Q90 D;  1N33 B;  1NVP D;  2GTS A;  4BW5 A;  3ZS8 C;  3S3W A;  4DV5 B;  4MVM A;  3KKY A;  3T1H B;  4LR3 A;  3FYI B;  3K57 A;  1B6Q A;  1OCR B;  4NXN O;  5CA1 B;  4ZKI A;  2VRZ A;  4R7C A;  1RSO B;  1PNM A;  5IJ0 B;  2ZIM A;  4L87 A;  1KBH A;  2EIK C;  1N4C A;  3W7U A;  4FLY A;  3JAL A;  1AJN A;  2WA4 A;  3RFR A;  5KUM A;  1HWY A;  5GTH Z;  3K04 A;  4GKK O;  2QM8 A;  1S5L Z;  2EX3 A;  2LW7 A;  4ZBM A;  3RWR D;  1EN4 A;  4RWU A;  5J2T B;  2Q0O C;  5A9G A;  4OX9 O;  5LHG A;  2ADQ B;  4NXM B;  4YJ3 A;  1J5E B;  4I4T B;  4LF4 B;  3MAQ A;  4W4K A;  2Q7H A;  3ABU A;  3ASN C;  1D5N A;  3L73 H;  2EZO A;  1EM1 A;  1SRY A;  4TV9 B;  1BHA A;  4JGS A;  3QNE A;  4MW8 A;  1K92 A;  3QTC A;  5IYZ A;  4DYL A;  2JJ1 G;  3CS5 A;  5LXT B;  3T4D A;  5L3F A;  1E79 G;  4DV4 B;  2QWO B;  1AIL A;  1GH6 A;  1Q82 W;  1LUV A;  2PI5 A;  4JYY A;  3U0Z A;  2X6A A;  4GLX A;  3SPJ A;  1QU7 A;  3QO7 A;  2YID A;  2QDO A;  1FXH A;  3CRA A;  2WLI B;  1H2G A;  3ML0 A;  5E1A C;  3OTO O;  2W6I G;  4MW3 A;  1PNL A;  4UB6 Z;  2GBO A;  4FFB A;  2N74 A;  3N2K B;  3ZHU A;  4DV7 B;  2QE7 G;  3FKS G;  4MVU A;  2AGA A;  3LDD A;  1NQT A;  1SET A;  4JYC A;  4J7K A;  2R9R B;  4LF6 O;  3JCU Z;  4X89 A;  4AQY B;  2K1E A;  3S3X A;  4WBN B;  2XND G;  2PGG A;  1FYJ A;  3W7X A;  2R9I A;  4I55 B;  5TIS Z;  2QEX V;  2RMK B;  4JF3 A;  4X1K A;  2N05 A;  3I55 V;  1JOY A;  3FD9 A;  3BAA A;  4DO2 A;  2YUA A;  3CRM A;  4NXN B;  3QF7 A;  2DWD C;  4PA6 A;  2LO1 A;  2WLL A;  2JGD A;  3F7V C;  2MW2 B;  1K8A W;  1VAR A;  3JAW A;  1Q8I A;  5JJJ B;  4UUJ C;  4LF7 B;  2FL4 A;  2ZD9 A;  4GKK B;  3FYE B;  1TA8 A;  1SQV H;  3AG2 B;  1JCH A;  3NR7 A;  1M90 W;  2ZM6 O;  4IIJ B;  1H2K A;  2IU3 A;  1RP3 B;  1JX9 A;  4OX9 B;  3JAW B;  4LH7 A;  3ETQ A;  5L3G A;  4FPP A;  4W4L A;  3SR2 C;  1HNW O;  2BE3 A;  3C3S A;  3T4Z A;  2BOC C;  2P06 A;  1VF7 A;  2D3O W;  1XI1 A;  3F5W C;  1SQX H;  4I9Q A;  2WA3 A;  3CCJ V;  1I94 O;  2JEX A;  4ZOL B;  2ZQM A;  1SS3 A;  2Z5U A;  4CS3 A;  1LUW A;  4D7S A;  3CCM V;  2FYU H;  1XOU A;  1SQF A;  4FM0 A;  3K03 A;  1FD9 A;  5CB4 A;  1AJP A;  2Y69 B;  3JAK A;  3GWK C;  1FXV A;  4D6T H;  4JI8 O;  4WFF A;  4JI4 O;  1XMO O;  1MZF A;  5FPO A;  1I08 A;  3W7S A;  1Y4M A;  3JD0 A;  3F5T A;  1QR8 A;  4ASU G;  3K5N A;  2PTM A;  3OTO B;  4HAM A;  5BY1 A;  1Z2G A;  3ZRV A;  4UVC A;  1YJW V;  4HYO A;  1GN3 A;  1FAF A;  1HNZ B;  4BIU A;  2ADP A;  3K5O A;  4DRX B;  3ZHR A;  3GVM A;  3LSU A;  1R3K C;  4UCU A;  2YIB D;  3N2G A;  4IL6 Z;  3JAT B;  4CBC A;  1VF6 A;  3CC4 V;  1Y76 B;  2EBO A;  1RPO A;  3THO A;  1S5J A;  1SER A;  2O57 A;  2XTA A;  1Q86 W;  1R73 A;  4OPH A;  2L6L A;  1NJI W;  3K06 A;  3JD2 A;  2F66 C;  3N2G B;  2IM9 A;  1YHQ V;  2OCC B;  4B7E A;  3B4S A;  3A0B Z;  2ZE6 A;  3M7M X;  3CCV V;  1CPY A;  4DR3 B;  5LMN B;  3GWO A;  3RYH B;  5B1A C;  3P3P A;  3GB7 C;  3CE2 A;  1H2S B;  1EZV H;  3WG7 C;  2QKA A;  4O2A A;  5E79 Z;  3OMA B;  2ZIN A;  3OGI B;  4MTX A;  4JTC B;  5H5N A;  2HLD G;  3B2E E;  2XAG A;  1DGS A;  3BA9 A;  5CA3 A;  3ETG A;  1K7D A;  1HNW B;  4FK5 C;  4X1Y B;  4UCT A;  4O4I A;  1K4D C;  2LGW A;  5J2U A;  5CN0 A;  4B7K A;  4PI2 A;  2A9H A;  2DW4 A;  3QVN A;  4GUN A;  3AK1 A;  2ETN A;  4X65 O;  5J2U B;  4U3J A;  1YTF D;  1V9P A;  1NTM H;  3VQV A;  5CBF A;  3HR0 A;  1KEC A;  2XUM A;  2Q7E A;  1E1Q G;  5JH7 B;  4DV1 B;  4PDV A;  3ABL C;  2B1I A;  2WPD G;  3VQX A;  2BSK A;  2KG7 A;  5FNV A;  4YIO A;  1M56 C;  4EEQ A;  2B1G A;  4TT3 G;  2XHB A;  2E76 B;  1XMO B;  2CAZ C;  5IJ9 B;  3ZHT A;  1YDX A;  2YEV A;  5FL7 G;  4DV3 O;  2VWK A;  3WB0 A;  2CDY A;  2RNB A;  2E75 B;  3JAM N;  1ZSP A;  4X20 B;  2NNU A;  4LBE C;  1XUQ A;  4XDK A;  4RQE A;  4Q6G A;  2WLJ A;  1GMG A;  3JAS A;  2FB5 A;  2Z0A A;  5KHJ A;  5DN6 G;  4JZ2 A;  1WPX A;  1SQB H;  3KCY A;  1YZB A;  1GKF A;  2M7W A;  3K9S A;  1SQP H;  3CB2 A;  2ATK C;  3G4S V;  3JAS B;  1SF9 A;  3OUS A;  3E8H A;  5CMU A;  1TUB A;  1AI4 A;  4E4E A;  5LHH A;  1SA0 B;  3A2F A;  1XNQ O;  2UUC B;  2QTS A;  3EVK A;  3RYF A;  1VIB A;  4DV6 O;  1R3L C;  3VQY A;  5BMV A;  1EN6 A;  1KYO F;  3AK2 A;  2F1M A;  4CH3 A;  1KKD A;  3I5D A;  1Q7Y W;  2PYJ A;  2AZ2 A;  2GUZ A;  2Q4P A;  2ZXW C;  3ZIA G;  1OCC C;  3RGB A;  5BMV B;  3SYQ A;  3FAV A;  1FFX A;  3SYC A;  1YSC A;  3ZMZ A;  3BY6 A;  2NLJ C;  1XDC A;  4K8X A;  1W0K G;  1QVF U;  4UXN A;  1BHB A;  3CCL V;  3K5M A;  3G71 V;  4PA9 A;  3FX7 A;  3HPL C;  1K73 W;  4MT8 A;  2WSS G;  2W6J G;  2FKX A;  3APQ A;  4X66 O;  5CBH A;  2UXD O;  4XDJ A;  1NR7 A;  2OTJ V;  2IH3 C;  1XEQ A;  2AHZ A;  1M5I A;  1VQ8 V;  1AI5 A;  1VQ7 V;  1XIL A;  5D5P A;  2QWQ B;  3M99 B;  4X65 B;  4ICG A;  3WFV A;  5KAI Z;  1JPX A;  4H44 B;  1AJQ A;  1EBO A;  3RVZ A;  5EZY A;  4DV2 O;  1TAE A;  1FKA O;  3G6B A;  5BZB A;  3F7Y C;  3K3W A;  5AG2 A;  1WLE A;  3H1H H;  5D5Q A;  1F4N A;  2DYS B;  4J11 A;  3E2E A;  1VQ6 V;  1MA1 A;  4BIO A;  1H38 A;  2AZ0 A;  3SGI A;  4DV3 B;  2AXT Z;  3L75 H;  1YJN V;  1NI8 A;  4CC6 A;  4H33 A;  3CCR V;  4O4J B;  2DYR B;  4ZI7 B;  2IW5 A;  4F6E A;  4FM2 A;  4ZHQ A;  4DV0 B;  3G80 A;  3H1K H;  1VQ9 V;  2DN9 A;  4PA3 A;  1H2L A;  4J9Y B;  2HR3 A;  2QWP B;  4B3M O;  1T5E A;  4UCS A;  1AR5 A;  3D3Q A;  1GM7 A;  4DW0 A;  5KHI A;  3TGU H;  4PA4 A;  3SYA A;  2Q8V A;  4JI7 O;  5CA0 B;  1YIT V;  1ROP A;  3G6E V;  1GM8 A;  3TXQ A;  4F6R B;  1GK9 A;  3OMN B;  2Q69 A;  4XDL A;  1ENV A;  1YJ9 V;  3ASO B;  1MSW D;  4DV6 B;  1THZ A;  1ZX3 A;  2IH1 C;  3AG4 C;  1F23 A;  1AR4 A;  4O4L B;  5IY5 B;  3W7T A;  4PD4 F;  1H8H G;  2HP8 A;  1LR1 A;  1KD1 W;  5IYD O;  1WA8 A;  1PV0 A;  2QJ1 A;  4KFM A;  4WCE V;  1XBL A;  5B3S B;  1LNQ A;  2XAS A;  3UT5 B;  4WFA V;  3LUT B;  2UUA B;  1DK1 A;  4PI0 A;  5ITZ A;  1NBM G;  2JRI A;  3O9O A;  4X66 B;  1NU1 H;  1AP5 A;  2UXD B;  1NS1 A;  2A06 H;  2UXB O;  1SZX A;  2XT9 A;  1YI2 V;  2UXX A;  3K0D A;  3CJH B;  3CXH F;  1NT2 B;  4LCU C;  2X6C A;  1BGY H;  2PY5 A;  2PZS A;  1E1R G;  2QKC A;  3HKD A;  4JV5 O;  2ZT9 B;  4QPJ A;  5LP6 C;  1M93 A;  4UB8 Z;  2EJR A;  4QIW F;  4C7U A;  3X2Q C;  2XAJ A;  3HKD B;  4FFK A;  3JAL B;  3JSN A;  2JK5 C;  3UO2 A;  2EIN B;  4MVZ A;  2Y4U A;  1XHZ A;  1V54 C;  5EBL C;  4PJ0 Z;  3B40 A;  2ZR2 A;  2UXC O;  2QM4 A;  1VP7 A;  1VQ4 V;  2HKO A;  4YHH B;  3OM3 B;  3AG3 C;  4FLW A;  2FTK A;  1D5A A;  2YXH A;  4YJ3 B;  5GON A;  1QLE B;  3AG7 A;  4B3M B;  2JJ2 G;  1GRJ A;  2KQX A;  3CSX A;  1R3J C;  3FB5 C;  3IGA C;  4CS4 A;  3OMI B;  2AHY A;  4BR6 A;  4JI7 B;  2MK3 A;  1N34 O;  4LF9 O;  3CP1 A;  4FLU A;  4U3F H;  4K8Z A;  3D36 C;  1PP9 H;  3OW2 U;  1P49 A;  3CYO A;  5IYZ B;  5B1N A;  4X64 B;  2HVJ C;  1K5Q A;  1ARO P;  2CTP A;  2EIL B;  1TGO A;  2HJF C;  5LA6 A;  2F95 B;  1SQQ H;  1OCZ B;  4MVQ A;  1RM1 C;  3JD3 A;  3AG1 B;  2ZCE A;  4CS2 A;  5LOV A;  1M57 C;  3ZHS A;  1MG1 A;  1SC5 B;  1N0N A;  3RW0 A;  4X1I A;  2WLK A;  4FFB B;  2ITC C;  3OD4 A;  5EYP A;  4X62 O;  2X7R B;  4WF9 V;  4DUY B;  4H0L B;  5DM6 V;  2F93 B;  2Z3Y A;  1I5X A;  4RUE A;  2HG5 C;  4H37 A;  4JI5 O;  4J9Z B;  1N8R W;  4X1K B;  5B1B B;  1BMF G;  3RN4 A;  3ZRW A;  3RYC A;  3CD6 V;  1IXB A;  4JV5 B;  1N32 O;  4R50 A;  1QBZ A;  2PYL A;  1WP7 A;  4MS2 A;  1JMK C;  4G27 B;  3H1J H;  3UQ8 A;  2WLL B;  3DC6 A;  2JGD B;  2W0F C;  4GX5 A;  2RCV A;  2UXN A;  2OTL V;  1FXK C;  2ILM A;  4IYH A;  3R65 A;  4JI0 O;  3JD1 A;  2UXC B;  3BVO A;  3ZMU A;  4DR4 O;  1XNR O;  1D2D A;  2ZE7 A;  1KUQ A;  4B3T O;  3QO5 A;  3TCU A;  4GKJ O;  1Q6H A;  5IDJ A;  5KX5 A;  3OUF A;  1S76 D;  4PEL A;  4JZG A;  4FLT A;  4DK0 A;  4MSW C;  2EIJ C;  2QKS A;  1URF A;  2QTO A;  3I56 V;  2CTQ A;  2EIK B;  1N34 B;  4Q20 A;  4LF9 B;  4J80 A;  1AB3 A;  4DXW A;  3JYC A;  1RFY A;  3Q4H A;  4TQD A;  5CB4 B;  3JAK B;  1QHT A;  4FJC C;  5KMG A;  5J9P C;  4LFA O;  4J7J A;  1QR9 A;  1AP6 A;  3CXC U;  3ZRS A;  2IU0 A;  4PHZ A;  4BIZ A;  4LFC O;  2ZNI A;  5IYC O;  1QVG U;  1JFF A;  1KP2 A;  3ASN B;  4GX2 A;  4IYI A;  4OPA A;  1M9N A;  5JWP A;  4JAU A;  2DWE C;  4I9W A;  1K9M W;  3D36 A;  2YXL A;  4O4H A;  4LF6 B;  2A0L A;  1JFF B;  4X62 B;  3CC7 V;  3ZX6 A;  4FZ1 A;  2OIE A;  4X88 A;  1V55 C;  2QGN A;  1TUE B;  4PV1 B;  1S3J A;  1FJG O;  1OCO C;  4A5U B;  1US6 A;  5LYJ A;  1QLN A;  2CH7 A;  2LJ2 A;  4NTX A;  1BZK A;  4QPK A;  4Z1V A;  2XOK G;  2Y0P A;  5GW7 A;  5H9C A;  4JI5 B;  2Q68 A;  2CTR A;  1IDS A;  2Q0A A;  2Q67 A;  5EC1 C;  2GHY A;  2HEP A;  3LSS A;  4P9P A;  4NTY A;  5KA5 A;  1R3I C;  3CPW U;  1GN2 A;  5DED A;  5JJN B;  3J81 N;  1WB7 A;  4FZ0 A;  2ZM6 B;  2F4V O;  3U11 A;  4BWA A;  3E8B A;  4JI0 B;  4O2A B;  2YIC A;  1KKC A;  3L74 H;  1M1K W;  4JI2 O;  3CX5 F;  4DR4 B;  1XNR B;  2WLM A;  1Y74 A;  3E35 A;  1KP3 A;  2FML A;  4B3T B;  1I94 B;  3P3N A;  3SYO A;  4JYA O;  4GKJ B;  3ICX A;  3ABM C;  3CMA V;  4YXW G;  3J7A U;  4O4I B;  2VQF O;  1BCC H;  3JD4 A;  1WJZ A;  4LC1 A;  3VQW A;  1XRE A;  4LH6 A;  1Q81 W;  1BL8 A;  4JTD B;  1NH2 B;  2EIM C;  3DXR A;  4I0X A;  1NTZ H;  5L3D A;  4HZ3 A;  3TXS A;  1FXK A;  2IJK A;  4GX0 A;  3E22 A;  3ABK C;  4U3J B;  1VQP V;  5IE9 A;  2OCH A;  3HKC A;  4JI8 B;  4JI4 B;  1O9G A;  3SPC A;  5CBG A;  2BSK B;  2KG7 B;  1DLB A;  1K33 A;  4HBN A;  5FNV B;  1HDJ A;  2Y0I A;  3HKC B;  4ABM A;  3C3T A;  3CCQ V;  1JJO A;  2YEV B;  4Z1M G;  4UCR A;  1HW7 A;  3FB7 C;  4JAA A;  5BR8 O;  4RAI A;  4CH4 A;  2ZR3 A;  2ITD C;  1PM9 A;  3IC9 A;  1DTO A;  2ZDI C;  4JI6 O;  3KCX A;  4FIP C;  4LFB O;  3LNN A;  4DUZ O;  5KHK A;  4CZZ A;  3APO A;  4FM1 A;  3R66 A;  1FJG B;  3H1L H;  3CCS V;  1TUB B;  5C8Y A;  1OZ0 A;  4QE9 A;  2VQE O;  1SES A;  5LGN A;  2VWJ A;  1IBK O;  1UJW B;  1FFT B;  2HVK C;  3A0R A;  3RYF B;  2RQ6 A;  2Q9L A;  4RQF A;  4QNH B;  5C8Y B;  2KB1 A;  4KHP O;  2XAH A;  2IJI A;  2P22 C;  2L35 A;  2GUZ B;  1OCR C;  1F51 A;  1VQO V;  2F4V B;  3FAV B;  3O65 A;  1FFX B;  2D2C B;  4I5S A;  3B8M A;  1GTO A;  4LWS A;  4DR5 O;  2HHH O;  1EN5 A;  3KG2 A;  4JI2 B;  2P7T C;  1MAB G;  2JS3 A;  4J10 A;  4JAS A;  3ZHQ A;  3AEI A;  3OR6 C;  1H8E G;  2V4D A;  1ZUQ A;  2LGQ A;  4PDL A;  2JGU A;  2R70 A;  3B77 A;  1PNK A;  4TV8 A;  3ZRX A;  3EFF K;  2A3Q A;  5B1A B;  3DSQ A;  4UCV A;  1Q3E A;  3TJT A;  3SJC C;  1B3Q A;  4AIL C;  4X9Q A;  3WG7 B;  5F2V O;  4I50 A;  3UCS C;  5EZY B;  1NR1 A;  4LP8 A;  4IT5 A;  1QNM A;  2ARH A;  2V7Q G;  2JDI G;  3U10 A;  2AW9 A;  4PDR A;  4KP4 A;  4O2B A;  2M6Y A;  4HNA A;  5BR8 B;  5FPR A;  4DR7 O;  2IJH A;  4NTW A;  1NTK H;  4ZHQ B;  4WFG A;  1NVP B;  3CRC A;  5JJE B;  1G1X B;  1MNG A;  4NYK A;  4JI6 B;  3ZMV A;  2UU9 O;  4LFB B;  2QA4 V;  4DK1 A;  1Q6U A;  3ABL B;  1XNQ B;  1L0L H;  1M56 B;  5KUK A;  3MD0 A;  4YIP A;  3W7W A;  3IC7 A;  4F4L A;  2VQE B;  3RYI A;  3UO3 A;  4EB6 A;  2V1D A;  2OIG A;  3BEH A;  2N04 A;  4DR1 O;  1IBK B;  1AI6 A;  5B5E Z;  1EZJ A;  1PD3 A;  1PPJ H;  4DV4 O;  5HFM A;  2Y4T A;  2YXY A;  4KHP B;  1AI7 A;  2DQ0 A;  3D3I A;  4EB6 B;  5EBW C;  1YEW A;  1S0V A;  4DR2 O;  4UVA A;  4PDM A;  3OT7 A;  1S77 D;  3HKB A;  5JCO C;  1WA8 B;  1GN4 A;  5K1X A;  4UFZ A;  4DR5 B;  2HHH B;  3JAR A;  4J7Z A;  1JR9 A;  2YC0 A;  3E83 A;  4QE7 A;  2R72 A;  5L3E A;  3AG2 C;  4NR1 A;  5ITZ B;  1BSM A;  1JQ0 A;  4PA7 A;  4GT1 A;  2Y48 A;  4XBF A;  3SPH A;  3ZHV A;  2QWR B;  3IJ4 A;  3EHB B;  1SZT A;  5IWA O;  3LSQ A;  4MVR A;  3FB6 C;  4RO2 A;  4RUF A;  2IJJ A;  3EXA A;  2ZXW B;  1L1F A;  1OCC B;  5CA1 A;  3NXS A;  3DC5 A;  3HKE A;  3RBZ A;  4DV2 B;  1RSO A;  4I7Z B;  4KL1 A;  5IJ0 A;  2E5L O;  2Q5Z A;  1L8D A;  4UCO A;  3LDE A;  3BA8 A;  3P30 A;  1P7B A;  3HKE B;  3K5L A;  3H1I H;  2LFS A;  2XAQ A;  2B5U A;  2Y69 C;  3JCZ A;  5J2T A;  3SJQ C;  1H2M A;  3CRQ A;  4LF7 O;  4D7T A;  1MZE A;  4TWK A;  3K08 A;  1YVW A;  2ZNJ A;  4I4T A;  4DR7 B;  3OEE G;  2JVD A;  5LGT A;  1H2N A;  1Y67 A;  4TV9 A;  2PI4 A;  1G6U A;  4K35 A;  4JI1 O;  1X59 A;  2UU9 B;  5GON B;  3K9A A;  1S72 V;  5LXT A;  1DF5 A;  1WPB A;  2R9A A;  1XHX A;  3K79 A;  1IVS A;  1VQM V;  2X0L A;  3P32 A;  1M4U A;  1XMQ O;  4DR1 B;  1IXM A;  4KXR A;  1Y6X A;  2LFR A;  4GCZ A;  5H2F Z;  2WLI A;  3FFQ A;  1SQG A;  4DR2 B;  5B1O A;  5EIB D;  1QCE A;  5LA6 B;  3N2K A;  1VF6 C;  2Q73 A;  2OCC C;  3BAB A;  1MSD A;  2DJV A;  3OR7 C;  2JEU A;  4LF8 O;  5LOV B;  2P90 A;  3E86 A;  4P30 A;  4DR6 O;  3G67 A;  4WBN A;  4X1I B;  1Q5O A;  2UXB B;  3M8A A;  4UV8 A;  5EYP B;  1HNZ O;  3T1Y O;  2CTW A;  1WP8 A;  4I55 A;  3A8T A;  4YY3 O;  4H13 B;  4AI8 A;  3AG4 B;  3CEI A;  4CC5 A;  3TET A;  5IWA B;  5LMU O;  3ETE A;  1IZ3 A;  2F43 G;  5H6R A;  2ZIO A;  4K3A A;  4BAY A;  5JCO A;  1YIJ V;  4NVP A;  1Z5V A;  2RN9 A;  1Z5W A;  2BCC H;  3CCE V;  2E5L B;  2YS8 A;  3ZRW B;  3RYC B;  4CH6 A;  2CK3 G;  3JSL A;  5K1P A;  1EFR G;  5DEC A;  3ZN1 A;  2DOS A;  2GTA A;  1U96 A;  3ETD A;  4JI3 O;  5LMN O;  4DR3 O;  4L8J A;  4IIJ A;  1NKD A;  3PJS K;  2YIB A;  5IT9 N;  1N36 O;  3STZ C;  3WB2 A;  1K5S A;  5C93 A;  3BFR A;  1U97 A;  4TSF G;  5LP6 A;  4GYC B;  2BOB C;  1OHH G;  4UVB A;  4ZOL A;  2QM7 A;  4TOI A;  1OJH A;  4N23 A;  4R6Z A;  1HR0 O;  4JI1 B;  1K34 A;  5KX5 B;  3QG5 A;  5JVD A;  1P7G A;  2CGO A;  5LP6 B;  2P4V A;  2ZE5 A;  4GX1 A;  1K3E A;  1KQS U;  3T1C A;  3X2Q B;  1WNS A;  2QWN B;  5FLX N;  3AK3 A;  3K59 A;  3T2M A;  4WFH A;  1BS3 A;  2RJZ A;  2EUL A;  5JVD B;  5KA6 A;  1XMQ B;  4NB5 A;  5B66 Z;  1N0J A;  1V54 B;  5EBM C;  2Q6A A;  4FLV A;  2Q7G A;  2OT5 A;  3Q4H B;  4DV1 O;  4B08 A;  2YIA A;  5KMG B;  2LQT A;  3ABT A;  1FPO A;  3AG3 B;  1SKV A;  4WFB V;  3H01 A;  4J42 A;  1Q6I A;  2NR5 A;  2PUS A;  4P9O A;  3SJA C;  1IBL O;  2H8P C;  3B09 A;  4FVM A;  2WLH A;  4LF8 B;  2E74 B;  1K4C C;  5BXZ A;  3DTU B;  4DRX A;  4DR6 B;  4O4H B;  1YTF B;  2C2A A;  3T1Y B;  1CEZ A;  3JAT A;  4YY3 B;  2A7W A;  1Y76 A;  4JYB A;  3N27 A;  2YSU B;  5LYJ B;  2F23 A;  2CH7 B;  2DMX A;  5LMU B;  2E3C A;  2HFE C;  3OFN G;  3K58 A;  1RPR A;  2KKW A;  2UUC O;  4IGG A;  1N32 B;  3BCC H;  1G4Y B;  1MMM A;  1XL6 A;  1AR1 B;  1RM1 B;  3QO8 A;  2EJ7 A;  3ZMS A;  3RYH A;  4MTG A;  5LGU A;  1M57 B;  1IUR A;  1O9H A;  3FB8 C;  4JI3 B;  1JA8 A;  2P5O A;  2P6J A;  3ZJZ A;  1A32 A;  3L9D A;  1F7Y A;  2CUG A;  1N36 B;  1VQN V;  1HP8 A;  2DYS C;  4FLX A;  1ZWI C;  1NZ6 A;  3CHX A;  5LBQ A;  4X1Y A;  1G8M A;  1VMG A;  2LW1 A;  1R6K A;  1VQ5 V;  2EZP A;  1Y74 B;  4MVS A;  2P67 A;  3CC2 V;  2DYR C;  3ZCC A;  1FS0 G;  1HR0 B;  3MDS A;  1R6N A;  2RDC A;  1DF4 A;  4MTO A;  3UKM A;  2B9Z A;  3OGC C;  5JH7 A;  3BHP A;  4U7N A;  4B3S O;  2KSD A;  3DXR B;  3OAA G;  2WLN A;  1CP9 A;  4I0X B;  2UUB O;  4LFA B;  1FXK B;  1B06 A;  3E22 B;  1YXB A;  4AHC A;  5IJ9 A;  4LFC B;  1CXZ B;  4TUY A;  2BTO A;  4LNU A;  4Z2W A;  2X6B A;  5L3B A;  1GAX A;  4X20 A;  3E8F A;  1BE3 H;  1W59 A;  2YDE A;  3ASO C;  1VQL V;  4U7O A;  1XL4 A;  4TUY B;  1JVM A;  4LNU B;  4FMT A;  5IY5 C;  1IBL B;  3ZED A;  5KHG A;  3E8G A;  3LDC A;  2OYQ A;  4YJ2 A;  4FLZ A;  3J80 N;  2GV9 A;  2EIJ B;  4B3R O;  4DV0 O;  4N21 A;  2ZKO A;  2HJD A;  1WN7 A;  3H9V A;  3MHH C;  3ZN0 A;  4MVO A;  4YJ2 B;  3CWB H;  1SA0 A;  4CH5 A;  5B3S C;  4MTF A;  1KC8 W;  2G38 A;  1GO3 F;  2YI8 A;  2LP7 A;  3B8N A;  1PKX A;  2GSM B;  5KAF Z;  1HNX O;  1L0N H;  2QSA A;  1WAZ A;  1NH2 D;  1GM9 A;  1W0J G;  1ZAU A;  1X4T A;  4BW9 A;  3D8C A;  3RVY A;  3UM7 A;  5KLV H;  1PL0 A;  4K0K O;  3E89 A;  2OWO A;  4JAV A;  4G2K A;  3VOU A;  4JTA B;  3SDL A;  1KU9 A;  1V55 B;  1YF2 A;  3IAY A;  5EIB C;  2QR4 A;  4QJF B;  2H3O A;  2DQ3 A;  1GN6 A;  1OCO B;  1PL4 A;  2CGN A;  4LWS B;  3VBB A;  4JYA B;  2BTQ A;  3SPG A;  2EIN C;  1IBM O;  2UUA O;  2CE4 A;  2VQF B;  4ZIB A;  1ZTE A;  4LF5 O;  4G28 B;  1P84 F;  1KB9 F;  2BTQ B;  4QGP A;  1KMI Z;  3WB1 A;  1N33 O;  4JPR A;  5A2Q N;  2VS0 A;  4DV5 O;  1F4M A;  3T1H O;  1QLE C;  4WFE A;  4EKW A;  3STL C;  4TV8 B;  4X8A A;  4B3S B;  2UUB B;  1B04 A;  3L71 H;  4GZR B;  5KHH A;  2JS5 A;  1P4R A;  5EK0 A;  4EFE A;  3MHS C;  4I50 B;  3SJB C;  3K0G A;  2WWW A;  4IHJ A;  3CCU V;  1W2B U;  2IBZ H;  2JIZ G;  4O4J A;  4ZI7 A;  5L3C A;  3PN1 A;  3ABM B;  1AVM A;  3RT3 C;  1Y66 A;  1OV9 A;  4IHJ B;  1UPG A;  1JJ2 U;  4P2Z A;  2EIL C;  4NXM O;  2XAF A;  1COW G;  3WU2 Z;  1J5E O;  1XQ8 A;  4O2B B;  1IX9 A;  4HNA B;  4LF4 O;  4B3R B;  2EIM B;  1OCZ C;  4DUZ B;  1ORQ C;  3AG1 C;  4YHH O;  1VQK V;  1J95 A;  3TK1 A;  3KZI Z;  3L70 H;  4UV9 A;  4OXS A;  1I5Y A;  5CA0 A;  3ABK B;  4OGQ B;  2YI9 A;  4J41 A;  5HFL A;  1ZL8 A;  2GDS A;  3HB3 B;  4F6R A; 
#chains in the Genus database with same CATH homology
 3H9V A;  4DW1 A;  4DW0 A;  3I5D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...