4DW0A

Crystal structure of the atp-gated p2x4 ion channel in the closed, apo state at 2.9 angstroms
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
330
structure length
330
Chain Sequence
GTLNRFTQALVIAYVIGYVFVYNKGYQDTDTVLSSVTTKVKGIALTKTSELGERIWDVADYIIPPQEDGSFFVLTNMIITTNQTQSKCAENPTPASTCTSHRDCKRGFNDARGDGVRTGRCVSYSASVKTCEVLSWCPLEKIVDPPNPPLLADAERFTVLIKNNIRYPKFNFNKRNILPNINSSYLTHCVFSRKTDPDCPIFRLGDIVGEAEEDFQIMAVRGGVMGVQIRWDCDLDMPQSWCVPRYTFRRLDNKDPDNNVAPGYNFRFAKYYKNSDGTETRTLIKGYGIRFDVMVFGQAGKFNIIPTLLNIGAGLALLGLVNVICDWIVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords P2X purinoceptor
publication title Molecular mechanism of ATP binding and ion channel activation in P2X receptors.
pubmed doi rcsb
source organism Danio rerio
molecule tags Transport protein
total genus 82
structure length 330
sequence length 330
ec nomenclature
pdb deposition date 2012-02-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.940 Mainly Alpha Orthogonal Bundle Helix Hairpins atp-gated p2x4 ion channel 4dw0A01
2.60.490.10 Mainly Beta Sandwich atp-gated p2x4 ion channel fold atp-gated p2x4 ion channel domain 4dw0A02
3I5DA 4DW1A 3H9VA 4DW0A
chains in the Genus database with same CATH superfamily
4G27B 2JDIG 3KCXA 4QJFB 3CE2A 3FAVA 3TCUA 2WLLB 3ZX6A 1DGSA 1UPGA 2OCCC 2HVJC 3ZMSA 1N0JA 3RYFB 3IGAC 3AG1C 4MVZA 5E79Z 3SPHA 1JCHA 3R66A 4JI2O 2Q67A 3JSLA 4BIZA 1VF5B 5L3GA 3SJCC 3ZCCA 5BXZA 2Q4PA 1ZUQA 1M56B 1BHAA 2L35A 2EJ7A 3CSXA 3JAKB 1VQ7V 4DUYB 1U96A 4FFBB 3ETDA 4XDLA 1PNKA 3CCJV 3AG4C 5DM6V 3CCVV 5KAFZ 1RM1C 4Z1MG 2ZM6B 5BY1A 1QLEC 2GUZB 5F2VO 4IHJB 1UFIA 2ADQB 1FJGB 2W6IG 4D7SA 3O9OA 4KHPO 3M7MX 2ADPA 4B3RO 3W7SA 4J9ZB 4RO2A 2Z3YA 2W0FC 2CTWA 3RYIB 1EZJA 3F7VC 4ZOLA 3E8GA 3MD0A 4O4IB 3JCZA 3OTOB 4Q6GA 3SGIA 1WA8A 1AP6A 3OEEG 1GN6A 3TJTA 5LP6C 3U0ZA 2IBZH 2EULA 4X1IA 1IDSA 5IJ9A 2ITDC 1F4NA 3C3SA 3FAVB 4L87A 3APOA 1JMKC 2UXCB 3LSSA 3W7UA 4X89A 3ZS8C 1AJNA 1TUBB 1Y66A 2M6YA 3E8BA 4DUYO 3ABKC 3HR0A 3K9SA 1PV0A 3E22B 3OMIB 5JJJB 1Y74A 4W4LA 3GWOA 5IWAB 1R6TA 1S77D 3L71H 4MW8A 1K7DA 2IU0A 1EFRG 3OD4A 1DLBA 4GZRB 1H8HG 1JJ2U 1L8DA 1URFA 2XTAA 1XMQB 3SYCA 3J81N 1J5EO 3RW0A 4X64B 4F4LA 1ZX3A 5LMNB 3CJHA 2GV9A 3FKSG 3G67A 1KKCA 2XAHA 1B06A 2DWDC 3AK3A 2A9HA 2GDSA 4ZHQB 1VP7A 1SF9A 1JOYA 4YY3B 1NH2D 2XAFA 2YUAA 2BOCC 1VQ4V 2A7WA 5B1AB 1Q82W 4DR3O 1S72V 1GKFA 1FXHA 1F4MA 2EINC 4DV0O 2B9ZA 3OEHG 3D36C 1AROP 5IYBO 2EX3A 5JJNB 2EIKB 1FXVA 5DN6G 1Z2GA 1VQMV 1WA8B 3B8MA 2F4VB 1FXKA 1XL4A 2EIMB 2YXYA 4ICGA 3I55V 2Y69C 3K0DA 4WFAV 1WJZA 3D8CA 4X1IB 5EBMC 3CRMA 3I5DA 5IJ9B 2JS5A 2LFSA 4DR6O 2DYRB 5CMUA 1MSDA 2QTOA 1K97A 5L3CA 1FS0G 1RPOA 4X1KA 4LFBO 4IT5A 3OR7C 4IYHA 4H13B 5EYPA 4B3SO 4JV5O 1HNXO 1Y74B 4UVBA 1SA0A 2OYQA 2CE4A 1VQ5V 2YXHA 3QO5A 1NVPB 3OMNB 1WB8A 4DR2O 1KUQA 2UU9O 1NI8A 2QE7G 4JTAB 5BZBA 1ZL8A 4DR4O 5B1NA 3S3WA 4MW3A 4LWSA 4DV4O 4LF5B 1J95A 4TWKA 2KKWA 1F51A 3CJHB 1KKDA 4GYCB 3H1IH 4OX9O 2QA4V 2XT9A 3UKMA 3E8HA 2A0LA 4TUYB 5H2FZ 2X6CA 3EHBB 1N36B 2HHHB 1GN2A 2A79B 4R8CA 4CH4A 3ABMB 3B8NA 1HNWB 4DV5O 3SPIA 4OPAA 4MTXA 2WAMA 4J10A 5EK0A 2FKXA 2IU3A 1SQFA 2Y4TA 3T1YO 4CC6A 1V9PA 5GTIZ 5BR8B 4LF8O 3ASOB 3E35A 4JZ2A 1KMIZ 4X88A 4K3AA 1NZ6A 3K5LA 5IYZA 4UCOA 1KC8W 2YI8A 1XNRB 4MVSA 4DK1A 1KBHA 3N2KA 1WP8A 3AK1A 3CB2A 1TVKA 1Q90D 2UXBB 5LGTA 1IBMB 3TGUH 1H2GA 1G1XB 4JAUA 5LL6Y 3UT5A 5EYPB 4GKJO 2XAJA 4PELA 2ZDIC 4KP4A 4FLVA 3FFQA 5KHIA 2EBOA 2YI9A 1FKAO 1R6KA 4MVUA 2E5LO 1YIJV 4H37A 5H6QA 2LQTA 1RPRA 1ZL8B 4JZGA 4ZBMA 4CH5A 4F6EA 4LWSB 2Z5UA 3JATA 4WFGA 2DE0X 5B1BC 2LJ2A 1N34B 4R7CA 1H2LA 3CXHF 4YXWG 4GX0A 4JI6O 4BWAA 4I0XA 2WLMA 4YJ2A 2ATKC 4K8XA 4U7OA 2ZIMA 5IE9A 3Q4HA 1IBKB 1YEWA 2PI4A 2XASA 2X0LA 3K03A 4MVQA 1O9HA 2E3CA 4QE9A 4O4HA 4FLTA 5LHIA 2O57A 3S3XA 1THZA 4CH6A 4AI8A 2CTQA 4JI1O 2FYUH 1K5QA 1QBZA 4I55A 3ASNB 2VS0A 1NR7A 1NS1A 1O9GA 1IVSA 4H33A 1IURA 2Q0OC 1S3JA 2PI5A 1W59A 4GKKB 4FLYA 1TUEB 1US6A 4OGQB 5IYZB 2F1MA 2NNUA 4XDKA 3ML0A 4RQFA 3N2KB 5L3EA 2WLIA 2OCCB 2F93B 1TVKB 3ETEA 2XOKG 2LGWA 5LGUA 2JGDB 1GM9A 3CRAA 3GB7C 3T2MA 1AP5A 4O2BA 1JFFA 2JGUA 4KL1A 4YHHO 4B3TO 2R72A 3N2GA 2P90A 4DR7O 4I7ZB 5FL7G 2YEVA 1AI6A 1IBLB 2PYJA 3G80A 3BRCA 3B09A 4B7EA 3JATB 2ZCEA 1BL8A 3D3IA 3G6EV 4JI3O 2PF4E 3RVZA 3CXCU 4J41A 1S5HC 4I0XB 2DQ0A 4YJ2B 2HJFC 2GSMB 1LR1A 3BAAA 4LF6B 4LFCO 2UUCB 1VQLV 2K9PA 4IL6Z 3K5MA 4JASA 1PNMA 4DR5O 3H01A 1AI7A 4B3MB 2GBOA 4W4KA 4TQFA 3OMAB 3E83A 1VQ6V 2XAQA 2YSUB 4D7TA 3WU2Z 2UXDO 2WWWA 3ZMTA 3K9AA 1BS3A 3F7YC 3A2FA 4KUMA 2IJIA 3T4DA 3F5WC 2VQEB 2W0XA 4MTFA 3K5NA 2XHBA 4JPRA 2YS8A 1E1RG 4PA3A 3HKCA 1HW7A 2ZXWB 4GCZA 5GW7A 1AI5A 4FFKA 1VQ8V 1PL4A 4NR1A 4X65O 1BZKA 3ZHRA 2C2AA 5J9PC 1HNZB 3IFXA 5FNVA 1I5XA 4UFZA 4ZIBA 4JI5O 1FPOA 2EILB 4BIUA 3WG7C 1WPXA 2QJ1A 1QR9A 1V54B 4U3JA 3CMAV 4ZI7A 4JYBA 4WFBV 2JJ1G 3IJ4A 3SJQC 3SPCA 5EIBD 5KA5A 4OPHA 2QDOA 3OFNG 4HAMA 4J7JA 5CA1A 2QWNB 4CBCA 3CCMV 4JI4O 5LA6B 2HR3A 1Q6UA 1E79G 1BMFG 1VF6C 3J7AU 3D3QA 2JJ2G 1BHBA 4XBFA 4AQYB 3VQYA 2CUGA 1ZTEA 2OIEA 2PY5A 2X7RB 3UQ8A 3LSQA 1JQ0A 4J42A 1LUWA 2EIJB 1WAZA 2EZOA 1Q81W 5JVDA 2WSSG 3O65A 1QNMA 3ICXA 1R3LC 1VARA 3OAAG 3CC7V 1OCZB 1K9MW 2QKCA 3F5TA 2NR5A 4QIWF 1P4RA 1CPYA 1HNZO 4BAYA 5B1OA 5LOVA 2DN9A 2V1DA 4RWUA 2NLJC 1SRYA 2UUAO 2OWOA 4FZ1A 4JYYA 3JARA 5IT9N 3PN1A 4AHCA 1QLNA 5JH7B 4JAVA 1VIBA 3DXRA 1U97A 4D6TH 3QG5A 4DV2O 3OR6C 1KYOF 1M90W 5FNVB 2P7TC 4LF7B 3JALB 4X66B 3ETGA 4R50A 3ZHUA 2AGAA 1I0HA 2ZR3A 2AHZA 1I94B 4P30A 3C90A 2VWKA 1K34A 5BMVA 1W0JG 2PZSA 3HKBA 5J2UA 2B1GA 5H6RA 2IH1C 2M7WA 1PKXA 2LFRA 1PD3A 2IJHA 5CA1B 3L73H 4JF3A 4R6ZA 2FMLA 3BPZA 3JD4A 1TA8A 2JEUA 4ABMA 3M99B 1XNQB 4O4LB 3RYHA 4H0LB 3CWBH 2H3OA 4PA7A 1N33B 4FM1A 1MNGA 1V55B 4PD4F 1EM1A 4JI0B 3FX7A 3QNEA 2Q73A 3CCRV 5JVDB 2QWPB 5EZYA 4X9QA 3ZJZA 2ZNIA 4K8ZA 3L75H 1D5AA 5E1AC 4X20A 2KG7A 4U3FH 1YJ9V 3UM7A 2RQ6A 1PM9A 3HPLC 5LOVB 4FVMA 3H1JH 2ZM6O 2Q7HA 4CS4A 5JJEB 1I94O 2ZNJA 1FJGO 2OT5A 1M5IA 3JARB 3AG3C 3CMEV 4JYAB 5A2QN 3DXRB 4FLUA 5KHJA 2B1IA 1EN5A 3KKYA 1P7BA 4ASUG 5B5EZ 4G2KA 2IW5A 2W6JG 1R3JC 3OTOO 4I4TA 1D5NA 3R65A 1ZWIC 3K08A 3HB3B 2Y48A 3ABLB 2P22C 2N05A 1VQNV 4NTWA 3KZIZ 5KMGA 3JYCA 1UJWB 5J2TA 1XMOB 4FLWA 1Q6IA 1OCRC 3FYIB 2UXCO 3FB5C 5J2UB 5K1PA 4FPPA 4ZOLB 2QWRB 1IZ3A 1OCCB 2DYSB 4KFMA 3GWKC 1K8AW 3RBZA 5B66Z 1GN3A 2RNBA 1VMGA 2DOSA 2ETNA 3X2QB 3C3TA 4EFBA 2ZINA 5IWAO 1M9NA 3TXSA 4DUZB 2HJDA 5HFLA 2Q6AA 1R6NA 4DV7B 1RP3B 4LF9B 4GUNA 1EN4A 4DW1A 1XMQO 3ZMZA 4GLXA 3G6BA 5FPOA 5CB4A 3E2EA 3B2EE 1T5EA 2LW7A 5EZYB 4X64O 5LMNO 3WB0A 2WLNA 2QM8A 5B3SB 1XOUA 4JI8B 4I9WA 3VQVA 3DC6A 4X20B 2KG7B 4P9OA 4Q20A 1ZAUA 4BW5A 3RVYA 4YY3O 1H8EG 4X62B 1M56C 2OIGA 2H94A 4DXWA 1M57B 1E1QG 1S5JA 1GAXA 1JJOA 1JR9A 4QPJA 5CBGA 4UCRA 4RUEA 1KD1W 3AG2B 2HG5C 4PA9A 2LO1A 1QHTA 3LUTB 2VQFB 3KCYA 4I4TB 2Q5ZA 2F4VO 1AVMA 3CD6V 1OZ0A 1GH6A 2BSKA 2ZR2A 5KMGB 2EZPA 2E76B 5J2TB 4DRXA 4DR1B 1XL6A 1BQZA 5LMUB 3QF7A 3JAWA 3SYAA 4X1YA 2ZE7A 3VBBA 2QEXV 3QVNA 4JI7B 2P4VA 4JTDB 1VF6A 4H44B 3JD2A 4QPKA 3T1HB 3BVOA 1FXKB 1GTOA 4YIOA 2HFEC 3ZBHA 2P4KA 1HR0B 1KQSU 4LF4B 2Q7EA 1NJIW 3H9VA 2MK3A 5L3FA 5TISZ 1Q3EA 1FAFA 1QQCA 3MHHC 3B77A 1BE3H 2OTJV 3ZIAG 4LF5O 4X1KB 1GK9A 4PDRA 3ZMVA 1ZLZA 5CBHA 1NQTA 1G8MA 1SA0B 5GONA 1SS3A 3ZMUA 1N36O 5K1XA 2HHHO 1BT8A 2YDEA 1XQ8A 1D2DA 1P49A 3SJAC 1Q43A 1HNWO 3ZRVA 1EZVH 4DV6B 4PA6A 1VEWA 1VQOV 2CTPA 1SERA 3SR2C 4NTXA 4FM0A 2DQ3A 3FYEB 4J7ZA 2KB1A 3ZN0A 2DW4A 5L3DA 5B1AC 5BR8O 4EEQA 5IY5B 2V4DA 2LP7A 3P30A 3HKDA 1R3KC 3IAYA 2LW1A 4B08A 2OTLV 3CRRA 4ZKIA 1NTZH 2YIBA 4NYKA 4LF4O 1P84F 3APQA 2EIKC 3UO2A 4DRXB 1YF2A 1XNRO 1N32B 3STZC 1G4YB 1OCOB 4GX5A 3OUSA 3IC9A 2UXBO 3CC4V 1I7FA 4AILC 1Q5OA 1IBMO 2EIMC 1IXBA 1WN7A 4N23A 3L9DA 1SQXH 2JRIA 3ETQA 2HLDG 5LP6A 1GO3F 3CHXA 4J11A 4F6RA 4DV3B 4WF9V 5FPRA 1YTFB 1WB7A 1NU1H 3JD0A 3JAMN 1EBOA 1NTKH 4LFAB 3H1LH 1Y76A 3ABUA 3BCCH 4PHZA 2A3QA 1SQQH 4NXMB 1ORQC 3CCLV 3SJBC 1F23A 2F66C 3UT5B 1N34O 1I5YA 1NTMH 3AG1B 1CEZA 1RSOA 1NBMG 1NVPD 1WPBA 2QR4A 2P6JA 1IBKO 5GONB 2XNDG 3AG7A 4IGGA 3U11A 3VQXA 3STLC 2UUBB 2R9IA 1TAEA 3LDDA 2X6BA 5KHGA 4FLXA 2MW2B 2RCVA 2PYLA 1XHZA 3ZHVA 4DV1B 3AG4B 2P5OA 1RM1B 3WB2A 3ABMC 3HKDB 1QLEB 1MA1A 2D3OW 3Q4HB 2ZE8A 5LXTA 1ENVA 2IJJA 1KB9F 4GKKO 2QSAA 4FIPC 4O4JA 3G4SV 1QU7A 3D36A 4O4HB 5LHHA 3ASOC 5LBQA 5A9GA 1AB3A 4FM2A 3K5OA 1XDCA 4LP8A 5C93A 4K0KB 4NVPA 1SESA 4WFHA 2WLLA 3E89A 4I55B 4UVAA 4NXNB 5LP6B 3EFFK 2L6LA 3NR7A 2CGOA 1SQBH 2CH7A 4F6RB 3CX5F 1N0NA 4FZ0A 1X59A 3CCUV 1IBLO 1YITV 1FFTB 1Y6XA 2WLIB 2ZQMA 3BFRA 2QGNA 1XHXA 2Q68A 2PTMA 3FB6C 3K57A 3ABKB 1SZTA 1YZBA 1L0NH 4O2BB 1JFFB 2X6AA 1S5LZ 1RSOB 4P2ZA 1Q8IA 3N2GB 1XILA 2DMXA 4TT3G 5EIBC 5CA3A 1IXMA 4BW9A 4LF6O 2R9AA 2YEVB 3JAKA 2UUCO 1IX9A 2YIAA 1AR4A 3BA8A 3LNMB 3DC5A 4B3MO 3RT3C 3K3WA 2CTRA 4YIPA 1DF5A 3CCEV 4UCVA 4MSWC 4HNAA 1Y67A 1NH2B 2ZKOA 4JI2B 2P67A 3RYCA 4L8JA 2ITCC 1VQ9V 1Z5WA 2CGNA 4CZZA 3CPWU 2VQEO 2VWJA 4O4IA 2EINB 1AILA 4LCUC 3BEHA 3ZRXA 4I5SA 4PJ0Z 2AZ2A 3SYPA 1NT2B 2FTKA 4JAAA 3OE7G 3THOA 1MABG 2QKSA 3ASNC 4MT8A 1HP8A 5AG2A 4KHPB 4U7NA 4B3RB 1M93A 4WBNA 2YC0A 1ROPA 5JCOC 5IYCO 1H2SB 1YHQV 4B7KA 1TUBA 2Y69B 2JVDA 3M8AA 1YTFD 2CH7B 4BIOA 1WP7A 3K04A 3HKCB 3E22A 2CK3G 4P9PA 1VF7A 5IYDO 1KP2A 1OV9A 4LBEC 4PDVA 3MHSC 3A0BZ 2AW9A 2EJRA 3CCSV 3DGEA 1CXZB 3P32A 5KHHA 2HP8A 2Q69A 1MOFA 4WCEV 1KP3A 2ZDIA 4LR3A 5HFMA 2WPDG 1DF4A 4WFEA 4AQYO 4J7KA 4QE7A 4GT1A 4PDLA 3CEIA 4U3JB 4NTYA 3SYQA 3W7WA 4DW0A 4ZI7B 2KSDA 4TOIA 1AR5A 5IDJA 3EVKA 3OT7A 2R70A 1H2NA 4ZHQA 1SQPH 3VQWA 2Q8VA 4CH3A 1S0VA 1SETA 2A06H 1PP9H 3CYOA 2QWQB 3CRQA 4HNAB 1XBLA 1R1BA 2QKAA 2QWOB 2HVKC 3RYCB 2FB5A 4UCUA 1HDJA 1J5EB 2GTSA 2XAGA 3BABA 3WB1A 3JCUZ 2YIBD 3CP1A 1SQGA 1K3EA 1JPXA 2NN4A 1GRJA 4CS3A 3KG2A 2YICA 1XREA 1SKVA 4A5UB 4C7UA 5LGNA 2PUSA 5GTHZ 3DSQA 2VRZA 5EC2C 2Q9LA 4RAIA 5ITZA 1YXBA 4DR3B 3U10A 4LF7O 2RMKB 4WBNB 2ZXWC 4DV0B 4X66O 1BSMA 1RFYA 4FLZA 3JD3A 2AHYA 4RUFA 4RQEA 3RGBA 1SZXA 1AJQA 2KQXA 4N21A 1EN6A 1DTOA 1Z5VA 2EILC 2FL4A 1Y4MA 5H5NA 3FD9A 4UV9A 5DEDA 1V54C 3N27A 2GTAA 1QVFU 1XNQO 2R9RB 3BY6A 3A8TA 4DR6B 3RFRA 1N33O 5KA6A 2BE3A 1FD9A 2B5UA 4KXRA 4JI0O 4LFBB 5BMVB 4UV8A 4E2LA 2AXTZ 5DECA 4LNUA 4GX1A 2QM7A 4MVOA 3HKBB 4LH7A 4EB6A 4B3SB 1X4TA 4PI2A 4JV5B 1HNXB 4TV8A 1BQ0A 1ZSPA 2BTQA 3DTUB 5B1BB 4TUYA 3I56V 4DR2B 1KECA 3CCQV 2UU9B 2EIJC 4TQDA 3RYHB 4DR4B 4I50A 1XEQA 2H8PC 4DV4B 4LC1A 3ZEDA 1OCZC 1N4CA 3SPGA 3K06A 3H1HH 4JYAO 4OX9B 3RWRD 4O2AA 4UB6Z 4XDJA 1W2BU 1M1KW 2P06A 1YDXA 3ZHQA 4TSFG 5KUKA 2UXNA 1PNLA 3TK1A 2D2CB 5ITZB 5LHGA 3FB8C 4PI0A 1OJHA 4DV5B 2CDYA 1LNQA 1XMOO 4CS2A 1K33A 3A0HZ 5JQGA 3T1YB 4LF8B 4K35A 3GVMA 2DJVA 3OGIB 3W7XA 5H9CA 5CBFA 4IYIA 1YJWV 4OXSA 4MVRA 4FMTA 1QVGU 3J80N 4DUZO 3P3PA 1SC5B 2WA4A 2RJZA 3JASA 4DV7O 4LF9O 2HKOA 3OUFA 1TGOA 4MTOA 2ILMA 4LNUB 3WFVA 4GKJB 4EB6B 5LYJA 1N8RW 4TV8B 3PJSK 5KAIZ 1AI4A 4Z2WA 2BTQB 1HWYA 2E5LB 1B3QA 1V55C 4JI8O 1MG1A 3ZHSA 3TXQA 4MVMA 4I50B 4X62O 2IM9A 2BTOA 4YJ3A 3BHPA 4WFFA 1FFXA 5D5PA 3CRCA 4UUJC 4PV1B 1Q6HA 5KX5A 4JGSA 4O2AB 4UXNA 3ZRSA 4JI6B 3TETA 5CB4B 2HEPA 4CC5A 1NR1A 2F23A 3IC7A 3JSNA 1BCCH 1GMGA 4TV9A 3AK2A 2VQFO 3W7TA 1R73A 5JCOA 1GM8A 3HKEA 1VQPV 1H2KA 1JVMA 4MTGA 5EC1C 2JGDA 4DR1O 5JQGB 2G38A 4BR6A 3OM3B 5LMUO 1L0LH 4JI1B 4EKWA 3ABLC 2ZE6A 3E86A 1YCIA 3QO7A 2JEXA 1WNSA 4JI7O 1F7YA 1XUQA 3WG7B 3MAQA 3T1HO 4JYCA 1PL0A 2ODMA 3B4SA 3OGCC 1HR0O 1I08A 2AZ0A 2BSKB 3JASB 2ZIOA 4HBNA 4DK0A 1OCCC 2DYSC 2ARHA 3JD1A 1H2MA 1K4DC 1QCEA 5JWPA 3X2QC 2BCCH 4YHHB 3JAWB 4B3TB 5LYJB 1MZFA 3RN4A 4DR7B 4X1YB 1S76D 4QNHB 4UB8Z 3ZN1A 2WLJA 3NXSA 2UXXA 2N04A 4PA4A 4MS2A 2Y0IA 3SDLA 2QM4A 2V7QG 3BA9A 2F95B 3CS5A 2DYRC 4DO2A 1CP9A 2WA3A 4YJ3B 1XI1A 1FFXB 4JI3B 3K0GA 3LDCA 1PPJH 2OCHA 5B3SC 3L74H 5KX5B 1H38A 5C8YA 4DV6O 1B6QA 2IJKA 1MMMA 2LGQA 1G6UA 3UCSC 4LFCB 3ZRWA 4TV9B 1B04A 1M57C 2Q7GA 2Y4UA 1KU9A 4DR5B 3LNNA 5IJ0A 3AG2C 1L1FA 3HKEB 2JS3A 1BGYH 1WLEA 1AJPA 1AR1B 4HZ3A 1YSCA 1GN4A 2UXDB 1N32O 3K59A 2RN9A 2K1EA 5KLVH 5CA0A 3OTFA 3T4ZA 1OHHG 3CC2V 4FK5C 3L72H 1LUVA 3H1KH 3ZHTA 1JA8A 4IIJA 4X65B 4J80A 4DV3O 3MDSA 5LA6A 2ZE5A 4JI5B 3ABTA 4LFAO 4X8AA 3G71V 4UVCA 1FXKC 4Z1VA 2ZT9B 3FB7C 3K58A 3SYOA 1K4CC 4NXMO 2JK5C 4J9YB 1R3IC 5EBWC 2CAZC 4FJCC 4G28B 3SPJA 5FLXN 3OW2U 4PDMA 1MZEA 1K73W 4JI4B 3L70H 4LH6A 4UCSA 4E4EA 3VOUA 5CN0A 3RYFA 4UCTA 3QTCA 1Y76B 5EBLC 5C8YB 2E74B 2Z0AA 3T1CA 2IH3C 1Q7YW 2UUBO 4NKGB 5KHKA 4GX2A 3ZRWB 3UO3A 1QR8A 3P3NA 1COWG 4DV1O 2F43G 1Q86W 1YI2V 2RDCA 5JH7A 1VQKV 5KUMA 2ZD9A 3LSUA 2DWEC 5IJ0B 4FFBA 2YIDA 3AG3B 5D5QA 1M4UA 3K79A 1P7GA 4JTCB 2WLKA 2YXLA 5IY5C 3JALA 1W0KG 2GUZA 4QGPA 1NKDA 4IHJA 5CA0B 4EFEA 1SQVH 3LDEA 2UUAB 3B40A 3AEIA 4K0KO 5L3BA 3A0RA 2QTSA 1YJNV 3QO8A 4NXNO 2XUMA 4IIJB 1OCOC 3RYIA 4DV2B 2BOBC 5LXTB 1JX9A 2PGGA 1K92A 1YVWA 2E75B 1MSWD 1FYJA 1K5SA 1OCRB 4O4JB 4NB5A 2N74A 3E8FA 4O4LA 4I9QA 2Y0PA 1A32A 4DYLA 2JIZG 4HYOA 2GHYA 1GM7A 2Q0AA 1DK1A 2WLHA 3EXAA
chains in the Genus database with same CATH topology
3I5DA 4DW1A 3H9VA 4DW0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I5D A;  4DW1 A;  3H9V A;  4DW0 A; 
#chains in the Genus database with same CATH topology
 4G27 B;  2JDI G;  3KCX A;  4QJF B;  3CE2 A;  3FAV A;  3TCU A;  2WLL B;  3ZX6 A;  1DGS A;  1UPG A;  2OCC C;  2HVJ C;  3ZMS A;  1N0J A;  3RYF B;  3IGA C;  3AG1 C;  4MVZ A;  5E79 Z;  3SPH A;  1JCH A;  3R66 A;  4JI2 O;  2Q67 A;  3JSL A;  4BIZ A;  1VF5 B;  5L3G A;  3SJC C;  3ZCC A;  5BXZ A;  2Q4P A;  1ZUQ A;  1M56 B;  1BHA A;  2L35 A;  2EJ7 A;  3CSX A;  3JAK B;  1VQ7 V;  4DUY B;  1U96 A;  4FFB B;  3ETD A;  4XDL A;  1PNK A;  3CCJ V;  3AG4 C;  5DM6 V;  3CCV V;  5KAF Z;  1RM1 C;  4Z1M G;  2ZM6 B;  5BY1 A;  1QLE C;  2GUZ B;  5F2V O;  4IHJ B;  1UFI A;  2ADQ B;  1FJG B;  2W6I G;  4D7S A;  3O9O A;  4KHP O;  3M7M X;  2ADP A;  4B3R O;  3W7S A;  4J9Z B;  4RO2 A;  2Z3Y A;  2W0F C;  2CTW A;  3RYI B;  1EZJ A;  3F7V C;  4ZOL A;  3E8G A;  3MD0 A;  4O4I B;  3JCZ A;  3OTO B;  4Q6G A;  3SGI A;  1WA8 A;  1AP6 A;  3OEE G;  1GN6 A;  3TJT A;  5LP6 C;  3U0Z A;  2IBZ H;  2EUL A;  4X1I A;  1IDS A;  5IJ9 A;  2ITD C;  1F4N A;  3C3S A;  3FAV B;  4L87 A;  3APO A;  1JMK C;  2UXC B;  3LSS A;  3W7U A;  4X89 A;  3ZS8 C;  1AJN A;  1TUB B;  1Y66 A;  2M6Y A;  3E8B A;  4DUY O;  3ABK C;  3HR0 A;  3K9S A;  1PV0 A;  3E22 B;  3OMI B;  5JJJ B;  1Y74 A;  4W4L A;  3GWO A;  5IWA B;  1R6T A;  1S77 D;  3L71 H;  4MW8 A;  1K7D A;  2IU0 A;  1EFR G;  3OD4 A;  1DLB A;  4GZR B;  1H8H G;  1JJ2 U;  1L8D A;  1URF A;  2XTA A;  1XMQ B;  3SYC A;  3J81 N;  1J5E O;  3RW0 A;  4X64 B;  4F4L A;  1ZX3 A;  5LMN B;  3CJH A;  2GV9 A;  3FKS G;  3G67 A;  1KKC A;  2XAH A;  1B06 A;  2DWD C;  3AK3 A;  2A9H A;  2GDS A;  4ZHQ B;  1VP7 A;  1SF9 A;  1JOY A;  4YY3 B;  1NH2 D;  2XAF A;  2YUA A;  2BOC C;  1VQ4 V;  2A7W A;  5B1A B;  1Q82 W;  4DR3 O;  1S72 V;  1GKF A;  1FXH A;  1F4M A;  2EIN C;  4DV0 O;  2B9Z A;  3OEH G;  3D36 C;  1ARO P;  5IYB O;  2EX3 A;  5JJN B;  2EIK B;  1FXV A;  5DN6 G;  1Z2G A;  1VQM V;  1WA8 B;  3B8M A;  2F4V B;  1FXK A;  1XL4 A;  2EIM B;  2YXY A;  4ICG A;  3I55 V;  2Y69 C;  3K0D A;  4WFA V;  1WJZ A;  3D8C A;  4X1I B;  5EBM C;  3CRM A;  3I5D A;  5IJ9 B;  2JS5 A;  2LFS A;  4DR6 O;  2DYR B;  5CMU A;  1MSD A;  2QTO A;  1K97 A;  5L3C A;  1FS0 G;  1RPO A;  4X1K A;  4LFB O;  4IT5 A;  3OR7 C;  4IYH A;  4H13 B;  5EYP A;  4B3S O;  4JV5 O;  1HNX O;  1Y74 B;  4UVB A;  1SA0 A;  2OYQ A;  2CE4 A;  1VQ5 V;  2YXH A;  3QO5 A;  1NVP B;  3OMN B;  1WB8 A;  4DR2 O;  1KUQ A;  2UU9 O;  1NI8 A;  2QE7 G;  4JTA B;  5BZB A;  1ZL8 A;  4DR4 O;  5B1N A;  3S3W A;  4MW3 A;  4LWS A;  4DV4 O;  4LF5 B;  1J95 A;  4TWK A;  2KKW A;  1F51 A;  3CJH B;  1KKD A;  4GYC B;  3H1I H;  4OX9 O;  2QA4 V;  2XT9 A;  3UKM A;  3E8H A;  2A0L A;  4TUY B;  5H2F Z;  2X6C A;  3EHB B;  1N36 B;  2HHH B;  1GN2 A;  2A79 B;  4R8C A;  4CH4 A;  3ABM B;  3B8N A;  1HNW B;  4DV5 O;  3SPI A;  4OPA A;  4MTX A;  2WAM A;  4J10 A;  5EK0 A;  2FKX A;  2IU3 A;  1SQF A;  2Y4T A;  3T1Y O;  4CC6 A;  1V9P A;  5GTI Z;  5BR8 B;  4LF8 O;  3ASO B;  3E35 A;  4JZ2 A;  1KMI Z;  4X88 A;  4K3A A;  1NZ6 A;  3K5L A;  5IYZ A;  4UCO A;  1KC8 W;  2YI8 A;  1XNR B;  4MVS A;  4DK1 A;  1KBH A;  3N2K A;  1WP8 A;  3AK1 A;  3CB2 A;  1TVK A;  1Q90 D;  2UXB B;  5LGT A;  1IBM B;  3TGU H;  1H2G A;  1G1X B;  4JAU A;  5LL6 Y;  3UT5 A;  5EYP B;  4GKJ O;  2XAJ A;  4PEL A;  2ZDI C;  4KP4 A;  4FLV A;  3FFQ A;  5KHI A;  2EBO A;  2YI9 A;  1FKA O;  1R6K A;  4MVU A;  2E5L O;  1YIJ V;  4H37 A;  5H6Q A;  2LQT A;  1RPR A;  1ZL8 B;  4JZG A;  4ZBM A;  4CH5 A;  4F6E A;  4LWS B;  2Z5U A;  3JAT A;  4WFG A;  2DE0 X;  5B1B C;  2LJ2 A;  1N34 B;  4R7C A;  1H2L A;  3CXH F;  4YXW G;  4GX0 A;  4JI6 O;  4BWA A;  4I0X A;  2WLM A;  4YJ2 A;  2ATK C;  4K8X A;  4U7O A;  2ZIM A;  5IE9 A;  3Q4H A;  1IBK B;  1YEW A;  2PI4 A;  2XAS A;  2X0L A;  3K03 A;  4MVQ A;  1O9H A;  2E3C A;  4QE9 A;  4O4H A;  4FLT A;  5LHI A;  2O57 A;  3S3X A;  1THZ A;  4CH6 A;  4AI8 A;  2CTQ A;  4JI1 O;  2FYU H;  1K5Q A;  1QBZ A;  4I55 A;  3ASN B;  2VS0 A;  1NR7 A;  1NS1 A;  1O9G A;  1IVS A;  4H33 A;  1IUR A;  2Q0O C;  1S3J A;  2PI5 A;  1W59 A;  4GKK B;  4FLY A;  1TUE B;  1US6 A;  4OGQ B;  5IYZ B;  2F1M A;  2NNU A;  4XDK A;  3ML0 A;  4RQF A;  3N2K B;  5L3E A;  2WLI A;  2OCC B;  2F93 B;  1TVK B;  3ETE A;  2XOK G;  2LGW A;  5LGU A;  2JGD B;  1GM9 A;  3CRA A;  3GB7 C;  3T2M A;  1AP5 A;  4O2B A;  1JFF A;  2JGU A;  4KL1 A;  4YHH O;  4B3T O;  2R72 A;  3N2G A;  2P90 A;  4DR7 O;  4I7Z B;  5FL7 G;  2YEV A;  1AI6 A;  1IBL B;  2PYJ A;  3G80 A;  3BRC A;  3B09 A;  4B7E A;  3JAT B;  2ZCE A;  1BL8 A;  3D3I A;  3G6E V;  4JI3 O;  2PF4 E;  3RVZ A;  3CXC U;  4J41 A;  1S5H C;  4I0X B;  2DQ0 A;  4YJ2 B;  2HJF C;  2GSM B;  1LR1 A;  3BAA A;  4LF6 B;  4LFC O;  2UUC B;  1VQL V;  2K9P A;  4IL6 Z;  3K5M A;  4JAS A;  1PNM A;  4DR5 O;  3H01 A;  1AI7 A;  4B3M B;  2GBO A;  4W4K A;  4TQF A;  3OMA B;  3E83 A;  1VQ6 V;  2XAQ A;  2YSU B;  4D7T A;  3WU2 Z;  2UXD O;  2WWW A;  3ZMT A;  3K9A A;  1BS3 A;  3F7Y C;  3A2F A;  4KUM A;  2IJI A;  3T4D A;  3F5W C;  2VQE B;  2W0X A;  4MTF A;  3K5N A;  2XHB A;  4JPR A;  2YS8 A;  1E1R G;  4PA3 A;  3HKC A;  1HW7 A;  2ZXW B;  4GCZ A;  5GW7 A;  1AI5 A;  4FFK A;  1VQ8 V;  1PL4 A;  4NR1 A;  4X65 O;  1BZK A;  3ZHR A;  2C2A A;  5J9P C;  1HNZ B;  3IFX A;  5FNV A;  1I5X A;  4UFZ A;  4ZIB A;  4JI5 O;  1FPO A;  2EIL B;  4BIU A;  3WG7 C;  1WPX A;  2QJ1 A;  1QR9 A;  1V54 B;  4U3J A;  3CMA V;  4ZI7 A;  4JYB A;  4WFB V;  2JJ1 G;  3IJ4 A;  3SJQ C;  3SPC A;  5EIB D;  5KA5 A;  4OPH A;  2QDO A;  3OFN G;  4HAM A;  4J7J A;  5CA1 A;  2QWN B;  4CBC A;  3CCM V;  4JI4 O;  5LA6 B;  2HR3 A;  1Q6U A;  1E79 G;  1BMF G;  1VF6 C;  3J7A U;  3D3Q A;  2JJ2 G;  1BHB A;  4XBF A;  4AQY B;  3VQY A;  2CUG A;  1ZTE A;  2OIE A;  2PY5 A;  2X7R B;  3UQ8 A;  3LSQ A;  1JQ0 A;  4J42 A;  1LUW A;  2EIJ B;  1WAZ A;  2EZO A;  1Q81 W;  5JVD A;  2WSS G;  3O65 A;  1QNM A;  3ICX A;  1R3L C;  1VAR A;  3OAA G;  3CC7 V;  1OCZ B;  1K9M W;  2QKC A;  3F5T A;  2NR5 A;  4QIW F;  1P4R A;  1CPY A;  1HNZ O;  4BAY A;  5B1O A;  5LOV A;  2DN9 A;  2V1D A;  4RWU A;  2NLJ C;  1SRY A;  2UUA O;  2OWO A;  4FZ1 A;  4JYY A;  3JAR A;  5IT9 N;  3PN1 A;  4AHC A;  1QLN A;  5JH7 B;  4JAV A;  1VIB A;  3DXR A;  1U97 A;  4D6T H;  3QG5 A;  4DV2 O;  3OR6 C;  1KYO F;  1M90 W;  5FNV B;  2P7T C;  4LF7 B;  3JAL B;  4X66 B;  3ETG A;  4R50 A;  3ZHU A;  2AGA A;  1I0H A;  2ZR3 A;  2AHZ A;  1I94 B;  4P30 A;  3C90 A;  2VWK A;  1K34 A;  5BMV A;  1W0J G;  2PZS A;  3HKB A;  5J2U A;  2B1G A;  5H6R A;  2IH1 C;  2M7W A;  1PKX A;  2LFR A;  1PD3 A;  2IJH A;  5CA1 B;  3L73 H;  4JF3 A;  4R6Z A;  2FML A;  3BPZ A;  3JD4 A;  1TA8 A;  2JEU A;  4ABM A;  3M99 B;  1XNQ B;  4O4L B;  3RYH A;  4H0L B;  3CWB H;  2H3O A;  4PA7 A;  1N33 B;  4FM1 A;  1MNG A;  1V55 B;  4PD4 F;  1EM1 A;  4JI0 B;  3FX7 A;  3QNE A;  2Q73 A;  3CCR V;  5JVD B;  2QWP B;  5EZY A;  4X9Q A;  3ZJZ A;  2ZNI A;  4K8Z A;  3L75 H;  1D5A A;  5E1A C;  4X20 A;  2KG7 A;  4U3F H;  1YJ9 V;  3UM7 A;  2RQ6 A;  1PM9 A;  3HPL C;  5LOV B;  4FVM A;  3H1J H;  2ZM6 O;  2Q7H A;  4CS4 A;  5JJE B;  1I94 O;  2ZNJ A;  1FJG O;  2OT5 A;  1M5I A;  3JAR B;  3AG3 C;  3CME V;  4JYA B;  5A2Q N;  3DXR B;  4FLU A;  5KHJ A;  2B1I A;  1EN5 A;  3KKY A;  1P7B A;  4ASU G;  5B5E Z;  4G2K A;  2IW5 A;  2W6J G;  1R3J C;  3OTO O;  4I4T A;  1D5N A;  3R65 A;  1ZWI C;  3K08 A;  3HB3 B;  2Y48 A;  3ABL B;  2P22 C;  2N05 A;  1VQN V;  4NTW A;  3KZI Z;  5KMG A;  3JYC A;  1UJW B;  5J2T A;  1XMO B;  4FLW A;  1Q6I A;  1OCR C;  3FYI B;  2UXC O;  3FB5 C;  5J2U B;  5K1P A;  4FPP A;  4ZOL B;  2QWR B;  1IZ3 A;  1OCC B;  2DYS B;  4KFM A;  3GWK C;  1K8A W;  3RBZ A;  5B66 Z;  1GN3 A;  2RNB A;  1VMG A;  2DOS A;  2ETN A;  3X2Q B;  3C3T A;  4EFB A;  2ZIN A;  5IWA O;  1M9N A;  3TXS A;  4DUZ B;  2HJD A;  5HFL A;  2Q6A A;  1R6N A;  4DV7 B;  1RP3 B;  4LF9 B;  4GUN A;  1EN4 A;  4DW1 A;  1XMQ O;  3ZMZ A;  4GLX A;  3G6B A;  5FPO A;  5CB4 A;  3E2E A;  3B2E E;  1T5E A;  2LW7 A;  5EZY B;  4X64 O;  5LMN O;  3WB0 A;  2WLN A;  2QM8 A;  5B3S B;  1XOU A;  4JI8 B;  4I9W A;  3VQV A;  3DC6 A;  4X20 B;  2KG7 B;  4P9O A;  4Q20 A;  1ZAU A;  4BW5 A;  3RVY A;  4YY3 O;  1H8E G;  4X62 B;  1M56 C;  2OIG A;  2H94 A;  4DXW A;  1M57 B;  1E1Q G;  1S5J A;  1GAX A;  1JJO A;  1JR9 A;  4QPJ A;  5CBG A;  4UCR A;  4RUE A;  1KD1 W;  3AG2 B;  2HG5 C;  4PA9 A;  2LO1 A;  1QHT A;  3LUT B;  2VQF B;  3KCY A;  4I4T B;  2Q5Z A;  2F4V O;  1AVM A;  3CD6 V;  1OZ0 A;  1GH6 A;  2BSK A;  2ZR2 A;  5KMG B;  2EZP A;  2E76 B;  5J2T B;  4DRX A;  4DR1 B;  1XL6 A;  1BQZ A;  5LMU B;  3QF7 A;  3JAW A;  3SYA A;  4X1Y A;  2ZE7 A;  3VBB A;  2QEX V;  3QVN A;  4JI7 B;  2P4V A;  4JTD B;  1VF6 A;  4H44 B;  3JD2 A;  4QPK A;  3T1H B;  3BVO A;  1FXK B;  1GTO A;  4YIO A;  2HFE C;  3ZBH A;  2P4K A;  1HR0 B;  1KQS U;  4LF4 B;  2Q7E A;  1NJI W;  3H9V A;  2MK3 A;  5L3F A;  5TIS Z;  1Q3E A;  1FAF A;  1QQC A;  3MHH C;  3B77 A;  1BE3 H;  2OTJ V;  3ZIA G;  4LF5 O;  4X1K B;  1GK9 A;  4PDR A;  3ZMV A;  1ZLZ A;  5CBH A;  1NQT A;  1G8M A;  1SA0 B;  5GON A;  1SS3 A;  3ZMU A;  1N36 O;  5K1X A;  2HHH O;  1BT8 A;  2YDE A;  1XQ8 A;  1D2D A;  1P49 A;  3SJA C;  1Q43 A;  1HNW O;  3ZRV A;  1EZV H;  4DV6 B;  4PA6 A;  1VEW A;  1VQO V;  2CTP A;  1SER A;  3SR2 C;  4NTX A;  4FM0 A;  2DQ3 A;  3FYE B;  4J7Z A;  2KB1 A;  3ZN0 A;  2DW4 A;  5L3D A;  5B1A C;  5BR8 O;  4EEQ A;  5IY5 B;  2V4D A;  2LP7 A;  3P30 A;  3HKD A;  1R3K C;  3IAY A;  2LW1 A;  4B08 A;  2OTL V;  3CRR A;  4ZKI A;  1NTZ H;  2YIB A;  4NYK A;  4LF4 O;  1P84 F;  3APQ A;  2EIK C;  3UO2 A;  4DRX B;  1YF2 A;  1XNR O;  1N32 B;  3STZ C;  1G4Y B;  1OCO B;  4GX5 A;  3OUS A;  3IC9 A;  2UXB O;  3CC4 V;  1I7F A;  4AIL C;  1Q5O A;  1IBM O;  2EIM C;  1IXB A;  1WN7 A;  4N23 A;  3L9D A;  1SQX H;  2JRI A;  3ETQ A;  2HLD G;  5LP6 A;  1GO3 F;  3CHX A;  4J11 A;  4F6R A;  4DV3 B;  4WF9 V;  5FPR A;  1YTF B;  1WB7 A;  1NU1 H;  3JD0 A;  3JAM N;  1EBO A;  1NTK H;  4LFA B;  3H1L H;  1Y76 A;  3ABU A;  3BCC H;  4PHZ A;  2A3Q A;  1SQQ H;  4NXM B;  1ORQ C;  3CCL V;  3SJB C;  1F23 A;  2F66 C;  3UT5 B;  1N34 O;  1I5Y A;  1NTM H;  3AG1 B;  1CEZ A;  1RSO A;  1NBM G;  1NVP D;  1WPB A;  2QR4 A;  2P6J A;  1IBK O;  5GON B;  2XND G;  3AG7 A;  4IGG A;  3U11 A;  3VQX A;  3STL C;  2UUB B;  2R9I A;  1TAE A;  3LDD A;  2X6B A;  5KHG A;  4FLX A;  2MW2 B;  2RCV A;  2PYL A;  1XHZ A;  3ZHV A;  4DV1 B;  3AG4 B;  2P5O A;  1RM1 B;  3WB2 A;  3ABM C;  3HKD B;  1QLE B;  1MA1 A;  2D3O W;  3Q4H B;  2ZE8 A;  5LXT A;  1ENV A;  2IJJ A;  1KB9 F;  4GKK O;  2QSA A;  4FIP C;  4O4J A;  3G4S V;  1QU7 A;  3D36 A;  4O4H B;  5LHH A;  3ASO C;  5LBQ A;  5A9G A;  1AB3 A;  4FM2 A;  3K5O A;  1XDC A;  4LP8 A;  5C93 A;  4K0K B;  4NVP A;  1SES A;  4WFH A;  2WLL A;  3E89 A;  4I55 B;  4UVA A;  4NXN B;  5LP6 B;  3EFF K;  2L6L A;  3NR7 A;  2CGO A;  1SQB H;  2CH7 A;  4F6R B;  3CX5 F;  1N0N A;  4FZ0 A;  1X59 A;  3CCU V;  1IBL O;  1YIT V;  1FFT B;  1Y6X A;  2WLI B;  2ZQM A;  3BFR A;  2QGN A;  1XHX A;  2Q68 A;  2PTM A;  3FB6 C;  3K57 A;  3ABK B;  1SZT A;  1YZB A;  1L0N H;  4O2B B;  1JFF B;  2X6A A;  1S5L Z;  1RSO B;  4P2Z A;  1Q8I A;  3N2G B;  1XIL A;  2DMX A;  4TT3 G;  5EIB C;  5CA3 A;  1IXM A;  4BW9 A;  4LF6 O;  2R9A A;  2YEV B;  3JAK A;  2UUC O;  1IX9 A;  2YIA A;  1AR4 A;  3BA8 A;  3LNM B;  3DC5 A;  4B3M O;  3RT3 C;  3K3W A;  2CTR A;  4YIP A;  1DF5 A;  3CCE V;  4UCV A;  4MSW C;  4HNA A;  1Y67 A;  1NH2 B;  2ZKO A;  4JI2 B;  2P67 A;  3RYC A;  4L8J A;  2ITC C;  1VQ9 V;  1Z5W A;  2CGN A;  4CZZ A;  3CPW U;  2VQE O;  2VWJ A;  4O4I A;  2EIN B;  1AIL A;  4LCU C;  3BEH A;  3ZRX A;  4I5S A;  4PJ0 Z;  2AZ2 A;  3SYP A;  1NT2 B;  2FTK A;  4JAA A;  3OE7 G;  3THO A;  1MAB G;  2QKS A;  3ASN C;  4MT8 A;  1HP8 A;  5AG2 A;  4KHP B;  4U7N A;  4B3R B;  1M93 A;  4WBN A;  2YC0 A;  1ROP A;  5JCO C;  5IYC O;  1H2S B;  1YHQ V;  4B7K A;  1TUB A;  2Y69 B;  2JVD A;  3M8A A;  1YTF D;  2CH7 B;  4BIO A;  1WP7 A;  3K04 A;  3HKC B;  3E22 A;  2CK3 G;  4P9P A;  1VF7 A;  5IYD O;  1KP2 A;  1OV9 A;  4LBE C;  4PDV A;  3MHS C;  3A0B Z;  2AW9 A;  2EJR A;  3CCS V;  3DGE A;  1CXZ B;  3P32 A;  5KHH A;  2HP8 A;  2Q69 A;  1MOF A;  4WCE V;  1KP3 A;  2ZDI A;  4LR3 A;  5HFM A;  2WPD G;  1DF4 A;  4WFE A;  4AQY O;  4J7K A;  4QE7 A;  4GT1 A;  4PDL A;  3CEI A;  4U3J B;  4NTY A;  3SYQ A;  3W7W A;  4DW0 A;  4ZI7 B;  2KSD A;  4TOI A;  1AR5 A;  5IDJ A;  3EVK A;  3OT7 A;  2R70 A;  1H2N A;  4ZHQ A;  1SQP H;  3VQW A;  2Q8V A;  4CH3 A;  1S0V A;  1SET A;  2A06 H;  1PP9 H;  3CYO A;  2QWQ B;  3CRQ A;  4HNA B;  1XBL A;  1R1B A;  2QKA A;  2QWO B;  2HVK C;  3RYC B;  2FB5 A;  4UCU A;  1HDJ A;  1J5E B;  2GTS A;  2XAG A;  3BAB A;  3WB1 A;  3JCU Z;  2YIB D;  3CP1 A;  1SQG A;  1K3E A;  1JPX A;  2NN4 A;  1GRJ A;  4CS3 A;  3KG2 A;  2YIC A;  1XRE A;  1SKV A;  4A5U B;  4C7U A;  5LGN A;  2PUS A;  5GTH Z;  3DSQ A;  2VRZ A;  5EC2 C;  2Q9L A;  4RAI A;  5ITZ A;  1YXB A;  4DR3 B;  3U10 A;  4LF7 O;  2RMK B;  4WBN B;  2ZXW C;  4DV0 B;  4X66 O;  1BSM A;  1RFY A;  4FLZ A;  3JD3 A;  2AHY A;  4RUF A;  4RQE A;  3RGB A;  1SZX A;  1AJQ A;  2KQX A;  4N21 A;  1EN6 A;  1DTO A;  1Z5V A;  2EIL C;  2FL4 A;  1Y4M A;  5H5N A;  3FD9 A;  4UV9 A;  5DED A;  1V54 C;  3N27 A;  2GTA A;  1QVF U;  1XNQ O;  2R9R B;  3BY6 A;  3A8T A;  4DR6 B;  3RFR A;  1N33 O;  5KA6 A;  2BE3 A;  1FD9 A;  2B5U A;  4KXR A;  4JI0 O;  4LFB B;  5BMV B;  4UV8 A;  4E2L A;  2AXT Z;  5DEC A;  4LNU A;  4GX1 A;  2QM7 A;  4MVO A;  3HKB B;  4LH7 A;  4EB6 A;  4B3S B;  1X4T A;  4PI2 A;  4JV5 B;  1HNX B;  4TV8 A;  1BQ0 A;  1ZSP A;  2BTQ A;  3DTU B;  5B1B B;  4TUY A;  3I56 V;  4DR2 B;  1KEC A;  3CCQ V;  2UU9 B;  2EIJ C;  4TQD A;  3RYH B;  4DR4 B;  4I50 A;  1XEQ A;  2H8P C;  4DV4 B;  4LC1 A;  3ZED A;  1OCZ C;  1N4C A;  3SPG A;  3K06 A;  3H1H H;  4JYA O;  4OX9 B;  3RWR D;  4O2A A;  4UB6 Z;  4XDJ A;  1W2B U;  1M1K W;  2P06 A;  1YDX A;  3ZHQ A;  4TSF G;  5KUK A;  2UXN A;  1PNL A;  3TK1 A;  2D2C B;  5ITZ B;  5LHG A;  3FB8 C;  4PI0 A;  1OJH A;  4DV5 B;  2CDY A;  1LNQ A;  1XMO O;  4CS2 A;  1K33 A;  3A0H Z;  5JQG A;  3T1Y B;  4LF8 B;  4K35 A;  3GVM A;  2DJV A;  3OGI B;  3W7X A;  5H9C A;  5CBF A;  4IYI A;  1YJW V;  4OXS A;  4MVR A;  4FMT A;  1QVG U;  3J80 N;  4DUZ O;  3P3P A;  1SC5 B;  2WA4 A;  2RJZ A;  3JAS A;  4DV7 O;  4LF9 O;  2HKO A;  3OUF A;  1TGO A;  4MTO A;  2ILM A;  4LNU B;  3WFV A;  4GKJ B;  4EB6 B;  5LYJ A;  1N8R W;  4TV8 B;  3PJS K;  5KAI Z;  1AI4 A;  4Z2W A;  2BTQ B;  1HWY A;  2E5L B;  1B3Q A;  1V55 C;  4JI8 O;  1MG1 A;  3ZHS A;  3TXQ A;  4MVM A;  4I50 B;  4X62 O;  2IM9 A;  2BTO A;  4YJ3 A;  3BHP A;  4WFF A;  1FFX A;  5D5P A;  3CRC A;  4UUJ C;  4PV1 B;  1Q6H A;  5KX5 A;  4JGS A;  4O2A B;  4UXN A;  3ZRS A;  4JI6 B;  3TET A;  5CB4 B;  2HEP A;  4CC5 A;  1NR1 A;  2F23 A;  3IC7 A;  3JSN A;  1BCC H;  1GMG A;  4TV9 A;  3AK2 A;  2VQF O;  3W7T A;  1R73 A;  5JCO A;  1GM8 A;  3HKE A;  1VQP V;  1H2K A;  1JVM A;  4MTG A;  5EC1 C;  2JGD A;  4DR1 O;  5JQG B;  2G38 A;  4BR6 A;  3OM3 B;  5LMU O;  1L0L H;  4JI1 B;  4EKW A;  3ABL C;  2ZE6 A;  3E86 A;  1YCI A;  3QO7 A;  2JEX A;  1WNS A;  4JI7 O;  1F7Y A;  1XUQ A;  3WG7 B;  3MAQ A;  3T1H O;  4JYC A;  1PL0 A;  2ODM A;  3B4S A;  3OGC C;  1HR0 O;  1I08 A;  2AZ0 A;  2BSK B;  3JAS B;  2ZIO A;  4HBN A;  4DK0 A;  1OCC C;  2DYS C;  2ARH A;  3JD1 A;  1H2M A;  1K4D C;  1QCE A;  5JWP A;  3X2Q C;  2BCC H;  4YHH B;  3JAW B;  4B3T B;  5LYJ B;  1MZF A;  3RN4 A;  4DR7 B;  4X1Y B;  1S76 D;  4QNH B;  4UB8 Z;  3ZN1 A;  2WLJ A;  3NXS A;  2UXX A;  2N04 A;  4PA4 A;  4MS2 A;  2Y0I A;  3SDL A;  2QM4 A;  2V7Q G;  3BA9 A;  2F95 B;  3CS5 A;  2DYR C;  4DO2 A;  1CP9 A;  2WA3 A;  4YJ3 B;  1XI1 A;  1FFX B;  4JI3 B;  3K0G A;  3LDC A;  1PPJ H;  2OCH A;  5B3S C;  3L74 H;  5KX5 B;  1H38 A;  5C8Y A;  4DV6 O;  1B6Q A;  2IJK A;  1MMM A;  2LGQ A;  1G6U A;  3UCS C;  4LFC B;  3ZRW A;  4TV9 B;  1B04 A;  1M57 C;  2Q7G A;  2Y4U A;  1KU9 A;  4DR5 B;  3LNN A;  5IJ0 A;  3AG2 C;  1L1F A;  3HKE B;  2JS3 A;  1BGY H;  1WLE A;  1AJP A;  1AR1 B;  4HZ3 A;  1YSC A;  1GN4 A;  2UXD B;  1N32 O;  3K59 A;  2RN9 A;  2K1E A;  5KLV H;  5CA0 A;  3OTF A;  3T4Z A;  1OHH G;  3CC2 V;  4FK5 C;  3L72 H;  1LUV A;  3H1K H;  3ZHT A;  1JA8 A;  4IIJ A;  4X65 B;  4J80 A;  4DV3 O;  3MDS A;  5LA6 A;  2ZE5 A;  4JI5 B;  3ABT A;  4LFA O;  4X8A A;  3G71 V;  4UVC A;  1FXK C;  4Z1V A;  2ZT9 B;  3FB7 C;  3K58 A;  3SYO A;  1K4C C;  4NXM O;  2JK5 C;  4J9Y B;  1R3I C;  5EBW C;  2CAZ C;  4FJC C;  4G28 B;  3SPJ A;  5FLX N;  3OW2 U;  4PDM A;  1MZE A;  1K73 W;  4JI4 B;  3L70 H;  4LH6 A;  4UCS A;  4E4E A;  3VOU A;  5CN0 A;  3RYF A;  4UCT A;  3QTC A;  1Y76 B;  5EBL C;  5C8Y B;  2E74 B;  2Z0A A;  3T1C A;  2IH3 C;  1Q7Y W;  2UUB O;  4NKG B;  5KHK A;  4GX2 A;  3ZRW B;  3UO3 A;  1QR8 A;  3P3N A;  1COW G;  4DV1 O;  2F43 G;  1Q86 W;  1YI2 V;  2RDC A;  5JH7 A;  1VQK V;  5KUM A;  2ZD9 A;  3LSU A;  2DWE C;  5IJ0 B;  4FFB A;  2YID A;  3AG3 B;  5D5Q A;  1M4U A;  3K79 A;  1P7G A;  4JTC B;  2WLK A;  2YXL A;  5IY5 C;  3JAL A;  1W0K G;  2GUZ A;  4QGP A;  1NKD A;  4IHJ A;  5CA0 B;  4EFE A;  1SQV H;  3LDE A;  2UUA B;  3B40 A;  3AEI A;  4K0K O;  5L3B A;  3A0R A;  2QTS A;  1YJN V;  3QO8 A;  4NXN O;  2XUM A;  4IIJ B;  1OCO C;  3RYI A;  4DV2 B;  2BOB C;  5LXT B;  1JX9 A;  2PGG A;  1K92 A;  1YVW A;  2E75 B;  1MSW D;  1FYJ A;  1K5S A;  1OCR B;  4O4J B;  4NB5 A;  2N74 A;  3E8F A;  4O4L A;  4I9Q A;  2Y0P A;  1A32 A;  4DYL A;  2JIZ G;  4HYO A;  2GHY A;  1GM7 A;  2Q0A A;  1DK1 A;  2WLH A;  3EXA A; 
#chains in the Genus database with same CATH homology
 3I5D A;  4DW1 A;  3H9V A;  4DW0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...