4DW0A

Crystal structure of the atp-gated p2x4 ion channel in the closed, apo state at 2.9 angstroms
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
330
structure length
330
Chain Sequence
GTLNRFTQALVIAYVIGYVFVYNKGYQDTDTVLSSVTTKVKGIALTKTSELGERIWDVADYIIPPQEDGSFFVLTNMIITTNQTQSKCAENPTPASTCTSHRDCKRGFNDARGDGVRTGRCVSYSASVKTCEVLSWCPLEKIVDPPNPPLLADAERFTVLIKNNIRYPKFNFNKRNILPNINSSYLTHCVFSRKTDPDCPIFRLGDIVGEAEEDFQIMAVRGGVMGVQIRWDCDLDMPQSWCVPRYTFRRLDNKDPDNNVAPGYNFRFAKYYKNSDGTETRTLIKGYGIRFDVMVFGQAGKFNIIPTLLNIGAGLALLGLVNVICDWIVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mechanism of ATP binding and ion channel activation in P2X receptors.
pubmed doi rcsb
source organism Danio rerio
molecule tags Transport protein
molecule keywords P2X purinoceptor
total genus 82
structure length 330
sequence length 330
ec nomenclature
pdb deposition date 2012-02-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.940 Mainly Alpha Orthogonal Bundle Helix Hairpins atp-gated p2x4 ion channel 4dw0A01
2.60.490.10 Mainly Beta Sandwich atp-gated p2x4 ion channel fold atp-gated p2x4 ion channel domain 4dw0A02
3I5DA 3H9VA 4DW1A 4DW0A
chains in the Genus database with same CATH superfamily
3OAAG 3ICXA 4JYBA 5IJ0A 4U3FH 3OTOB 5CA3A 3G6EV 3JD0A 1AR4A 3PN1A 4ZHQB 3VQYA 2F93B 2QJ1A 4JPRA 3F5TA 1XOUA 3OGIB 3R65A 3TCUA 1WA8A 5EBMC 3H01A 2F95B 1SERA 1I0HA 5J9PC 4Q20A 4PA7A 4MVZA 2ZD9A 4DV5B 2WPDG 4LFBO 4DV0O 3DC6A 2CDYA 2IJIA 2X6AA 2Q67A 4UCUA 1SQBH 4JAAA 5B1OA 2ADQB 4WCEV 1JA8A 4R8CA 3EVKA 3RN4A 2YXHA 1LUVA 2ZDIA 4LFBB 1AROP 2IU0A 4DV0B 3ABKC 4JTAB 4MTXA 1TAEA 1TUEB 1VIBA 4I4TB 2HFEC 4JTDB 3CC4V 1G6UA 4JI7O 1TVKB 2LW1A 2GTAA 3Q4HB 1OCCB 1ZSPA 3D3IA 1XNRO 3ZHQA 4UB6Z 4UCVA 1P49A 1P7BA 4WFBV 4DR5B 1Q6HA 2YIAA 3DXRA 5J2TA 2JS3A 3ABUA 4LNUB 1KP2A 1UJWB 2YICA 2YIBD 4BW5A 4YJ2A 1XNRB 4IT5A 4R6ZA 4K3AA 1CEZA 2RMKB 4LF6O 4G2KA 2Q68A 4JYAB 4X62B 4B3SB 3JCZA 4CC6A 4JV5O 1PL0A 3RYHB 5KHGA 2WLLA 1N36O 3OFNG 2CTRA 1SKVA 3HPLC 2HVJC 2QDOA 4MW3A 3GWOA 1LNQA 3U10A 1AILA 4E2LA 1K73W 4GZRB 1XNQB 1S0VA 1Q43A 3N27A 5DECA 1QLNA 2WAMA 3SYPA 4JZGA 3CS5A 4FMTA 4X62O 4B3SO 5CMUA 1H2GA 3QNEA 4O2BA 3ZMVA 5EK0A 5HFLA 5LP6C 1X4TA 1L8DA 4LR3A 4KL1A 3AG7A 5FNVB 2XAGA 5LOVB 3J81N 2Y69B 3ZRWB 2QKCA 3A0BZ 1VQ7V 1IBMO 5JH7B 5CA0A 4NB5A 5C8YA 2GV9A 3H1IH 1KUQA 1YDXA 1EZVH 4ZOLA 1S5JA 3SPJA 1IDSA 1Y66A 3B2EE 2EILC 3ASNB 5EZYA 1P4RA 4WFAV 2VRZA 3G6BA 5JCOC 3HKDA 4FVMA 1M93A 3RBZA 3L72H 4X1KA 2CH7A 4RUEA 2QTOA 2E74B 2UUAO 3AK1A 2DYRB 1FFTB 1JQ0A 1K97A 1GAXA 1OCRB 3FAVA 2W6JG 3FB5C 1R3IC 3B8MA 3ETQA 5LGUA 2BTQA 1NT2B 1K8AW 4JF3A 5H2FZ 2GDSA 2UXDB 1SS3A 5J2UA 1R6NA 1YXBA 4R7CA 1SQQH 4O2AB 3OEHG 3G71V 1GN4A 1KU9A 3W7UA 3UKMA 2PYJA 1YITV 2Q4PA 3JASA 3RW0A 4FLTA 1TA8A 1NTKH 2M6YA 1SA0B 3JD4A 3K5OA 3IFXA 4FLVA 4MTOA 3WB1A 1GM9A 1K4CC 3GWKC 4PA4A 2A06H 2A79B 3D8CA 4UVCA 2QGNA 4EFBA 3ZMSA 2CUGA 2EULA 1NKDA 3RVYA 2D3OW 5C93A 4UXNA 3T2MA 5ITZB 5H6QA 3SYQA 5BY1A 4DV4B 2WA4A 1J5EB 1CPYA 1NR7A 3P3NA 2ARHA 2YI9A 2CTPA 3JALB 4LWSB 3TXSA 3H1HH 4DXWA 2JVDA 4LFAO 2ILMA 4B3MB 1FXHA 3KZIZ 1HWYA 3BFRA 5JQGA 3R66A 5CBHA 3ABTA 5CA1A 3HKEA 3NXSA 1NTZH 1MG1A 3BABA 2H3OA 1U97A 2KQXA 1JFFA 1VF6C 2ZR3A 1BHBA 5LOVA 3CE2A 1HNWO 4KXRA 4CBCA 4C7UA 3EXAA 2HLDG 3JARA 3CRQA 2V1DA 3QF7A 1M4UA 2HJDA 3CJHB 3LDDA 3EHBB 4RAIA 4DV6O 1GH6A 5IDJA 4K0KO 1I5XA 1DF5A 1NBMG 5BZBA 3AG3C 4JI1B 2Q0OC 1AR5A 3FYIB 3SYAA 1R3JC 2WLLB 3WB2A 3OMIB 3T4DA 4NTXA 2KSDA 4BR6A 3B09A 3N2KA 3SPCA 2IBZH 2Y4UA 4O4IA 1E79G 2HP8A 3EFFK 2PTMA 4P2ZA 4JI3B 3SYOA 4KHPB 2YEVB 2CH7B 4RWUA 4AQYO 4JI8O 2R72A 2JGDA 2PZSA 5DM6V 2E5LB 3DXRB 4L87A 1GN6A 1YJWV 3CP1A 2UXCO 4ZBMA 1VQ5V 1N4CA 4EB6A 5LMUO 3CCMV 4DR7B 3BCCH 4KHPO 3E89A 5J2UB 1KKCA 4W4KA 3AEIA 2CTWA 2R70A 3TJTA 4AQYB 4JI8B 1T5EA 1F4MA 4LBEC 3SGIA 4X9QA 2P4KA 5F2VO 4AI8A 5L3EA 3OR6C 4I50B 3N2GB 5LMUB 5LXTB 4F6RB 4FPPA 2RJZA 5KUKA 1Q81W 1XL6A 1KBHA 3RYHA 3OMNB 2P6JA 4LF4O 4FLWA 1NVPB 1H8EG 4J11A 5LGNA 3RT3C 1N32B 5JVDA 3RYIA 3J80N 3H1JH 3CEIA 3RWRD 2JJ2G 2JK5C 2BTQB 1WA8B 1HDJA 4DV3O 4X1IA 1B04A 5B5EZ 2FMLA 1IBKB 3UO2A 5IYDO 3ZRVA 1G4YB 2JDIG 1GM8A 2QM7A 2DYRC 4CH5A 1D5AA 1HNZO 4IIJA 2QWOB 4D7TA 3CCLV 4B3TO 1EBOA 2EBOA 3OGCC 3FKSG 3CD6V 2P06A 2PI4A 4N23A 1GN2A 1BL8A 1VMGA 2Z5UA 4MTGA 3FB8C 4I0XA 2EIMB 1YHQV 2UUBO 2O57A 4LF7B 1Z5WA 2GUZB 1PD3A 2P22C 2WWWA 3AG4C 1N0JA 4X1YA 5LGTA 3HB3B 1SC5B 1FJGO 4B3TB 5CBGA 1QNMA 1VF5B 3JD3A 4MW8A 4EB6B 1VARA 4FIPC 2NLJC 3H1KH 3RVZA 5BR8B 1YTFB 4I55B 2UUCO 3ZRWA 3E22A 2YUAA 4DV7O 1JOYA 4LF9O 3CPWU 5L3BA 1JR9A 5KHIA 1PNMA 4TUYB 3CC2V 4JAVA 4DUZB 5JVDB 2Q9LA 2VS0A 3LUTB 5KX5B 2QWNB 1IXMA 3W7WA 4LP8A 1R6TA 2XUMA 1L0LH 1A32A 4GKJB 5KX5A 5BR8O 3L73H 1Q90D 4X8AA 1HNXB 2OIEA 1B3QA 4CS2A 2MK3A 5IWAB 1IXBA 1QVFU 1X59A 5LHIA 2E76B 2VQEB 2UXXA 2QEXV 1S3JA 1K5SA 2VWKA 1OCZC 3OTOO 4P30A 4ZHQA 5KA6A 1M90W 1HR0B 4DV1O 1NTMH 1AR1B 3RGBA 1ZWIC 2WLIB 1DLBA 2XASA 2NNUA 5JJJB 1PP9H 3TGUH 2IJHA 4QPJA 4JI0O 2HHHO 1SF9A 2VQEO 1XMOB 3LSSA 2ZIMA 1FXKA 1H38A 2W0FC 4PDMA 2R9AA 3J7AU 4DR6O 4G27B 1KP3A 2BOCC 2EX3A 4L8JA 2ZT9B 3LNMB 2X6CA 2NN4A 1D5NA 4KP4A 2WLJA 1NR1A 4IHJA 1YJNV 3C3SA 2Q69A 4J42A 3D36C 1VQ4V 4A5UB 5IT9N 3MD0A 3STLC 2RDCA 1UFIA 1ZL8A 3M8AA 5EYPA 3ZN0A 1I94O 1H2SB 4Z2WA 3ZHRA 1AP6A 1YEWA 3OW2U 1PM9A 4PA3A 2D2CB 4OPHA 3S3XA 2DQ0A 2ATKC 3F5WC 4WFGA 4B3RO 4BWAA 2LQTA 1BMFG 1VEWA 3G80A 1YI2V 3ZRSA 1VQ9V 3AG1B 1KKDA 4FM2A 4NXMO 2QKSA 1AJNA 2DYSB 4JI7B 2LJ2A 5BMVA 1OCOB 1VQ6V 1I08A 3N2GA 4O4LB 1I5YA 3FX7A 1PNLA 1Q6UA 2Z3YA 1Z2GA 4JV5B 2YS8A 3AK2A 3D36A 4DR5O 4PI2A 3SJCC 3THOA 1XMQO 1KMIZ 1YIJV 5LXTA 1WPBA 4DUYO 1US6A 1ZX3A 5L3DA 1L0NH 4CH3A 4FJCC 4DR2O 1O9GA 1NU1H 4ZI7A 2PI5A 1QU7A 1MSWD 3L70H 1NH2D 2GTSA 1RFYA 2OTJV 4DUYB 4QPKA 2QM8A 4FM1A 3APQA 1YCIA 4O2BB 3QVNA 1AVMA 1OV9A 4D6TH 4AHCA 1VF6A 1BQZA 4TSFG 3P3PA 1MMMA 5KHJA 2FTKA 4X1KB 2A0LA 4LNUA 3LDCA 5L3FA 4FLYA 2GSMB 1H2MA 2XOKG 1JPXA 1AI6A 1XI1A 4P9OA 5IJ9A 4IL6Z 1GM7A 4B08A 1I7FA 3AG4B 3B77A 2LFSA 4NTWA 3BHPA 1P7GA 1HW7A 2EIJB 4ZOLB 4X1YB 4JI5B 4NR1A 4X20B 3NR7A 4PELA 2JRIA 2P90A 1K34A 1W0JG 1O9HA 2QWRB 1H2KA 3A2FA 4I5SA 5EZYB 4I50A 1VF7A 4RQEA 1SZTA 5LP6B 1KD1W 3JD2A 2DN9A 2RCVA 3S3WA 2G38A 3ZX6A 4DRXA 3DSQA 1DGSA 1R3LC 1QR9A 2Y48A 1TVKA 1GMGA 4BW9A 3ABKB 2UXDO 2ZXWC 4QE9A 5IYZA 4MVSA 2Q8VA 5L3CA 3UM7A 1VP7A 4RO2A 1K9MW 3I5DA 2Q5ZA 2KB1A 4W4LA 3BA9A 3KCXA 5KHKA 5H6RA 4DV4O 3STZC 1FFXA 2EZPA 2ZE5A 1ZTEA 3JAWA 5K1XA 4PDVA 3FD9A 2Z0AA 2BE3A 4LFAB 1GN3A 5LA6A 4B3MO 2EIMC 2UU9B 3FFQA 4O4HA 2ZXWB 4O4JA 1N36B 3T1YB 3K5NA 3OTFA 3ZIAG 2IH1C 1Q8IA 4YHHB 1M56C 5KUMA 4LFCB 5LYJA 2ZCEA 4JI4B 5LHGA 3F7YC 1XNQO 1AI7A 1J5EO 1F23A 4K35A 3JASB 2VWJA 1AI4A 5IYCO 3OD4A 2GBOA 3JATB 4H37A 4X88A 2OIGA 3T1CA 1WP7A 1VQLV 4UCSA 4JYCA 4H0LB 1Q3EA 3E8HA 3K57A 1K4DC 4NYKA 1IBMB 5LBQA 4YJ3B 5EYPB 4JI4O 3Q4HA 2JS5A 2JGUA 3HKBA 5KAIZ 2N05A 4F4LA 1DTOA 4UVBA 3IC7A 4I0XB 1MZEA 3CHXA 1JVMA 4I7ZB 5JCOA 1S5LZ 3CXCU 1KB9F 5KAFZ 4CH6A 1PNKA 4MVMA 3D3QA 3WFVA 2Q7GA 5EC2C 2VQFO 1IVSA 2HJFC 1BE3H 3SR2C 4O4IB 2MW2B 4KUMA 3VQVA 1V55C 1F51A 5B1BC 1YTFD 1B6QA 2CGOA 3K9SA 1VQPV 4FM0A 1RSOB 4BIOA 1N0NA 4XDLA 2ZM6B 3SPIA 3DGEA 3CCUV 3E22B 3L74H 2QM4A 2BSKA 2Y0PA 1Y67A 1W0KG 2Q7EA 4OPAA 3LSQA 2Y69C 4JI2O 3ZHVA 2XAHA 3E35A 2AHYA 3ABLC 1BHAA 1QLEC 2LGQA 3K79A 2E75B 3QO5A 4GCZA 3FAVB 4DR3B 5IYBO 3VOUA 1OCOC 3BEHA 1G8MA 1SQXH 2LW7A 2WLNA 4DV2O 2UXBO 3K08A 2EJ7A 4B7EA 4FFKA 2Q7HA 2ZIOA 1R73A 3CX5F 2OCHA 2P4VA 1Y6XA 3GVMA 3ZEDA 4DR3O 3PJSK 3CB2A 3JCUZ 3ETGA 2KKWA 1R3KC 1LUWA 5H5NA 2B1GA 5GONB 1HNZB 4MVQA 4WFFA 3ZHUA 3ML0A 1EN5A 4JYYA 2DWEC 3RYIB 1Q82W 3L75H 4HZ3A 3JAMN 4LF8B 2F4VO 1SQVH 5JWPA 4DV3B 3CJHA 3L71H 4FK5C 3FYEB 1AB3A 1E1RG 1IBKO 3RYFB 1AP5A 1WLEA 4HYOA 1BGYH 4D7SA 1SZXA 2ZINA 1MOFA 4LC1A 2XNDG 2IH3C 4J9YB 2F66C 4FFBA 1SRYA 1XILA 4LF8O 4X65B 4UCRA 2QKAA 1Q5OA 1GRJA 2F43G 1HP8A 2BSKB 3FB6C 1N8RW 1Y76A 1K92A 2WLMA 3C3TA 4LF5B 5JJNB 3K9AA 5CN0A 1DK1A 2UUBB 2DJVA 4TQFA 4DK1A 4ZKIA 5LMNO 4BIZA 4X65O 5IE9A 3OUFA 2OCCC 4GX5A 4R50A 1NS1A 3OT7A 5CB4A 1M1KW 2EIKB 1ZLZA 5LP6A 3K59A 2XAQA 2ITCC 4NXNB 3K03A 3QO7A 2A9HA 4UV8A 4PDRA 5B1AC 1WNSA 2X7RB 4PHZA 3K58A 1PV0A 4J41A 4GX2A 4LF9B 5LMNB 3B40A 3ZMTA 1R6KA 2FYUH 5E79Z 1GO3F 2OTLV 3G67A 4DR1O 4OX9B 1HR0O 1FYJA 2FB5A 3DTUB 3UT5B 1FS0G 2ZE6A 2OT5A 4Q6GA 1FPOA 4NXNO 1EN6A 1ZUQA 1MSDA 1HNXO 2N74A 1W2BU 2EIJC 1ZL8B 4J80A 3BA8A 5B1AB 3SPGA 1L1FA 4FZ1A 1XUQA 4GX1A 3BRCA 2EILB 3ASNC 5K1PA 4HAMA 4DR4O 4DV1B 2JGDB 5H9CA 4CZZA 4MTFA 1U96A 2ZNIA 3A0RA 4UVAA 4MT8A 1FFXB 1OJHA 1Q7YW 4WF9V 2EZOA 4CH4A 1IBLO 2H94A 3A0HZ 2IW5A 3E8GA 4EEQA 3N2KB 3CCSV 2BTOA 4ZI7B 2PYLA 4MVRA 4DR4B 3IC9A 1SETA 4JI6B 5A2QN 4F6EA 1MA1A 2ZE8A 5GTHZ 4FLZA 4YY3O 2PF4E 1K5QA 5B3SC 1AJQA 1EN4A 4ICGA 2RN9A 2HKOA 4PI0A 3JSLA 3WG7B 5KHHA 1S72V 4UB8Z 4QIWF 1WN7A 2DWDC 3OE7G 2XAFA 2M7WA 4P9PA 4XDKA 1N33O 5B3SB 3ABMC 2OCCB 2QSAA 4YY3B 2ITDC 2WLHA 2UUCB 3K5LA 2OWOA 2JIZG 2HEPA 4DV7B 2RNBA 4FFBB 4X66B 1Y74A 4DUZO 2QWPB 2V7QG 1P84F 3KG2A 4AILC 3E86A 2EINB 1RSOA 2YEVA 3H9VA 4MVOA 1ENVA 2B5UA 3DC5A 5GONA 1N33B 3TETA 3TXQA 4TOIA 1NJIW 1QHTA 1M56B 4DR2B 3CRAA 3CCVV 2LO1A 1IURA 5LA6B 4FZ0A 4TV8A 5IJ0B 2LP7A 4O2AA 2QE7G 3MHHC 5FPRA 1OZ0A 2N04A 4IHJB 4X66O 3WU2Z 1S76D 2ADPA 2PY5A 1N34B 1BT8A 1FXKC 4X89A 4DV5O 2W6IG 4NTYA 4I55A 3ABLB 3C90A 3QG5A 4BIUA 1UPGA 3OEEG 2ZR2A 3U11A 4PA9A 2EINC 3KKYA 1ORQC 4IYHA 1YF2A 3MHSC 1AJPA 2QTSA 3UCSC 2YXLA 3K3WA 3UT5A 1XHZA 4I4TA 3RYCB 5EBWC 5CA1B 1TGOA 2QA4V 1FXKB 4YXWG 2UUAB 1WP8A 1MABG 1NH2B 3ZCCA 3CMAV 3IAYA 4GKKO 1OCRC 2WLIA 4IYIA 4ZIBA 4LH6A 1Q86W 3SJBC 4YIPA 3ZBHA 2K1EA 2ZNJA 3AG1C 2F1MA 3RFRA 3UO3A 4O4LA 4J10A 1SQGA 1QQCA 3JSNA 1TUBA 1I94B 1BSMA 4UV9A 5LHHA 2AW9A 3OR7C 3SYCA 5FNVA 1XBLA 4GKKB 3ZRXA 4CS4A 1RP3B 1LR1A 4LCUC 4PD4F 5FLXN 4H33A 1M9NA 4JYAO 4IGGA 3ABMB 3B8NA 3JYCA 2L35A 4WBNB 3KCYA 3W7TA 4TUYA 1XQ8A 2Q6AA 1J95A 4BAYA 1IX9A 4Z1MG 4IIJB 5E1AC 2YC0A 4YJ3A 3CCRV 5B1NA 3JAKB 1EFRG 4OGQB 4LF6B 5DEDA 3WG7C 1XMQB 3I55V 1CXZB 4G28B 4YHHO 3P32A 2XT9A 3ZJZA 3MDSA 4CS3A 5IY5B 2ETNA 4DO2A 1SQPH 5CB4B 3K06A 5A9GA 2OYQA 3APOA 4WBNA 3IJ4A 1S5HC 1VQOV 1DF4A 2X0LA 1H2LA 4UFZA 5C8YB 2UU9O 1JMKC 2RQ6A 5D5QA 2P7TC 3E83A 4X64B 1V55B 3CRCA 4MS2A 3CCQV 3CWBH 1EZJA 3CMEV 4LFCO 2KG7A 1Y76B 4LH7A 3ZHTA 5CBFA 3E8BA 1QVGU 4J7ZA 3OUSA 1F4NA 1K7DA 1OCCC 2F23A 4GX0A 3O9OA 1XL4A 3IGAC 2B9ZA 1RPOA 3WB0A 4NVPA 2XTAA 4X64O 1RM1C 1WJZA 2UXNA 1W59A 4JI3O 4Z1VA 3RYFA 5KA5A 4F6RA 2VQFB 4DRXB 4XBFA 3AG2B 2ZE7A 5FL7G 1FAFA 3U0ZA 1M5IA 5EIBC 4JI5O 4DYLA 4J7KA 5D5PA 5HFMA 5IYZB 3SJAC 2UXCB 2W0XA 3VBBA 2XHBA 2GHYA 3RYCA 3X2QC 5L3GA 1GK9A 4DR7O 1MNGA 2R9IA 2EIKC 3I56V 5ITZA 5AG2A 1IZ3A 1URFA 3SJQC 3LNNA 1WB8A 3CRRA 1MZFA 2K9PA 4GYCB 1RPRA 3HKCA 3T4ZA 4TT3G 1BS3A 2QR4A 2EJRA 3ETEA 4DK0A 5BMVB 2QWQB 2IJJA 5B66Z 2CTQA 3ZS8C 2AZ0A 3VQWA 2DW4A 3OM3B 2CGNA 3CCJV 2GUZA 4U3JB 3LDEA 3M7MX 1Y74B 3AG3B 1NQTA 4HNAB 3K5MA 2WLKA 2YI8A 4JZ2A 5IY5C 5TISZ 1JX9A 3HKBB 3JARB 4LF4B 4DV2B 2JEXA 3ZHSA 1HNWB 2P67A 4PV1B 1V54C 3O65A 3W7SA 2E3CA 3L9DA 2FKXA 4XDJA 3ETDA 1JFFB 2AHZA 4KFMA 2WA3A 4QJFB 3T1YO 1GTOA 4O4HB 4MSWC 4UUJC 3M99B 4YIOA 4K0KB 5JQGB 1KQSU 3P30A 1V54B 3FB7C 1WAZA 1KECA 3JAWB 5LYJB 4DW1A 2DYSC 2DE0X 2CK3G 4O4JB 3T1HB 3HKCB 5KMGB 1QBZA 3SDLA 5LL6Y 2A3QA 3LSUA 2PUSA 4DV6B 5CA0B 4U7NA 5GW7A 4MVUA 2IJKA 3H1LH 5EBLC 4JI1O 4ABMA 1XREA 4TV9A 5B1BB 1YJ9V 4JGSA 3T1HO 3JATA 5FPOA 5KLVH 1FJGB 2HR3A 1BCCH 5KMGA 2F4VB 4I9QA 3JAKA 3VQXA 4N21A 4FLUA 5EC1C 2P5OA 3G4SV 2JJ1G 4QE7A 4JAUA 1SESA 4I9WA 3BPZA 1ROPA 1F7YA 2E5LO 3ZMZA 4TV8B 4UCTA 2BCCH 1JCHA 3K04A 4U7OA 2PGGA 3F7VC 1FD9A 2Q73A 4HNAA 2YXYA 1KC8W 2KG7B 3SPHA 3B4SA 2ZM6O 1B06A 4YJ2B 4GKJO 2BOBC 4U3JA 1XHXA 4NKGB 2XAJA 3HKDB 2LFRA 2Y4TA 2CE4A 3X2QB 4FLXA 1WB7A 4PA6A 5BXZA 4PJ0Z 2H8PC 4JI2B 5IJ9B 4EFEA 1VQ8V 1G1XB 4CC5A 1N32O 2Q0AA 2A7WA 3ASOC 1NZ6A 3K0DA 2DMXA 2V4DA 2CAZC 1OCZB 4JTCB 4PDLA 4TV9B 1YSCA 2IM9A 3QO8A 1M57C 2LGWA 4K8ZA 1YVWA 4RQFA 2Y0IA 1AI5A 3BAAA 4JI0B 1RM1B 3GB7C 2HHHB 4J9ZB 4WFHA 5DN6G 3JD1A 2JEUA 3MAQA 3A8TA 2UXBB 1OHHG 3CSXA 1COWG 5JJEB 4LWSA 4JASA 4E4EA 2YDEA 2HVKC 5JH7A 1Q6IA 1BZKA 4DR6B 1H8HG 3CCEV 2ZQMA 1Z5VA 1GKFA 1IBLB 2HG5C 4H44B 3HKEB 2AZ2A 1BQ0A 1YZBA 1PL4A 1VQNV 2YIBA 2AGAA 4JI6O 1Y4MA 2YIDA 4HBNA 2DQ3A 4X20A 1EM1A 1H2NA 2IU3A 4GT1A 1XEQA 4TQDA 1TUBB 1R1BA 4GUNA 5J2TB 4UCOA 1FKAO 4WFEA 1QR8A 2B1IA 1WPXA 3ZMUA 1S77D 1NI8A 3OMAB 5GTIZ 4EKWA 3CYOA 4B3RB 4LF7O 3UQ8A 4OXSA 2AXTZ 1JJ2U 4K8XA 1SA0A 4QGPA 1QLEB 4NXMB 4QNHB 1JJOA 3ZN1A 4H13B 1D2DA 3BVOA 4LF5O 2WSSG 1THZA 3CC7V 5IWAO 1XDCA 4TWKA 4J7JA 1SQFA 1K33A 2X6BA 2R9RB 3AK3A 1CP9A 1ZAUA 2NR5A 5EIBD 1PKXA 2L6LA 3ASOB 4B7KA 3BY6A 3CXHF 4ASUG 2C2AA 2ODMA 4DW0A 4GLXA 1VQMV 1KYOF 2DOSA 1M57B 1NVPD 3E8FA 3E2EA 2ZKOA 1E1QG 1FXVA 3HR0A 1VQKV 1V9PA 1K3EA 2YSUB 4X1IB 3JALA 3W7XA 3AG2C 3QTCA 2FL4A 1QCEA 3CRMA 3K0GA 1XMOO 2ZDIC 4RUFA 1PPJH 1N34O 4DR1B 4OX9O 3TK1A
chains in the Genus database with same CATH topology
3I5DA 3H9VA 4DW1A 4DW0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I5D A;  3H9V A;  4DW1 A;  4DW0 A; 
#chains in the Genus database with same CATH topology
 3OAA G;  3ICX A;  4JYB A;  5IJ0 A;  4U3F H;  3OTO B;  5CA3 A;  3G6E V;  3JD0 A;  1AR4 A;  3PN1 A;  4ZHQ B;  3VQY A;  2F93 B;  2QJ1 A;  4JPR A;  3F5T A;  1XOU A;  3OGI B;  3R65 A;  3TCU A;  1WA8 A;  5EBM C;  3H01 A;  2F95 B;  1SER A;  1I0H A;  5J9P C;  4Q20 A;  4PA7 A;  4MVZ A;  2ZD9 A;  4DV5 B;  2WPD G;  4LFB O;  4DV0 O;  3DC6 A;  2CDY A;  2IJI A;  2X6A A;  2Q67 A;  4UCU A;  1SQB H;  4JAA A;  5B1O A;  2ADQ B;  4WCE V;  1JA8 A;  4R8C A;  3EVK A;  3RN4 A;  2YXH A;  1LUV A;  2ZDI A;  4LFB B;  1ARO P;  2IU0 A;  4DV0 B;  3ABK C;  4JTA B;  4MTX A;  1TAE A;  1TUE B;  1VIB A;  4I4T B;  2HFE C;  4JTD B;  3CC4 V;  1G6U A;  4JI7 O;  1TVK B;  2LW1 A;  2GTA A;  3Q4H B;  1OCC B;  1ZSP A;  3D3I A;  1XNR O;  3ZHQ A;  4UB6 Z;  4UCV A;  1P49 A;  1P7B A;  4WFB V;  4DR5 B;  1Q6H A;  2YIA A;  3DXR A;  5J2T A;  2JS3 A;  3ABU A;  4LNU B;  1KP2 A;  1UJW B;  2YIC A;  2YIB D;  4BW5 A;  4YJ2 A;  1XNR B;  4IT5 A;  4R6Z A;  4K3A A;  1CEZ A;  2RMK B;  4LF6 O;  4G2K A;  2Q68 A;  4JYA B;  4X62 B;  4B3S B;  3JCZ A;  4CC6 A;  4JV5 O;  1PL0 A;  3RYH B;  5KHG A;  2WLL A;  1N36 O;  3OFN G;  2CTR A;  1SKV A;  3HPL C;  2HVJ C;  2QDO A;  4MW3 A;  3GWO A;  1LNQ A;  3U10 A;  1AIL A;  4E2L A;  1K73 W;  4GZR B;  1XNQ B;  1S0V A;  1Q43 A;  3N27 A;  5DEC A;  1QLN A;  2WAM A;  3SYP A;  4JZG A;  3CS5 A;  4FMT A;  4X62 O;  4B3S O;  5CMU A;  1H2G A;  3QNE A;  4O2B A;  3ZMV A;  5EK0 A;  5HFL A;  5LP6 C;  1X4T A;  1L8D A;  4LR3 A;  4KL1 A;  3AG7 A;  5FNV B;  2XAG A;  5LOV B;  3J81 N;  2Y69 B;  3ZRW B;  2QKC A;  3A0B Z;  1VQ7 V;  1IBM O;  5JH7 B;  5CA0 A;  4NB5 A;  5C8Y A;  2GV9 A;  3H1I H;  1KUQ A;  1YDX A;  1EZV H;  4ZOL A;  1S5J A;  3SPJ A;  1IDS A;  1Y66 A;  3B2E E;  2EIL C;  3ASN B;  5EZY A;  1P4R A;  4WFA V;  2VRZ A;  3G6B A;  5JCO C;  3HKD A;  4FVM A;  1M93 A;  3RBZ A;  3L72 H;  4X1K A;  2CH7 A;  4RUE A;  2QTO A;  2E74 B;  2UUA O;  3AK1 A;  2DYR B;  1FFT B;  1JQ0 A;  1K97 A;  1GAX A;  1OCR B;  3FAV A;  2W6J G;  3FB5 C;  1R3I C;  3B8M A;  3ETQ A;  5LGU A;  2BTQ A;  1NT2 B;  1K8A W;  4JF3 A;  5H2F Z;  2GDS A;  2UXD B;  1SS3 A;  5J2U A;  1R6N A;  1YXB A;  4R7C A;  1SQQ H;  4O2A B;  3OEH G;  3G71 V;  1GN4 A;  1KU9 A;  3W7U A;  3UKM A;  2PYJ A;  1YIT V;  2Q4P A;  3JAS A;  3RW0 A;  4FLT A;  1TA8 A;  1NTK H;  2M6Y A;  1SA0 B;  3JD4 A;  3K5O A;  3IFX A;  4FLV A;  4MTO A;  3WB1 A;  1GM9 A;  1K4C C;  3GWK C;  4PA4 A;  2A06 H;  2A79 B;  3D8C A;  4UVC A;  2QGN A;  4EFB A;  3ZMS A;  2CUG A;  2EUL A;  1NKD A;  3RVY A;  2D3O W;  5C93 A;  4UXN A;  3T2M A;  5ITZ B;  5H6Q A;  3SYQ A;  5BY1 A;  4DV4 B;  2WA4 A;  1J5E B;  1CPY A;  1NR7 A;  3P3N A;  2ARH A;  2YI9 A;  2CTP A;  3JAL B;  4LWS B;  3TXS A;  3H1H H;  4DXW A;  2JVD A;  4LFA O;  2ILM A;  4B3M B;  1FXH A;  3KZI Z;  1HWY A;  3BFR A;  5JQG A;  3R66 A;  5CBH A;  3ABT A;  5CA1 A;  3HKE A;  3NXS A;  1NTZ H;  1MG1 A;  3BAB A;  2H3O A;  1U97 A;  2KQX A;  1JFF A;  1VF6 C;  2ZR3 A;  1BHB A;  5LOV A;  3CE2 A;  1HNW O;  4KXR A;  4CBC A;  4C7U A;  3EXA A;  2HLD G;  3JAR A;  3CRQ A;  2V1D A;  3QF7 A;  1M4U A;  2HJD A;  3CJH B;  3LDD A;  3EHB B;  4RAI A;  4DV6 O;  1GH6 A;  5IDJ A;  4K0K O;  1I5X A;  1DF5 A;  1NBM G;  5BZB A;  3AG3 C;  4JI1 B;  2Q0O C;  1AR5 A;  3FYI B;  3SYA A;  1R3J C;  2WLL B;  3WB2 A;  3OMI B;  3T4D A;  4NTX A;  2KSD A;  4BR6 A;  3B09 A;  3N2K A;  3SPC A;  2IBZ H;  2Y4U A;  4O4I A;  1E79 G;  2HP8 A;  3EFF K;  2PTM A;  4P2Z A;  4JI3 B;  3SYO A;  4KHP B;  2YEV B;  2CH7 B;  4RWU A;  4AQY O;  4JI8 O;  2R72 A;  2JGD A;  2PZS A;  5DM6 V;  2E5L B;  3DXR B;  4L87 A;  1GN6 A;  1YJW V;  3CP1 A;  2UXC O;  4ZBM A;  1VQ5 V;  1N4C A;  4EB6 A;  5LMU O;  3CCM V;  4DR7 B;  3BCC H;  4KHP O;  3E89 A;  5J2U B;  1KKC A;  4W4K A;  3AEI A;  2CTW A;  2R70 A;  3TJT A;  4AQY B;  4JI8 B;  1T5E A;  1F4M A;  4LBE C;  3SGI A;  4X9Q A;  2P4K A;  5F2V O;  4AI8 A;  5L3E A;  3OR6 C;  4I50 B;  3N2G B;  5LMU B;  5LXT B;  4F6R B;  4FPP A;  2RJZ A;  5KUK A;  1Q81 W;  1XL6 A;  1KBH A;  3RYH A;  3OMN B;  2P6J A;  4LF4 O;  4FLW A;  1NVP B;  1H8E G;  4J11 A;  5LGN A;  3RT3 C;  1N32 B;  5JVD A;  3RYI A;  3J80 N;  3H1J H;  3CEI A;  3RWR D;  2JJ2 G;  2JK5 C;  2BTQ B;  1WA8 B;  1HDJ A;  4DV3 O;  4X1I A;  1B04 A;  5B5E Z;  2FML A;  1IBK B;  3UO2 A;  5IYD O;  3ZRV A;  1G4Y B;  2JDI G;  1GM8 A;  2QM7 A;  2DYR C;  4CH5 A;  1D5A A;  1HNZ O;  4IIJ A;  2QWO B;  4D7T A;  3CCL V;  4B3T O;  1EBO A;  2EBO A;  3OGC C;  3FKS G;  3CD6 V;  2P06 A;  2PI4 A;  4N23 A;  1GN2 A;  1BL8 A;  1VMG A;  2Z5U A;  4MTG A;  3FB8 C;  4I0X A;  2EIM B;  1YHQ V;  2UUB O;  2O57 A;  4LF7 B;  1Z5W A;  2GUZ B;  1PD3 A;  2P22 C;  2WWW A;  3AG4 C;  1N0J A;  4X1Y A;  5LGT A;  3HB3 B;  1SC5 B;  1FJG O;  4B3T B;  5CBG A;  1QNM A;  1VF5 B;  3JD3 A;  4MW8 A;  4EB6 B;  1VAR A;  4FIP C;  2NLJ C;  3H1K H;  3RVZ A;  5BR8 B;  1YTF B;  4I55 B;  2UUC O;  3ZRW A;  3E22 A;  2YUA A;  4DV7 O;  1JOY A;  4LF9 O;  3CPW U;  5L3B A;  1JR9 A;  5KHI A;  1PNM A;  4TUY B;  3CC2 V;  4JAV A;  4DUZ B;  5JVD B;  2Q9L A;  2VS0 A;  3LUT B;  5KX5 B;  2QWN B;  1IXM A;  3W7W A;  4LP8 A;  1R6T A;  2XUM A;  1L0L H;  1A32 A;  4GKJ B;  5KX5 A;  5BR8 O;  3L73 H;  1Q90 D;  4X8A A;  1HNX B;  2OIE A;  1B3Q A;  4CS2 A;  2MK3 A;  5IWA B;  1IXB A;  1QVF U;  1X59 A;  5LHI A;  2E76 B;  2VQE B;  2UXX A;  2QEX V;  1S3J A;  1K5S A;  2VWK A;  1OCZ C;  3OTO O;  4P30 A;  4ZHQ A;  5KA6 A;  1M90 W;  1HR0 B;  4DV1 O;  1NTM H;  1AR1 B;  3RGB A;  1ZWI C;  2WLI B;  1DLB A;  2XAS A;  2NNU A;  5JJJ B;  1PP9 H;  3TGU H;  2IJH A;  4QPJ A;  4JI0 O;  2HHH O;  1SF9 A;  2VQE O;  1XMO B;  3LSS A;  2ZIM A;  1FXK A;  1H38 A;  2W0F C;  4PDM A;  2R9A A;  3J7A U;  4DR6 O;  4G27 B;  1KP3 A;  2BOC C;  2EX3 A;  4L8J A;  2ZT9 B;  3LNM B;  2X6C A;  2NN4 A;  1D5N A;  4KP4 A;  2WLJ A;  1NR1 A;  4IHJ A;  1YJN V;  3C3S A;  2Q69 A;  4J42 A;  3D36 C;  1VQ4 V;  4A5U B;  5IT9 N;  3MD0 A;  3STL C;  2RDC A;  1UFI A;  1ZL8 A;  3M8A A;  5EYP A;  3ZN0 A;  1I94 O;  1H2S B;  4Z2W A;  3ZHR A;  1AP6 A;  1YEW A;  3OW2 U;  1PM9 A;  4PA3 A;  2D2C B;  4OPH A;  3S3X A;  2DQ0 A;  2ATK C;  3F5W C;  4WFG A;  4B3R O;  4BWA A;  2LQT A;  1BMF G;  1VEW A;  3G80 A;  1YI2 V;  3ZRS A;  1VQ9 V;  3AG1 B;  1KKD A;  4FM2 A;  4NXM O;  2QKS A;  1AJN A;  2DYS B;  4JI7 B;  2LJ2 A;  5BMV A;  1OCO B;  1VQ6 V;  1I08 A;  3N2G A;  4O4L B;  1I5Y A;  3FX7 A;  1PNL A;  1Q6U A;  2Z3Y A;  1Z2G A;  4JV5 B;  2YS8 A;  3AK2 A;  3D36 A;  4DR5 O;  4PI2 A;  3SJC C;  3THO A;  1XMQ O;  1KMI Z;  1YIJ V;  5LXT A;  1WPB A;  4DUY O;  1US6 A;  1ZX3 A;  5L3D A;  1L0N H;  4CH3 A;  4FJC C;  4DR2 O;  1O9G A;  1NU1 H;  4ZI7 A;  2PI5 A;  1QU7 A;  1MSW D;  3L70 H;  1NH2 D;  2GTS A;  1RFY A;  2OTJ V;  4DUY B;  4QPK A;  2QM8 A;  4FM1 A;  3APQ A;  1YCI A;  4O2B B;  3QVN A;  1AVM A;  1OV9 A;  4D6T H;  4AHC A;  1VF6 A;  1BQZ A;  4TSF G;  3P3P A;  1MMM A;  5KHJ A;  2FTK A;  4X1K B;  2A0L A;  4LNU A;  3LDC A;  5L3F A;  4FLY A;  2GSM B;  1H2M A;  2XOK G;  1JPX A;  1AI6 A;  1XI1 A;  4P9O A;  5IJ9 A;  4IL6 Z;  1GM7 A;  4B08 A;  1I7F A;  3AG4 B;  3B77 A;  2LFS A;  4NTW A;  3BHP A;  1P7G A;  1HW7 A;  2EIJ B;  4ZOL B;  4X1Y B;  4JI5 B;  4NR1 A;  4X20 B;  3NR7 A;  4PEL A;  2JRI A;  2P90 A;  1K34 A;  1W0J G;  1O9H A;  2QWR B;  1H2K A;  3A2F A;  4I5S A;  5EZY B;  4I50 A;  1VF7 A;  4RQE A;  1SZT A;  5LP6 B;  1KD1 W;  3JD2 A;  2DN9 A;  2RCV A;  3S3W A;  2G38 A;  3ZX6 A;  4DRX A;  3DSQ A;  1DGS A;  1R3L C;  1QR9 A;  2Y48 A;  1TVK A;  1GMG A;  4BW9 A;  3ABK B;  2UXD O;  2ZXW C;  4QE9 A;  5IYZ A;  4MVS A;  2Q8V A;  5L3C A;  3UM7 A;  1VP7 A;  4RO2 A;  1K9M W;  3I5D A;  2Q5Z A;  2KB1 A;  4W4L A;  3BA9 A;  3KCX A;  5KHK A;  5H6R A;  4DV4 O;  3STZ C;  1FFX A;  2EZP A;  2ZE5 A;  1ZTE A;  3JAW A;  5K1X A;  4PDV A;  3FD9 A;  2Z0A A;  2BE3 A;  4LFA B;  1GN3 A;  5LA6 A;  4B3M O;  2EIM C;  2UU9 B;  3FFQ A;  4O4H A;  2ZXW B;  4O4J A;  1N36 B;  3T1Y B;  3K5N A;  3OTF A;  3ZIA G;  2IH1 C;  1Q8I A;  4YHH B;  1M56 C;  5KUM A;  4LFC B;  5LYJ A;  2ZCE A;  4JI4 B;  5LHG A;  3F7Y C;  1XNQ O;  1AI7 A;  1J5E O;  1F23 A;  4K35 A;  3JAS B;  2VWJ A;  1AI4 A;  5IYC O;  3OD4 A;  2GBO A;  3JAT B;  4H37 A;  4X88 A;  2OIG A;  3T1C A;  1WP7 A;  1VQL V;  4UCS A;  4JYC A;  4H0L B;  1Q3E A;  3E8H A;  3K57 A;  1K4D C;  4NYK A;  1IBM B;  5LBQ A;  4YJ3 B;  5EYP B;  4JI4 O;  3Q4H A;  2JS5 A;  2JGU A;  3HKB A;  5KAI Z;  2N05 A;  4F4L A;  1DTO A;  4UVB A;  3IC7 A;  4I0X B;  1MZE A;  3CHX A;  1JVM A;  4I7Z B;  5JCO A;  1S5L Z;  3CXC U;  1KB9 F;  5KAF Z;  4CH6 A;  1PNK A;  4MVM A;  3D3Q A;  3WFV A;  2Q7G A;  5EC2 C;  2VQF O;  1IVS A;  2HJF C;  1BE3 H;  3SR2 C;  4O4I B;  2MW2 B;  4KUM A;  3VQV A;  1V55 C;  1F51 A;  5B1B C;  1YTF D;  1B6Q A;  2CGO A;  3K9S A;  1VQP V;  4FM0 A;  1RSO B;  4BIO A;  1N0N A;  4XDL A;  2ZM6 B;  3SPI A;  3DGE A;  3CCU V;  3E22 B;  3L74 H;  2QM4 A;  2BSK A;  2Y0P A;  1Y67 A;  1W0K G;  2Q7E A;  4OPA A;  3LSQ A;  2Y69 C;  4JI2 O;  3ZHV A;  2XAH A;  3E35 A;  2AHY A;  3ABL C;  1BHA A;  1QLE C;  2LGQ A;  3K79 A;  2E75 B;  3QO5 A;  4GCZ A;  3FAV B;  4DR3 B;  5IYB O;  3VOU A;  1OCO C;  3BEH A;  1G8M A;  1SQX H;  2LW7 A;  2WLN A;  4DV2 O;  2UXB O;  3K08 A;  2EJ7 A;  4B7E A;  4FFK A;  2Q7H A;  2ZIO A;  1R73 A;  3CX5 F;  2OCH A;  2P4V A;  1Y6X A;  3GVM A;  3ZED A;  4DR3 O;  3PJS K;  3CB2 A;  3JCU Z;  3ETG A;  2KKW A;  1R3K C;  1LUW A;  5H5N A;  2B1G A;  5GON B;  1HNZ B;  4MVQ A;  4WFF A;  3ZHU A;  3ML0 A;  1EN5 A;  4JYY A;  2DWE C;  3RYI B;  1Q82 W;  3L75 H;  4HZ3 A;  3JAM N;  4LF8 B;  2F4V O;  1SQV H;  5JWP A;  4DV3 B;  3CJH A;  3L71 H;  4FK5 C;  3FYE B;  1AB3 A;  1E1R G;  1IBK O;  3RYF B;  1AP5 A;  1WLE A;  4HYO A;  1BGY H;  4D7S A;  1SZX A;  2ZIN A;  1MOF A;  4LC1 A;  2XND G;  2IH3 C;  4J9Y B;  2F66 C;  4FFB A;  1SRY A;  1XIL A;  4LF8 O;  4X65 B;  4UCR A;  2QKA A;  1Q5O A;  1GRJ A;  2F43 G;  1HP8 A;  2BSK B;  3FB6 C;  1N8R W;  1Y76 A;  1K92 A;  2WLM A;  3C3T A;  4LF5 B;  5JJN B;  3K9A A;  5CN0 A;  1DK1 A;  2UUB B;  2DJV A;  4TQF A;  4DK1 A;  4ZKI A;  5LMN O;  4BIZ A;  4X65 O;  5IE9 A;  3OUF A;  2OCC C;  4GX5 A;  4R50 A;  1NS1 A;  3OT7 A;  5CB4 A;  1M1K W;  2EIK B;  1ZLZ A;  5LP6 A;  3K59 A;  2XAQ A;  2ITC C;  4NXN B;  3K03 A;  3QO7 A;  2A9H A;  4UV8 A;  4PDR A;  5B1A C;  1WNS A;  2X7R B;  4PHZ A;  3K58 A;  1PV0 A;  4J41 A;  4GX2 A;  4LF9 B;  5LMN B;  3B40 A;  3ZMT A;  1R6K A;  2FYU H;  5E79 Z;  1GO3 F;  2OTL V;  3G67 A;  4DR1 O;  4OX9 B;  1HR0 O;  1FYJ A;  2FB5 A;  3DTU B;  3UT5 B;  1FS0 G;  2ZE6 A;  2OT5 A;  4Q6G A;  1FPO A;  4NXN O;  1EN6 A;  1ZUQ A;  1MSD A;  1HNX O;  2N74 A;  1W2B U;  2EIJ C;  1ZL8 B;  4J80 A;  3BA8 A;  5B1A B;  3SPG A;  1L1F A;  4FZ1 A;  1XUQ A;  4GX1 A;  3BRC A;  2EIL B;  3ASN C;  5K1P A;  4HAM A;  4DR4 O;  4DV1 B;  2JGD B;  5H9C A;  4CZZ A;  4MTF A;  1U96 A;  2ZNI A;  3A0R A;  4UVA A;  4MT8 A;  1FFX B;  1OJH A;  1Q7Y W;  4WF9 V;  2EZO A;  4CH4 A;  1IBL O;  2H94 A;  3A0H Z;  2IW5 A;  3E8G A;  4EEQ A;  3N2K B;  3CCS V;  2BTO A;  4ZI7 B;  2PYL A;  4MVR A;  4DR4 B;  3IC9 A;  1SET A;  4JI6 B;  5A2Q N;  4F6E A;  1MA1 A;  2ZE8 A;  5GTH Z;  4FLZ A;  4YY3 O;  2PF4 E;  1K5Q A;  5B3S C;  1AJQ A;  1EN4 A;  4ICG A;  2RN9 A;  2HKO A;  4PI0 A;  3JSL A;  3WG7 B;  5KHH A;  1S72 V;  4UB8 Z;  4QIW F;  1WN7 A;  2DWD C;  3OE7 G;  2XAF A;  2M7W A;  4P9P A;  4XDK A;  1N33 O;  5B3S B;  3ABM C;  2OCC B;  2QSA A;  4YY3 B;  2ITD C;  2WLH A;  2UUC B;  3K5L A;  2OWO A;  2JIZ G;  2HEP A;  4DV7 B;  2RNB A;  4FFB B;  4X66 B;  1Y74 A;  4DUZ O;  2QWP B;  2V7Q G;  1P84 F;  3KG2 A;  4AIL C;  3E86 A;  2EIN B;  1RSO A;  2YEV A;  3H9V A;  4MVO A;  1ENV A;  2B5U A;  3DC5 A;  5GON A;  1N33 B;  3TET A;  3TXQ A;  4TOI A;  1NJI W;  1QHT A;  1M56 B;  4DR2 B;  3CRA A;  3CCV V;  2LO1 A;  1IUR A;  5LA6 B;  4FZ0 A;  4TV8 A;  5IJ0 B;  2LP7 A;  4O2A A;  2QE7 G;  3MHH C;  5FPR A;  1OZ0 A;  2N04 A;  4IHJ B;  4X66 O;  3WU2 Z;  1S76 D;  2ADP A;  2PY5 A;  1N34 B;  1BT8 A;  1FXK C;  4X89 A;  4DV5 O;  2W6I G;  4NTY A;  4I55 A;  3ABL B;  3C90 A;  3QG5 A;  4BIU A;  1UPG A;  3OEE G;  2ZR2 A;  3U11 A;  4PA9 A;  2EIN C;  3KKY A;  1ORQ C;  4IYH A;  1YF2 A;  3MHS C;  1AJP A;  2QTS A;  3UCS C;  2YXL A;  3K3W A;  3UT5 A;  1XHZ A;  4I4T A;  3RYC B;  5EBW C;  5CA1 B;  1TGO A;  2QA4 V;  1FXK B;  4YXW G;  2UUA B;  1WP8 A;  1MAB G;  1NH2 B;  3ZCC A;  3CMA V;  3IAY A;  4GKK O;  1OCR C;  2WLI A;  4IYI A;  4ZIB A;  4LH6 A;  1Q86 W;  3SJB C;  4YIP A;  3ZBH A;  2K1E A;  2ZNJ A;  3AG1 C;  2F1M A;  3RFR A;  3UO3 A;  4O4L A;  4J10 A;  1SQG A;  1QQC A;  3JSN A;  1TUB A;  1I94 B;  1BSM A;  4UV9 A;  5LHH A;  2AW9 A;  3OR7 C;  3SYC A;  5FNV A;  1XBL A;  4GKK B;  3ZRX A;  4CS4 A;  1RP3 B;  1LR1 A;  4LCU C;  4PD4 F;  5FLX N;  4H33 A;  1M9N A;  4JYA O;  4IGG A;  3ABM B;  3B8N A;  3JYC A;  2L35 A;  4WBN B;  3KCY A;  3W7T A;  4TUY A;  1XQ8 A;  2Q6A A;  1J95 A;  4BAY A;  1IX9 A;  4Z1M G;  4IIJ B;  5E1A C;  2YC0 A;  4YJ3 A;  3CCR V;  5B1N A;  3JAK B;  1EFR G;  4OGQ B;  4LF6 B;  5DED A;  3WG7 C;  1XMQ B;  3I55 V;  1CXZ B;  4G28 B;  4YHH O;  3P32 A;  2XT9 A;  3ZJZ A;  3MDS A;  4CS3 A;  5IY5 B;  2ETN A;  4DO2 A;  1SQP H;  5CB4 B;  3K06 A;  5A9G A;  2OYQ A;  3APO A;  4WBN A;  3IJ4 A;  1S5H C;  1VQO V;  1DF4 A;  2X0L A;  1H2L A;  4UFZ A;  5C8Y B;  2UU9 O;  1JMK C;  2RQ6 A;  5D5Q A;  2P7T C;  3E83 A;  4X64 B;  1V55 B;  3CRC A;  4MS2 A;  3CCQ V;  3CWB H;  1EZJ A;  3CME V;  4LFC O;  2KG7 A;  1Y76 B;  4LH7 A;  3ZHT A;  5CBF A;  3E8B A;  1QVG U;  4J7Z A;  3OUS A;  1F4N A;  1K7D A;  1OCC C;  2F23 A;  4GX0 A;  3O9O A;  1XL4 A;  3IGA C;  2B9Z A;  1RPO A;  3WB0 A;  4NVP A;  2XTA A;  4X64 O;  1RM1 C;  1WJZ A;  2UXN A;  1W59 A;  4JI3 O;  4Z1V A;  3RYF A;  5KA5 A;  4F6R A;  2VQF B;  4DRX B;  4XBF A;  3AG2 B;  2ZE7 A;  5FL7 G;  1FAF A;  3U0Z A;  1M5I A;  5EIB C;  4JI5 O;  4DYL A;  4J7K A;  5D5P A;  5HFM A;  5IYZ B;  3SJA C;  2UXC B;  2W0X A;  3VBB A;  2XHB A;  2GHY A;  3RYC A;  3X2Q C;  5L3G A;  1GK9 A;  4DR7 O;  1MNG A;  2R9I A;  2EIK C;  3I56 V;  5ITZ A;  5AG2 A;  1IZ3 A;  1URF A;  3SJQ C;  3LNN A;  1WB8 A;  3CRR A;  1MZF A;  2K9P A;  4GYC B;  1RPR A;  3HKC A;  3T4Z A;  4TT3 G;  1BS3 A;  2QR4 A;  2EJR A;  3ETE A;  4DK0 A;  5BMV B;  2QWQ B;  2IJJ A;  5B66 Z;  2CTQ A;  3ZS8 C;  2AZ0 A;  3VQW A;  2DW4 A;  3OM3 B;  2CGN A;  3CCJ V;  2GUZ A;  4U3J B;  3LDE A;  3M7M X;  1Y74 B;  3AG3 B;  1NQT A;  4HNA B;  3K5M A;  2WLK A;  2YI8 A;  4JZ2 A;  5IY5 C;  5TIS Z;  1JX9 A;  3HKB B;  3JAR B;  4LF4 B;  4DV2 B;  2JEX A;  3ZHS A;  1HNW B;  2P67 A;  4PV1 B;  1V54 C;  3O65 A;  3W7S A;  2E3C A;  3L9D A;  2FKX A;  4XDJ A;  3ETD A;  1JFF B;  2AHZ A;  4KFM A;  2WA3 A;  4QJF B;  3T1Y O;  1GTO A;  4O4H B;  4MSW C;  4UUJ C;  3M99 B;  4YIO A;  4K0K B;  5JQG B;  1KQS U;  3P30 A;  1V54 B;  3FB7 C;  1WAZ A;  1KEC A;  3JAW B;  5LYJ B;  4DW1 A;  2DYS C;  2DE0 X;  2CK3 G;  4O4J B;  3T1H B;  3HKC B;  5KMG B;  1QBZ A;  3SDL A;  5LL6 Y;  2A3Q A;  3LSU A;  2PUS A;  4DV6 B;  5CA0 B;  4U7N A;  5GW7 A;  4MVU A;  2IJK A;  3H1L H;  5EBL C;  4JI1 O;  4ABM A;  1XRE A;  4TV9 A;  5B1B B;  1YJ9 V;  4JGS A;  3T1H O;  3JAT A;  5FPO A;  5KLV H;  1FJG B;  2HR3 A;  1BCC H;  5KMG A;  2F4V B;  4I9Q A;  3JAK A;  3VQX A;  4N21 A;  4FLU A;  5EC1 C;  2P5O A;  3G4S V;  2JJ1 G;  4QE7 A;  4JAU A;  1SES A;  4I9W A;  3BPZ A;  1ROP A;  1F7Y A;  2E5L O;  3ZMZ A;  4TV8 B;  4UCT A;  2BCC H;  1JCH A;  3K04 A;  4U7O A;  2PGG A;  3F7V C;  1FD9 A;  2Q73 A;  4HNA A;  2YXY A;  1KC8 W;  2KG7 B;  3SPH A;  3B4S A;  2ZM6 O;  1B06 A;  4YJ2 B;  4GKJ O;  2BOB C;  4U3J A;  1XHX A;  4NKG B;  2XAJ A;  3HKD B;  2LFR A;  2Y4T A;  2CE4 A;  3X2Q B;  4FLX A;  1WB7 A;  4PA6 A;  5BXZ A;  4PJ0 Z;  2H8P C;  4JI2 B;  5IJ9 B;  4EFE A;  1VQ8 V;  1G1X B;  4CC5 A;  1N32 O;  2Q0A A;  2A7W A;  3ASO C;  1NZ6 A;  3K0D A;  2DMX A;  2V4D A;  2CAZ C;  1OCZ B;  4JTC B;  4PDL A;  4TV9 B;  1YSC A;  2IM9 A;  3QO8 A;  1M57 C;  2LGW A;  4K8Z A;  1YVW A;  4RQF A;  2Y0I A;  1AI5 A;  3BAA A;  4JI0 B;  1RM1 B;  3GB7 C;  2HHH B;  4J9Z B;  4WFH A;  5DN6 G;  3JD1 A;  2JEU A;  3MAQ A;  3A8T A;  2UXB B;  1OHH G;  3CSX A;  1COW G;  5JJE B;  4LWS A;  4JAS A;  4E4E A;  2YDE A;  2HVK C;  5JH7 A;  1Q6I A;  1BZK A;  4DR6 B;  1H8H G;  3CCE V;  2ZQM A;  1Z5V A;  1GKF A;  1IBL B;  2HG5 C;  4H44 B;  3HKE B;  2AZ2 A;  1BQ0 A;  1YZB A;  1PL4 A;  1VQN V;  2YIB A;  2AGA A;  4JI6 O;  1Y4M A;  2YID A;  4HBN A;  2DQ3 A;  4X20 A;  1EM1 A;  1H2N A;  2IU3 A;  4GT1 A;  1XEQ A;  4TQD A;  1TUB B;  1R1B A;  4GUN A;  5J2T B;  4UCO A;  1FKA O;  4WFE A;  1QR8 A;  2B1I A;  1WPX A;  3ZMU A;  1S77 D;  1NI8 A;  3OMA B;  5GTI Z;  4EKW A;  3CYO A;  4B3R B;  4LF7 O;  3UQ8 A;  4OXS A;  2AXT Z;  1JJ2 U;  4K8X A;  1SA0 A;  4QGP A;  1QLE B;  4NXM B;  4QNH B;  1JJO A;  3ZN1 A;  4H13 B;  1D2D A;  3BVO A;  4LF5 O;  2WSS G;  1THZ A;  3CC7 V;  5IWA O;  1XDC A;  4TWK A;  4J7J A;  1SQF A;  1K33 A;  2X6B A;  2R9R B;  3AK3 A;  1CP9 A;  1ZAU A;  2NR5 A;  5EIB D;  1PKX A;  2L6L A;  3ASO B;  4B7K A;  3BY6 A;  3CXH F;  4ASU G;  2C2A A;  2ODM A;  4DW0 A;  4GLX A;  1VQM V;  1KYO F;  2DOS A;  1M57 B;  1NVP D;  3E8F A;  3E2E A;  2ZKO A;  1E1Q G;  1FXV A;  3HR0 A;  1VQK V;  1V9P A;  1K3E A;  2YSU B;  4X1I B;  3JAL A;  3W7X A;  3AG2 C;  3QTC A;  2FL4 A;  1QCE A;  3CRM A;  3K0G A;  1XMO O;  2ZDI C;  4RUF A;  1PPJ H;  1N34 O;  4DR1 B;  4OX9 O;  3TK1 A; 
#chains in the Genus database with same CATH homology
 3I5D A;  3H9V A;  4DW1 A;  4DW0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...