4DWSD

Crystal structure of a chitinase from the yersinia entomophaga toxin complex
Total Genus 191
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
191
sequence length
539
structure length
532
Chain Sequence
PTENIPSPILVEDKYTEETYSRPDVNFKEDGSQGNLSYTATRVCAPMYNHYVGDKTKPKLSAYITDWCQYDARLDGGGSKEEERGRGFDLATLMQNPATYDRLIFSFLGICGDIGNSKKVQEVWDGWNAQAPSLGLPQIGGHIVPLDPYGDLGTARNVGLPPESADTSIESGTFLPYYQQNRAAGLLGGLRELQKKAHAMGHKLDLAFSIGGWSLSSYFSALAENPDERRVFVASVVDFFVRFPMFSCVDIDWEYPGGGGDEGNISSDKDGENYVLLIKELRSALDSRFGYSNREISIACSGVALKKSNIDQLVANGLDNIYLMSYDFFGTIWADYIGHHTNLYSPKDPGEQELFDLSAEAAIDYLHNELGIPMEIHLGYANYGRSAVGGDLTTRQYTNGPALGTMENGAPEFFDIVKNYMDAEHSLSMGKNGFVLMTDTNADADFLFSEAKGHFISLDTPRTVKQKGEYAAKNKLGGVFSWSGDQDCGLLANAAREGLGYVADSNQETIDMGPLYNPGKEIYLKSISEIKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chi2
publication title The BC component of ABC toxins is an RHS-repeat-containing protein encapsulation device.
pubmed doi rcsb
source organism Yersinia entomophaga
molecule tags Sugar binding protein
total genus 191
structure length 532
sequence length 539
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2012-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4dwsD01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4dwsD02
1H0GA 4PMUA 2VNCA 1LG1A 1UR8A 3CZGA 1WCGA 3WUBA 1V0KA 1V6XA 3O6AA 2AOSA 3K1DA 5GQBA 4HA1A 1E6QM 3W28A 1YHTA 3UR7A 3RM9A 3QR3A 1HVXA 4LGXA 4P8UA 3W26A 2Y2WA 5AYBA 5CG0A 2EXOA 4NSBA 3ARUA 2CKSA 4TVUA 5ABGA 3OGSA 5I5RA 1J9YA 3LPOA 2XJ7A 1UD5A 1W3KA 2ZX5A 2GJPA 5AY7A 2FH6A 2E40A 4HA3A 3RCNA 1H49A 1HJQA 4AIEA 2VX4A 2EJ1A 4D6GA 3VINA 3L4TA 3AS0A 2J7BA 1VBRA 3WMCA 1IZJA 5A6SA 1PJ9A 4P7OA 3N17A 2HISA 5I0DA 3NYDA 4W93A 2DDXA 4UFHA 2OLHA 7A3HA 1E56A 2CETA 3VIOA 1VFFA 4A3HA 5LA0A 2PWGA 3IANA 4GZEA 2C8NA 2XIIA 3POCA 2VR5A 3VGHA 1TZ7A 1NWTA 5BYWA 3VD5A 4OZOA 3CHDA 3BLKA 1GJWA 3WDPP 5CGMA 1V02A 3VX0A 4J3TA 5A2CA 2BFGA 1OB0A 2DT3A 3ALGA 4R5EA 4NI3A 1I1WA 3WEOA 4F9DA 4WK9A 3VIKA 3WL1A 1FA2A 2CBUA 3UETA 1W2VA 1W9BM 4DUVA 4Z2LA 5ABFA 1BGAA 1CEOA 1UZ4A 3OBAA 4YHGA 1R87A 4PYSA 3ZOAA 2PF0A 2F61A 4GQRA 4KRUA 1BPLB 3PZ9A 1JDDA 1V3JA 3POHA 1CGTA 3WDIA 2D0HA 1TA3A 1HJWA 1KXQA 4PMZA 4GI8A 3WNPA 3MUIA 5A2AA 4W8AA 3T0AA 2AAAA 3N12A 5D8ZA 1CYGA 4AW7A 3VX1A 1C90A 4HPHA 3SUTA 5HXMA 3SCTA 2CESA 2E8YA 2VURA 4FLSA 1VFUA 2J7GA 4DUWA 1OINA 3WKZA 2X09A 5DMYA 1AVAA 1BYDA 2BHYA 2W61A 1QOXA 3I3EA 4UFIA 2VRQA 1I1XA 3K46A 1NARA 2NT0A 4UQDA 1KCLA 3VMOA 3PZOA 3RJYA 5A6JA 3NDZA 1EQPA 4WJXA 2XM2A 3LPPA 3U5UA 5CGTA 4EKJA 2J75A 4E8DA 3JUGA 5CLTA 3NUKA 1VJZA 1E9LA 3FAXA 2CHOA 3VNYA 1UHVA 2JFEX 3AS3A 3AMLA 3PHAA 2VX5A 1E43A 1P6WA 1GOOA 1RH9A 2BV9A 3M6DA 3UERA 1JL8A 4BQ4A 1Q6EA 2YA1A 3WQWA 2YA0A 1UD2A 1VAHA 1JYXA 5EMYA 1E5NA 1V0LA 5D9PA 3VM5A 3VDCA 3IJ9A 1QHZA 4PUEA 1VEMA 4D6HA 4ACZB 5EBAA 3GXDA 3A3HA 1NWSA 2O9TA 2MANA 1WPCA 4TVCA 3VILA 1GVIA 1J0HA 5D8WA 1OCQA 4WSJA 2CBJA 4CD5A 1UKQA 4JZ5A 1MFVA 3AZRA 4M8UA 4PMQA 1ECEA 2VVSA 2G3MA 5LA1A 4HU0A 4GZIA 4D6DA 4DM2A 3SCQA 2CKRA 3OB8A 5I78A 5FOOA 3W53A 1UWTA 2BY1A 4D6FA 4LYPA 2ZUMA 3VGDA 4IPNB 2WMJA 4B3KA 4PTXA 1W3JA 4QP0A 3UG4A 3CHFA 5A95A 4E8CA 1UWUA 1XYFA 2ZOXA 2X1IA 1HKKA 4TTUA 2OYKA 1EOMA 2CBVA 2WCGA 3AQUA 1QBBA 3AYRA 3QHNA 3W38A 4TVDA 4JAWA 2YL5A 2GK1A 1TUXA 1XC6A 1B3YA 1TVPA 1QI2A 2YA2A 4UOQA 4FLRA 1ZS2A 3ZR5A 4ATDA 1M53A 1K6AA 2GJXA 3WL0A 3PZVA 4EE9A 5BXRA 2DSVA 2V5DA 3TOPA 3AICA 3PBGA 1UA3A 5I2UA 1HKIA 3WFLA 1BG9A 3AMDA 4HOZA 1KQZA 3AMCA 4EANA 1OD8A 5D4YA 4M1RA 1CDGA 3WDJA 1QI3A 4P7NA 1G1YA 1MVYA 1H1NA 4KRTA 4PEEA 4MAVA 1W9VA 1JZ8A 4E2OA 1NOFA 2WZEA 4PN2A 4U33A 4ACYA 1ZJAA 3SCPA 1QW9A 3W4RA 4WKHA 1E3ZA 3N04A 1B90A 4GI9A 1DTUA 5C70A 1JG9A 3BSGA 4MB3A 3RDKA 1NP0A 4BF7A 4TX8A 1BTCA 1V6WA 5A6LA 2WPGA 3SCSA 5CPSA 1UKSA 4DUXA 4NZCA 3L2MA 1E0WA 3AHYA 4MPKA 4DWSB 5IHRA 3VIPA 1Q6DA 4QLKA 4PUDA 2VRKA 1JD9A 3MSGA 4HA4A 3B9AA 4AZGA 1I75A 4L4PA 2V3GA 1E55A 1OSEA 4UQCA 3TA9A 3RM4A 3VNZA 1LQ0A 1JZ5A 4XZWA 1DWFM 5ABEA 3TTYA 1UR4A 3ARRA 1CIUA 1CBGA 2VZOA 5IFPA 4B3LA 3AIWA 3CPUA 3TTQA 1ZBVA 3BMVA 5GPRA 1TCMA 2XVNA 2WANA 1GONA 5M17A 4ZE5A 5A69A 4AIUA 3KL0A 2VL4A 3WH8A 1WE5A 3WUFA 1J0JA 2FHBA 1MW0A 3PZTA 1GOIA 2Z1KA 1QNSA 2DSWA 4B9ZA 5BCAA 3F4VA 5I6SA 4UZUA 4HOWA 1VIWA 3CTTA 3T2QA 3AIUA 1E6RA 1XH0A 2WLYA 3AIQA 5DO8A 1BYCA 2WVVA 3MU7A 1CXLA 1JYVA 1UQZA 1VFOA 3SCOA 1VFMA 4D6JA 4BA0A 5I24A 2YBTA 1HL9A 2W66A 4PMRA 2J77A 1E6NA 1CNVA 1KGWA 4BQ5A 4Z2JA 2WMIB 1Q6FA 2Y8KA 1WZLA 1K9TA 1GUVA 3VU2A 3IK2A 3AROA 1OD0A 3WNLA 2FH8A 2IXVA 4ATLA 3RJXA 4V2XA 3EDKA 6CGTA 4XB3A 1CXFA 3VM7A 5JUVA 4CU8A 3FXYA 4EAMA 5FIPA 1MXGA 1UQYA 1OBAA 1U30A 3GM8A 2V3EA 3ARTA 2D0GA 2XFRA 1OWQA 5E0CA 1C7TA 4JKLA 3DC0A 2VOTA 1C8QA 2ZWYA 5E9AA 2ZXBA 3BAJA 4FF5A 1JFHA 1J0ZA 2ZXDA 2XSBA 3UEQA 1O7AA 3THDA 3W27A 1TMQA 1L8NA 5ECUA 2DGAA 2VTFA 4H2CA 3FW6A 3CHEA 2XSAA 1H41A 3OGVA 3VIIA 1NWUA 3OLIA 1NH6A 2GDUA 1W9XA 3ECQA 4HU8A 4WLCA 4UNIA 3FNDA 3ZR6A 3AIEA 3CMGA 1B3XA 3MMUA 3IJ7A 4M24A 3SUVA 2BXYA 1DEDA 3WD1A 1ODUA 1XCWA 1UWIA 4H04A 2QF8A 4JFUA 2CITA 3ARYA 3MUY1 2WM0A 4M56A 3UG5A 5CJ5A 4AEEA 2G8ZA 4GIAA 4AD0A 4IISA 1ZJBA 3GXMA 2D0FA 3WNMA 4NF7A 3AJ7A 4MNLA 4V28A 4W7UA 2YDSA 3WQ5A 2GJRA 4AZBA 1FHLA 3N15A 1J0YA 1MW3A 1EGZA 3CZ8A 1BVZA 2QPSA 2BHUA 2YLLA 3CUJA 1UH4A 4CD4A 1WZKA 3MSDA 4QCEA 4KWUA 1K9EA 5HOSA 2GDVA 5C8BB 4U5KA 2WCSA 1OT2A 3LPFA 4HTYA 1C7SA 1WP6A 2D1ZA 4HMEA 1W1VA 2C0HA 3QOKA 5CSUA 2O92A 2WYSA 4F8XA 5LA2A 2J78A 2YDQA 1ZU8A 1QHOA 4URIA 3KL5A 4MTVA 3OZPA 1W9DM 3AZTA 1JGIA 5TD4A 2DSZA 1W32A 5BRQA 2BY0A 4YPJA 1HVQA 4JIEA 5ABFB 4DWSD 4PRWA 2VX6A 3DYOA 3EYPA 3ZO9A 3KEHA 2OSXA 1EDGA 4LPCA 4LYQA 3L4VA 5D9OA 1E73M 1HT6A 1HJUA 2VQUA 5JH8A 4F79A 5HPCA 1XCXA 4H8VA 1BYAA 2EPNA 1C3FA 1UWQA 5DFAA 2GUYA 2JEPA 3WF0A 3A47A 5FL1A 1K9DA 3CIVA 2WC7A 1WKYA 4UCFA 1MW2A 2HVMA 5CZKA 1V3HA 2WVTA 1ITXA 1C8XA 3CZLA 1C91A 1XGZA 1HJSA 3OGRA 3M46A 4UOJA 2Y24A 4J3UA 4JHOA 3CBWA 4PMYA 2O9PA 2PWHA 4JFSA 3BAXA 3O2LA 3J7HA 3KE0A 3MANA 2JIEA 1GNXA 2NT1A 1HN1A 1XSKA 4N0RA 4UOZA 1X6LA 2YJQA 3ZT7A 1E71M 1GQJA 1UD6A 5I3DA 4WKFA 4U3AA 3VIGA 4HOXA 1OT1A 3AHVA 3VIHA 3FY1A 3MMDA 1M01A 3WQ4A 1W91A 1CXKA 2RGMA 1IZKA 2X0HA 4MADA 4ZFMA 3GH4A 2FHFA 1V0MA 2E3ZA 3WMBA 4KGLA 1FH7A 2VQTA 2CPUA 3FN9A 1H5VA 4J3XA 1SFSA 1JAEA 2G3JA 1LL6A 3SUUA 1J10A 2J4GA 5GNZA 2G3NA 3BCDA 1H11A 2BXZA 1HL8A 2D20A 2VC9A 2QV4A 4GXPA 5I77A 2EPMX 4J27A 4A4AA 1ISVA 1K9FA 3FAWA 3W24A 1JZ4A 1ESWA 4OOUA 1V3MA 4RL3A 1HP5A 4U5IA 2G4FA 3OZOA 1TE1A 2CEQA 1FOBA 1OGBA 1FFRA 1HJXA 1MXDA 2EO7A 2VRJA 2A3BA 2VR4A 3QGVA 2V5CA 1NM9A 2A3CA 2VX7A 2WHKA 4S3JA 1LWHA 1V08A 3CUFA 2XTKA 1KBBA 1BQCA 1BHGA 3PN8A 1UYQA 1LF1A 3ARXA 1B3WA 3WBAA 2XVGA 4U2YA 5HPOA 4AZCA 1JI1A 5A8MA 1UD3A 3VD7A 3WH9A 3GH5A 3CUGA 3VTRA 3MKKA 5CQ1A 4RE2A 3NJ3A 4P8VA 5CPTA 1QPKA 2VT0A 1JNEA 4D6CA 1MQRA 1A47A 1W3LA 1UKPA 2ZX7A 1JDCA 3VIJA 2WNWA 2ZXAA 4GINA 1E70M 3AXXA 3SCNA 2DH2A 2J47A 3B8SA 4J28A 4HZ6A 2JF7A 2WSPA 1W3HA 4U3CA 4OBSA 3GDBA 3A4XA 3SCRA 3IAQA 5FL0A 3EDEA 3L2LA 2XWDA 2YL8A 2E4TA 1QNPA 1XYZA 2WWCA 1UKOA 2E8ZA 3M7SA 3N9KA 4AISA 3VVGA 1GOQA 3N1AA 3ARQA 1AQMA 1MWOA 2OSYA 3WDQA 2WBGA 3WNNA 3MS8A 5DEZA 1JZ7A 3WUGA 3VIFA 4J3WA 1GVYA 1R8LA 3B9DA 4WSKA 4X0NA 1QBAA 1D3CA 2VI0A 3SCUA 1LWJA 2EQDA 3DYMA 2OSWA 1E3XA 3M07A 1E4LA 2VJXA 2QMKA 3AXHA 3NIYA 2VCAA 2RGLA 3VGBA 3WD0A 1UKTA 2YIHA 4FLOA 1QNOA 4CU6A 2EPKX 3A4AA 2CCRA 4XV0A 4P8XA 1B30A 4PMNA 1JZ3A 4ZE4A 1J0IA 2PBOA 2PC8A 1X6NA 3RMEA 4U31A 3T2OA 3L4YA 1SR0A 1S46A 3BAKA 3ZJKA 2Y5EA 4CN6A 3SIMA 3AS1A 1E4MM 1DP0A 2NSXA 1Q4NX 1UR0A 3WNKA 5E70A 1V6VA 4NRSA 5I79A 1UR9A 3RIKA 3ZQ9A 5A8QA 4U2ZA 2QMJA 3PTMA 5BWFA 4W5UA 4Z2HA 1W1TA 4UQ9A 3VMPA 3ARVA 3BH4A 4PTVA 3WDHA 1QW8A 1ISWA 2DIJA 2J25A 3PZNA 1J0KA 3WNOA 1BSIA 1BF2A 2EPLX 2ZXQA 1V03A 4GPNA 1WZAA 3N13A 4W7WA 5KZ6A 1H09A 1G0CA 4D6EA 2WMHA 2V3DA 3RM8A 2WCAA 4YHEA 2J62A 3W29A 1PEZA 2WZIA 4EK7A 3DHUA 4A3YA 1JYNA 1E4IA 2XM1A 2O9RA 2ZUVA 3TP4A 4XX6A 1QNQA 1JYWA 2VUYA 1HKJA 2VCBA 1MYRA 4GQQA 4ACZA 1PIGA 1XH1A 5JBEA 2QHAA 1O6IA 4L4OA 4ZEPA 2DT0A 1JZ2A 5A6BD 4W5ZA 2VVNA 3CUHA 1E40A 1C92A 1LL7A 3T09A 3VD3A 1D7FA 3SURA 1E15A 3OG2A 2E0PA 3MUAA 4QLJA 3EMCA 1CXIA 5CXPA 1SMAA 3WQ6A 2YDRA 4PBGA 4D72A 4XUYA 1BYBA 3BC9A 4JCLA 4B9YA 2G3IA 2JE8A 3TONA 4CCDA 1CGXA 4W88A 2BHZA 2A3EA 1GZJA 1XHGA 2WWDA 5C71A 4AD5A 3WBEA 3W37A 4GI6A 2WMFA 2J8GA 1OIMA 2DT1A 1L0PA 3ZSSA 4PSPA 4PMDA 1FH9A 1HXJA 3ARSA 1YQ2A 4CD7A 3ZSTA 1E0VA 5A6KA 1KR0A 1DWAM 1KXTA 1E6PA 4AD4A 2WXDM 3U5YA 1E6ZA 2J8FA 2PB1A 3L4WA 4AWEA 2UY2A 3AMKA 2C7FA 1KR1A 4AIOA 3ZJ8A 4JFVA 3GYCA 2YKKA 3OIHA 4OJYA 4JL1A 4Z2KA 3PZQA 4IM4A 1J01A 3AMGA 3LMYA 1UH3A 1UA7A 1KGXA 2IXUA 2XPKA 8CGTA 4CN4A 1UUQA 4AD2A 1KFWA 2QLYA 2G41A 2DT2A 3EBVA 3VGFA 2DIEA 1V6UA 2CNCA 1H4PA 3EDFA 2WSKA 1BLIA 4LYRA 1LLOA 4BCEA 1WDQA 5ABHA 3BSHA 4E4PA 1CPUA 4CGTA 2JIWA 1JF5A 4MB4A 3DHPA 3SCWA 4DWSA 3WF4A 4MB5A 4UQEA 3HN3A 4JKMA 1ISXA 1EO5A 1B1YA 2Q8XA 2D23A 1CLXA 4MDOA 1KCKA 4MNJA 3WQVA 2WAGA 1FP9A 4CVWA 3WELA 1KGUA 3WDRA 4ZXLA 1AMYA 3QOMA 4CN1A 3CLWA 3U7VA 3AIRA 3HJEA 2J7HA 1TG7A 3UG3A 4PCSA 1WNOA 4AYSA 2J7CA 3CGTA 5I23A 1CECA 3OA5A 4YN5A 1EHAA 1EDQA 3ARPA 1US2A 2WKLA 4W85A 3II1A 1EDTA 1AQ0A 3OLGA 1R86A 4P7LA 3W0KA 1EO7A 2VZVA 1DWHM 2OYLA 1KB3A 3NCOA 6A3HA 5A3HA 2XFFA 1E5JA 3WN6A 1TR1A 1J11A 2ZWZA 5JIPA 3RO8A 3TTSA 3K4DA 4X0VA 2WMIA 1CWYA 1V6YA 2WKGA 4GKLA 3PZMA 4WF7A 1VBUA 2BVTA 4M29A 3MV11 4D71A 4AZ6A 5A2BA 3WIJA 1JFXA 3WH6A 2J7DA 2W62A 5GNYA 4AD3A 2VZSA 3W82A 2PI6A 4BQ3A 5CLWA 2UWFA 1CLVA 3I3DA 1OGGA 4TXEA 1JAKA 1Y7VA 3A6OA 4FMVA 4N42A 5M03A 4W86A 1VEOA 1DWIM 3VGEA 2WVSA 1B0IA 1V02E 1EXPA 5JBFA 4B16A 4UFJA 1GJUA 3E1F1 3WH7A 3GH7A 3EDDA 4AY1A 3BGAA 4UR9A 2UY3A 2FDMA 4UFLA 3K4AA 1JZ6A 5CSYA 2IUZA 4KMQA 3GNRA 4PMXA 1TA3B 1F4AA 4LQ1A 4MAZA 1GQKA 1UR2A 2CHNA 4TX6A 4OUEA 2WLZA 1ZBCA 5IDIA 1WAWA 3L4ZA 3AZSA 2DSUA 1ZB5A 3WD3A 1VF8A 2ZUTA 4AZCB 2D3LA 3WUEA 2BNJA 5BXSA 3PTQA 5IFTA 3K8MA 1KWKA 3G6MA 1H0IA 2D3NA 2E9MA 4AXNA 3IAPA 4QLLA 3DYPA 2W5FA 1KQYA 3AIVA 1QI0A 2ESCA 5FCZA 4MJ2A 1GQLA 4KH2A 2WB5A 1GOMA 1PX3A 5E6ZA 1ISZA 3FHQA 1EH9A 1FHDA 4TUFA 4J7RA 1BAGA 4BZYA 1GOWA 1E6SM 1VB9A 2EEXA 1HJVA 2WHJA 4HZ8A 1BGGA 4S3KA 3T0DA 2XIBA 1GOKA 2OWWA 2WC3A 2XVPA 1HNYA 1MW1A 1PAMA 3A4WA 2AMGA 1ODZA 1V3KA 4HP5A 5IHSA 1MFUA 5A8OA 1XD0A 5AYIA 3LPGA 2X8RA 3D3AA 1RP8A 4AEFA 1JIBA 3GZAA 4TOQA 2DQXA 3QHOA 3EMZA 3NSNA 4W7VA 2V38A 2ZX9A 5FKYA 1KBKA 3ZJ7A 1QI4A 5DT7A 1IT0A 3AYSA 2VZTA 3SCVA 2JF6A 3MMWA 2OYMA 2Y8VA 2ZICA 4AC1X 2GVYA 2A3AA 1LG2A 1ITCA 1W1YA 1G5AA 5D9MA 1CXEA 4QAWA 1Z32X 3CH9A 4OKDA 2VCCA 4BS0A 2FHCA 5HDRA 5EB8A 3PZGA 3S6TA 4W84A 1CTNA 2XFYA 5LYRA 2W92A 2DH3A 1ZBKA 5D9NA 4ATWA 1NWRA 4K68A 2YBUA 2XGIA 3WSUA 1W9UA 3ZIZA 2VZUA 2JALA 3W25A 2XG9A 2GK1B 4UFKA 3WENA 2CBIA 1HP4A 2WVUA 5DT5A 2BVDA 4CUCA 4C7DA 1US3A 2CYGA 2BY3A 1CENA 1ISYA 2GJXB 2ZE0A 4MDPA 1LL4A 1UG6A 2WMKA 4H8UA 4AZHA 1EOKA 9CGTA 2XVKA 4JFTA 4CKQA 1TVNA 1UD4A 2DPEA 3AXIA 3VDAA 2VO5A 3GXIA 5JIWA 4C7GA 1QHPA 4UQAA 1G9HA 2BVYA 3NSXA 4V27A 5EFDA 4CVUA 1QNRA 3AHXA 1X1NA 4Y7EA 2YLAA 1C8YA 2D2OA 1B2YA 3WF3A 4C7FA 3VIMA 5AC4A 2XYLA 3QHMA 5BROA 5FD0A 1ZBWA 1G01A 1XRVA 4DWSC 5A1AA 3ZT5A 1JXJA 2ZX6A 1HIZA 1DWJM 2PWFA 1JNDA 1M03A 1W2PA 5BXTA 1U2YA 3WMSA 2EPOA 2DEPA 1NOUA 7TAAA 3GBDA 3MO4A 4J3VA 1HF6A 2NW0A 4HZ7A 4OBRA 3L4XA 3UR8A 5A8NA 4OIFA 4D6IA 3L4UA 3CUIA 3THCA 4H7VA 1RD6A 3B9EA 1D2KA 3VKKA 3TTOA 5A6BA 1E4NA 2ZUWA 1WDSA 1VEPA 5EFFA 2PWEA 2DSKA 4JL2A 3T0BA 3APGA 4FK9A 1WDPA 5DF0A 4WIWA 1CXHA 2PBGA 3VGGA 2WHMA 2GFTA 3KL3A 2J7FA 4JKKA 4MNMA 4UFMA 5GNXA 1QVBA 2W91A 3MUZ1 1M7XA 3U57A 6TAAA 1CGUA 3ZT6A 5BXPA 2B31A 3CO4A 5KEZA 4CD6A 1E72M 1R85A 4M81A 2E9LA 2YL9A 4W8LA 3PTKA 1QI5A 1G94A 1LJYA 7CGTA 3CZKA 3GNOA 3BAWA 4QDMA 2WZHA 5BRPA 2WVVB 1WZMA 3AFBA 2E9BA 4PTMA 1PZ3A 1XH2A 4AZ7A 1AQHA 1NOWA 4Q7NA 3UESA 3OLDA 5M3WA 2ZX8A 1EIBA 2CIPA 1CGYA 1GHSA 3VPLA 5HNNA 5JBDA 2Z1SA 1VJSA 4ZENA 4HMCA 4PMOA 3W6LA 2W63A 4QFUA 1WB0A 3PZUA 4CCEA 1FP8A 1CGWA 2BY2A 2CXGA 4QCFA 1EQCA 8A3HA 1M04A 4IUGA 1MQPA 3VO0A 3CZJA 3ARWA 1W9PA 2WK2A 1IV8A 3G6LA 3U7BA 3O9NA 4LX4A 1XD1A 3AI0A 4FLQA 3EMQA 2A3HA 3AISA 1GCYA 3NDYA 3VD4A 3K8KA 3PZIA 2XVLA 4CD8A 2W4XA 3GNPA 4M82A 4B15A 1XV8A 2TAAA 3F5JA 3AIBA 5E09A 2FGZA 1Q6CA 4M80A 2FGLA 1B3ZA 2Y4SA 4DM1A 3OLEA 1PBGA 2EBNA 3FHAA 2YL6A 3BAIA 1VRXA 3HU7A 1PIFA 1PPIA 3ZMRA 3AS2A 4X9YA 2JEQA 2BS9A 4ZXOA 1GW1A 2XGBA 1BG4A 3BMWA 3VD9A 2D22A 4W87A 2WHLA 1Q6GA 3N11A 4D1JA 1GHRA 4R27A 3MV01 3CMJA 3WH5A 3WD4A 2ZUUA 4HMDA 4WKAA 4J3SA 1U33A 1E1FA 1H3GA 4JFWA 2W67A 1KXVA 4UTFA 4LXFA 4AZ5A 1JD7A 3CHCA 5IXEA 3IJ8A 4PCTA 3CZEA 1TFVA 1ZL1A 4HPGA 2X05A 4AZIA 1UWSA 4UQBA 2J7EA 3BAYA 2F2HA 1RP9A 3BXWA 2GSJA 1OIFA 4W8BA 4H41A 4PSRA 1E6XM 2QPUA 1F4HA 3AOFA 1JXKA 2XHYA 2ZIDA 1B3VA 3ARZA 4H8HA 4Z2GA 2X0YA 3RILA 1GQIA 4KGJA 1FFQA 2OWCA 4IPLA 4P7RA 2UY5A 3KWXA 3ZJ6A 1PX4A 2WW5A 3K8LA 1CGVA 1UD8A 3GBEA 3T08A 3GXFA 3ALFA 1A3HA 4D1IA 1XSIA 3ZM8A 1EHNA 2J74A 4NRRA 3T2PA 1V0NA 1J12A 3W6MA 3KZSA 1H2JA 1HX0A 4RE3A 5E6YA 1SMDA 4AMCA 1JDAA 1MQQA 4PMVA 4JCMA 3NSMA 3VMNA 3DECA 1BVNP 5HBFA 1OM0A 1VENA 1GORA 1NQ6A 1V3LA 5F7UA 4MJ4A 1JF6A 4GO8A 4F66A 1KXHA 1OGSA 3VDHA 3WQ8A 3UCQA 4UZSA 3WY1A 4F9JA 4OOZA 1UWRA 2V3FA 3N18A 3WFZA 3HMCA 2F8QA 2XWEA 3RPMA 1SYTA 4MB1A 3F5LA 2UY4A 1V3IA 3SUSA 1HKMA 1UR1A 1WO2A 2PWDA 2X2YA 4Q22A 1JI2A 1GPFA 1E1EA 2WC4A 1J18A 1BFNA 4CCCA 5M5DA 2J79A 2OWXA 2VMFA 5CPQA 1B9ZA 2XUCA 1W1PA 2D24A 4GZJA 1EA9C 3WF2A 5A94A 1CZ1A 4GO9A 5AC5A 4RE4A 3BLPX 3W81A 1E0XA 1DWGM 4JHZA 5A8PA 1DHKA 1R7OA 4CU7A 4AD1A 5A6MA 3F5KA 4Z2IA 3WD2A 3WEZA 1UOKA 3D5HA 3BCFA 4P8WA 4MNKA 4ML4A 2O9OA 3SUWA 1FH8A 2YOCA 5A6AA 2ZUSA 5E0FA 1UZ1A 1WDRA 3WEMA 3GTNA 4TTGA 3AHZA 4BQ2A 3I3BA 3EDJA 1KWGA 1R7AA 3S2CA 1NP2A 3VDBA 4PTWA 1XSJA 1PX8A 1N82A 2WMGA 4P7QA 4W89A 3WF1A 2CERA 3AHTA 2WBKA 1C93A 3VUPA 3VOCA 2ZUNA 1RPKA 4XZBA 3SEPA 1UH2A 1B31A 1PZ2A
chains in the Genus database with same CATH superfamily
3ZLHA 1PL9A 1LG1A 1GYNA 1V0KA 3I7RA 1BKFA 3E0IA 3H26A 3O06A 1D7JA 2OQLA 1HVXA 1XBVA 4Q32A 3PULA 4MKNA 5AYBA 2EXOA 3STCA 1LZOA 5ABGA 1J9YA 1XP3A 1UD5A 2XJ7A 3L66A 3RO6A 4F3HA 4JBRA 1ZHAA 1Q7QA 2G97A 2HPMA 3OVQA 5GPGA 1DE5A 2RUSA 2VN1A 2CZ5A 3L4TA 4QG9A 1IZJA 1YDYA 4GUJA 1JPKA 5DMMA 3ZVHA 4UR7A 3VKJA 2HISA 2J88A 4UTHA 2DDXA 4UFHA 7A3HA 3VA8A 5JH1A 2FZDA 5LA0A 4GCXA 3DHDA 2OB3A 1TZ7A 1VBJA 4TV5A 4KPLA 5LKYA 4DRMA 4H19A 4LF2A 5BYWA 4OZOA 3BLKA 4G1KA 1V02A 4J3TA 3QZAA 4O1FA 2ACRA 4DO7A 3OEXA 2BFGA 1OB0A 3A23A 1I1WA 3TQ0A 5DITA 2G5WA 2QCNA 5EMMA 4F9DA 3UZYA 4WK9A 3WL1A 1FA2A 4IIGA 4QSHA 1EJXC 4DUVA 3SECA 5ABFA 3OBAA 3UJSA 1R87A 2PDPA 2F61A 4GQRA 1BPLB 3GIYA 3GG1A 1FKLA 3QFWA 1X8CA 3WNPA 3O5JA 5A2AA 4PFHA 2AAAA 5I3HA 4A05A 2CLHA 2J9XA 1C90A 2OG9A 3SUTA 3W7IA 4E4FA 5FI8A 4FLSA 4DO4A 4KFOA 5J8LA 5HWMA 3SN0A 2CZEA 3RU6A 3WKZA 2X09A 1AVAA 2BHYA 2W61A 1O5RA 4UFIA 5IM51 4UTJA 1B6CA 3MC5A 1KTBA 4HNVA 2E1WA 4HVXA 1NFGA 4F2TA 2XM2A 1AUSL 3UR5A 2W6RA 1FKWA 3NUKA 3FAXA 3NPXA 2PN0A 3QY8A 4GWEA 3PHAA 1P6WA 3LHTA 3UERA 3QVQA 1Q6EA 2YA1A 1JYXA 1B3OA 4LBSA 4YWSA 4TMCA 1V0LA 1XIEA 2CLIA 3QQ0A 1VEMA 4G2PA 2H8ZA 4TU1A 1LLZA 8TIMA 2DVXA 3GXTA 3P14A 2DZXA 3GXDA 4DNMA 1P0EA 2P3ZA 4FIRA 1NWSA 1IGWA 1K03A 1WPCA 4TVCA 3HGRA 1OCQA 3NTPA 4CD5A 1W3TA 4BKNA 5C9ZA 2VVSA 1L6WA 2G3MA 3H55A 3LHUA 3SADA 3TZNA 4AUBA 3PBWA 1FKFA 3O5LA 1TPVA 2CKRA 3UI5A 4ZOBA 4ES4A 5I78A 3TC6A 2BY1A 4FEZA 4S1FA 2M08A 5CZSA 3VGDA 1FWIC 4PCPA 4IPNB 2PSNA 2WMJA 3H6OA 4PTXA 4RDVA 2FAPA 1W3JA 1THFD 5A95A 4YVVA 1EQ3A 1K1DA 3RXZA 1UWUA 4KBXA 2O4MA 2FPYA 2OYKA 4XSMA 3ES8A 3QHNA 4TVDA 3W38A 2RUQA 4JAWA 1BWVA 1B3YA 2YA2A 3LV6A 1ZS2A 3LGGA 4WDXA 4EE9A 3WL0A 1EGVA 2IW0A 2DSVA 4JXCA 3TOPA 1UA3A 2VEPA 1HKIA 2OR2A 3IEBA 4MJMA 1QAPA 1H7NA 1AH4A 4EANA 1OD8A 2OPJA 2HBXA 2WQDA 4O10A 4KRTA 3A3XA 4LY8A 2KAUC 3DFPA 1DJXA 1D3HA 1NOFA 3UF9A 3DFHA 4PN2A 1ZJAA 3ATZA 4ML9A 3SCPA 5DBTA 1VCVA 1KW1A 3GUWA 4K6AA 1DTUA 3RDKA 2PDYA 3EPNA 4BK9A 2YDAA 4DJDA 1I4NA 2CLLA 1HKWA 4BF7A 4HN4A 3M41A 2IMRA 4JIQA 5A6LA 2WPGA 1KNWA 1W54A 3IUDA 1E0WA 5IHRA 5AFDA 3Q65A 1OSEA 1W3IA 1Z48A 5J6EA 1GKQA 4OVXA 3VDGA 4LRTA 4S38A 2NVDA 2Z1BA 3ARRA 4K1WA 3UR2A 3CB3A 3CAKA 2VZOA 4KETA 1P7TB 4JTTA 5HJYA 3CNYA 5FJTA 4DRPA 3BMVA 4KR0B 3JZEA 4H83A 1TCMA 2G96A 2XVNA 2WANA 4ENLA 5M17A 5MKGB 1WXZA 3KL0A 2VL4A 1NF0A 1WE5A 4IWWA 3HG5A 3TQPA 1MW0A 2ODOA 4N19A 3CV2A 4H9YA 4H9XA 4B9ZA 2C14A 3F4VA 4HOWA 3AIUA 1E6RA 3B8TA 2QT3A 1XFCA 1BYCA 3RGTA 1XLBA 1UQZA 1VFOA 1VFMA 2YBTA 1E1CA 1CNVA 3CAQA 2A4AA 3QPZA 1Q6FA 1C8VA 2QUMA 3V18A 3BLIA 3W7PA 1YE4A 3IK2A 1OD0A 3WJZA 4C6QA 5FJIA 4V2XA 1Y8BA 5FIPA 1MXGA 1UQYA 3NQEA 2F2DA 1LP6A 3EX6A 3C6CA 4RCXA 2KI3A 2XFRA 5FF0A 3L7RA 5E0CA 3H4XA 5K7JA 3WQDA 1MXSA 1A5UA 1C8QA 2YYTA 2ZWYA 2E6AA 4GY0A 3UYCA 4FF5A 2ZXDA 3C3NA 1NY1A 1YIXA 2P53A 3FA5A 3IRDA 1L6FA 3TXVA 4LNYA 1PUDA 5G2IA 1K02A 5LHEA 1KKRA 2DGAA 1WUFA 3FW6A 3CHEA 2XSAA 3ZXWA 3OGVA 4HT3A 3VIIA 4IP4A 3UBPC 3R79A 1RBLA 1KA9F 2QCCA 2DVTA 1FKTA 3KBNA 3S0CA 1GG0A 4XUGA 3IJ7A 5J5DA 2XH7A 4IX2A 3LBMA 1KLZA 4YIWA 2VEMA 4DX3A 4GNVA 4IXXA 3I4EA 1TSIA 2QDGA 1JVNA 1DYSA 1XCWA 2F21A 4JFUA 4I90A 2CITA 2VFFA 3MUY1 3PBUA 4GIRA 2ISSA 4IL0A 2X0SA 4AD0A 4IISA 2FZMA 4NF7A 1SW3A 1ITUA 5BOEA 4FP1A 4UTUA 1MW3A 1EGZA 1MZHA 1U1HA 2Q3OA 2BHUA 3CUJA 3OQ8A 3BGGA 2BXVA 4CD4A 4QCEA 4KWUA 1HFBA 1OT2A 2QYGA 2IPWA 1BQGA 5CSRA 5CPOA 4IPIA 3QOKA 2R6OA 3AALA 3B8DA 4IT1A 2G4JA 5CSUA 2O92A 2J78A 1EZ2A 3TN4A 3O1NA 5DELA 1QHOA 3EWYA 4S39A 2A0NA 2NWRA 3KL5A 4MTVA 1FDZA 1W9DM 5D33A 1JGIA 1LLWA 2X2GA 1M7OA 1W32A 4YPJA 1MUCA 2ZRWA 4IMGA 3E5PA 3KVMA 3DYOA 2FZ9A 3EYPA 1Q6UA 4LPCA 4LYQA 4YNGA 3L4VA 4GLEA 4Y9MA 4IIEA 5HPCA 5ABTA 1TV3A 2DUZA 3G3DA 4K1GA 3E74A 5DFAA 2JEPA 4IFKB 5FL1A 3DGRA 1WKYA 1B57A 2Z2UA 4IIFA 1NEYA 1O66A 2BODX 3I6CA 5CZKA 4WEVX 3R13A 1C91A 1XGZA 3OGRA 3M46A 5DIUA 4UOJA 4GY7A 5HT1A 3KCOA 4OBTA 3CBWA 4PMYA 2PWHA 4JFSA 4WRHA 1GWJA 2YBVA 1LUCB 5DQPA 4L4MA 3N2BA 3KE0A 1SJDA 2ISDA 3VC6A 1XSKA 2NX1A 1KM0A 1KCXA 1YNPA 3KAIA 4UOZA 1PVNA 2WNNA 2YW4A 1UD6A 3O5IA 1T99A 1FVPA 4YVXA 3WK0A 3VIGA 1OT1A 3AHVA 2WSRA 3QJAA 4KEZA 2AQVA 1IZKA 4DNHA 3PR9A 3FKRA 1S1RA 2XP8A 4J3XA 5BNKA 4JYFA 3SUUA 1XJBA 3T81A 1ZJHA 2Y7DA 1SW0A 4ZGYA 1VBGA 3PBVA 4I6KA 5HMSA 4A4AA 3O6YX 2NQ9A 1BF6A 1TJ0A 3GXPA 1ESWA 4ZVJA 1V3MA 3W1PA 1PWMA 4IFOA 1MXDA 1YW1A 3EX4A 1U1JA 5LIYX 2V5CA 3R0KA 1NM9A 3TFXA 4S3JA 1Q8JA 3MP4A 1RXOB 1LDCA 1UYQA 4DJFA 2VFHA 4I5XA 1J2BA 1XC4A 1YNYA 1X38A 4ODKA 1TPWA 4U2YA 5HPOA 4AZCA 1JI1A 1UD3A 4ZA0A 1RK5A 3NGJA 2FTPA 3VTRA 3MMTA 3MKKA 4AB4A 3QY6A 4RE2A 3UPMA 5I3GA 5CPTA 4DBSA 1JNEA 2YX0A 4GYPA 5D75A 2QIWA 3LNMA 1A47A 1CCWB 1RVKA 2E67A 3QFEA 2BB0A 2B7OA 2ZXAA 4CCZA 2JF7A 1JR1A 1W3HA 5BOOA 4HPJA 3GDBA 3A4XA 3IAQA 3WLMA 4HCDA 1ML1A 2E4TA 3EA3A 2WWCA 3C8NA 2E8ZA 3RHGA 4YTUA 4Z1CA 3KCEA 2IPFA 1W8SA 3NQGA 1FKXA 4JTHA 4B5TA 4EACA 3ARQA 1AQMA 2HEJA 3GKFA 3LI1A 1A4LA 2NVAA 2WBGA 3QKEA 3WNNA 1JZ7A 1A5MC 3VIFA 4H9UA 1R8LA 3MYOA 4WSKA 1M6JA 3EZ4A 2R14A 4G2DA 4MZ1A 3M7WA 2XN2A 1TKKA 1D3CA 3N3MA 5FEWA 3DI0A 2VI0A 4LB3A 5A5WA 1LRTA 3PSVA 5K9XA 4GFIA 4RX0A 2EQDA 1IT8A 1XIBA 2VC7A 2VJXA 3TN6A 1EP1A 1PV8A 1TZ9A 2Q3RA 2NUWA 1KFEA 2FFIA 3P74A 4CU6A 1T6MA 1TJRA 2EPKX 1RY8A 3KZPA 1VJIA 4WY0F 4B5UA 2PBOA 3RU8X 4IHCA 3ABOA 3IJLA 3T0CA 4MKSA 3ZJKA 3AYTA 3R1ZA 2RDWA 5DCEA 3L5LA 4IGSA 5B80A 2NSXA 3E2QA 5F2GA 4ZTXA 5E70A 5KITA 3ZQ9A 5A8QA 4U2ZA 3CQHA 4MLRA 3PTMA 4Z1YA 3NA8A 3TSBA 1F76A 3APYA 3VMPA 4F4RA 3G1FA 2DIJA 4PUUA 2KX9A 3CQIA 1BSIA 3HG3A 1R2TA 1V03A 1WOAA 4GRSA 2TYSA 3LA4A 3N13A 1W26A 4K8EA 1G0CA 2WMHA 3H2NA 3UXKA 3RM8A 2WCAA 4YHEA 1XIIA 3A3WA 4MY1A 4O15A 5HQLA 2WZIA 1N55A 4GIYA 3P2VA 1E4IA 1H62A 4MSPA 2ZUVA 3T9PA 4XX6A 3VAVA 2R1LA 4XKYB 4JR5A 1HKJA 2VCBA 3RGCA 3F03K 2BGSA 1XH1A 3VKAA 1W1A1 2QHAA 3JU2A 4J3ZA 5HW7A 2X42A 2Y1HA 4FALA 1XX1A 4KERA 3M43A 5A6BD 4W5ZA 2VVNA 3CUHA 2ZVRA 4LY4A 1LL7A 4CNOA 1TPEA 4CQ9A 4E5TA 1D7FA 3SURA 3GR8A 3ITTA 1E15A 3SR7A 3C2VA 2C6QA 2PDBA 4QLJA 3EMCA 3WMLA 1CXIA 1SMAA 3WQ6A 2P4VA 2GZXA 3MI3A 3WBWA 4B9YA 1WUEA 2G3IA 4KEVA 3DKLA 2JZVA 1OC5A 3TONA 4CCDA 3QMSA 3PRBA 4L6DA 1VFTA 4HCHA 4L6HA 2L2SA 3VZZA 3WBEA 4QJ4B 4G7EB 2HXTA 1OIMA 4M51A 1JCLA 1UOZA 3O5RA 4PSPA 3ZSSA 4EWJA 2WNQA 1GZGA 3MW7A 3LDVA 1H63A 3KBSA 1FH9A 4GYKA 1YQ2A 4NY2A 1A5BA 3VOJA 4QDPA 1JNTA 2CLMA 1PYMA 5A6KA 1KR0A 3MWAA 1BRLB 1UPPA 3KBVA 1KXTA 4AD4A 4J1OA 2D73A 2NXIA 1I2OA 4KKXA 3AMKA 1XL9A 1KR1A 2AGTA 3ZJ8A 2PMQA 2RHGA 5G1MA 3BPWA 4Q4PA 4CLMA 2F84A 2G0WA 4HGXA 4OJYA 3PAOA 5C2XA 2CHRA 2TMDA 3PZQA 3GKAA 1UH3A 3GTXA 3WJWA 5F2MA 1KGXA 2LGOA 2IXUA 2QDEA 1QR7A 4CN4A 4LV9A 2ZBTA 3TYDA 2GQ3A 4YU1A 4DXKA 1VFLA 2CNCA 3EDFA 4F0SA 3IIZA 4LYRA 4UDMA 1WDQA 4H6EA 3E0LA 3QH2A 4I5UA 4CGTA 4DPQA 2EULA 2FDSA 4QT2A 4D8LA 3DHPA 4DWSA 2Z1XA 3WF4A 3FVDA 4JKMA 3L0NA 3HQPA 3OPSA 1EO5A 1Z41A 3CHVA 2D23A 3I6TA 3TROA 4ZPTR 2WAGA 4NQ1A 5CH9A 1DJYA 1DJWA 4L3NA 3ANVA 1KGUA 4O54A 1XIMA 3LBCA 4C1NB 2AQOA 3PUGA 3CLWA 4QE1A 3HJEA 3FSUA 1J6YA 1A5SA 1IEIA 2FB3A 1ONRA 1Y5VA 3T05A 1HZYA 3S42A 2C15A 2J6VA 3CGTA 5I23A 4BF8A 4YN5A 3IJDA 4MWAA 1EDQA 4DWDA 5LNSA 4EWND 2WKLA 4XIMA 3N4FA 4QBXA 3D47A 2EF9A 4P7LA 3VOHA 3W0KA 1EO7A 1DWHM 4XD4A 5A3HA 1RVGA 1TR1A 2ZWZA 4W4QA 4X0VA 1V6YA 4GKLA 4KT2A 3ODKA 3MV11 3CT7A 3WIJA 1JFXA 2W62A 5GNYA 3UCCA 2I5GA 4HB7A 5CLWA 2UWFA 2ADAA 3I3DA 4LAYA 1XFBA 5M03A 4W86A 2VGBA 2XP5A 1B0IA 1H5YA 2OT0A 3LYEA 3TWAA 4JTRA 4UFJA 4B16A 1GJUA 4NU7A 4O18A 2PDXA 1DTNA 4UR9A 2YXOA 3G1DA 3K4AA 2EG8A 4Q8VA 4KMQA 1F4AA 4ASTA 1V51A 4DF2A 5BU6A 1IEXA 1ZBCA 3LENA 2QCDA 5I06A 4TYOA 1L2QA 1VF8A 5C7VA 1KM1A 4KCWA 3LSCA 1S5WA 3BG9A 2SFPA 3MPGA 3WUEA 3LV5A 1SU5A 3HA1A 1PWLA 3PTQA 3STEA 3T6CA 3K8MA 5HMEA 1H0IA 5I3JA 2D69A 4JTUA 1KQYA 3AIVA 2ESCA 4MJ2A 4XAFA 3UQIA 4QGCA 5CAHA 2WB5A 4XIAA 1PX3A 3QSTA 3G0SA 1EH9A 4TUFA 3VFLA 3SJ3A 3M9YA 4IUOA 1BAGA 2ZQUA 1VB9A 2EEXA 1WAUA 2PDMA 4PUKA 3OG3A 1EJWC 1BGGA 4S3KA 1LRNA 1QATA 1KTCA 5LIWX 2XIBA 4IZGA 2WC3A 2XVPA 1HNYA 4LS1A 2QGYA 3LTYA 3NL5A 5IHSA 2NWSA 1MFUA 2IKGA 4AIBA 3UZJA 3D3AA 3T8LA 4HHHA 2F6XA 1VYSX 1JIBA 2HDJA 3FEQA 2YW3A 2DQXA 4Q8PA 4ZMGA 3NSNA 4RW3A 1ONWA 2ZX9A 1O68A 5FKYA 1XIDA 3FA3A 1KBKA 1QI4A 5DT7A 1RAKA 1V5XA 3MMWA 1OCJA 2OYMA 4BY3A 1ELSA 2ZZ4A 3KRBA 3EX2A 1TWIA 3CC1A 4HSOA 1DL3A 1G5AA 1EBHA 3GQYA 1CXEA 4NYUA 5IBXA 3MJMA 1Z32X 3CH9A 4BS0A 2FHCA 3PZGA 1MRQA 3S6TA 4YVPA 4NAEB 2W92A 2DH3A 2DW6A 1EUNA 5KZMA 3TAOA 1NWRA 2YBUA 1N8WA 1VHCA 2VZUA 1VYRA 4LUJA 1EC7A 1LQAA 3G0UA 1HP4A 3EOSA 1KLYA 4PGLA 2BVDA 3NNTA 1DJQA 2BY3A 1CENA 4UB9A 2GJXB 2ZE0A 4GXWA 3N25A 1LL4A 2OU4A 2WMKA 1EOKA 9CGTA 3WK2A 3B8UA 4WY0B 2VO5A 3GXIA 4UQAA 1AMKA 1QNRA 4Q6JA 3O3RA 4CEXC 1C8YA 3MHUA 3ENLA 3ZYZA 5FD0A 1Q6IA 2V5JA 1ZBWA 1J4RA 1T5AA 3UVIA 1R9HA 3ZT5A 4JIHA 3LXAA 1HIZA 2VENA 2PWFA 1JNDA 2PLKA 1M03A 5BXTA 1U2YA 3WMSA 2RSEA 1OX5A 3PPCA 1YPXA 3C52A 3GBDA 3QQ1A 3L0GA 1QWKA 2CZFA 2PTYA 3O07A 3CUIA 4H7VA 4ZB2A 3ONCA 1WDSA 1ZP3A 2AKMA 1GEQA 3LCWA 1SPQA 2POTA 4JL2A 3PWIA 3OU8A 2Z0IA 5AZ0A 5D2WA 2PBGA 1Y65A 3VGGA 1E9IA 4DLMA 1TVLA 3H24A 3LU2A 1S2VA 4UFMA 5GNXA 3WYZA 3MUZ1 2W91A 2PRMA 3NVTA 3M0JA 1M7XA 1CGUA 3R0UA 5BXPA 4JDYA 2B31A 3CO4A 2E5CA 5BZAA 2JGYA 4CD6A 2NV1A 5AHFA 1RA0A 1Z9AA 5EMJA 1CI1A 4LRSA 4W8LA 4ADTA 1G94A 4GH1A 4B5VA 3BAWA 1F61A 1P5QA 2E9BA 2PBCA 4AZ7A 3PUEA 1AQHA 1NOWA 2B7NA 4U10A 3TW9A 3MB9A 4Q3MA 4V1XA 3MDYB 2QDDA 2CIPA 4MF4A 1TPC1 3OVRA 1XGDA 2O55A 1XISA 3S9IA 2AMXA 2Z1SA 1UUMA 1VJSA 4PMOA 2PWUA 1WB0A 1FP8A 4R7WA 3NZPA 4I9MA 1AZ2A 4E2VA 1G4EA 5DCDA 3CZJA 4ZQPA 3CT2A 3KTXA 1OJXA 2F6UA 2INEA 3GVRA 3P5YA 3DFQA 3TA6A 1QU4A 4AEOA 5CBBA 2E6DA 1JGMA 2W9MA 1XD1A 3AI0A 3BG3A 3EMQA 2A3HA 1GCYA 1TV2A 4OFCA 3K8KA 3Q58A 2XVLA 4CD8A 2Y78A 1EPXA 4LC6A 4FAMA 2G95A 4BEUA 3AIBA 5E09A 5HWJA 3H22A 3GO2A 1GW9A 4ERIA 2PDNA 2YL6A 4DZ5A 3G8RA 1KC7A 2BS9A 3BMBA 1O94A 3LUTA 3QMRA 1GW1A 2C79A 5HK4A 1D9EA 2XGBA 3NRKA 4KS0A 4W87A 1Q6GA 4MYXA 5HUOA 1XRFA 4UMBA 5DN1A 2ZUUA 4WKAA 3U4AA 3GZ3A 2BBFA 1E1FA 1H3GA 2TSYA 5H8UA 2XN1A 3CAWA 4DRSA 1ZJIA 3IVTA 4PCTA 4IIBA 1X1ZA 4JTQA 4XSLA 3RNDA 4HPGA 3UGVA 1UWSA 1RP9A 4J2PA 1OF8A 2DW7A 2GSJA 2QQ6A 4YTRA 3IK4A 3AOFA 2ZIDA 2YB1A 3GVQA 4H8HA 3SZ8A 4Z2GA 1ZALA 3GNNA 4A2SA 1GQIA 4KGJA 1FFQA 4QS5A 4C6PA 3KWXA 2VGIA 4U86A 3GBEA 1UD8A 2PDHA 3T08A 2DZAA 4K3ZA 1XIFA 3TDFA 3C2FA 4ODLA 4DJDD 1TIWA 1TCDA 4ZODA 4H01A 1BEUA 3LS9A 1A3HA 3KOYA 2J74A 4NNCA 5EMKA 2KZHA 2E09A 3MTWA 4PZVA 3SFKA 1OCBA 2E5BA 1AL8A 1J12A 3W6MA 4O57A 4HA0A 1YATA 3NL2A 1H2JA 1HX0A 5E6YA 1GQNA 4L1WA 1MQQA 5CG7A 4NZ3A 4BEQA 3VMNA 4AQLA 2WSQA 1CB7B 4GGBA 1MDRA 5HBFA 3LN3A 1V3LA 1IYXA 1P7TA 5F7UA 1JF6A 4F66A 1DIOA 5H91A 2PFHA 1ZRQA 2GVLA 1POJA 4R9XA 3UCQA 3CPRA 4EPEC 3IIPA 1QWGA 4F9JA 5MKGA 3GB6A 1UWRA 3N18A 4JIIX 4RDWA 2XWEA 1ZCOA 1QXLA 5DIVA 3GK0A 3U2EA 4JTEA 1I2RA 1VKFA 1V3IA 3SUSA 3FJNA 3W1QA 3FFSA 1JEZA 2QZRA 3UNDA 2YR1A 3S2JA 1PS9A 2X2YA 4Q22A 1A0CA 1A3WA 3SM0A 2PGWA 4C6JA 5M5DA 2J79A 2OOFA 1ONXA 3QC3A 1B9ZA 1DV7A 3WF2A 3GIPA 4GO9A 2ZRVA 3QZ6A 4LCRA 3HPSA 3W81A 4H1ZA 4FXJA 3H53A 4JHZA 3C2YA 5EPDA 4K36A 4AD1A 1EP2A 1L2UA 5A6MA 4I8DA 4TV6A 7ENLA 2BGNE 3GTHA 3BSMA 3HOJA 3KAFA 1H7RA 1QPRA 2O0TA 4MNKA 2O9OA 2YOCA 4XZIA 4FHAA 5A6AA 1UZ1A 1SFLA 2ZA1A 2R1PA 3IJ6A 4OECA 2BASA 4BQ2A 4BJHA 1R7AA 4QJ1A 3S2CA 1BVWA 5B7YA 4PTWA 3GR7A 3TYEA 1EL3A 1N82A 3S6OA 3PFMA 2HE8A 4IQLA 4W89A 7REQA 1PB0A 2CERA 4XD5A 1S2CA 1XLHA 4HJWA 4WD0A 5D32A 2WBKA 2CFFA 4H6QA 1D7IA 3VOCA 1DQXA 3IIOA 3IK8A 1UBSA 4PMUA 3WFAA 1UR8A 2YYUA 3WUBA 1YLVA 4DRQA 2QULA 1AODA 4X22A 2PV3A 4JQAA 4JX6A 4ORIA 3UU0A 5GQBA 4GCAA 4F40A 2PDUA 4HA1A 4J40A 3UR7A 3QR3A 3A9IA 5XINA 4P8UA 3N2XA 2NLIA 2CKSA 4ECLA 2V81A 1R3VA 1WOBA 2PWVA 2ZX5A 3IIXA 2FH6A 4LAMA 2OXNA 5EKYA 3MCMA 3VINA 1UCWA 3V0SA 2J7BA 1DJZA 1VBRA 3WMCA 1PJ9A 3TYAA 4E3VA 2QAFA 4P7OA 1LT8A 3RUBL 1XLIA 3N17A 4Z1AA 1RV8A 3G1VA 4H2HA 3CH0A 1MI3A 1E56A 1G7VA 2C8NA 4GZEA 2R1NA 2XIIA 3C0SA 4DT4A 4Q4KA 2ZZ1A 3CWHA 3VD5A 4NVTA 5LNRA 5CJNA 3ZR4A 2V2DA 1R3RA 3L9CA 1W3NA 3G22A 3K4WA 4QE5A 5A2CA 2ANUA 4PODA 3GTYX 4L4LA 3T78A 4GX9A 2DT3A 4R5EA 1RD5A 1JQVA 3ELFA 1QPNA 4Q8OA 3S1GA 1SR9A 1WBJA 4A3UA 3UETA 1W2VA 3OTRA 3VE7A 5CSSA 1KV5A 1XG3A 3N19B 1BGAA 1CEOA 1JPDX 1UZ4A 4YHGA 4PYSA 3ZOAA 1M5YA 3UPBA 2PDQA 2C18A 1JDDA 4QEHA 3TFCA 1DQWA 4WSHA 2D0HA 1Q6HA 1J79A 3EOUA 3SI9A 4PMZA 4DXVA 3OA3A 2QAPA 5D8ZA 3NPWA 4IFKA 4KF1A 3SCTA 2CESA 4U85A 1GVFA 3T8QA 2R91A 5T9CE 3EX1A 3RPTA 4ADSA 2CWXA 1JPIA 3I3EA 1QOXA 4AAJA 4O13A 3VUSA 4UQDA 3RJYA 4HSHA 1EQPA 1Z44A 3DESA 1W5NA 2BOGX 1LUCA 1WKDA 2ZQSA 3MHGA 1F6KA 1VJZA 1E9LA 3MHFA 2CHOA 2MNTA 4XZMX 3N6HA 2ALRA 3AO0A 2VX5A 4JFIA 3TJXA 4QE4A 3M6DA 3W00A 5FACA 3WQWA 1EC8A 1GPWA 1VAHA 3NGFA 5EMYA 4P5UA 1E5NA 3PAJA 3VM5A 3UZXA 3G1YA 3W6YA 1XLKA 2AAMA 4E4UA 3WLSA 3N2OA 2Z6JA 3ZWSA 2ZQTA 1FWWA 4C02B 2O9TA 2MANA 4GQBA 3GDMA 3C5QA 4ITZA 3VILA 3FEMA 1J0HA 5D8WA 4WSJA 5CAKA 3EGJA 4S3EA 4JZ5A 5A6TC 1MFVA 3AZRA 1QT1A 4M8UA 4PMQA 1K4GA 3FK4A 1GYLA 4UC5A 4REQA 1PKYA 1O5QA 5AHLA 4GMEA 4K37A 3UZWA 2VWTA 4PTNA 5FOOA 1K7XA 4D6FA 2ZUMA 4KQZA 2XZ9A 2IQDA 1X8FA 4D2JA 2IKHA 4B3KA 2WJFA 4FR6A 3UG4A 2ZA3A 5C9WA 3CHFA 1XLCA 1VIZA 3PY2A 4GFSA 2V68A 1XYFA 2ZOXA 4TTUA 3QXBA 1EOMA 2CBVA 3AQUA 2FKEA 2WCGA 3W7DA 3AYRA 2VWSA 2KR7A 3TE9A 1HGWA 1FWCC 3C2RA 4FLRA 2Z27A 3PZVA 2EGZA 3GC4A 2WO5A 1EF3A 1K6WA 1OABA 3AICA 5I2UA 1QRQA 4WDTA 1TQXA 3R8RA 3KCJA 3UZZA 4O12A 1KQZA 3AMCA 1XLFA 5D4YA 1LRQA 5CEWA 2BSLA 2OQHA 4DROA 4PEEA 4MSSA 3HPXA 4HNCA 2VD9A 2WZEA 4U33A 5DRCA 1QCWA 1QW9A 1VFHA 1SZNA 4WKHA 1TJ1A 2EG6A 3M1ZA 1ZGDA 1JG9A 2NQJA 1VPQA 4N9BA 3Q45A 1BTCA 1QFEA 7PTDA 3TWBA 3SCSA 3L2MA 4MPKA 4QROA 1UPMB 2NLYA 1S5TA 9XIAA 1I9CB 1Q6DA 4EOUA 4PUDA 4HA4A 3B9AA 2V3GA 1E55A 4UQCA 2B81A 2RUDA 1GYMA 1MUMA 1DWFM 4GOAA 3VNKA 3TTYA 1UR4A 1CIUA 4H9TA 3V5CA 1R30A 3AIWA 3PM6A 3H2CA 4RXGA 1ZBVA 5GPRA 2XDFA 1PTAA 1GONA 2OCZA 3BV4A 2FPTA 3JZUA 3HQOA 5G2HA 1N1AA 4FO4A 4S3CA 1GG1A 3UZ5A 3DKJA 4GUHA 1MEWA 2FHBA 4MOZA 4WHBA 3RN6A 3WUFA 3FLUA 5C55A 4MY9A 2GWNA 1QOQA 1SO4A 4PRRA 1XINA 1QDSA 1O1ZA 2JK2A 3T2QA 5I07A 2WLYA 4GYJA 4HPNA 2WVVA 3NOYA 3PF3A 4BA0A 5I24A 3F4CA 2QV5A 2WMIB 5G4WA 2Y8KA 1EFZA 1RQEA 3A9BA 2OOGA 3BCJA 3AROA 3H8AA 3WNLA 3I7QA 3FVMA 2PDIA 3DENA 4JN7A 2VDHA 3MA8A 5JUVA 5PTDA 3L0KA 4EAMA 1WKFA 3NZ1A 2ZDRA 4KWVA 1IXQA 3GM8A 4LCQA 5LZLA 1VCGA 3G0XA 3ARTA 3BZGA 3BLEA 1R3SA 3L67A 1JCHB 4IJBA 4ZQCA 2QCMA 3WX7A 1SZRA 5CKSA 1JCXA 1FWNA 2ZXBA 2ALDA 2VEFA 2ZYFA 5FF7A 1J0ZA 3WLOA 3FJ4A 3A21A 4P61A 1Q66A 5GJMA 3THDA 2FTYA 4WJ8A 3GFYA 1JPMA 1FDYA 5DO2A 3OLIA 1D7HA 1S2WA 4KCVA 2GDUA 1W9XA 3ECQA 4HU8A 4O16A 3EWUA 4WLCA 1EUAA 1BSLA 4M24A 1ECQA 4RV3A 1K8XA 2BXYA 2VXNA 4QZVB 2V8ZA 2C19A 1IXPA 1LOLA 1UWIA 4GUGA 2QF8A 1ZZMA 4G7EA 4UNLA 3IHZA 4S2BA 3E6EA 5CC5A 1Q8AA 9RUBA 3ARYA 4MFDA 2ZRUA 4HMNA 3UG5A 4N2YA 3TW6A 4I5RA 5HTGA 3BLOA 4AEEA 3G1XA 1ZJBA 2D0FA 3NQ6A 1BRLA 4V28A 4B90A 1O95A 2JGQA 2GJRA 4AZBA 3NQ7A 3LHZA 3N15A 3VKCA 4Q8TA 3LY0A 4NJKA 2GL5A 3EWWA 3AJXA 3MDUA 2YLLA 4QG6A 3EWZA 2A7RA 1UH4A 4AF0B 1WZKA 1K9EA 2GDVA 5C8BB 3AC0A 4HTYA 3PP7A 4Y90A 4HMEA 3ITXA 4CQAA 4ZPWR 4C6CA 2C0HA 1ZCCA 3CIXA 2XP7A 2VDGA 2YGYA 3VZYA 1ZU8A 4URIA 2IKIA 1PDZA 3P84A 1UROA 5AZ1A 3MI6A 3N2TA 2DSZA 5BRQA 1FWSA 2Y5SA 1HVQA 4JICA 1XYLA 1NVMA 4JIEA 4DWSD 3P0WA 2VX6A 3TNOA 2OSXA 1EDGA 5D9OA 1EJSC 3PJXA 1E73M 1HT6A 2VQUA 3F4WA 1XCXA 1A7XA 3NO1A 3M6YA 5T8GA 1EPVA 1RCXB 1K9DA 2A6NA 4UWMA 1IXNA 3CIVA 4UCFA 3VYLA 5GJPA 3B0YA 2DG4A 1BTMA 2HVMA 1ENUA 3NI6A 1JCTA 1C8XA 3P81A 2CLEA 4MWAD 2Y24A 3BW4A 5SWUA 2J8TA 4DJDC 3NQVA 4JHOA 3W2LA 4NIRA 1HXVA 3VCNA 3VCCA 3CU2A 2Q6ZA 1A53A 4JQ1A 1LOQA 3CL8A 5FF2A 1WX0A 1HN1A 1XGEA 3O5EA 2C1HA 3ZT7A 1GQJA 5I3DA 3RLHA 3W22A 4U3AA 3GW0A 3WLNA 2OFNA 4IMDA 2OKTA 1W91A 1YXYA 1R3WA 1AZ1A 3R43A 4P2VA 2FHFA 3WMBA 2VQTA 4NZJA 1H5VA 3TX9A 1JAEA 1LL6A 1J10A 5G1TA 4LJ3A 3BCDA 4L1GA 2N87A 1H11A 4OUIA 5HQMA 1JCMP 2D20A 2VC9A 4G5DA 2EPMX 1QZ2A 1K9FA 1FKRA 3W24A 3FAPA 4U5IA 2CEQA 3BQ6A 1FOBA 2AWGA 1FFRA 4RNHA 3EWBX 4ZR8A 1XBXA 5HW6A 1MDLA 2QVNA 4HZMA 5BMXA 2VX7A 2Q01A 2WHKA 4M6QA 1LWHA 1GVOA 3MKVA 3CEUA 2C1GA 3PN8A 1T96A 3DZ1A 1LF1A 1VFSA 4EF9A 3VD7A 2NX3A 3MQTA 4Q4OA 4ZOEA 3XISA 1R2RA 3NJ3A 3M0XA 2VT0A 4D6CA 2OVLA 4DBUA 3UY7A 3C2OA 1W3LA 1RY0A 1UKPA 3H2EA 1NAL1 1JDCA 2WNWA 3AXXA 4J28A 2Z1VA 2HROA 1PE1A 5T9BG 1GZ1A 3L2LA 4FXFA 1QNPA 1XYZA 3VOFA 3QR1A 3VVGA 2Y70A 3EWDA 2PGRA 1DXEA 2OKOA 1PCWA 1NDZA 4DAIA 1MWOA 1EB3A 3WDQA 2UV8G 3IIVA 1U5VA 2VFGA 1Q5MA 3KAGA 2DJLA 4LUSB 3GAYA 3QRHA 1F3EA 1TPUA 3GWQA 4NJJA 3TLLA 4JX4A 4YYFA 2V6AA 3SCUA 4FAPA 3DYMA 2OSWA 4KESA 4HN8A 4DHGA 3M07A 1E4LA 3KADA 1UP3A 3NIYA 2RGLA 3RCYA 3WD0A 1UKTA 1OX4B 4EXQA 2YIHA 2QIIA 2P50A 4V33A 1QNOA 3OO2A 4ZO6A 3A4AA 4FNRA 4P8XA 1B30A 1YPIA 2EKGA 5CBJA 1J0IA 4Q6XA 4QNEA 4O1EA 4JNZA 4U31A 5B8IC 1XR2A 3SIMA 4GQ0A 3SJNA 2B7PA 4HYRA 1R9YA 3DUGA 4RNFA 2BOFX 4L9ZA 3SN4A 4WY0A 2ONEA 1J6OA 1DJGA 3TYUA 4ZTYA 4QX4A 1RBOB 1EWEA 2OO6A 3H54A 4Q33A 4UQ9A 2Q8LA 1PTGA 1AFSA 3I10A 4GJJA 3ZWTA 1VCFA 2ZADA 3P8JA 4PUWA 1QOPA 1XWYA 3H4GA 4GPNA 1UB3A 1WZAA 5KZ6A 3WLIA 2V3DA 5FF4A 2DZVA 4JN6A 2ABBA 1H7OA 4DRIA 4A3YA 3RG6A 3G77A 3W1XA 1EEPA 4HBKA 1Q13A 1DXIA 3LCGA 4QJ5B 2P76A 4JTAA 4GQQA 4ACZA 1PIGA 1JCYA 2PCEA 1O6IA 4ADUA 1XIGA 3LHWA 4ZEPA 3TJ4A 3A5FA 4M19A 3NEVA 3T09A 3VD3A 4OHQA 4R9OA 3DAQA 3OG2A 3M0LA 2Y7FA 3S8HA 1HUVA 3OHIA 1XUUA 4INFA 2H9AB 4H8NA 4KIEA 4MJZA 4XUYA 4JCLA 1HO4A 4C1KA 1IWBA 1K7FA 5HKGA 3IWPA 1P0KA 2C3ZA 3W87A 1CGXA 1GVRA 2BHZA 1GZJA 1XHGA 2WWDA 3UGRA 3UI4A 2WMFA 1FWJC 1O1HA 2DT1A 3QGKC 2HNEA 3OW1A 4MWAE 1W5PA 4AWSA 1QW7A 5DY3A 4RE0A 1LTDA 1CX9A 3U5YA 5AOUA 1ALDA 1E6ZA 2J8FA 2O4QA 1X7IA 2A5HA 4C6EA 3MCNA 4LYKA 4JFVA 3B9OA 3KACA 4JFLA 4PB5A 1M7JA 3HV8A 4Z2KA 2OZ8A 3LMYA 3A24A 3NQMA 2J66A 4X2RA 2CLPA 2XPKA 1XG4A 4DJFC 2RDXA 2W79A 3CWOX 3FYYA 3SN1A 5AECA 5I3KA 1XPYA 3R4IA 3BW2A 4R85A 2I17A 4QQ3A 3PS7A 2QUUA 4X60A 3LRLA 4AY8A 4Z42C 4Q8NA 2CLKA 1BLIA 1TV5A 4GYPC 1LLOA 4BCEA 2GVEA 3BSHA 3TCZA 2Y8UA 3CB8A 1N7KA 3MUXA 1OFQA 3U3HA 1XDMA 4NILA 4Y8FA 4MB5A 3T40A 5I3FA 1JCNA 1OY0A 3HN3A 4DO5A 1ISXA 4JTKA 4ZSTA 1CLXA 1KCKA 1XKYA 4CVWA 3H7VA 3G1SA 3WELA 3OZYA 3QW4B 1F7BA 4ZXLA 2P5NA 4JIPA 3QOMA 4CN1A 1DORA 4IMAA 3U7VA 3FJ6A 4M0XA 5HINA 4J5NA 1TG7A 4XK2A 2E6YA 2OLAA 3SDOA 4F0LA 4AYSA 4Q7IA 2J7CA 2GQ9A 1K7EA 2PD9A 1UMLA 3I65A 2YFOA 3QLLA 3KAOA 4ROQA 4KFPA 1FWEC 4JTJA 4X9SA 1XXXA 4AU0A 2VZVA 1OYAA 3LEPA 1JULA 5AVHA 2XFFA 3K13A 2XP4A 2NQLA 3P80A 1CWYA 1ZK6A 2WKGA 5I3IA 1VBUA 2BVTA 4XD6A 4LVFA 3ABQA 2ZQVA 3DGBA 2UBPC 4AZ6A 2J7DA 5B7ZA 4AD3A 1QUMA 2VZSA 2MLYA 4ICNA 3O7UA 4QEEA 3EKGA 2HTMA 5FF3A 3Q67A 3UQAA 4PL2A 5FAJA 4FMVA 1YYAA 4LVGA 1VEOA 3TR9A 3VGEA 1FWDC 3MSRA 3GR4A 2QUVA 4C6IA 3E1F1 3WH7A 3GH7A 1OADA 2VELA 2FDMA 1KT1A 1JZ6A 5CSYA 2IUZA 2MUCA 1SJAA 4AX6A 2OELA 4ZL1A 4QSFA 1GQKA 3OQEA 2CHNA 4OUEA 4TX0A 2PRHA 3AZSA 1HW6A 2DSUA 2J13A 1XIJA 2D3LA 3S1UA 2PPPA 2OTDA 3KRUA 1UWAA 1KWKA 3G6MA 2E9MA 3N14A 2ZKMX 4DIPA 2KFWA 2Y7EA 4Y9AA 4HBOA 5FCZA 1J5TA 3GU2A 1F8AB 1PZ1A 1GQLA 4Z08A 5D04C 5E6ZA 4G50A 3WK1A 4J7RA 3RFWA 3EXTA 3JYMA 1NSJA 1GOWA 2QPXA 1E6SM 1XF0A 3GIQA 3R8GA 1GOKA 2OWWA 2PC4A 1OC6A 2AMGA 1V3KA 4ZS6A 1TX0A 1XDLA 5A8OA 5AYIA 3LMZA 3RR4A 3TVAA 4JEJA 3GZAA 4K39A 3E2SA 2GLKA 3FJLA 3QHOA 4FXRA 4GH3A 3N9SA 1O4UA 4IP5A 5I09A 1WDWA 4S3DA 4GNKB 3UNTA 3WBXA 4Q8WA 1IT0A 3H2OA 1H61A 1F07A 4GABA 2GVYA 2A3AA 4ZB5A 1LG2A 2PP3A 1ITCA 1UJQA 4NASA 5D9MA 3EEZA 4QAWA 4MG4A 1O5XA 2VCCA 1OG6A 5EB8A 4AYGA 1CTNA 4NZ1A 3MVIA 5U7SA 3SQMA 5LYRA 4PEKA 1NQKA 4IGMA 4M6VA 4K68A 2XP3A 5T91A 2RKXA 2XGIA 4IPPA 5C6MA 2Z2BA 5AN7A 3OODA 3W2NA 4UFKA 3WENA 3UY8A 2FMOA 5DT5A 3L5MA 3RFAA 1P43A 1US3A 4TQTA 5MHBA 3EPMA 4DRKA 1KV8A 1ISYA 4MDPA 1B9BA 1TUFA 3JYJA 3N2MA 3KABA 4JFTA 4DN1A 1TVNA 3U2ZA 1JQXA 3VDAA 1QHPA 2ZE3A 4WGHA 1G9HA 1VZWA 3LM7A 5EFDA 3AHXA 3LLFA 1LBLA 2QCGA 2A6LA 2D2OA 2IF4A 2VFDA 2XIMA 3WF3A 4UCGA 4O19A 3SY8A 1G01A 1XRVA 3LRMA 4DWSC 3BLDA 3TMLA 2PS2A 1JXJA 1XPGA 4RDYA 1G7UA 1QO2A 5HNTA 1W2PA 2EPOA 4FA3A 1NOUA 5F2IA 2E28A 3G2GA 1S3TC 3EOOA 3MO4A 3BTNA 4HZ7A 4DB7A 1QTWA 3E3HA 5A8NA 4PUMA 3L4UA 3MO7A 3RX4A 1FKBA 3TC7A 3NR0A 3PK7A 4O8RA 3IPWA 3AXMA 3KDNA 1E4NA 5FEPA 1VEPA 2HWGA 4RLIA 4MWAC 2DSKA 3APGA 1CXHA 1RSCA 4DH0A 1ZP4A 5K3VA 3QGAC 4DF0A 2WHMA 3GHUA 4UR8A 3KL3A 1SM9A 3P82A 4MNMA 3R25A 4A8NA 3NZGA 1W6TA 1QVBA 1OZMA 3U57A 6TAAA 3ZT6A 5C2CA 1OQFA 4JTFA 4GIEA 4XISA 1UW9A 1E72M 4US5D 4LW7A 2E9LA 2QJNA 4NAFA 4NJHA 3EIPA 1LJYA 5I98A 3SW6A 3CZKA 3RYSA 3THUA 4QDMA 1WZMA 3JXVA 1H51A 3W1LA 2CLOA 1XH2A 3QV9A 1E1CB 4FX7A 3TLQA 2BWGA 5HW8A 1CGYA 3LI0A 5C54A 2E77A 4ODMA 3ONBA 2FQIA 3UXLA 3W7GA 1ADDA 4ZENA 4HMCA 1RK6A 2W63A 3PZUA 1Q1CA 1ZQ5A 4FZIA 3N4EA 4IPXA 4NXKA 5BW6A 2CXGA 1EQCA 1M04A 3KOXA 4IUGA 3HBLA 2POZA 3SY5A 2PP0A 4H7CA 2IQTA 3ANUA 3TXZA 4LCSA 3U7BA 4RZ4A 4FLQA 4MKVA 1AG1O 1LCOA 4XO7A 3RK8A 1QPQA 1Q2SA 2PD5A 1FCBA 3DOPA 3GNPA 1RR2A 2TAAA 3LK6A 4KCUA 4NP7A 3N73A 1TWZA 2GJNA 1Q6CA 1U79A 1B3ZA 4GBDA 3HGSA 5LSMA 1I0DA 1N8IA 3KDOA 4DPPA 4LALA 3HU7A 1PPIA 4PA8A 4QITA 1EWDA 2HQAA 4Z0SA 1Z7AA 2BGQA 1BG4A 3BMWA 2D22A 4FS9A 1LORA 1POKA 2RH9A 3PC0A 5EY5A 3EAUA 4R27A 3D6NA 5LGXA 1XRTA 5DCBA 2BDQA 4HMDA 3AXKA 4EP8C 1RJQA 3ITGA 1FKGA 2D2JA 4KQNA 1KFCA 4M6UA 3W75A 2W67A 4YWIA 3B8WA 3L23A 4AZ5A 1T41A 5IXEA 3CZEA 2OEMA 2VC5A 1XI3A 2W0UA 4DF1A 1TFVA 1G4TA 5BOFA 2PDGA 3BAYA 3BVJA 4PUNA 1X39A 3BXWA 5C7HA 1OIFA 4PSRA 2ICSA 1GTEA 6XIMA 1F4HA 1P0NA 1JXKA 1LWIA 2XHYA 1S5NA 4LEQA 3CS2A 5IBXC 1KFLA 1Q3NA 1F6PA 2FVMA 3HG2A 4IPLA 4XD3A 4LT9A 3ZJ6A 3GTIA 4NX0A 1YMYA 4PB4A 2DZTA 4FXSA 1HKVA 5LGZA 3GXFA 1FCUA 3R11A 3EB4A 2X30A 3ALFA 4UTTC 1WDDA 5XIMA 4IQ2A 3VCRA 3ID7A 5D2XA 3C0LA 4LUTA 4GVGA 4NHVA 2LLEA 1M5WA 1V0NA 4NT0A 4X3ZA 2IPJA 1ICPA 3QV6A 3GU0A 1PIIA 1GK8A 4AMCA 2QKFA 3DECA 1BVNP 3IUIA 4XG1A 2FFCA 3S9ZA 4GVFA 4GO8A 1IR2A 3O8AA 5HANA 3WQ8A 1TWWA 4UZSA 1TMLA 3UCDA 2QEZA 1AD4A 3WFZA 4UTMA 3HMCA 2EJAA 1SYTA 2WNZA 3F5LA 3GG0A 4KEUA 3OBEA 1YTDA 2EHHA 1WO2A 2PWDA 1JI2A 1YDNA 2WC4A 4J4NA 2V2CA 1BFNA 1N8FA 2OWXA 3BW3A 2VMFA 2XP9A 1W1PA 4GZJA 4WR3A 1EA9C 1OFDA 4RE4A 3BLPX 1BWKA 2ACSA 4J4KA 3A12A 2I5QA 4CU7A 3W1NA 2WJDA 1OG0A 4NX5A 2A79A 4JNMA 4A35A 1QPFA 1UOKA 3DERA 4FIQA 3VK5A 2VUNA 5DANA 5E0FA 1E9ZB 4RZBA 1DKWA 1KM4A 3GTNA 3PUOA 3V35A 2GJLA 2PTZA 1JCJA 1NP2A 4GGHA 4E0CA 1XSJA 1EEXA 4X61A 2GSHA 4P7QA 3T4WA 3AHTA 3F4NA 1V7AA 1W5QA 1VR6A 3B03A 2F9RA 2VDIA 4O2TA 3GXNA 4I7WA 3V75A 1UC5A 1RPKA 2A7NA 4QISA 5HR7A 9XIMA 3P0XA 1H60A 1B31A 1W1B1 2CW6A 2VNCA 4AMAA 1A0DA 3CZGA 1Y0EA 3GDKA 1V6XA 2JKPA 3O6AA 3E2VA 3K1DA 3UJEA 1PDYA 5C9XA 2DVUA 4ZOAA 4UIOA 2HE5A 4LGXA 3DBNA 2RURA 5CG0A 4ERGA 3ARUA 2FZBA 2OZTA 3WLKX 1AH0A 1ROUA 3LPOA 1W3KA 2RJHA 2GJPA 5AY7A 1REQA 4HK7A 4HA3A 5I7GA 3RCNA 1HJQA 4AIEA 3M64A 2EJ1A 3B0VC 5C0QA 4F0KA 4D6GA 3S1XA 3AS0A 4O1CA 5A6SA 1TV4A 3IARA 3UXIA 4W93A 3LQGA 3CLMA 4KWSA 4L72B 2Y5JA 3HPAA 3VIOA 1VFFA 1VD6A 2PWGA 2ACUA 3VABA 3M0KA 2VR5A 3VGHA 4N7QA 1Q6OA 3HFTA 4DEFA 3PNUA 2F38A 3CHDA 3WDPP 5CGMA 4LH8A 3ITOA 1V79A 1IXOA 3CTLA 3TAKA 3DC8A 4DLFA 1Z42A 2DUXA 2IKJA 4C6KA 5REQA 2GGJA 4WX2A 1S5VA 3ALGA 4NI3A 1OK4A 3DFOA 2DZBA 4L80A 3GSMA 4L7ZA 4O1DA 3VIKA 2GPTA 4S23A 5C2GA 2CBUA 2DG3A 4K7VA 2GGIA 1W9BM 1DJNA 1PINA 2ZR5A 3B40A 2PF0A 4KRUA 4JNYA 4FF7A 3WQCA 3NDOA 4LAUA 3WDIA 3V5FA 1TA3A 1HJWA 2XINA 4GI8A 1V6TA 3KLKA 4W8AA 1AL7A 1ICSA 2Y6ZA 1VHNA 4FNSA 3N12A 4DRNA 4IGHA 2DV0A 4PRTA 4XWUA 3SBFA 4JTDA 4IG2A 1F74A 1UZHA 2RUCA 1VFUA 1OINA 2V69A 3QV8A 5DMYA 1KRBC 1BYDA 2J6XA 3K46A 1NARA 2EAWA 2NT0A 3PZOA 2PLMA 3PG8A 5A6JA 4LUYA 3FYOA 4J4OA 4EKJA 4DRJA 1Y5WA 1TELA 2J75A 4E8DA 3AWNA 3JUGA 5LIXX 1DJHA 1RLCL 1L6YA 3VNYA 2V2HA 1UHVA 3AS3A 3AMLA 3LHVA 3E38A 1E43A 1GOOA 2WJZA 4K8GA 5D05A 2GDQA 4OWGA 1TREA 1F6YA 2G37A 2YA0A 3T55A 2DQWA 5LNVA 3KBMA 1JJKA 5D9PA 1WXJA 3VDCA 3IJ9A 1KM2A 2P10A 3A3HA 3U2CA 1T11A 4IQDA 4LAOA 1KFBA 5HWBA 4DBEA 5DLCA 2CBJA 2PRLA 1UKQA 3R89A 4M6PA 2QW5A 1ECEA 1YRRA 4ZQMA 4GZIA 3GU9A 2QJIA 4PE8A 3S2NA 3WQFA 1VPXA 3W53A 4O4WA 1UWTA 4HPXA 4M1BA 4YJ5A 4S2CA 4LYPA 3SRHA 3W9ZA 3PJWA 3DCPA 1QK0A 3W74A 3VOIA 1IZCA 4G8TA 5HJXA 3L68A 4E8CA 3WLJA 1KRAC 2X1IA 3QC0A 2V63A 2UZ9A 3W7LA 1QBBA 1Q63A 3RLGA 5I02A 1TR9A 2GK1A 3QLDA 1TUXA 1XC6A 1TVPA 1QI2A 5EL1A 4UOQA 3A13A 3SRFA 1VC4A 4ATDA 1M53A 1K6AA 4YTSA 5BXRA 1MEHA 1DVJA 1ZAIA 2V5DA 2MLZA 3G8EA 3WFLA 4CQCA 1BG9A 1XDJA 1SUXA 2DFAA 4ILSA 1IIGA 1GKPA 3E02A 4M1RA 1CDGA 3WDJA 2XGZA 1GTHA 2RFGA 1QI3A 4LAVA 2DORA 2NXGA 4JTCA 4P7NA 1MVYA 4MAVA 1OX6A 3UWVA 1W9VA 3DH7A 1JZ8A 1RBAA 3F2CA 3NO3A 3W4RA 3P3BA 4JDBA 3JS3A 3KRZA 1B90A 2PTDA 1U5HA 4DI9A 1NP0A 4QG8A 3WO8A 1KM5A 3AUJA 5C9UA 4I8YA 2DY3A 5CPSA 1UKSA 4DUXA 4NZCA 3DDMA 4DWSB 3PNZA 3I68A 3VIPA 3UFYA 3TV8A 2VRKA 1JD9A 1DOSA 3MSGA 1I75A 3V3WA 4AH7A 3NTYA 1Z69A 1V77A 3RM4A 3NPVA 3BO9A 3S3GA 5ABEA 1CBGA 5IFPA 4Q8MA 4B3LA 3GDTA 3TTQA 1OX4A 1R0MA 1T7LA 3ITCA 3HQNA 1EF2A 1KD0A 4ZQRA 1A80A 4ZE5A 5A69A 1KM6A 5HR6A 1C9WA 2V5BA 3WH8A 1DE6A 1ZENA 1RCOB 1IX5A 1QNSA 1KM3A 4Q4QA 5BCAA 2QGHA 1FJDA 3FDGA 3BL3A 4B5SA 1XH0A 1ROTA 1Z3NA 4NZ4A 2I1OA 1CXLA 1AW1A 4D6JA 3S9YA 2NX9A 2W66A 2PE4A 4PMRA 4NZFA 4S3FA 1E6NA 3O5OA 3T1GA 1F40A 4BQ5A 2ISVA 1IIHA 3ICJA 4N4PA 5LIUX 3SAZA 1GUVA 5FAGA 2FH8A 2X1SA 2PLCA 3RJXA 2OEKA 3EDKA 6CGTA 4XB3A 3T4CA 1ITQA 1S39A 3G24A 3TDBA 3WLPA 3CQJA 3FXYA 2NV9A 3WCZA 3K5XA 1QJWA 1TWSA 3N6QA 4GC4A 1OBAA 1AK5A 4JYEA 1FKSA 4O28A 1U30A 4I3GA 1TX2A 2V3EA 4O1BA 1MEIA 1N2VA 5FEZA 1OWQA 1C7TA 4FN2A 3O0FA 3OVPA 3W7EA 3GHRA 3TN3A 5E9AA 4GISA 3SGZA 2XSBA 3FOKA 3PJTA 3UYIA 4WZHA 5HA7A 2X7VA 3UG8A 1O7AA 2X7WA 2PF8A 4HHLA 2HS8A 1TMQA 3NZQA 1L1PA 5FEXA 1L8NA 4LANA 4N6FA 3WZ0E 2VTFA 4H2CA 4F0RA 3ATYA 4R88A 3KBJA 1NWUA 2QCDB 3OYXA 3C0JA 2H9AA 3QEZA 3GU1A 3WQPA 1NH6A 5M2FX 4L61A 3CYJA 5GVJA 4O50A 3F2DA 4UNIA 3UXAA 3E49A 1FWGC 1YDOA 3QM3A 1YBQA 2R24A 4PCFA 3N4AA 1DEDA 3WD1A 2PCQA 3S2MA 2PGEA 3UJFA 3AWOA 3OIXA 3TZFA 3FCPA 1HL2A 2WM0A 4M56A 4I7UA 3DBPA 3WNMA 3P61A 4MNLA 1IGSA 3U9IA 3ME3A 1Q6RA 2YDSA 3WQ5A 2Y7GA 3HFYA 5LXEA 1J0YA 4UTWA 5D38A 3CZ8A 4IT6A 2WKJA 3C0QA 3P8IA 3N9RA 4ZQNA 4ICMA 5TF0A 1UIOA 4FSAA 2DJXA 3NQAA 4JQ3A 1SFTA 5D2YA 5HOSA 4DXXA 2VD8A 3LPFA 3TU9A 1C7SA 3F4DA 2RDUA 3O5QA 1Q4WA 1CT5A 4PMJA 2X41A 1J5SA 3FGCB 2Q71A 3UWUA 2Y89A 4G56A 4IJCA 2PZ0A 3VZXA 4GIVA 2BLEA 3TMQA 2YCKX 3DG6A 4UMAA 5FA5A 2XU2A 3F7JA 3OZPA 3GNXA 5TD4A 3LNPA 1OYBA 2BY0A 3A64A 2CXEA 3ZO9A 3KEHA 2K8IA 4MGGA 1RUSA 1PKNA 1NMVA 4GX8A 5H6HA 3LBOA 1C9HA 4EPBC 1EX5A 4F79A 3OOQA 5G2WA 3FSTA 3QR0A 2GGEA 4Q8UA 4H8VA 1OK6A 1C3FA 3BDKA 3PSWA 1UWQA 1PKMA 4NNRA 3A47A 1SQ7A 1MW2A 3KW3A 3HPFA 2QCFA 1F3WA 1KRCC 1V3HA 2WVTA 5G5IA 3CZLA 3W2JA 2Z1WA 2P8CA 4Y6GA 2PDLA 4XAKA 3BAXA 4FNQA 4GGQA 3MZNA 1OFAA 3O6CA 3A5VA 3ABRA 3MANA 3FX4A 2JIEA 1GNXA 4UXDA 3W7KA 2XIJA 4N0RA 5G4HC 4WOQA 1E71M 5FJUA 4WKFA 4HOXA 2HBVA 1O60A 3W7QA 3MMDA 3WQ4A 4DJEA 2RGMA 4MADA 3GG7A 4UNKA 4ZFMA 4IPJA 3CGMA 1CB2A 1V0MA 2E3ZA 2PDCA 1IWAA 1ZFJA 1SO5A 1KBIA 1SFSA 3FA4A 5GNZA 3TYCA 4BI5A 1HL8A 2QV4A 4GXPA 1FCVA 3NQCA 5I77A 4PL1A 4L56A 4B2DA 4RNJA 2VKZG 3BOLA 3QN3A 1JZ4A 4RL3A 3S47A 3M4HA 4FX6M 2G4FA 3OZOA 5DRIA 1HJXA 4BR1A 2VRJA 2VR4A 1S5MA 3QGVA 5EMLA 2I57A 3O5MA 3B05A 1FWHC 2JKAA 5KZEA 3W70A 1EKOA 3CUFA 2XTKA 2OLSA 1BQCA 1BHGA 3MKCA 3DU0A 4KEMA 4PH6A 4EXBA 3U0HA 1ICQA 2PV2A 1B3WA 1DJIA 2XVGA 3R10A 4N4QA 5A8MA 3WH9A 5K9DA 1VGAA 3RLVA 3L21A 2FZ8A 4P8VA 4JTGA 1MQRA 1VLIA 2GQ8A 3LGDA 2ZX7A 1DIKA 3VIJA 4RZ5A 2ZRZA 2AKZA 4PBEA 3SCNA 4KFNA 3B8SA 4HZ6A 4JYSA 1IEVA 4U84A 4QIUA 3UWZA 2WSYA 1KFJA 3SCRA 4JGDA 2XWDA 3B0UX 1CLKA 1RALA 4X63A 3O5FA 3MY9A 3IGXA 3N9KA 4V15A 4YCOA 4AISA 1GOQA 3W1UA 3N1AA 2HSAA 3MS8A 5DEZA 4MMWA 3WUGA 4ZBCA 4J3WA 4LVBA 1I60A 1ZAJA 2DP3A 1TTIA