4DW0A

Crystal structure of the atp-gated p2x4 ion channel in the closed, apo state at 2.9 angstroms
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
330
structure length
330
Chain Sequence
GTLNRFTQALVIAYVIGYVFVYNKGYQDTDTVLSSVTTKVKGIALTKTSELGERIWDVADYIIPPQEDGSFFVLTNMIITTNQTQSKCAENPTPASTCTSHRDCKRGFNDARGDGVRTGRCVSYSASVKTCEVLSWCPLEKIVDPPNPPLLADAERFTVLIKNNIRYPKFNFNKRNILPNINSSYLTHCVFSRKTDPDCPIFRLGDIVGEAEEDFQIMAVRGGVMGVQIRWDCDLDMPQSWCVPRYTFRRLDNKDPDNNVAPGYNFRFAKYYKNSDGTETRTLIKGYGIRFDVMVFGQAGKFNIIPTLLNIGAGLALLGLVNVICDWIVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mechanism of ATP binding and ion channel activation in P2X receptors.
pubmed doi rcsb
source organism Danio rerio
molecule tags Transport protein
molecule keywords P2X purinoceptor
total genus 82
structure length 330
sequence length 330
ec nomenclature
pdb deposition date 2012-02-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.940 Mainly Alpha Orthogonal Bundle Helix Hairpins atp-gated p2x4 ion channel 4dw0A01
2.60.490.10 Mainly Beta Sandwich atp-gated p2x4 ion channel fold atp-gated p2x4 ion channel domain 4dw0A02
3H9VA 4DW1A 4DW0A 3I5DA
chains in the Genus database with same CATH superfamily
3ZMVA 1HNWO 5IT9N 1DF5A 1OZ0A 2VQFO 1GO3F 4MW3A 3CPWU 2UUAO 4XBFA 4RQFA 3ASNC 2P4VA 1GM7A 4DV2B 1L0NH 1AP5A 2YEVB 4QPKA 4O4LA 2Y48A 3G6BA 1IBKB 2E3CA 4IGGA 4UB8Z 2EIKB 3QVNA 1JJ2U 2H3OA 2GHYA 2B1IA 2WA4A 1EBOA 1PL0A 5BMVA 5JJEB 1SQXH 5KAIZ 3RYCA 5IYDO 1QLNA 1VQNV 1P84F 4X65O 2UXCO 1AB3A 2XT9A 2OTJV 1KU9A 1H2SB 2ZIOA 4NXMO 2XASA 3FAVA 4DO2A 1Q5OA 3AG1B 3LNMB 1TVKB 1JX9A 4NXNO 3M99B 1SZXA 2ZD9A 5B66Z 1PP9H 4ZI7A 4GLXA 2E5LO 3CYOA 1FFXB 4U3JA 1WA8A 1AR1B 2UXBO 1PKXA 4WFFA 5HFMA 3WB0A 3W7WA 3KZIZ 5LMUB 2QTSA 4R6ZA 5LHHA 2DYSC 2UU9B 2UXCB 4C7UA 4NTXA 4UUJC 4YHHB 3JARA 1VIBA 3B4SA 1GN3A 3SYPA 5HFLA 4BW5A 4TQFA 3K5LA 3EVKA 3WB2A 1NJIW 2JS3A 4FM0A 2D3OW 4JI0O 5IE9A 3JAMN 2DE0X 1YZBA 4K0KO 4LF5B 2F95B 2YI8A 4DV2O 3D8CA 3E83A 4X65B 1SQBH 2VQEO 3AG2B 3JAWA 2Q5ZA 1F51A 2D2CB 4U3FH 5B5EZ 4AI8A 5EBLC 4TQDA 4Z1VA 5KA6A 4DW0A 1JFFA 3SJCC 4ZOLA 2OIEA 5D5QA 1AR4A 4DK0A 4PA6A 5L3CA 2BCCH 3ETDA 2OYQA 4LWSB 3ZRSA 2MW2B 3OW2U 4JI7O 3B09A 4X1KA 4YJ3B 1NQTA 2WSSG 3IGAC 2M6YA 2YIBD 5IY5C 4MTXA 5JH7A 2QSAA 5F2VO 3E8BA 3A0HZ 4PDVA 2BTQA 5LMNO 3K04A 1L1FA 1BGYH 1WPBA 1XMQO 4O4IB 3EHBB 3SDLA 1VQ4V 4DV7B 4JF3A 1FXKB 1Y67A 3SGIA 1VQLV 3L75H 3CC2V 4MVMA 4LFBO 4YXWG 5FNVA 4IL6Z 3N2GA 4PA7A 4J11A 1LNQA 2V4DA 1ZTEA 3L9DA 3RVZA 4TSFG 1T5EA 1QR9A 3K5NA 1THZA 4JV5B 2ZT9B 1J5EO 3JSLA 2OCHA 1B04A 4MTGA 1S77D 2IM9A 3KCXA 4ABMA 2PI4A 3DTUB 4QE7A 1GN2A 3HR0A 1FS0G 4HNAB 4KXRA 2OTLV 1D5NA 3D3QA 4LF7B 4FLTA 4LNUB 5JQGB 4DUZB 2A79B 2GSMB 3UCSC 1EFRG 4B7EA 3IJ4A 4G27B 5EC2C 4UCTA 1M93A 1JQ0A 2YEVA 1Z2GA 4X66B 1HR0O 4PHZA 4PA9A 1YITV 1OHHG 1S5JA 5CB4A 3AG7A 5LP6A 4H44B 4B3TO 4F6RB 1N0JA 4JI1O 2BSKA 2ILMA 5ITZB 1ZLZA 3Q4HA 4B3RO 2Q0AA 4GKJO 3G67A 4NVPA 2LFSA 1IXBA 1V9PA 4F6EA 2OWOA 4ASUG 2K1EA 4WFGA 5LXTA 2QGNA 4KFMA 1RPRA 1F4NA 4FK5C 2ZNIA 1IDSA 1NI8A 3CRCA 5LOVB 3LNNA 2EZOA 5J2TA 4P2ZA 5LMNB 2H8PC 3ZN0A 3CCEV 1V54C 3RYFB 2F4VB 1MA1A 4I50A 2PYJA 2LW7A 5EZYB 1PD3A 1WP8A 3RN4A 5JJJB 1HNXO 1Q6HA 1CXZB 3ABMC 3APQA 4MTFA 5GONA 1JMKC 4J9ZB 3FYIB 3CE2A 1XREA 4ICGA 2YIBA 2XNDG 1XMOO 3EFFK 1IURA 1O9HA 3B40A 2QWQB 1Q86W 4DV3B 4RWUA 1Z5VA 1LUVA 5IYCO 4DV7O 4Z1MG 4ZOLB 3CP1A 3OD4A 3RVYA 5LP6B 1AJNA 4OPHA 4UVAA 4O4HA 4UV8A 2GDSA 3A2FA 3ETQA 3SYCA 4AQYO 1HW7A 2NLJC 3PN1A 3G4SV 4G28B 3E22A 3OUSA 4UXNA 3RYCB 3BAAA 1HDJA 3CCRV 3JATA 3ZRXA 4MVSA 1DF4A 2P4KA 3K06A 3VQYA 3MHSC 4LBEC 1RM1B 1I08A 5DEDA 4CH3A 1IX9A 2Q68A 3ZRWA 3J81N 4DV0O 2E75B 5EBWC 5L3BA 4LR3A 4FLWA 3D36A 2RQ6A 4JI1B 4TV9B 2ZKOA 3L70H 4YHHO 4JI3B 4J7JA 1ENVA 2IW5A 2JEXA 2Y69B 3QO7A 3CXHF 1M56C 3TXSA 1BS3A 3BVOA 3RBZA 3SPGA 1VQOV 4K0KB 4JPRA 5CA1B 5GTHZ 5BR8B 2XUMA 3IC9A 4U7OA 5JCOC 5JVDB 4LF6O 3F5WC 2AZ2A 1XL6A 1BQ0A 2A3QA 2EINC 5ITZA 3T1YB 4DR5B 1V55B 5BXZA 5LGUA 4XDJA 5BY1A 1OCZC 3CRQA 2LP7A 3CCLV 4K35A 1Q90D 4L8JA 1N33O 4LF4B 1KYOF 1LR1A 4JI2O 3N2KA 1WPXA 1U96A 4G2KA 1CEZA 2GTAA 3K03A 4JYYA 3NXSA 1OCCB 2EJ7A 1IZ3A 2HVJC 3K08A 2YICA 3X2QC 4X8AA 3CCVV 1AILA 2Y69C 3E8GA 3CD6V 1M1KW 1G8MA 1J5EB 2Q4PA 4EFBA 3QG5A 3SPJA 4DUYB 2BE3A 4LF7O 1SQGA 3B8MA 4QPJA 4XDLA 5IWAB 1XILA 5IJ0A 5B3SB 3BEHA 2F23A 2IH1C 4QIWF 4TV9A 5L3FA 4N23A 1M4UA 4F6RA 3JD0A 3B77A 1OCOB 1VQ9V 3RW0A 2IU3A 1ZSPA 4JI6O 2F93B 2ARHA 4LF8O 3B8NA 2PI5A 2LGWA 4PV1B 1SC5B 3VQWA 2HR3A 5FNVB 4PD4F 1COWG 3I56V 2NNUA 3IC7A 1QBZA 4LFCO 4FZ1A 4HNAA 3E89A 3JD3A 2WLLA 4UCVA 4OGQB 4WBNA 4NYKA 2ZM6B 1KUQA 1XMQB 4KP4A 4LFCB 1ZUQA 3HKDB 2EULA 2EIJB 4JAAA 1FAFA 5KLVH 2B1GA 1M5IA 2M7WA 2JVDA 3TK1A 1R6KA 3DC6A 3HPLC 1XHZA 1DK1A 3VQVA 1TUBA 4J7ZA 2CK3G 4JI0B 2XAFA 2P7TC 1H2NA 3U10A 2JS5A 1H2KA 3JARB 4LH6A 4I0XB 1JOYA 5DECA 1SETA 3H1HH 2Q0OC 3ASOC 3BA9A 4CH5A 2PGGA 4IIJA 4LFAO 1VQ6V 2EBOA 4CS3A 4ZKIA 1AI6A 1NTMH 1RFYA 4UFZA 1YF2A 3CB2A 3H1IH 1Q8IA 3FB7C 2P67A 1EN4A 4J42A 4LNUA 4YIOA 5LYJB 3FFQA 3AG2C 1IBMO 4IHJA 2AGAA 4W4KA 1E1RG 1IBMB 5FLXN 1SQPH 1MABG 2X6CA 1XNQB 2EX3A 1W0KG 5H9CA 3GVMA 4LWSA 2BOCC 3HB3B 2RNBA 2Y4UA 4X89A 4KHPB 1YTFB 2E76B 3BPZA 2RN9A 4D7TA 2IJKA 5LA6A 4J10A 3ABLC 5JQGA 3CXCU 1Q43A 2OIGA 1ZAUA 4DRXA 5A9GA 5LA6B 3ZBHA 1BQZA 3K0DA 4JZ2A 2VS0A 3K5MA 3CS5A 2ZXWB 4O4IA 3CSXA 4YJ2A 3UT5A 1K9MW 3ZMZA 5LXTB 1HNWB 3TGUH 4KL1A 1NTKH 5CN0A 1V55C 1QR8A 4DR3B 1OV9A 1UPGA 4GX0A 1E79G 1F23A 1GM8A 3ABMB 2KKWA 1KMIZ 3OFNG 4TWKA 5H2FZ 3P3NA 3C90A 2YIDA 4NXMB 4O4HB 4GKKO 1RSOB 4J9YB 4KHPO 2HJFC 1VQ8V 2DOSA 2X6AA 1AVMA 3ZHSA 2W6IG 4TT3G 1PL4A 1G1XB 4ZHQA 1K4CC 2LW1A 5CBGA 3DXRB 2DWDC 5KMGB 2ZR2A 4JZGA 4TV8B 4JTCB 1YSCA 4NTYA 4GX5A 3ZRWB 2ZM6O 2K9PA 2UXDO 1MZEA 3QO5A 1HWYA 1SERA 1K92A 1RM1C 1WB7A 2X6BA 4FLUA 2JGDB 4KUMA 1I94O 1D2DA 1S5HC 1NS1A 3JCUZ 5B1NA 1FD9A 1K5SA 1BZKA 1BL8A 1SESA 5LP6C 2A9HA 3CHXA 3I5DA 1H2MA 2AW9A 2Z5UA 2BTOA 1K8AW 2L35A 4JTAB 2LJ2A 3O9OA 1US6A 3CCJV 2HKOA 4LCUC 2AHZA 2ETNA 5EC1C 4QGPA 3AG4C 3LSQA 1AJPA 4PJ0Z 1AR5A 3G6EV 1VF5B 3JD1A 5KUKA 3A8TA 3H1KH 2WLNA 4DUYO 5LBQA 3BFRA 3CRRA 2F66C 4MVRA 3BY6A 1Q6UA 1S3JA 4PI0A 3SYQA 3RYHA 1VF6C 2W0FC 1D5AA 1Y6XA 3BRCA 4FVMA 4DV4O 1SA0A 4YJ2B 3ZS8C 3CMEV 4PI2A 1HR0B 1SRYA 3VOUA 1AROP 3W7UA 1B3QA 4Z2WA 3L73H 2HVKC 3STZC 3RFRA 4I9QA 4MVOA 1VQ5V 1OCRB 4UCRA 3ZHRA 2WWWA 2GTSA 4DR7O 4LH7A 1Q7YW 1UJWB 1NBMG 4CZZA 2PYLA 4BIZA 2WLKA 4FLZA 4YY3O 2C2AA 2QM8A 4ZBMA 4ZIBA 3K79A 4FFKA 5IYBO 2EILC 3QTCA 3QNEA 3HKCB 4PDRA 4DR5O 4IYIA 1Y74B 4RAIA 4N21A 4JI5B 1S5LZ 1ZX3A 1R6TA 4UCOA 4LF6B 1PNLA 5K1XA 2N05A 3E86A 5BR8O 4X1IB 5LGTA 2WLLB 4RQEA 3RYIB 1PNKA 2IU0A 4DR4O 1GKFA 4DV5O 2P5OA 1N34B 3F7VC 1AJQA 1ZL8B 4WFEA 3N2GB 3K59A 1K5QA 4NR1A 1GTOA 2F43G 1XL4A 4F4LA 1NTZH 4LFAB 4AQYB 3WG7B 2Z3YA 5B1AB 1HNZO 1FPOA 5LL6Y 3MHHC 1YHQV 3SJBC 3ABTA 5EYPA 5TISZ 1FFXA 1BCCH 3WU2Z 1P7GA 5KA5A 1TUBB 3TJTA 1TVKA 5KHGA 3OR6C 4X20B 3LSSA 1YJ9V 2FMLA 3M7MX 4X62B 1Z5WA 4OX9B 4W4LA 2YI9A 2BOBC 1EM1A 3VQXA 2F4VO 2WPDG 1FJGO 4DV1O 2UUBB 2VWJA 4PA4A 2QEXV 3U0ZA 5KHIA 1M57C 4TUYB 1YEWA 3OEEG 2DYSB 3IFXA 3T4DA 5C8YB 3H9VA 1OCOC 1XMOB 5CA1A 1FKAO 5KX5B 1B06A 2ZE5A 2VRZA 4JAUA 5EIBD 1PM9A 2RCVA 2ZDIC 4LF5O 4P9OA 3TXQA 4CC5A 3T4ZA 1Q81W 4LF9B 1N32O 5FL7G 2WLIA 4RO2A 2UXXA 5CMUA 1QQCA 2Q8VA 4JI5O 4GX2A 4J80A 2CH7B 2QTOA 4JI6B 3MD0A 4IYHA 5EK0A 2ADQB 2DN9A 4YIPA 1R73A 3G71V 5CBFA 3JYCA 3THOA 5KAFZ 4IIJB 2PTMA 2Q67A 4YY3B 3SJAC 5CB4B 5J2UA 5KHHA 4EB6B 2R72A 4E2LA 2FYUH 1SZTA 2ITCC 1F7YA 3CCMV 1KKDA 5DN6G 4NB5A 2FB5A 2ZDIA 4FFBA 2QM4A 4O2BB 4ZI7B 3J7AU 2FTKA 1W0JG 1KBHA 5J2UB 4ZHQB 1N4CA 4MVQA 3ZHTA 4DRXB 2HHHO 3ZMUA 1WP7A 1N0NA 4I9WA 1H8HG 4H33A 3E8HA 4P9PA 2R9IA 4X1KB 4YJ3A 1M57B 2JK5C 2O57A 1QVFU 2X0LA 2HG5C 4DR7B 5LHIA 1GRJA 3T1CA 4I55A 3LSUA 2R70A 2ZNJA 1I0HA 3CRAA 2RJZA 1VF6A 3DSQA 4EKWA 5E1AC 4PDMA 1K34A 5EIBC 2GUZB 3HKBA 1BT8A 3JASB 3OMNB 2VWKA 3H01A 2V1DA 1Y76A 4DV6B 4LFBB 4JGSA 2E74B 4OPAA 3RT3C 4A5UB 2UUCO 2ITDC 4JI3O 2JIZG 2CGOA 4TV8A 1NZ6A 5IYZB 1O9GA 4AHCA 1I5XA 1MMMA 1IBLB 1PNMA 3SPCA 2AZ0A 1UFIA 5AG2A 4JTDB 1R3KC 3ABLB 1H38A 4DV1B 2NN4A 2UUBO 5E79Z 4CH6A 4DK1A 2YS8A 3S3XA 5GW7A 1EZVH 1Y74A 2FL4A 1SF9A 1M90W 1P49A 4CBCA 4OX9O 3JD2A 3KCYA 3N27A 1EN5A 3Q4HB 3FYEB 1FXVA 4WFAV 3LDEA 3T1HB 1YJNV 1EZJA 2ZINA 1SQVH 2HJDA 4U3JB 3A0RA 1M9NA 4B3SB 5L3EA 4UB6Z 5C93A 2EIJC 3GWKC 3WFVA 4FLXA 1HNZB 3C3SA 2YXYA 2VQEB 1VQPV 1I94B 4HBNA 3OGIB 1HNXB 4GKKB 2EIMC 2ATKC 3HKCA 1XOUA 3JAKB 1TA8A 4TUYA 1XQ8A 3ETEA 1QLEB 3APOA 1CPYA 4FJCC 4MTOA 1I7FA 4I7ZB 4JASA 4O2AB 4FM1A 1L0LH 3HKEB 3ZJZA 5LOVA 3ASOB 2CTRA 5LHGA 3K58A 1QU7A 3RYIA 1VF7A 5KX5A 1XNQO 2YSUB 4GUNA 2JGUA 1FXKA 2E5LB 3GB7C 1FYJA 4NXNB 3BHPA 1JJOA 1JCHA 1N36B 4DR2O 2DYRB 2DWEC 1ORQC 4U7NA 1YI2V 3U11A 3UQ8A 3R66A 2RDCA 2WLJA 1SA0B 1R1BA 3ABKC 3AK1A 1QVGU 1R3IC 2PF4E 1GAXA 1H2LA 1JVMA 2F1MA 2LGQA 1SS3A 2UXBB 4O2BA 2Y0PA 2CH7A 1IVSA 1MSDA 2WAMA 2IH3C 3DGEA 3J80N 5JJNB 3FD9A 2KSDA 4E4EA 3CCSV 1KC8W 3GWOA 4MS2A 1QCEA 2GUZA 3E22B 1K4DC 2P6JA 3HKBB 3JASA 4B08A 2UU9O 3LDCA 3IAYA 2QM7A 5CA3A 2QA4V 2DW4A 4O2AA 2KB1A 3OUFA 1Y4MA 3ZMTA 1LUWA 4AILC 3ZHVA 3OTFA 2JGDA 2N74A 4JI8B 4GX1A 3QO8A 1ZWIC 4JYBA 1M56B 3OM3B 2P22C 2QKCA 5JH7B 3OTOB 3C3TA 1Q3EA 5EZYA 2JRIA 5L3GA 3NR7A 4BIOA 3WB1A 4BW9A 5J9PC 1K3EA 1YXBA 5KUMA 3OAAG 2WLMA 3ZX6A 3MDSA 1YDXA 1OCZB 4EFEA 2XAQA 4O4JA 3STLC 1NVPD 5CA0A 4P30A 5H5NA 2CGNA 1KKCA 3JSNA 4FFBB 3OE7G 4Q6GA 4Q20A 1JFFB 5EYPB 1WN7A 5CBHA 4K3AA 2CTQA 4H13B 1NH2D 1XI1A 2IBZH 3F5TA 3TCUA 3FB6C 4B3MB 1KP3A 3SPIA 2LFRA 1PV0A 1MNGA 4UVCA 2PZSA 4JI7B 3P32A 4GT1A 3D3IA 2YXLA 3HKDA 1Q82W 4WCEV 2G38A 4JYAO 1G6UA 5B3SC 1NR1A 4D7SA 2IJJA 4JI8O 5D5PA 4HAMA 1IXMA 1NVPB 4WBNB 2UXNA 1JA8A 1VMGA 4JI2B 3JALB 3D36C 4CH4A 1ZL8A 2X7RB 3X2QB 1N33B 2NR5A 1U97A 1OCCC 3UO3A 1GN6A 3K57A 1F4MA 4DYLA 3O65A 5L3DA 1J95A 1MG1A 4NTWA 2YDEA 3PJSK 1N8RW 2AXTZ 2DQ3A 5JWPA 3AG1C 3FAVB 4BWAA 3CMAV 2HLDG 1QHTA 5IWAO 4DR6O 1H2GA 2ODMA 2ZXWC 1YCIA 3K5OA 5J2TB 2XAHA 1TAEA 4DW1A 4OXSA 5BMVB 4TOIA 2IJHA 1SQQH 4DR2B 1V54B 4GYCB 5IJ9A 4LP8A 2DMXA 1XHXA 1K7DA 3JCZA 3BCCH 1KP2A 4FPPA 3OT7A 1CP9A 3SR2C 2WLHA 3UO2A 3JATB 1N32B 4UV9A 2YIAA 2LO1A 4X1YB 4X64O 2Q9LA 2Z0AA 2Y4TA 4LF4O 2IJIA 3SYAA 2A7WA 3JD4A 2V7QG 3W7XA 2B9ZA 2ZE7A 4IT5A 4RUFA 2H94A 1JPXA 3CJHA 1N36O 2ZQMA 4PA3A 2JDIG 2QKAA 3JAKA 4DV0B 3L74H 4R7CA 1R3JC 2ZE6A 1FJGB 1H8EG 1IBKO 1GH6A 3ZCCA 3W7TA 4DR1B 3ICXA 2ZIMA 1AP6A 2ZR3A 2ZCEA 2QKSA 2P06A 1WNSA 1MZFA 1P7BA 2A06H 4QNHB 2GBOA 1NH2B 3SJQC 1L8DA 2FKXA 1R3LC 3H1JH 3LDDA 5IYZA 4B3SO 2YC0A 4IHJB 1W59A 3ZEDA 2Y0IA 3TETA 3ETGA 4BAYA 2RMKB 2CTPA 3T1HO 5B1AC 1NU1H 4MVZA 3ABKB 2Q7EA 3CCUV 4PDLA 4DV6O 2EIKC 4CS4A 4QE9A 1JR9A 4DR4B 3ZN1A 3BABA 4GKJB 2DYRC 3RWRD 2L6LA 1RSOA 1GK9A 3ZIAG 2KG7B 1RPOA 3R65A 3CCQV 4B7KA 1X4TA 2DJVA 3E35A 1MOFA 2R9RB 5KMGA 2XOKG 4J7KA 2DQ0A 3CJHB 3G80A 4CS2A 1GN4A 2EILB 1K33A 1KD1W 2PUSA 5IDJA 1BHAA 1Q6IA 2EINB 3QF7A 2HP8A 4K8ZA 1N34O 3UT5B 3OGCC 2QJ1A 3JAWB 3FB5C 2CAZC 5KHKA 2W0XA 3CC7V 5FPRA 1KECA 1IBLO 1R6NA 3ABUA 4DUZO 4K8XA 3MAQA 2AHYA 2EIMB 3ML0A 3FKSG 5EBMC 4R8CA 2UUCB 3K9AA 5IY5B 3AK2A 4H0LB 3VBBA 4I4TB 5IJ0B 1S76D 1PPJH 2QR4A 3ZHQA 4X66O 4QJFB 1YVWA 1I5YA 4WFHA 1VP7A 3JALA 3L71H 4H37A 2HHHB 1BE3H 1YIJV 4B3TB 1NKDA 2XAJA 3AG3B 3H1LH 4MT8A 1YJWV 4XDKA 4X20A 2JEUA 1QNMA 2EJRA 1XEQA 4EB6A 3CWBH 2Q7GA 5H6QA 4MSWC 1XBLA 1XUQA 1K97A 3T1YO 1AI7A 5LYJA 4JI4O 1MSWD 2A0LA 4HYOA 1S0VA 1W2BU 2EZPA 4FMTA 2Q73A 4LF9O 2R9AA 5CA0B 2JJ2G 1VQKV 2B5UA 1DTOA 4X62O 1WA8B 3AEIA 3ZRVA 2HFEC 3LUTB 2Q6AA 5KHJA 2PY5A 5FPOA 3RGBA 4DR1O 1A32A 4I50B 4L87A 4D6TH 1FFTB 5GTIZ 4X88A 2UXDB 2KG7A 2QWOB 5K1PA 3P3PA 1KQSU 5GONB 1YTFD 4DV3O 4HZ3A 4R50A 5BZBA 4UCUA 1SQFA 1WJZA 1XDCA 3DC5A 3KG2A 5JCOA 3RYHB 4FZ0A 5B1OA 3I55V 3FB8C 2KQXA 1NT2B 5LGNA 3E2EA 4BR6A 3CX5F 3CEIA 1WLEA 3AG4B 3E8FA 2QWRB 3M8AA 1OJHA 2QWPB 3CC4V 2BTQB 4GCZA 2MK3A 1X59A 1GM9A 1EN6A 3SPHA 2QDOA 2BSKB 4DR6B 4NKGB 5LMUO 4MW8A 3DXRA 4X1IA 2P90A 4X64B 4X1YA 3HKEA 4X9QA 3AG3C 1E1QG 3CRMA 1ROPA 1NR7A 4CC6A 4FLYA 2N04A 5B1BC 4JI4B 1TUEB 3P30A 3UKMA 4FIPC 5DM6V 5IJ9B 1VQ7V 1AI4A 4J41A 3ASNB 1KB9F 1K73W 4I4TA 1QLEC 2ADPA 5H6RA 2YUAA 1HP8A 4DV4B 1WB8A 4UVBA 4DV5B 4MVUA 3L72H 4B3RB 3K0GA 1VEWA 2Q7HA 4UCSA 3AK3A 4O4LB 3S3WA 2Q69A 1SKVA 2CDYA 3EXAA 1BMFG 5C8YA 4I5SA 1WAZA 4FLVA 3WG7C 1URFA 3OMIB 1S72V 2UUAB 1TGOA 4RUEA 3ZHUA 2VQFB 1FXKC 2OCCC 4DXWA 2WLIB 2HEPA 1DLBA 3OMAB 1DGSA 4JYAB 3SYOA 2XTAA 4PELA 3B2EE 1AI5A 4I55B 2CE4A 2CTWA 2GV9A 2OT5A 2ZE8A 4WF9V 5B1BB 2OCCB 1XNRO 3K3WA 4JYCA 1RP3B 1BSMA 2W6JG 4B3MO 4JAVA 4LC1A 1G4YB 2JJ1G 1P4RA 3K9SA 4GZRB 1BHBA 1GMGA 5JVDA 3BA8A 3T2MA 5A2QN 2QWNB 1Y66A 1FXHA 2WA3A 4JV5O 4I0XA 3N2KB 2LQTA 3UM7A 1VQMV 1VARA 4O4JB 3OR7C 1XNRB 4BIUA 3FX7A 3ZMSA 2XHBA 3W7SA 4LF8B 3KKYA 3A0BZ 3OTOO 3RYFA 1OCRC 2XAGA 1Y76B 3F7YC 4FM2A 2QE7G 2CUGA 4WFBV 1B6QA 4DR3O 4EEQA 3OEHG 2YXHA
chains in the Genus database with same CATH topology
3H9VA 4DW1A 4DW0A 3I5DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H9V A;  4DW1 A;  4DW0 A;  3I5D A; 
#chains in the Genus database with same CATH topology
 3ZMV A;  1HNW O;  5IT9 N;  1DF5 A;  1OZ0 A;  2VQF O;  1GO3 F;  4MW3 A;  3CPW U;  2UUA O;  4XBF A;  4RQF A;  3ASN C;  2P4V A;  1GM7 A;  4DV2 B;  1L0N H;  1AP5 A;  2YEV B;  4QPK A;  4O4L A;  2Y48 A;  3G6B A;  1IBK B;  2E3C A;  4IGG A;  4UB8 Z;  2EIK B;  3QVN A;  1JJ2 U;  2H3O A;  2GHY A;  2B1I A;  2WA4 A;  1EBO A;  1PL0 A;  5BMV A;  5JJE B;  1SQX H;  5KAI Z;  3RYC A;  5IYD O;  1QLN A;  1VQN V;  1P84 F;  4X65 O;  2UXC O;  1AB3 A;  2XT9 A;  2OTJ V;  1KU9 A;  1H2S B;  2ZIO A;  4NXM O;  2XAS A;  3FAV A;  4DO2 A;  1Q5O A;  3AG1 B;  3LNM B;  1TVK B;  1JX9 A;  4NXN O;  3M99 B;  1SZX A;  2ZD9 A;  5B66 Z;  1PP9 H;  4ZI7 A;  4GLX A;  2E5L O;  3CYO A;  1FFX B;  4U3J A;  1WA8 A;  1AR1 B;  2UXB O;  1PKX A;  4WFF A;  5HFM A;  3WB0 A;  3W7W A;  3KZI Z;  5LMU B;  2QTS A;  4R6Z A;  5LHH A;  2DYS C;  2UU9 B;  2UXC B;  4C7U A;  4NTX A;  4UUJ C;  4YHH B;  3JAR A;  1VIB A;  3B4S A;  1GN3 A;  3SYP A;  5HFL A;  4BW5 A;  4TQF A;  3K5L A;  3EVK A;  3WB2 A;  1NJI W;  2JS3 A;  4FM0 A;  2D3O W;  4JI0 O;  5IE9 A;  3JAM N;  2DE0 X;  1YZB A;  4K0K O;  4LF5 B;  2F95 B;  2YI8 A;  4DV2 O;  3D8C A;  3E83 A;  4X65 B;  1SQB H;  2VQE O;  3AG2 B;  3JAW A;  2Q5Z A;  1F51 A;  2D2C B;  4U3F H;  5B5E Z;  4AI8 A;  5EBL C;  4TQD A;  4Z1V A;  5KA6 A;  4DW0 A;  1JFF A;  3SJC C;  4ZOL A;  2OIE A;  5D5Q A;  1AR4 A;  4DK0 A;  4PA6 A;  5L3C A;  2BCC H;  3ETD A;  2OYQ A;  4LWS B;  3ZRS A;  2MW2 B;  3OW2 U;  4JI7 O;  3B09 A;  4X1K A;  4YJ3 B;  1NQT A;  2WSS G;  3IGA C;  2M6Y A;  2YIB D;  5IY5 C;  4MTX A;  5JH7 A;  2QSA A;  5F2V O;  3E8B A;  3A0H Z;  4PDV A;  2BTQ A;  5LMN O;  3K04 A;  1L1F A;  1BGY H;  1WPB A;  1XMQ O;  4O4I B;  3EHB B;  3SDL A;  1VQ4 V;  4DV7 B;  4JF3 A;  1FXK B;  1Y67 A;  3SGI A;  1VQL V;  3L75 H;  3CC2 V;  4MVM A;  4LFB O;  4YXW G;  5FNV A;  4IL6 Z;  3N2G A;  4PA7 A;  4J11 A;  1LNQ A;  2V4D A;  1ZTE A;  3L9D A;  3RVZ A;  4TSF G;  1T5E A;  1QR9 A;  3K5N A;  1THZ A;  4JV5 B;  2ZT9 B;  1J5E O;  3JSL A;  2OCH A;  1B04 A;  4MTG A;  1S77 D;  2IM9 A;  3KCX A;  4ABM A;  2PI4 A;  3DTU B;  4QE7 A;  1GN2 A;  3HR0 A;  1FS0 G;  4HNA B;  4KXR A;  2OTL V;  1D5N A;  3D3Q A;  4LF7 B;  4FLT A;  4LNU B;  5JQG B;  4DUZ B;  2A79 B;  2GSM B;  3UCS C;  1EFR G;  4B7E A;  3IJ4 A;  4G27 B;  5EC2 C;  4UCT A;  1M93 A;  1JQ0 A;  2YEV A;  1Z2G A;  4X66 B;  1HR0 O;  4PHZ A;  4PA9 A;  1YIT V;  1OHH G;  1S5J A;  5CB4 A;  3AG7 A;  5LP6 A;  4H44 B;  4B3T O;  4F6R B;  1N0J A;  4JI1 O;  2BSK A;  2ILM A;  5ITZ B;  1ZLZ A;  3Q4H A;  4B3R O;  2Q0A A;  4GKJ O;  3G67 A;  4NVP A;  2LFS A;  1IXB A;  1V9P A;  4F6E A;  2OWO A;  4ASU G;  2K1E A;  4WFG A;  5LXT A;  2QGN A;  4KFM A;  1RPR A;  1F4N A;  4FK5 C;  2ZNI A;  1IDS A;  1NI8 A;  3CRC A;  5LOV B;  3LNN A;  2EZO A;  5J2T A;  4P2Z A;  5LMN B;  2H8P C;  3ZN0 A;  3CCE V;  1V54 C;  3RYF B;  2F4V B;  1MA1 A;  4I50 A;  2PYJ A;  2LW7 A;  5EZY B;  1PD3 A;  1WP8 A;  3RN4 A;  5JJJ B;  1HNX O;  1Q6H A;  1CXZ B;  3ABM C;  3APQ A;  4MTF A;  5GON A;  1JMK C;  4J9Z B;  3FYI B;  3CE2 A;  1XRE A;  4ICG A;  2YIB A;  2XND G;  1XMO O;  3EFF K;  1IUR A;  1O9H A;  3B40 A;  2QWQ B;  1Q86 W;  4DV3 B;  4RWU A;  1Z5V A;  1LUV A;  5IYC O;  4DV7 O;  4Z1M G;  4ZOL B;  3CP1 A;  3OD4 A;  3RVY A;  5LP6 B;  1AJN A;  4OPH A;  4UVA A;  4O4H A;  4UV8 A;  2GDS A;  3A2F A;  3ETQ A;  3SYC A;  4AQY O;  1HW7 A;  2NLJ C;  3PN1 A;  3G4S V;  4G28 B;  3E22 A;  3OUS A;  4UXN A;  3RYC B;  3BAA A;  1HDJ A;  3CCR V;  3JAT A;  3ZRX A;  4MVS A;  1DF4 A;  2P4K A;  3K06 A;  3VQY A;  3MHS C;  4LBE C;  1RM1 B;  1I08 A;  5DED A;  4CH3 A;  1IX9 A;  2Q68 A;  3ZRW A;  3J81 N;  4DV0 O;  2E75 B;  5EBW C;  5L3B A;  4LR3 A;  4FLW A;  3D36 A;  2RQ6 A;  4JI1 B;  4TV9 B;  2ZKO A;  3L70 H;  4YHH O;  4JI3 B;  4J7J A;  1ENV A;  2IW5 A;  2JEX A;  2Y69 B;  3QO7 A;  3CXH F;  1M56 C;  3TXS A;  1BS3 A;  3BVO A;  3RBZ A;  3SPG A;  1VQO V;  4K0K B;  4JPR A;  5CA1 B;  5GTH Z;  5BR8 B;  2XUM A;  3IC9 A;  4U7O A;  5JCO C;  5JVD B;  4LF6 O;  3F5W C;  2AZ2 A;  1XL6 A;  1BQ0 A;  2A3Q A;  2EIN C;  5ITZ A;  3T1Y B;  4DR5 B;  1V55 B;  5BXZ A;  5LGU A;  4XDJ A;  5BY1 A;  1OCZ C;  3CRQ A;  2LP7 A;  3CCL V;  4K35 A;  1Q90 D;  4L8J A;  1N33 O;  4LF4 B;  1KYO F;  1LR1 A;  4JI2 O;  3N2K A;  1WPX A;  1U96 A;  4G2K A;  1CEZ A;  2GTA A;  3K03 A;  4JYY A;  3NXS A;  1OCC B;  2EJ7 A;  1IZ3 A;  2HVJ C;  3K08 A;  2YIC A;  3X2Q C;  4X8A A;  3CCV V;  1AIL A;  2Y69 C;  3E8G A;  3CD6 V;  1M1K W;  1G8M A;  1J5E B;  2Q4P A;  4EFB A;  3QG5 A;  3SPJ A;  4DUY B;  2BE3 A;  4LF7 O;  1SQG A;  3B8M A;  4QPJ A;  4XDL A;  5IWA B;  1XIL A;  5IJ0 A;  5B3S B;  3BEH A;  2F23 A;  2IH1 C;  4QIW F;  4TV9 A;  5L3F A;  4N23 A;  1M4U A;  4F6R A;  3JD0 A;  3B77 A;  1OCO B;  1VQ9 V;  3RW0 A;  2IU3 A;  1ZSP A;  4JI6 O;  2F93 B;  2ARH A;  4LF8 O;  3B8N A;  2PI5 A;  2LGW A;  4PV1 B;  1SC5 B;  3VQW A;  2HR3 A;  5FNV B;  4PD4 F;  1COW G;  3I56 V;  2NNU A;  3IC7 A;  1QBZ A;  4LFC O;  4FZ1 A;  4HNA A;  3E89 A;  3JD3 A;  2WLL A;  4UCV A;  4OGQ B;  4WBN A;  4NYK A;  2ZM6 B;  1KUQ A;  1XMQ B;  4KP4 A;  4LFC B;  1ZUQ A;  3HKD B;  2EUL A;  2EIJ B;  4JAA A;  1FAF A;  5KLV H;  2B1G A;  1M5I A;  2M7W A;  2JVD A;  3TK1 A;  1R6K A;  3DC6 A;  3HPL C;  1XHZ A;  1DK1 A;  3VQV A;  1TUB A;  4J7Z A;  2CK3 G;  4JI0 B;  2XAF A;  2P7T C;  1H2N A;  3U10 A;  2JS5 A;  1H2K A;  3JAR B;  4LH6 A;  4I0X B;  1JOY A;  5DEC A;  1SET A;  3H1H H;  2Q0O C;  3ASO C;  3BA9 A;  4CH5 A;  2PGG A;  4IIJ A;  4LFA O;  1VQ6 V;  2EBO A;  4CS3 A;  4ZKI A;  1AI6 A;  1NTM H;  1RFY A;  4UFZ A;  1YF2 A;  3CB2 A;  3H1I H;  1Q8I A;  3FB7 C;  2P67 A;  1EN4 A;  4J42 A;  4LNU A;  4YIO A;  5LYJ B;  3FFQ A;  3AG2 C;  1IBM O;  4IHJ A;  2AGA A;  4W4K A;  1E1R G;  1IBM B;  5FLX N;  1SQP H;  1MAB G;  2X6C A;  1XNQ B;  2EX3 A;  1W0K G;  5H9C A;  3GVM A;  4LWS A;  2BOC C;  3HB3 B;  2RNB A;  2Y4U A;  4X89 A;  4KHP B;  1YTF B;  2E76 B;  3BPZ A;  2RN9 A;  4D7T A;  2IJK A;  5LA6 A;  4J10 A;  3ABL C;  5JQG A;  3CXC U;  1Q43 A;  2OIG A;  1ZAU A;  4DRX A;  5A9G A;  5LA6 B;  3ZBH A;  1BQZ A;  3K0D A;  4JZ2 A;  2VS0 A;  3K5M A;  3CS5 A;  2ZXW B;  4O4I A;  3CSX A;  4YJ2 A;  3UT5 A;  1K9M W;  3ZMZ A;  5LXT B;  1HNW B;  3TGU H;  4KL1 A;  1NTK H;  5CN0 A;  1V55 C;  1QR8 A;  4DR3 B;  1OV9 A;  1UPG A;  4GX0 A;  1E79 G;  1F23 A;  1GM8 A;  3ABM B;  2KKW A;  1KMI Z;  3OFN G;  4TWK A;  5H2F Z;  3P3N A;  3C90 A;  2YID A;  4NXM B;  4O4H B;  4GKK O;  1RSO B;  4J9Y B;  4KHP O;  2HJF C;  1VQ8 V;  2DOS A;  2X6A A;  1AVM A;  3ZHS A;  2W6I G;  4TT3 G;  1PL4 A;  1G1X B;  4ZHQ A;  1K4C C;  2LW1 A;  5CBG A;  3DXR B;  2DWD C;  5KMG B;  2ZR2 A;  4JZG A;  4TV8 B;  4JTC B;  1YSC A;  4NTY A;  4GX5 A;  3ZRW B;  2ZM6 O;  2K9P A;  2UXD O;  1MZE A;  3QO5 A;  1HWY A;  1SER A;  1K92 A;  1RM1 C;  1WB7 A;  2X6B A;  4FLU A;  2JGD B;  4KUM A;  1I94 O;  1D2D A;  1S5H C;  1NS1 A;  3JCU Z;  5B1N A;  1FD9 A;  1K5S A;  1BZK A;  1BL8 A;  1SES A;  5LP6 C;  2A9H A;  3CHX A;  3I5D A;  1H2M A;  2AW9 A;  2Z5U A;  2BTO A;  1K8A W;  2L35 A;  4JTA B;  2LJ2 A;  3O9O A;  1US6 A;  3CCJ V;  2HKO A;  4LCU C;  2AHZ A;  2ETN A;  5EC1 C;  4QGP A;  3AG4 C;  3LSQ A;  1AJP A;  4PJ0 Z;  1AR5 A;  3G6E V;  1VF5 B;  3JD1 A;  5KUK A;  3A8T A;  3H1K H;  2WLN A;  4DUY O;  5LBQ A;  3BFR A;  3CRR A;  2F66 C;  4MVR A;  3BY6 A;  1Q6U A;  1S3J A;  4PI0 A;  3SYQ A;  3RYH A;  1VF6 C;  2W0F C;  1D5A A;  1Y6X A;  3BRC A;  4FVM A;  4DV4 O;  1SA0 A;  4YJ2 B;  3ZS8 C;  3CME V;  4PI2 A;  1HR0 B;  1SRY A;  3VOU A;  1ARO P;  3W7U A;  1B3Q A;  4Z2W A;  3L73 H;  2HVK C;  3STZ C;  3RFR A;  4I9Q A;  4MVO A;  1VQ5 V;  1OCR B;  4UCR A;  3ZHR A;  2WWW A;  2GTS A;  4DR7 O;  4LH7 A;  1Q7Y W;  1UJW B;  1NBM G;  4CZZ A;  2PYL A;  4BIZ A;  2WLK A;  4FLZ A;  4YY3 O;  2C2A A;  2QM8 A;  4ZBM A;  4ZIB A;  3K79 A;  4FFK A;  5IYB O;  2EIL C;  3QTC A;  3QNE A;  3HKC B;  4PDR A;  4DR5 O;  4IYI A;  1Y74 B;  4RAI A;  4N21 A;  4JI5 B;  1S5L Z;  1ZX3 A;  1R6T A;  4UCO A;  4LF6 B;  1PNL A;  5K1X A;  2N05 A;  3E86 A;  5BR8 O;  4X1I B;  5LGT A;  2WLL B;  4RQE A;  3RYI B;  1PNK A;  2IU0 A;  4DR4 O;  1GKF A;  4DV5 O;  2P5O A;  1N34 B;  3F7V C;  1AJQ A;  1ZL8 B;  4WFE A;  3N2G B;  3K59 A;  1K5Q A;  4NR1 A;  1GTO A;  2F43 G;  1XL4 A;  4F4L A;  1NTZ H;  4LFA B;  4AQY B;  3WG7 B;  2Z3Y A;  5B1A B;  1HNZ O;  1FPO A;  5LL6 Y;  3MHH C;  1YHQ V;  3SJB C;  3ABT A;  5EYP A;  5TIS Z;  1FFX A;  1BCC H;  3WU2 Z;  1P7G A;  5KA5 A;  1TUB B;  3TJT A;  1TVK A;  5KHG A;  3OR6 C;  4X20 B;  3LSS A;  1YJ9 V;  2FML A;  3M7M X;  4X62 B;  1Z5W A;  4OX9 B;  4W4L A;  2YI9 A;  2BOB C;  1EM1 A;  3VQX A;  2F4V O;  2WPD G;  1FJG O;  4DV1 O;  2UUB B;  2VWJ A;  4PA4 A;  2QEX V;  3U0Z A;  5KHI A;  1M57 C;  4TUY B;  1YEW A;  3OEE G;  2DYS B;  3IFX A;  3T4D A;  5C8Y B;  3H9V A;  1OCO C;  1XMO B;  5CA1 A;  1FKA O;  5KX5 B;  1B06 A;  2ZE5 A;  2VRZ A;  4JAU A;  5EIB D;  1PM9 A;  2RCV A;  2ZDI C;  4LF5 O;  4P9O A;  3TXQ A;  4CC5 A;  3T4Z A;  1Q81 W;  4LF9 B;  1N32 O;  5FL7 G;  2WLI A;  4RO2 A;  2UXX A;  5CMU A;  1QQC A;  2Q8V A;  4JI5 O;  4GX2 A;  4J80 A;  2CH7 B;  2QTO A;  4JI6 B;  3MD0 A;  4IYH A;  5EK0 A;  2ADQ B;  2DN9 A;  4YIP A;  1R73 A;  3G71 V;  5CBF A;  3JYC A;  3THO A;  5KAF Z;  4IIJ B;  2PTM A;  2Q67 A;  4YY3 B;  3SJA C;  5CB4 B;  5J2U A;  5KHH A;  4EB6 B;  2R72 A;  4E2L A;  2FYU H;  1SZT A;  2ITC C;  1F7Y A;  3CCM V;  1KKD A;  5DN6 G;  4NB5 A;  2FB5 A;  2ZDI A;  4FFB A;  2QM4 A;  4O2B B;  4ZI7 B;  3J7A U;  2FTK A;  1W0J G;  1KBH A;  5J2U B;  4ZHQ B;  1N4C A;  4MVQ A;  3ZHT A;  4DRX B;  2HHH O;  3ZMU A;  1WP7 A;  1N0N A;  4I9W A;  1H8H G;  4H33 A;  3E8H A;  4P9P A;  2R9I A;  4X1K B;  4YJ3 A;  1M57 B;  2JK5 C;  2O57 A;  1QVF U;  2X0L A;  2HG5 C;  4DR7 B;  5LHI A;  1GRJ A;  3T1C A;  4I55 A;  3LSU A;  2R70 A;  2ZNJ A;  1I0H A;  3CRA A;  2RJZ A;  1VF6 A;  3DSQ A;  4EKW A;  5E1A C;  4PDM A;  1K34 A;  5EIB C;  2GUZ B;  3HKB A;  1BT8 A;  3JAS B;  3OMN B;  2VWK A;  3H01 A;  2V1D A;  1Y76 A;  4DV6 B;  4LFB B;  4JGS A;  2E74 B;  4OPA A;  3RT3 C;  4A5U B;  2UUC O;  2ITD C;  4JI3 O;  2JIZ G;  2CGO A;  4TV8 A;  1NZ6 A;  5IYZ B;  1O9G A;  4AHC A;  1I5X A;  1MMM A;  1IBL B;  1PNM A;  3SPC A;  2AZ0 A;  1UFI A;  5AG2 A;  4JTD B;  1R3K C;  3ABL B;  1H38 A;  4DV1 B;  2NN4 A;  2UUB O;  5E79 Z;  4CH6 A;  4DK1 A;  2YS8 A;  3S3X A;  5GW7 A;  1EZV H;  1Y74 A;  2FL4 A;  1SF9 A;  1M90 W;  1P49 A;  4CBC A;  4OX9 O;  3JD2 A;  3KCY A;  3N27 A;  1EN5 A;  3Q4H B;  3FYE B;  1FXV A;  4WFA V;  3LDE A;  3T1H B;  1YJN V;  1EZJ A;  2ZIN A;  1SQV H;  2HJD A;  4U3J B;  3A0R A;  1M9N A;  4B3S B;  5L3E A;  4UB6 Z;  5C93 A;  2EIJ C;  3GWK C;  3WFV A;  4FLX A;  1HNZ B;  3C3S A;  2YXY A;  2VQE B;  1VQP V;  1I94 B;  4HBN A;  3OGI B;  1HNX B;  4GKK B;  2EIM C;  2ATK C;  3HKC A;  1XOU A;  3JAK B;  1TA8 A;  4TUY A;  1XQ8 A;  3ETE A;  1QLE B;  3APO A;  1CPY A;  4FJC C;  4MTO A;  1I7F A;  4I7Z B;  4JAS A;  4O2A B;  4FM1 A;  1L0L H;  3HKE B;  3ZJZ A;  5LOV A;  3ASO B;  2CTR A;  5LHG A;  3K58 A;  1QU7 A;  3RYI A;  1VF7 A;  5KX5 A;  1XNQ O;  2YSU B;  4GUN A;  2JGU A;  1FXK A;  2E5L B;  3GB7 C;  1FYJ A;  4NXN B;  3BHP A;  1JJO A;  1JCH A;  1N36 B;  4DR2 O;  2DYR B;  2DWE C;  1ORQ C;  4U7N A;  1YI2 V;  3U11 A;  3UQ8 A;  3R66 A;  2RDC A;  2WLJ A;  1SA0 B;  1R1B A;  3ABK C;  3AK1 A;  1QVG U;  1R3I C;  2PF4 E;  1GAX A;  1H2L A;  1JVM A;  2F1M A;  2LGQ A;  1SS3 A;  2UXB B;  4O2B A;  2Y0P A;  2CH7 A;  1IVS A;  1MSD A;  2WAM A;  2IH3 C;  3DGE A;  3J80 N;  5JJN B;  3FD9 A;  2KSD A;  4E4E A;  3CCS V;  1KC8 W;  3GWO A;  4MS2 A;  1QCE A;  2GUZ A;  3E22 B;  1K4D C;  2P6J A;  3HKB B;  3JAS A;  4B08 A;  2UU9 O;  3LDC A;  3IAY A;  2QM7 A;  5CA3 A;  2QA4 V;  2DW4 A;  4O2A A;  2KB1 A;  3OUF A;  1Y4M A;  3ZMT A;  1LUW A;  4AIL C;  3ZHV A;  3OTF A;  2JGD A;  2N74 A;  4JI8 B;  4GX1 A;  3QO8 A;  1ZWI C;  4JYB A;  1M56 B;  3OM3 B;  2P22 C;  2QKC A;  5JH7 B;  3OTO B;  3C3T A;  1Q3E A;  5EZY A;  2JRI A;  5L3G A;  3NR7 A;  4BIO A;  3WB1 A;  4BW9 A;  5J9P C;  1K3E A;  1YXB A;  5KUM A;  3OAA G;  2WLM A;  3ZX6 A;  3MDS A;  1YDX A;  1OCZ B;  4EFE A;  2XAQ A;  4O4J A;  3STL C;  1NVP D;  5CA0 A;  4P30 A;  5H5N A;  2CGN A;  1KKC A;  3JSN A;  4FFB B;  3OE7 G;  4Q6G A;  4Q20 A;  1JFF B;  5EYP B;  1WN7 A;  5CBH A;  4K3A A;  2CTQ A;  4H13 B;  1NH2 D;  1XI1 A;  2IBZ H;  3F5T A;  3TCU A;  3FB6 C;  4B3M B;  1KP3 A;  3SPI A;  2LFR A;  1PV0 A;  1MNG A;  4UVC A;  2PZS A;  4JI7 B;  3P32 A;  4GT1 A;  3D3I A;  2YXL A;  3HKD A;  1Q82 W;  4WCE V;  2G38 A;  4JYA O;  1G6U A;  5B3S C;  1NR1 A;  4D7S A;  2IJJ A;  4JI8 O;  5D5P A;  4HAM A;  1IXM A;  1NVP B;  4WBN B;  2UXN A;  1JA8 A;  1VMG A;  4JI2 B;  3JAL B;  3D36 C;  4CH4 A;  1ZL8 A;  2X7R B;  3X2Q B;  1N33 B;  2NR5 A;  1U97 A;  1OCC C;  3UO3 A;  1GN6 A;  3K57 A;  1F4M A;  4DYL A;  3O65 A;  5L3D A;  1J95 A;  1MG1 A;  4NTW A;  2YDE A;  3PJS K;  1N8R W;  2AXT Z;  2DQ3 A;  5JWP A;  3AG1 C;  3FAV B;  4BWA A;  3CMA V;  2HLD G;  1QHT A;  5IWA O;  4DR6 O;  1H2G A;  2ODM A;  2ZXW C;  1YCI A;  3K5O A;  5J2T B;  2XAH A;  1TAE A;  4DW1 A;  4OXS A;  5BMV B;  4TOI A;  2IJH A;  1SQQ H;  4DR2 B;  1V54 B;  4GYC B;  5IJ9 A;  4LP8 A;  2DMX A;  1XHX A;  1K7D A;  3JCZ A;  3BCC H;  1KP2 A;  4FPP A;  3OT7 A;  1CP9 A;  3SR2 C;  2WLH A;  3UO2 A;  3JAT B;  1N32 B;  4UV9 A;  2YIA A;  2LO1 A;  4X1Y B;  4X64 O;  2Q9L A;  2Z0A A;  2Y4T A;  4LF4 O;  2IJI A;  3SYA A;  2A7W A;  3JD4 A;  2V7Q G;  3W7X A;  2B9Z A;  2ZE7 A;  4IT5 A;  4RUF A;  2H94 A;  1JPX A;  3CJH A;  1N36 O;  2ZQM A;  4PA3 A;  2JDI G;  2QKA A;  3JAK A;  4DV0 B;  3L74 H;  4R7C A;  1R3J C;  2ZE6 A;  1FJG B;  1H8E G;  1IBK O;  1GH6 A;  3ZCC A;  3W7T A;  4DR1 B;  3ICX A;  2ZIM A;  1AP6 A;  2ZR3 A;  2ZCE A;  2QKS A;  2P06 A;  1WNS A;  1MZF A;  1P7B A;  2A06 H;  4QNH B;  2GBO A;  1NH2 B;  3SJQ C;  1L8D A;  2FKX A;  1R3L C;  3H1J H;  3LDD A;  5IYZ A;  4B3S O;  2YC0 A;  4IHJ B;  1W59 A;  3ZED A;  2Y0I A;  3TET A;  3ETG A;  4BAY A;  2RMK B;  2CTP A;  3T1H O;  5B1A C;  1NU1 H;  4MVZ A;  3ABK B;  2Q7E A;  3CCU V;  4PDL A;  4DV6 O;  2EIK C;  4CS4 A;  4QE9 A;  1JR9 A;  4DR4 B;  3ZN1 A;  3BAB A;  4GKJ B;  2DYR C;  3RWR D;  2L6L A;  1RSO A;  1GK9 A;  3ZIA G;  2KG7 B;  1RPO A;  3R65 A;  3CCQ V;  4B7K A;  1X4T A;  2DJV A;  3E35 A;  1MOF A;  2R9R B;  5KMG A;  2XOK G;  4J7K A;  2DQ0 A;  3CJH B;  3G80 A;  4CS2 A;  1GN4 A;  2EIL B;  1K33 A;  1KD1 W;  2PUS A;  5IDJ A;  1BHA A;  1Q6I A;  2EIN B;  3QF7 A;  2HP8 A;  4K8Z A;  1N34 O;  3UT5 B;  3OGC C;  2QJ1 A;  3JAW B;  3FB5 C;  2CAZ C;  5KHK A;  2W0X A;  3CC7 V;  5FPR A;  1KEC A;  1IBL O;  1R6N A;  3ABU A;  4DUZ O;  4K8X A;  3MAQ A;  2AHY A;  2EIM B;  3ML0 A;  3FKS G;  5EBM C;  4R8C A;  2UUC B;  3K9A A;  5IY5 B;  3AK2 A;  4H0L B;  3VBB A;  4I4T B;  5IJ0 B;  1S76 D;  1PPJ H;  2QR4 A;  3ZHQ A;  4X66 O;  4QJF B;  1YVW A;  1I5Y A;  4WFH A;  1VP7 A;  3JAL A;  3L71 H;  4H37 A;  2HHH B;  1BE3 H;  1YIJ V;  4B3T B;  1NKD A;  2XAJ A;  3AG3 B;  3H1L H;  4MT8 A;  1YJW V;  4XDK A;  4X20 A;  2JEU A;  1QNM A;  2EJR A;  1XEQ A;  4EB6 A;  3CWB H;  2Q7G A;  5H6Q A;  4MSW C;  1XBL A;  1XUQ A;  1K97 A;  3T1Y O;  1AI7 A;  5LYJ A;  4JI4 O;  1MSW D;  2A0L A;  4HYO A;  1S0V A;  1W2B U;  2EZP A;  4FMT A;  2Q73 A;  4LF9 O;  2R9A A;  5CA0 B;  2JJ2 G;  1VQK V;  2B5U A;  1DTO A;  4X62 O;  1WA8 B;  3AEI A;  3ZRV A;  2HFE C;  3LUT B;  2Q6A A;  5KHJ A;  2PY5 A;  5FPO A;  3RGB A;  4DR1 O;  1A32 A;  4I50 B;  4L87 A;  4D6T H;  1FFT B;  5GTI Z;  4X88 A;  2UXD B;  2KG7 A;  2QWO B;  5K1P A;  3P3P A;  1KQS U;  5GON B;  1YTF D;  4DV3 O;  4HZ3 A;  4R50 A;  5BZB A;  4UCU A;  1SQF A;  1WJZ A;  1XDC A;  3DC5 A;  3KG2 A;  5JCO A;  3RYH B;  4FZ0 A;  5B1O A;  3I55 V;  3FB8 C;  2KQX A;  1NT2 B;  5LGN A;  3E2E A;  4BR6 A;  3CX5 F;  3CEI A;  1WLE A;  3AG4 B;  3E8F A;  2QWR B;  3M8A A;  1OJH A;  2QWP B;  3CC4 V;  2BTQ B;  4GCZ A;  2MK3 A;  1X59 A;  1GM9 A;  1EN6 A;  3SPH A;  2QDO A;  2BSK B;  4DR6 B;  4NKG B;  5LMU O;  4MW8 A;  3DXR A;  4X1I A;  2P90 A;  4X64 B;  4X1Y A;  3HKE A;  4X9Q A;  3AG3 C;  1E1Q G;  3CRM A;  1ROP A;  1NR7 A;  4CC6 A;  4FLY A;  2N04 A;  5B1B C;  4JI4 B;  1TUE B;  3P30 A;  3UKM A;  4FIP C;  5DM6 V;  5IJ9 B;  1VQ7 V;  1AI4 A;  4J41 A;  3ASN B;  1KB9 F;  1K73 W;  4I4T A;  1QLE C;  2ADP A;  5H6R A;  2YUA A;  1HP8 A;  4DV4 B;  1WB8 A;  4UVB A;  4DV5 B;  4MVU A;  3L72 H;  4B3R B;  3K0G A;  1VEW A;  2Q7H A;  4UCS A;  3AK3 A;  4O4L B;  3S3W A;  2Q69 A;  1SKV A;  2CDY A;  3EXA A;  1BMF G;  5C8Y A;  4I5S A;  1WAZ A;  4FLV A;  3WG7 C;  1URF A;  3OMI B;  1S72 V;  2UUA B;  1TGO A;  4RUE A;  3ZHU A;  2VQF B;  1FXK C;  2OCC C;  4DXW A;  2WLI B;  2HEP A;  1DLB A;  3OMA B;  1DGS A;  4JYA B;  3SYO A;  2XTA A;  4PEL A;  3B2E E;  1AI5 A;  4I55 B;  2CE4 A;  2CTW A;  2GV9 A;  2OT5 A;  2ZE8 A;  4WF9 V;  5B1B B;  2OCC B;  1XNR O;  3K3W A;  4JYC A;  1RP3 B;  1BSM A;  2W6J G;  4B3M O;  4JAV A;  4LC1 A;  1G4Y B;  2JJ1 G;  1P4R A;  3K9S A;  4GZR B;  1BHB A;  1GMG A;  5JVD A;  3BA8 A;  3T2M A;  5A2Q N;  2QWN B;  1Y66 A;  1FXH A;  2WA3 A;  4JV5 O;  4I0X A;  3N2K B;  2LQT A;  3UM7 A;  1VQM V;  1VAR A;  4O4J B;  3OR7 C;  1XNR B;  4BIU A;  3FX7 A;  3ZMS A;  2XHB A;  3W7S A;  4LF8 B;  3KKY A;  3A0B Z;  3OTO O;  3RYF A;  1OCR C;  2XAG A;  1Y76 B;  3F7Y C;  4FM2 A;  2QE7 G;  2CUG A;  4WFB V;  1B6Q A;  4DR3 O;  4EEQ A;  3OEH G;  2YXH A; 
#chains in the Genus database with same CATH homology
 3H9V A;  4DW1 A;  4DW0 A;  3I5D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...