4DWSD

Crystal structure of a chitinase from the yersinia entomophaga toxin complex
Total Genus 191
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
191
sequence length
539
structure length
532
Chain Sequence
PTENIPSPILVEDKYTEETYSRPDVNFKEDGSQGNLSYTATRVCAPMYNHYVGDKTKPKLSAYITDWCQYDARLDGGGSKEEERGRGFDLATLMQNPATYDRLIFSFLGICGDIGNSKKVQEVWDGWNAQAPSLGLPQIGGHIVPLDPYGDLGTARNVGLPPESADTSIESGTFLPYYQQNRAAGLLGGLRELQKKAHAMGHKLDLAFSIGGWSLSSYFSALAENPDERRVFVASVVDFFVRFPMFSCVDIDWEYPGGGGDEGNISSDKDGENYVLLIKELRSALDSRFGYSNREISIACSGVALKKSNIDQLVANGLDNIYLMSYDFFGTIWADYIGHHTNLYSPKDPGEQELFDLSAEAAIDYLHNELGIPMEIHLGYANYGRSAVGGDLTTRQYTNGPALGTMENGAPEFFDIVKNYMDAEHSLSMGKNGFVLMTDTNADADFLFSEAKGHFISLDTPRTVKQKGEYAAKNKLGGVFSWSGDQDCGLLANAAREGLGYVADSNQETIDMGPLYNPGKEIYLKSISEIKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The BC component of ABC toxins is an RHS-repeat-containing protein encapsulation device.
pubmed doi rcsb
source organism Yersinia entomophaga
molecule tags Sugar binding protein
molecule keywords Chi2
total genus 191
structure length 532
sequence length 539
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2012-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4dwsD01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4dwsD02
2J77A 1QI2A 3BAIA 1I1WA 1KXHA 3VDAA 2WVTA 1ODZA 4QLLA 4W7UA 1BSIA 2BVYA 2VT0A 1VRXA 3MSDA 3CMGA 3AISA 4R5EA 3SCUA 5A8OA 1K6AA 1NWSA 3ECQA 3OGSA 3MUZ1 1XD0A 2E0PA 3AYSA 1FFQA 3AYRA 3IAPA 3SUTA 1UD8A 3ZIZA 1QVBA 5TD4A 3GXDA 1CXLA 2OYMA 2WWDA 3KL5A 5BWFA 5IFPA 3GXMA 2VCAA 1W9UA 1WE5A 2FDMA 3W4RA 4LXFA 3DHUA 1GONA 5CPTA 3CUIA 2G4FA 4UOJA 5GNZA 2XWDA 4OOZA 4IM4A 1GUVA 4OIFA 3VX1A 3AFBA 2GVYA 2BXZA 3ARTA 2J7GA 1DWFM 1EHAA 2JALA 6TAAA 3CTTA 1R7AA 4WSKA 1ITCA 1V6UA 4Y7EA 2DT3A 4TUFA 3FAWA 1C90A 3OLIA 5BXRA 2PI6A 1M01A 3WNMA 1KBKA 3UG3A 5A8PA 1KFWA 1MWOA 4MTVA 2BVTA 3PZMA 2IUZA 4U3CA 2W63A 3NSXA 3VILA 2ZIDA 2DH3A 5DO8A 1SR0A 1UKSA 4JZ5A 4PMDA 4CVUA 2F8QA 1ZJBA 2O92A 1J9YA 4WJXA 5I0DA 2DSWA 2VX6A 3KEHA 1UR1A 1VAHA 3O2LA 4TX8A 1E4IA 4UFMA 5I23A 1NH6A 2J75A 3AS0A 3NJ3A 5ABHA 4ACZA 4KH2A 3A47A 1GW1A 4HP5A 3AIBA 1HIZA 3VIMA 1I75A 4FLRA 3K8MA 2QMJA 5FCZA 2WVVA 2OLHA 1W3LA 1Q4NX 1UWSA 1HKIA 1CDGA 2GJXB 2WBKA 4B3KA 3CUFA 4CD5A 2BY1A 3WEZA 2XHYA 4JCLA 3W24A 1E4MM 4C7GA 3OB8A 4HZ7A 1XYFA 1EDQA 3F5KA 4PRWA 1TCMA 1E71M 3ZR5A 4D6IA 1HF6A 2J7FA 1AMYA 3OLDA 3ZM8A 4KRUA 5C70A 1FP8A 1Q6EA 1HJVA 3UR7A 5GNYA 4BS0A 2WCSA 2BY3A 1BLIA 4NZCA 4W93A 4XZBA 3NIYA 2Y2WA 3OLEA 4JCMA 1XHGA 1CECA 2WANA 3WUGA 1PIGA 3FN9A 2XVGA 1HKJA 1E3ZA 4FLSA 2QHAA 1K9TA 4QCEA 3B9EA 1TVPA 4WKFA 2VQTA 2VVNA 2BHZA 1QBAA 6A3HA 3MMDA 3VIOA 3I3DA 1KQZA 2VUYA 2X2YA 2DH2A 4MAVA 1XH1A 2WK2A 3WUEA 1J0JA 4J28A 3WH6A 1JYWA 3PZUA 2EQDA 3AMLA 1HP5A 2XGIA 3AHTA 5AC4A 1L8NA 2CERA 1LQ0A 3QR3A 4LYRA 3AXXA 4ACYA 5E0FA 5I24A 1E6QM 1CENA 1H3GA 1JDDA 2ZXAA 3SURA 4CD8A 1NM9A 2BY0A 4HOZA 3VGFA 5A2AA 1OT2A 2J7EA 2V3FA 2G3IA 1KGUA 2WXDM 5M3WA 4P8XA 1ZBWA 3GH7A 2VC9A 2FGZA 3TOPA 4CU8A 3BXWA 5CQ1A 3W38A 4UCFA 2ZX5A 2NSXA 3QHMA 1JZ7A 2YL8A 1PIFA 3SCQA 1UWRA 5DT5A 2X0HA 1X6NA 2ZUSA 1UKOA 5E09A 5D8ZA 4U31A 3T0AA 3U7VA 5D9OA 1E1EA 1JDAA 1B3XA 5I2UA 2VCBA 1UQZA 3VPLA 3AIQA 4BF7A 3VGBA 3VIJA 2HVMA 3AXHA 4WK9A 1UD6A 2FHBA 4MAZA 2J8FA 2WZIA 5LA0A 3ARQA 2V3DA 2CHOA 1CPUA 1V0MA 4P8VA 4UQCA 2JF7A 3CZGA 1GCYA 2WYSA 4HPGA 1B0IA 2CKRA 4V28A 3QGVA 2EEXA 5AY7A 5A8NA 1TMQA 5HPOA 1QHPA 1W9BM 1K9EA 3CO4A 5FL1A 4HMEA 2W91A 4D6GA 3WQ5A 1ISVA 1QPKA 4H7VA 1DWJM 1DWIM 2EPKX 2VRQA 4CU6A 5JBDA 3SCNA 2CIPA 2WZHA 3S2CA 4UR9A 4RE4A 4ZXOA 2XUCA 1VFMA 1UH2A 4M56A 5E9AA 4ZE4A 3VIGA 1V3MA 4V27A 1D7FA 1P6WA 4A3HA 1B3ZA 1IZJA 3CGTA 1JYXA 4J27A 1QBBA 3NDYA 3N15A 1E0VA 4MB4A 1FH8A 3PZ9A 1TA3B 3CIVA 2EPOA 2WMKA 3LPFA 3AHXA 2OWWA 2XTKA 2GK1A 2WSKA 3RDKA 4PBGA 2NT1A 2QV4A 3HU7A 5JH8A 4UTFA 1B1YA 2OSWA 3TONA 2YIHA 3FW6A 3K1DA 1E6PA 1PEZA 2QPSA 3BGAA 4PMOA 3WD2A 4CN1A 1E4LA 1V02E 4KMQA 1OB0A 3FHAA 2X0YA 2XVNA 4QLJA 2FHFA 3WQ4A 4KGLA 3RPMA 2GK1B 1VFOA 3WF2A 3EDEA 1QI3A 3PTMA 1VJZA 1VFFA 2ZX7A 3W6MA 3AXIA 1W2PA 1JZ3A 2DT1A 1DWGM 1UR0A 3PTQA 2RGLA 2VCCA 2D24A 4W86A 2AMGA 3MS8A 1HT6A 2IXVA 1VFUA 4UFLA 5GPRA 4PCTA 3WFZA 5LYRA 2ZX9A 1CYGA 5GQBA 5HPCA 1JI2A 1UR9A 4GQQA 1S46A 1BG4A 1KWKA 1J0YA 1UA3A 1CGVA 2BHYA 3VINA 4JL1A 1MVYA 3WF1A 4LQ1A 4HOXA 1EOKA 3HJEA 3WL0A 5ABGA 4TVUA 2ZUUA 4AW7A 3WDIA 1XSKA 1MW0A 4UFIA 3MMWA 3CZEA 4Z2IA 4D71A 1VENA 1OD0A 1BG9A 1NQ6A 1V0NA 4HMCA 3AMKA 4UQEA 1AQ0A 4W8BA 3I3BA 1DWAM 5I77A 4E2OA 1QOXA 3RJYA 2Z1SA 3ZT5A 4AEFA 4HPHA 2QMKA 2CETA 1LJYA 3RM8A 3SUSA 5A6MA 1JYVA 4LGXA 3WL1A 2FGLA 4E8DA 1M7XA 1V0LA 5A94A 3PHAA 4GINA 1M53A 1QI0A 8A3HA 4ZEPA 3WH5A 4URIA 2D0HA 3GNPA 3RMEA 4N0RA 5CXPA 1WZKA 4MB5A 4W7VA 1SMDA 3WMCA 1XC6A 4HZ8A 3W53A 4QFUA 1C93A 4W84A 4PTMA 4B3LA 3WIJA 4JFTA 3ARWA 2GSJA 3L2LA 1V6YA 3WD3A 3SCVA 2GJXA 1CXHA 3VIKA 1OWQA 3AROA 1LWJA 1EGZA 3K8LA 1MXDA 4P7NA 3W29A 4X9YA 4QCFA 5JBEA 5HXMA 1U30A 2CXGA 3NCOA 2VVSA 4J3WA 3VMNA 1H49A 2D22A 5A6BA 1CLVA 1ZJAA 4J7RA 1J01A 1RH9A 1UWUA 3CMJA 4NF7A 1E40A 2D0GA 2DSVA 4K68A 5IHSA 4AMCA 2O9TA 4AZIA 3VD9A 1FFRA 2VR4A 3MV11 1PJ9A 3PBGA 3UETA 1YQ2A 3MV01 2WMIA 3TTYA 2E4TA 3RILA 4MJ4A 1H0IA 3ZSSA 4UFKA 1M04A 1L0PA 2ZUTA 2JIWA 3CHDA 4P7RA 2F61A 3K4AA 1UQYA 1WO2A 2VOTA 2XVLA 3UR8A 1WDRA 2ZICA 3AZRA 1CZ1A 3ZJ8A 4Z2GA 1BGAA 3ZT7A 1B9ZA 2WKGA 3WD0A 5CZKA 2CBVA 5I5RA 3WD4A 2ZUWA 1TFVA 2J62A 3EMQA 5FIPA 2YL6A 1EXPA 1MW1A 1XYZA 1E0XA 3SCOA 4TTGA 3WNPA 4CCEA 3WY1A 4H8HA 1NP0A 3WDRA 1A3HA 4MNLA 1FH9A 1R85A 1OGSA 4D72A 5IXEA 1LL6A 2O9PA 5FL0A 4MNJA 2E40A 4CU7A 1WB0A 3WEOA 4J3VA 4UNIA 3I3EA 5DMYA 1UOKA 3VDCA 3TTOA 1HX0A 4IUGA 1OM0A 3T08A 2OWXA 2PWFA 3WH9A 1VBRA 1E9LA 5HDRA 2VX5A 2UWFA 2EJ1A 2WSPA 1UKPA 1H1NA 5BRPA 1JIBA 1CGXA 5JBFA 1GJWA 2GDVA 2WLZA 1UZ4A 2F2HA 4ATWA 4IPNB 1PX3A 1ZBKA 1JG9A 2CBIA 3RJXA 2XG9A 3VIPA 4UQAA 4AZCA 4AZBA 2JE8A 3NSMA 4CN6A 1W1TA 1KGXA 1H2JA 3KWXA 2W67A 2J4GA 4D6EA 1JI1A 1ECEA 1EO7A 1U2YA 4CGTA 4WSJA 1UR4A 1CTNA 1QI4A 3VIFA 3WSUA 3CLWA 2ZX6A 3NSNA 1HKKA 2PWEA 4D1IA 1E73M 1V3KA 1V6WA 2ZXQA 1GOQA 4W5UA 1XGZA 2WPGA 4V2XA 1J0HA 3VD7A 1E6RA 2YLLA 2BVDA 1QNRA 2ZWYA 1TZ7A 2WC4A 4Z2JA 1F4AA 3SCPA 1E6XM 1B3VA 1W9DM 2E9LA 3MUAA 3CPUA 5CSUA 3MKKA 1HJXA 1UUQA 1UWIA 3WN6A 3AHYA 4GI8A 3M46A 3UG5A 1I1XA 4J3UA 5A6SA 1MQQA 1FP9A 2VI0A 5BCAA 3AZSA 3NDZA 4OOUA 3UERA 1LG1A 3CHCA 3RCNA 2PWDA 1EOMA 3DHPA 4OKDA 3N1AA 1VIWA 4AZGA 1CXIA 1QI5A 3SEPA 2DQXA 2YOCA 3N9KA 3ARPA 2Y8VA 3BLPX 4CVWA 4DUXA 1E43A 4LPCA 1GHRA 1UHVA 5CJ5A 1H0GA 3SCWA 1GOMA 3S6TA 1BF2A 3WH8A 1B30A 4W7WA 4B9ZA 5A6KA 4KRTA 4U2ZA 3AZTA 1WZLA 4JHOA 3NYDA 1W1PA 4JKLA 3T0BA 1ZU8A 5ABEA 1OD8A 2HISA 4QAWA 4PMRA 5EB8A 3WKZA 2VZTA 2V5DA 3SIMA 3VD4A 1JF6A 3N11A 2PWGA 1O7AA 3O6AA 1GNXA 1HJSA 3AIRA 4XUYA 1JZ5A 1PZ3A 1NOUA 4E8CA 1VEPA 4FLQA 2YA1A 3NUKA 3CZKA 4PSRA 4U3AA 1V03A 1WNOA 1QW9A 3IJ9A 1JNDA 4BZYA 3WF4A 7A3HA 3ZJKA 3E1F1 3ZR6A 4H8VA 1BYCA 1EDGA 2X8RA 4FLOA 4M81A 4JFSA 1TG7A 2ZUNA 3VOCA 4PTWA 1HP4A 4HZ6A 3SCRA 2QPUA 1WPCA 2XM1A 2PB1A 2VZOA 1W32A 2JF6A 4JHZA 1WAWA 1J12A 3VU2A 4F9DA 3EBVA 2WMFA 1KCKA 2WNWA 4TX6A 1E6NA 1JZ2A 5A2CA 2J79A 2AOSA 1V3LA 1CEOA 4AD2A 3PZOA 3WMSA 4XZWA 1LF1A 3WQWA 3POHA 3WQ8A 3OG2A 2YDQA 3W82A 4P7OA 5A69A 1J0ZA 1UA7A 4BA0A 4GZEA 2WM0A 1GPFA 1JXKA 1CLXA 3AS2A 2NW0A 1CNVA 1KCLA 2B31A 1V3IA 1XH2A 2W66A 3AICA 3WENA 5CSYA 4YN5A 2J25A 5DFAA 4W85A 1BYBA 2DSKA 3K8KA 2C7FA 4MJ2A 3QOKA 5CPSA 2D3LA 2WMGA 2DT2A 3BAYA 4AZHA 2WB5A 1KGWA 1QHZA 4LYPA 4AYSA 2G41A 1OIFA 5M03A 4PCSA 4JFUA 2V5CA 2ZXDA 3ARXA 5A95A 1GVYA 2J7BA 1OIMA 4ZFMA 4D6JA 3UG4A 3WBEA 3WDJA 3HN3A 4F66A 5E70A 4C7DA 4U33A 1JZ6A 1JAKA 2BNJA 1WZMA 3BMVA 5D4YA 1OGBA 3QHNA 1ZL1A 3PZIA 4AZ5A 1GOOA 1A47A 2X09A 1LL4A 1HL9A 2CEQA 2ZX8A 4JIEA 3VMPA 5D9PA 3VD3A 2GJPA 3THDA 1KXTA 4DWSA 4PMXA 4EKJA 4UQBA 5LA1A 4UZSA 1E70M 2C0HA 4B16A 4GZJA 1H41A 3LMYA 1V3HA 1BFNA 3PN8A 5I78A 2XYLA 5FOOA 1TUXA 1BTCA 5IDIA 4PN2A 3T2OA 3VO0A 5A3HA 4AZCB 1IT0A 2OSXA 3O9NA 3ZSTA 4D6FA 1WZAA 3K46A 3IANA 4Q22A 4Z2LA 3ZO9A 3GH4A 1C8QA 3W81A 4IISA 1PZ2A 3U5UA 2XGBA 3CH9A 2CKSA 3POCA 3AQUA 1UKQA 1C3FA 3BSHA 2DDXA 4BCEA 2VZVA 1J10A 1DP0A 4DUWA 2WAGA 2WVVB 4JFVA 3ZJ7A 3AMCA 1HVQA 5JIPA 2ESCA 1NOWA 1BVZA 2CCRA 3WELA 3BAWA 5HBFA 4AIUA 3GXIA 1OBAA 1E15A 1D3CA 2CPUA 5GNXA 4GI6A 2XFFA 1NWRA 1RD6A 3WDPP 4AD1A 1B31A 1E4NA 2WHJA 3OZOA 3OLGA 2O9RA 3WNNA 4F9JA 1W3JA 2YL5A 3FHQA 2WHLA 2QF8A 1TE1A 1NARA 2OWCA 1GHSA 4ML4A 4JL2A 4F8XA 2WCAA 1BYDA 5DF0A 4MNMA 2MANA 1G01A 2XFRA 3MUY1 2YBUA 2A3EA 1W2VA 2J47A 3G6MA 3VM7A 1SYTA 3CZ8A 4GXPA 3CHEA 3ZMRA 4LYQA 1O6IA 3EDDA 1MQRA 3AMGA 1Y7VA 4KGJA 5C71A 4UQDA 1HJQA 2VZSA 4C7FA 2WLYA 4ACZB 2E8ZA 1OGGA 2VQUA 2WVUA 3THCA 2VURA 3A4WA 3ZQ9A 3WQVA 1QNQA 4MNKA 4OJYA 2WW5A 4W88A 4ZENA 5A6LA 3W6LA 2CYGA 1MFVA 3F4VA 4H8UA 1W91A 2D20A 4F79A 2ZWZA 1BYAA 2DPEA 3LPOA 5E0CA 4MB3A 4PMVA 4MPKA 4JAWA 4Z2KA 4U2YA 1XH0A 5LA2A 7TAAA 4CD7A 1LG2A 3N13A 4R27A 2YKKA 3G6LA 1UD5A 1KQYA 3GBEA 1EQPA 3L4VA 2WVSA 3T2QA 3EDJA 3VMOA 1WDPA 4TVDA 1VJSA 1Q6DA 3IK2A 2V38A 2GUYA 1UH4A 1BQCA 2OYLA 3LPGA 2AAAA 4PTXA 2C8NA 1W3KA 4DM1A 2J8GA 3AS1A 1GOWA 3GTNA 1PX4A 5A6BD 5BROA 3ARVA 3VX0A 1V02A 4Z2HA 3AI0A 1E5NA 4QLKA 2G3MA 1JNEA 3VDHA 4EAMA 2YL9A 3VIHA 2DIJA 3MO4A 4GIAA 3GBDA 4P7QA 3BCFA 4TOQA 3U5YA 1CXEA 3CUGA 1C8XA 3GNRA 3KL3A 4HU0A 3WH7A 3WDQA 1PAMA 9CGTA 4W89A 2ZUVA 4JKMA 3WDHA 1X1NA 2DGAA 2W62A 3DYMA 3EDKA 1HVXA 5A2BA 4BQ5A 1JD9A 5ABFB 2J74A 3GYCA 1H11A 4UOQA 1ESWA 3D5HA 2PBGA 2NT0A 1XRVA 1QNPA 2JEPA 4EK7A 5CLTA 3ZT6A 3W37A 2JFEX 4HTYA 4PTVA 5EFDA 1GQIA 3OGVA 3AJ7A 4OBRA 3ARRA 1JAEA 2VNCA 3PZTA 5CG0A 1FHDA 3ARZA 2BY2A 1C7TA 3M07A 2A3BA 2UY4A 3PTKA 1DEDA 1Z32X 1KBBA 1B3YA 3AOFA 4S3JA 3B8SA 4HU8A 1W9VA 1LLOA 1ITXA 1GOKA 1TA3A 1MXGA 4AD0A 3EMZA 4PSPA 3FY1A 1MW3A 2YJQA 1ZBVA 2XWEA 2EPMX 5I79A 1CIUA 2J78A 5IHRA 4PMNA 2G8ZA 4Q7NA 2Y5EA 4AD3A 5M5DA 4AEEA 1EA9C 1K9DA 1BPLB 4W8LA 1OSEA 4X0VA 1AQHA 5D8WA 1SFSA 2WMJA 4OUEA 3U7BA 3WNKA 1FA2A 5AYBA 3TP4A 1XSJA 1N82A 1OCQA 2XIIA 1TVNA 4RE2A 4YHEA 5CGMA 1UYQA 1V08A 3QOMA 4PUDA 1B3WA 1QNSA 2BXYA 2D3NA 1CXFA 1MYRA 4BQ4A 1KWGA 2D1ZA 4AWEA 2VMFA 7CGTA 4PYSA 4M8UA 1KB3A 1WCGA 4D6DA 4DM2A 3AIWA 5KEZA 1EDTA 2WKLA 2WWCA 4AXNA 5DT7A 5JIWA 3PZVA 4DUVA 3GNOA 3WQ6A 3MSGA 1EO5A 4P8UA 4GO8A 2VRKA 1VEMA 1G94A 1H09A 1HN1A 1K9FA 1JYNA 3WEMA 6CGTA 2EPNA 1QNOA 3GXFA 1E72M 5EMYA 4HA1A 2XSBA 1CGYA 4A3YA 3WNOA 3CZJA 2VX7A 4M24A 1VBUA 4CN4A 3WD1A 3VM5A 3VNYA 1EIBA 2QLYA 3JUGA 3DC0A 1KXQA 3CUHA 3SCTA 1J0IA 1UH3A 1RPKA 3DECA 5D9MA 1PPIA 3F5JA 1HJUA 3OIHA 1WDQA 2D0FA 5ABFA 3BMWA 4AISA 1JF5A 3FNDA 3ALGA 1JZ4A 4AD5A 2D23A 2CITA 1B90A 1FH7A 1XSIA 2OSYA 2VTFA 2Y4SA 4NI3A 3DYOA 1UWTA 4QP0A 2Y24A 3A4AA 4NSBA 1ODUA 3L4UA 4UZUA 2DT0A 3AIEA 1GJUA 3MANA 1QW8A 2A3AA 1OT1A 3M7SA 1H4PA 1EH9A 3BSGA 4DWSB 2IXUA 2X1IA 4H41A 3ZOAA 1CWYA 2XPKA 3N18A 1UD2A 1GQLA 1HNYA 1NWTA 4CD4A 4HMDA 4RL3A 5JUVA 4MB1A 4ATLA 4TVCA 4GQRA 3T0DA 3BAXA 1E0WA 1WKYA 1OINA 2ZUMA 1CXKA 3AIUA 1V3JA 1GQKA 1Q6FA 1J11A 2FH8A 4PMQA 4AY1A 1SMAA 2YBTA 1KR0A 1MFUA 4AC1X 4UQ9A 4BQ3A 4WF7A 3SUUA 2BS9A 3IJ7A 1X6LA 3VGGA 1CGWA 2Y8KA 3D3AA 4CKQA 2J7CA 2UY5A 4EE9A 1W1VA 4B9YA 1V0KA 3BLKA 3BCDA 3GH5A 3VNZA 1MQPA 3MU7A 3W28A 3U57A 1JFXA 5HNNA 3WF3A 5CPQA 3N04A 5F7UA 3VDBA 3WUBA 2ZE0A 1E3XA 4D1JA 1ZS2A 2GFTA 1ZB5A 3VD5A 4P8WA 5E6YA 1E56A 1C92A 2D2OA 1HJWA 3FAXA 2XVPA 1IZKA 1UR2A 5DEZA 2BFGA 3ARYA 1H5VA 3BAKA 2DSUA 3OBAA 4NRRA 3TA9A 5BXPA 1U33A 4MDPA 4U5IA 3N17A 3B9AA 4W8AA 2G3NA 2EXOA 1CGTA 4H04A 3CUJA 3M6DA 1E1FA 2WZEA 2VL4A 2VO5A 2W5FA 4PMUA 4YHGA 2OYKA 3APGA 2RGMA 1UKTA 3WUFA 2WC3A 1FOBA 1G0CA 2EO7A 4U5KA 5CGTA 1JDCA 3RM4A 2E9BA 3KZSA 4EANA 2E3ZA 5A8MA 3CBWA 5BRQA 5A6JA 3WMBA 2XIBA 1E6SM 1NP2A 4HA4A 1VF8A 3RM9A 3CZLA 4PMYA 3W26A 3PZNA 1UG6A 2EBNA 3UESA 4A4AA 4BQ2A 4FF5A 3B9DA 2WMIB 3GDBA 1JL8A 3HMCA 2ZXBA 4M1RA 3L2MA 3IJ8A 3KL0A 3WNLA 2XSAA 4D6CA 4WLCA 3II1A 5BYWA 4HOWA 5HOSA 1NOFA 3ZJ6A 2XJ7A 1YHTA 1BVNP 4L4OA 5E6ZA 4DWSD 4L4PA 1UZ1A 3VKKA 1VEOA 1JXJA 4XV0A 2VR5A 4M82A 2WBGA 2FH6A 1NWUA 2E8YA 2W92A 4UOZA 3ARUA 3EMCA 3BH4A 4IPLA 4J3SA 2UY2A 2V3EA 1M03A 2V3GA 4HA3A 2PF0A 2XFYA 4FK9A 4H2CA 4AZ6A 1RP9A 1FHLA 3UCQA 3TTQA 2WHMA 2DEPA 1CBGA 4UFJA 2X05A 1D2KA 4XX6A 2CNCA 1EHNA 1EQCA 2VJXA 4CCDA 4ZXLA 1GQJA 3AIVA 2FHCA 1ISWA 4CCCA 1R86A 3VGHA 1BGGA 1Q6CA 2WCGA 2YA2A 4D6HA 4NRSA 3ALFA 1G9HA 3MUIA 4GO9A 4J3XA 2EPLX 1JD7A 3VUPA 2BHUA 3FXYA 2CBJA 4X0NA 2A3CA 1C8YA 2Q8XA 2CBUA 4WKAA 3WBAA 5EBAA 2WHKA 5ECUA 4WIWA 3OGRA 2J7DA 3L4YA 1J18A 4AIOA 3L4ZA 1GOIA 1R7OA 3OA5A 3ARSA 5FKYA 4UFHA 4FMVA 3N12A 2W61A 1XD1A 3L4XA 2PBOA 2XM2A 3AS3A 1UR8A 4MDOA 1UD3A 1CGUA 2VX4A 3VIIA 4TTUA 4GI9A 2VZUA 2YLAA 4M29A 3VGDA 3UEQA 2JIEA 1G1YA 3DYPA 2GJRA 2G3JA 4DWSC 1UD4A 4JFWA 4S3KA 2JEQA 3T09A 2Z1KA 1ISXA 1LWHA 3CHFA 1XCWA 3L4TA 2WMHA 3IAQA 1F4HA 3A6OA 4GZIA 4QDMA 5IFTA 1US3A 4TXEA 2CESA 1XV8A 1DHKA 3EYPA 3KE0A 3W27A 1ISYA 1ZBCA 3SUVA 5BXSA 1V6VA 1ISZA 2WC7A 1W1YA 1GORA 1E6ZA 1KR1A 3VVGA 1QHOA 2DIEA 4MADA 1GVIA 5I6SA 4GPNA 3T2PA 4AIEA 5A8QA 5CLWA 3J7HA 5FD0A 1G5AA 2A3HA 4J3TA 3RIKA 1BAGA 2XVKA 1DTUA 2PWHA 1KXVA 4LX4A 1VB9A 1R87A 2ZOXA 5A1AA 4OZOA 2UY3A 1US2A 5AC5A 1UWQA 3OZPA 1W9XA 4B15A 4AD4A 4PEEA 2E9MA 3PZGA 1HKMA 4PMZA 1PBGA 1WDSA 3SCSA 3WFLA 3K4DA 1E55A 5I3DA 4AZ7A 1J0KA 4E4PA 3EDFA 1BHGA 4CUCA 4PUEA 1PX8A 5D9NA 3GZAA 4KWUA 1AVAA 5KZ6A 2W4XA 4ZE5A 3MMUA 1JGIA 2GDUA 3TTSA 2BV9A 1LL7A 1GZJA 5A6AA 3LPPA 3AMDA 4RE3A 3AHVA 5M17A 3W25A 1MW2A 2YDSA 2TAAA 4YPJA 1IV8A 4WKHA 4N42A 3L4WA 5AYIA 3F5LA 4GKLA 3GM8A 3BAJA 1B2YA 4W87A 1JFHA 5EFFA 1Q6GA 3QHOA 1R8LA 1AQMA 4CD6A 1TR1A 1C7SA 1XCXA 1JZ8A 3W0KA 4XB3A 5C8BB 1DWHM 3A3HA 4M80A 2J7HA 2YDRA 2VRJA 4JKKA 3RO8A 1RP8A 1C91A 3PZQA 4P7LA 2O9OA 4OBSA 3VTRA 1W9PA 1HL8A 3SUWA 8CGTA 2CHNA 2DSZA 2YA0A 1HXJA 2PC8A 4W5ZA 3VGEA 3BC9A 1V6XA 4ATDA 5BXTA 3WF0A 1WP6A 1E5JA 1W3HA 3A4XA 3AHZA
chains in the Genus database with same CATH superfamily
3WBYA 4MSSA 1QXLA 3VDAA 5T91A 1M3UA 2CLFA 3QPEA 2O4MA 4HSNA 1VRXA 4R5EA 4JY9A 2WSQA 2X7WA 3FJ6A 2J9YA 2QAFA 3ECQA 3MUZ1 4LY4A 4L3NA 4O17A 3G1RA 3O16A 5FJTA 3V3WA 4L9XA 3ZIZA 1OADA 5TD4A 2ZRXA 4TO8A 4IFRA 3GXMA 1QK2A 1W9UA 1WE5A 3W4RA 4IL0A 4IMGA 3N4FA 3A9BA 3DHUA 2CFFA 3CUIA 3CV1A 3VX1A 3HO8A 3S1UA 2GVYA 1PVNA 3AU6A 3C2EA 4MY1A 4Q8PA 3CTTA 4PL1A 5E5CA 4Y7EA 2E6FA 2DT3A 4TUFA 3PS7A 3IARA 3OLIA 5BXRA 2PI6A 2ANUA 1M01A 1KBKA 1RBOB 2W27A 1OABA 4U3CA 1J8VA 1JR1A 2W63A 4J35A 4Q3MA 4LAZA 1EKOA 2ZIDA 3ELFA 4OU1A 4JZ5A 2WO5A 4PMDA 2F8QA 1XISA 2FQIA 1MDLA 4LNYA 3FFSA 2DSWA 4O1AA 3KEHA 3VOIA 1VAHA 4AIBA 4ACZA 4KH2A 1RD5A 3UI5A 1GW1A 1GJPA 4HP5A 3SN0A 1W6TA 1R6WA 2VFFA 3B9OA 1I75A 3K8MA 5FCZA 2WVVA 2VGIA 2OLHA 3DFOA 1W3LA 1Q4NX 3KTSA 3EXRA 3CUFA 4XAYA 2BY1A 4QDPA 3WEZA 2FTPA 1GYMA 4C7GA 1OCBA 1C29A 1XYFA 5AOUA 4FOJA 4KFOA 5MHBA 4GQBA 5CBBA 1HF6A 3EPOA 2ETNA 3LYEA 2KE0A 2J7FA 1AMYA 4R9XA 3ZM8A 3KHJA 4KKXA 4ODQA 1FP8A 4GH1A 3VNJA 1HJVA 5GNYA 4QIUA 4BS0A 2BY3A 4B5WA 1BLIA 1CB2A 3ICJA 4G50A 1XHGA 1CECA 2IQTA 2W3ZA 3TKFA 1CI1A 2PTXA 5LGXA 4QCEA 3IGXA 4ZSTA 1QBAA 1XLGA 1VYRA 3MMDA 1LWIA 1MUMA 3CL7A 3I3DA 3TLQA 3ABSA 4OECA 2DH2A 3C2FA 3RGTA 5J8LA 4QX4A 3QN3A 3WUEA 1J0JA 4CQCA 3LV6A 2XGIA 3Q65A 3W7IA 2NXHA 1T7LA 3EKZA 2BOEX 2NQHA 3KWSA 4Z1BA 1L8NA 1OC6A 4Z17A 1YTDA 3WG6A 4MJMA 1NM9A 1VCGA 4HOZA 2OQYA 3ZLHA 3VGFA 5FACA 2E6AA 1TCDA 5HJLA 1KGUA 3O5PA 3GDLA 2PMQA 2R8WA 3WLTA 3GH7A 4F0KA 4X60A 1O12A 4W4QA 4IIGA 3IUHA 4QG8A 5CQ1A 3NQ2A 1J79A 1UWRA 4GWEA 2YZRA 1X6NA 5E09A 4U31A 4IQCA 3GC2A 4MM1A 4PFHA 1JDAA 5T9CE 2BSLA 3R43A 1TIMA 3QY6A 1SSDA 1LP6A 3AIQA 4GIRA 3CHVA 3VGBA 3MCOA 1UD6A 3F7JA 4JHMA 4MOZA 2VP8A 1VHCA 1ZCOA 1E51A 3S0CA 2Z2AA 2J8FA 3RCMA 2PDGA 1EBHA 1KV5A 3UXIA 1D7KA 1IGSA 5REQB 4A29A 4YVXA 3CZGA 4PULA 2WYSA 4HPGA 1OF6A 4JDYA 3D46A 3HQPA 1LRNA 3L0GA 1VHNA 2PDNA 4V28A 1OF8A 4GUJA 4H9UA 3QGVA 3UJSA 5AY7A 3STFA 1Y5VA 5HPOA 1W9BM 3LHUA 3IWPA 2W91A 2ZKMX 4D6GA 4NKCA 1DWIM 2EPKX 4AC7C 1EZWA 2YSWA 4ZO7A 2OELA 2DZUA 4UC5A 3UPWA 2QCMA 2Y5JA 3DFQA 2LJ4A 3GVQA 4FX6M 4ZE4A 4V27A 1RBLA 1D7FA 3NOEA 4O0ZA 2Y7DA 2P0OA 3LEPA 1IZJA 3CGTA 4WY0A 4GZ7A 1XIHA 3R6IA 4C6MA 2GVJA 4EAYA 1E0VA 1P0NA 4QAIA 4MB4A 3CIVA 1AZ1A 1HKWA 3EKLA 4C6JA 3R5EA 2GK1A 4DNMA 4EIVA 1MEIA 3M4HA 1RCOB 2NT1A 3HU7A 4EACA 3G8RA 1KTBA 1POKA 5FEZA 5KZMA 2PLKA 3ANYA 2OSWA 1O1HA 3FW6A 3K1DA 1WYIA 3JZEA 1E6PA 4PMOA 1UW9A 3WD2A 4IIFA 1IEIA 3HURA 2WJEA 2Z2BA 2NSOA 1DIKA 4QLJA 3TCZA 4GLEA 2HDJA 3QF0A 3W83A 1ALDA 1VFOA 4IP4A 3U2EA 1ZRQA 3TV8A 2R6OA 3JS3A 3PTMA 2ZX7A 1W2PA 3GVWA 2DT1A 4JQ1A 3PTQA 3VKCA 3NR0A 3UQIA 3CS2A 3IRSA 4Q8QA 1HT6A 4A05A 3CIXA 2HEJA 3N6JA 1BG4A 1I2NA 3C61A 3KBNA 3A12A 4D8ZA 1UA3A 2BHYA 4CQAA 3VINA 2MNRA 2VGBA 3WF1A 3H4GA 2FPYA 4HOXA 4B4HA 1W8GA 3WL0A 5ABGA 5B80A 3CWNA 4FAPA 4ZA0A 3E74A 1DJQA 4ERGA 2ZUUA 3F1QA 4C6NA 1OQFA 1MW0A 5F2LA 1TSIA 3CZEA 5U4NA 5TF0A 5CPNA 3HPZA 4FIQA 1ZALA 3LI1A 1NQ6A 3EPMA 3W1NA 5CGQA 3I3BA 2NX9A 1DWAM 4KPLA 2FPVA 3RJYA 3V1PA 2QQ6A 2A3LA 4AEFA 3CNYA 1LJYA 1GPWA 1JYVA 1V0LA 3O5IA 1XPGA 4HVXA 1Q63A 2VGGA 3N2OA 1OY0A 2ZZ7A 1BTMA 3RMEA 4KETA 4N0RA 4OE7A 3WLMA 5CXPA 1XS2A 1WZKA 5AB3A 3WMCA 1XLDA 5DIUA 1IR2A 4W84A 4IHCA 3WIJA 3ARWA 5K4ZA 1V6YA 3WD3A 3C0JA 3VIKA 3MKVA 3AROA 4LVBA 3MJMA 2PP3A 3BLIA 3MP4A 1AG1O 4NHVA 1U30A 3SO7A 3MKCA 3VMNA 1G4SA 1H49A 2X42A 5G4HC 4IX2A 1REQB 4U10A 1RA0A 4BFAA 4NF7A 4K8HA 4I9TA 3S2NA 5DELA 3TW6A 4K68A 1A5OC 1ZJHA 5IHSA 4AMCA 3RUBL 3EOLA 1AMKA 3L7RA 5T9BG 2VDHA 2VUNA 4X2RA 3W7RA 5LSMA 2B7PA 3OG3A 3KRUA 5JH2A 1H7WA 3W1MA 1P6CA 3R11A 1QPFA 3LNMA 3HBLA 5G2IA 3TTYA 4BWLC 3RILA 4LJ3A 1BRLA 4MJ4A 5IM51 1M04A 1K7FA 6XIAA 1IGWA 1FWFC 3EB3A 1S39A 3ZJ8A 5AYYA 5AVNA 4FEZA 4RDWA 3WD0A 4GVHA 4P61A 2CBVA 5I5RA 4WEVX 4QJ1A 5T8GA 3PR9A 5FIPA 3THUA 1XYZA 1E0XA 5FF2A 4TTGA 2VWSA 1QPQA 3WY1A 3NYZA 4H8HA 2KFWA 1Q6LA 2HBVA 1UIOA 4O1DA 4BR1A 3M0HA 1LL6A 4L65A 4MNJA 3OHIA 2Y5SA 4DN1A 4IUOA 4UNIA 2VELA 5FJJA 3PM6A 3TTOA 1JVWA 1QPRA 4IUGA 4V1XA 3OO2A 1OM0A 1XIGA 3T08A 5A8GA 4LYKA 1E1CB 4DLFA 2ZQ0A 1ROTA 5DY2A 3DG7A 2F7FA 3O5EA 4Q7IA 2EJ1A 1T40A 1UKPA 2KO7A 3LCXA 3QLLA 5BRPA 2FLIA 2WLZA 2F2HA 4ATWA 3MBDA 1PX3A 4YL2A 3P67A 2OOFA 1JG9A 4C6LA 3KRSA 3LRMA 1XRSA 4AZBA 4RPPA 1KGXA 1IIGA 1LTDA 4LAVA 1F6PA 3TC5A 3NQDA 4UR8A 4DJFC 1EO7A 1U2YA 4CGTA 1PO9A 2PLMA 3GVRA 2AL2B 1QI4A 1A5SA 3CLWA 2PLCA 1HKKA 2PWEA 4D1IA 4RCXA 1GOQA 4KWSA 2VFIA 2DORA 4W5UA 1XGZA 3SADA 3EX4A 1LQ2A 3NFUA 1IXNA 2BVDA 2FVLA 3TZNA 1TZ7A 1P7TA 2WC4A 5LKYA 2RJHA 4QE4A 1E6XM 5D2XA 3VUSA 4AQLA 4H7ZA 5CSUA 2HPMA 1UUQA 1UWIA 2GQ8A 2VM8A 3TR9A 5A6SA 3G0XA 5D05A 3R10A 4M7TA 4LC8A 4H9MA 2VI0A 3W1RA 2JZVA 1LG1A 3CHCA 2PWDA 1VCVA 4CLMA 2ZZ2A 3DFYA 1YNPA 3PTDA 3BARA 3KBWA 3A4JA 3O8AA 4DUXA 3XINA 2ZTJA 4IMCA 1GHRA 3H70A 1UHVA 1H0GA 4E8GA 3W75A 4NIRA 1BF2A 4KRTA 4N9BA 4U2ZA 3P0WA 1V5XA 3NYDA 1Z9AA 1W1PA 4O28A 3QFWA 3T0BA 4N7QA 2YYUA 2DZTA 2HISA 4PMRA 1AODA 3C8NA 3VD4A 3FYPA 1VPYA 4Y9NA 4BI6A 1AD4A 2I17A 2W79A 4RW3A 5HR6A 1JZ5A 1PZ3A 3FLUA 4E8CA 3IV3A 2K8IA 1YXCA 4FLQA 3UR5A 3H2CA 2Y1HA 4MG4A 3LSBA 3VE9A 1WDDA 4GGQA 6ALDA 5EMMA 2CLPA 1NU5A 4WGXA 3NGJA 4I5UA 1QPLA 4JFSA 5HQMA 3DEQA 4YYFA 4IPJA 4ZO8A 2QPUA 3IKGA 1XX1A 1TV3A 3TJIA 2CLMA 1QU4A 1KLYA 1WAWA 1HW6A 1OFOA 4F9DA 2OR2A 3EBVA 4LCSA 3W07A 1SO6A 4TX6A 1TPDA 1JZ2A 2FKPA 2AOSA 1DXIA 2IPWA 2Y7EA 1D7IA 1CEOA 2G37A 3WMSA 1NMWA 2V5KA 1LF1A 3POHA 3DFTA 3WQ8A 2YDQA 3TQKA 4ZZ9A 1NFBA 4DRSA 1VJIA 3SW6A 1DIEA 4P7OA 1AJ0A 3TX9A 4HCLA 1Q2RA 4H6QA 2WM0A 4JFIA 3OPSA 4F0SA 1JXKA 2VENA 3W02A 3AS2A 2ZC1A 4DJEC 1CNVA 1EZ2A 1KCLA 2B31A 1V3IA 1OFDA 2W66A 4XAFA 2J25A 5DFAA 1NSGA 2HK1A 4NYYA 4YTRA 2B81A 1QFEA 3COTA 3BOFA 3KXQA 1ADDA 1DQUA 4MGGA 1KTCA 4AYSA 4R7WA 5M03A 4PCSA 3IHZA 2V5CA 3NQCA 3FVDA 1GVYA 1DE5A 1A0DA 4UTWC 5C9UA 4ZFMA 1IEVA 4B5XA 4HNVA 2INZA 2ISDA 1RUSA 3E38A 4Y9OA 1JAKA 4AMAA 3S9ZA 4LS2A 3BMVA 3B05A 3L23A 3QZAA 3S1VA 3BPWA 4R7JA 1CW2A 1ZL1A 3SM0A 1GOOA 3S5NA 1W5OA 3GK0A 4H00A 1A47A 2FZDA 2X09A 4R34A 1LL4A 5DO2A 2ZX8A 3UWZA 2CHRA 4Z0JA 2HTMA 2VC7A 1OK4A 1KXTA 4PMXA 4WDXA 4EKJA 4K8EA 1GVQA 4RPQA 5LA1A 2C0HA 4GZJA 2D2GA 3IVSA 1H41A 2UZ5A 1BFNA 1JPMA 3PN8A 3RG6A 3BMXA 2WZMA 3TCSA 3VNKA 1BSLA 2I7GA 4EF9A 2CZDA 1BWVA 3W1TA 3CWOX 2D73A 1TUXA 1BTCA 1SQ7A 3R0DA 4AZCB 3UI6A 2OSXA 3ZSTA 1V4YA 5H91A 4DF0A 1XLHA 2XN0A 4E6MA 5RUBA 2WM1A 1AL8A 1C8QA 3NL5A 4IISA 5REQA 1YEYA 2ALRA 3HIJA 1PZ2A 3U5UA 1XLIA 4Y96A 4PCNA 4HPJA 5DMNA 3IV8A 1A4MA 4XK2A 5CZSA 1HVQA 1V93A 2LKNA 3O5RA 3WK1A 3WELA 3BAWA 4INFA 3NQEA 1OFAA 4OHQA 1QUMA 3GXIA 1DJWA 3P74A 3ZVHA 5GNXA 4DYEA 1HGWA 1NWRA 3NM1A 7PTDA 3WDPP 1UC4A 3TWAA 3CO8A 4KCWA 4AD1A 4JTJA 1PHQA 4XBSA 3P93A 1MEWA 2ACQA 3R79A 4GUGA 3OZOA 3MB9A 2C0AA 2O7QA 1WDWA 4F9JA 3PJUA 2WHLA 2QF8A 4B3ZA 1NARA 3DFHA 1GHSA 3N6HA 2QDGA 5TQLA 2WCAA 4F8XA 5J5DA 2DIKA 5A5WA 2MANA 1G01A 4FOKA 1PL9A 3MUY1 3S6DA 2OFNA 2A3EA 1QK0A 4F3HA 4XUGA 4L1WA 3VM7A 4QT2A 3I6TA 3QY8A 3CHEA 4NNRA 1UOZA 1YDNA 4Q8VA 1IT8A 3M5XA 3KAGA 3ZZ1A 1Y7VA 1HJQA 3WO8A 3UZ5A 3CQIA 4R7OA 4LAKA 1WAUA 4NJGA 5HUAA 1J6OA 1YXYA 4JTFA 3WLRA 4WSHA 2XGZA 4ODLA 4W88A 4JFLA 5A6LA 1NVMA 1I0BA 2CLIA 5KITA 4F79A 1RJRA 4B2DA 3TIMA 4CQ9A 3CM4A 1VGAA 2DPEA 1TMLA 1TJ1A 3LPOA 1ZENA 5BWAA 7TAAA 4H83A 4KT2A 2QCEA 1KFJA 4JYEA 3KP1A 1D7HA 4O1FA 2BLEA 3G6LA 1UD5A 3WLIA 2CXEA 4O13A 3EDJA 3SGUA 3NTYA 2QIIA 3FJLA 3LERA 1X98A 3NURA 4JX4A 1P1XA 2V38A 5AC7A 1XLKA 4F2UA 9XIAA 1UH4A 3AXMA 1UMLA 2OYLA 1POJA 5C2XA 2AAAA 4S3GA 2PDCA 4KEVA 2XH4A 3FJNA 4GYJA 4AUBA 4J4OA 2J27A 3I7RA 2GUBA 3BLLA 2B5UB 4QLKA 2V2DA 4RZ6A 3RRAA 1C9HA 3NA8A 1K70A 3S6OA 2VDGA 2ZQSA 3CLMA 4YTSA 5LXEA 4CEUC 2QT3A 2E1WA 4AHPA 1OFRA 4KWOA 1MDRA 3BCFA 1FY6A 1CXEA 1KNWA 3OP2A 5ABTA 3MWCA 3EAUA 3WDQA 1E0TA 1PAMA 4HHLA 2OX1A 1Q8AA 1PE1A 4ZQMA 2P10A 2J6VA 1X1NA 1BKHA 3UBPC 3DYMA 1WUEA 4XVEA 4ZQRA 5ABFB 3C2YA 1G6CA 2QCFA 3T9PA 3S5SA 1ESWA 4EK7A 5CLTA 3ZT6A 4QBXA 4LEFA 4PTVA 2RUDA 2AGKA 1GGOA 1GQIA 3AJ7A 4OBRA 1XBXA 3ARRA 2VNCA 1QOQA 3AYVA 2A3BA 1DEDA 2EKGA 1P43A 1TA3A 3KW3A 3FEQA 4AD0A 2PDXA 1MW3A 2F6KA 1YYAA 2EPMX 5I79A 1CIUA 3DAQA 2Z28A 5IHRA 2QZRA 5EYWA 3BLOA 3WQEA 2Y5EA 1XKYA 5M5DA 4EP8C 1EA9C 4XKYA 1K9DA 4PGLA 1BPLB 1XCFA 1AQHA 2WMJA 4OUEA 2HNHA 2TYSA 4GXMA 2BGQA 1XSJA 1N82A 4UTHA 4HCDA 1JCJA 4ZO6A 3M0JA 3R13A 3O0KA 5CGMA 2KR7A 4HHHA 2VEMA 4PUDA 1QNSA 2BXYA 2D3NA 2V5JA 2WZTA 4NAFA 2Q3RA 1P5BA 4BQ4A 1KWGA 3S46A 2D1ZA 3AALA 2VMFA 1N2VA 4M8UA 1FKBA 4IPIA 3OJGA 4LUSB 1XLAA 2XP7A 5KEZA 5C9ZA 2HE8A 1JCLA 5GPGA 3T8LA 4ITZA 4A3RA 1GVEA 5DT7A 1U5HA 4IGSA 4G7FA 4GE8A 2PPNA 5BOFA 4DUVA 4FN2A 4BY3A 3E2VA 3PNUA 3IJDA 1HKVA 2X1SA 1LOQA 6CGTA 1EJWC 4KEUA 2XSBA 3ZFHA 2A5HA 4O52A 1SSGA 4WY0B 1EIBA 2QLYA 3O1NA 3CUHA 4RNIA 3DECA 5D9MA 3ITLA 1WDQA 4K7YA 1KRAC 4IJCA 3AJXA 4AISA 5LZLA 3KAIA 3FNDA 3V0TA 1A3XA 1RY8A 1JZ4A 4JTTA 4JIPA 2D23A 2J9XA 2XINA 1B90A 1VR6A 3CXOA 1K1DA 1XSIA 3DIPA 1ZUAX 1X6UA 4FX7A 3U4FA 4AU0A 1XLFA 3A4AA 3O5MA 4UZUA 3C6CA 4I8YA 1QW8A 1ONRA 3U6WA 2AL1A 3H2FA 3NPUA 3MC5A 4IWWA 1NF0A 3TW7A 2X1IA 4GX9A 1UD2A 1HNYA 4HMDA 5JUVA 3NEHA 4GQRA 5HWCA 3V5FA 1E0WA 1DJGA 3IK8A 1PV8A 4K7VA 2OTDA 3GXTA 3LD5A 2ZC8A 3PRDA 2FH8A 2DV0A 4ORIA 1FKJA 4AC1X 1UC5A 4BQ3A 4Q32A 3EWYA 4NZ1A 1X6LA 4JX5A 3URAA 2Y8KA 5HULA 3MVIA 3GNDA 3PUDA 4NJHA 1V0KA 4HD5A 3HOJA 2TRSA 1Z42A 4ICMA 3W28A 1JFXA 2I16A 3VZXA 4Y8EA 3DKJA 2ZE0A 1E3XA 4YVPA 4D1JA 1DV7A 1N7KA 2PTDA 3M0MA 5E6YA 4WDWA 2GGHA 4QQUA 4ERIA 4IMAA 3LLDA 3QMSA 1KM1A 2LGOA 3OBAA 3TA9A 3THAA 4JTCA 2RKXA 3N17A 3RF9A 2ZRYA 3B9AA 1WOBA 3TQVA 3CUJA 4C6BA 1PSCA 2WZEA 2VO5A 1VD6A 3H54A 4YHGA 1YBQB 3MQTA 1UKTA 1L6FA 3FIGA 2I5QA 5CGTA 1A50A 3RM4A 1YW5A 1SZGA 4JXCA 3KZSA 4S1FA 3BMBA 5A8MA 2OKTA 1KO0A 3NM3A 1JUKA 4PMYA 4U86A 2ZVIA 2HCVA 4BQ2A 3W1UA 4ZOEA 1ONXA 2V30A 1ZCCA 2WMIB 1HTIA 1H7PA 3GDBA 2V2CA 2ADAA 3CUZA 3UGVA 2PGFA 3XISA 4C6OA 2VXNA 4UTIA 2CU0A 4DJED 2XSAA 3W7JA 5BYWA 1FTXA 1ZZMA 5K4XA 3UY8A 3GU9A 4S3BA 4NVTA 4U28A 1JXJA 1CB7B 3MJYA 3F4DA 2PAJA 4QSFA 4ICNA 1B6CA 4J3SA 2PF0A 4AZ6A 2NQ9A 1AD1A 2YBVA 1XFBA 2X05A 1D2KA 4A3UA 1MMFA 4G7EA 4BK9A 1ISWA 1Q65A 5LNWA 3T78A 4E2DA 3A3WA 1O1ZA 3GWQA 2YA2A 4ZFCA 4GO9A 2EPLX 3VUPA 5F1VA 1QT1A 4DXXA 3UJ2A 2GGEA 4WKAA 3GKFA 4OUIA 2NLYA 3L0KA 1Z6KA 5ECUA 4WIWA 3HG4A 1EB3A 2XH2A 3IJLA 3NGFA 3OGRA 3L4YA 1J18A 4MPQA 4AIOA 3L4ZA 1TV2A 1FDZA 1R7OA 3ARSA 4UFHA 4FMVA 3N12A 2W61A 3L4XA 4DIPA 2XM2A 1OYBA 4W9OA 3AS3A 3WLPA 2A85A 1CGUA 2ZR4A 2Z6JA 4HN4A 3VIIA 4AFYA 2YPIA 2OLSA 1J96A 3QM3A 3VE7A 3VGDA 1XYBA 1LBLA 4YWSA 4S3KA 3T09A 2Z1KA 3NXFA 2G5WA 3KLKA 1PXGA 4GVGA 2ZQUA 1U79A 1XYCA 1H7RA 3IAQA 2NUXA 2NX1A 4NX5A 5LIUX 1X7FA 2CESA 2XP4A 2R1LA 3MDWA 1I8JA 3WFAA 2VOMA 2Q8ZA 1GORA 3WCZA 3VVGA 4L1GA 1QHOA 1NDYA 3KOZA 1EBGA 3GC5A 1S2WA 4C65A 3T2PA 5A8QA 3H26A 3LSCA 3J7HA 5FD0A 3FDGA 5CPLA 1U83A 1BAGA 4HBOA 1AZ2A 5ENLA 3NZRA 3P7YA 1KXVA 1EA0A 4A22A 4OZOA 2QPXA 1XRTA 2UY3A 3ZXWA 1N8WA 2OOGA 5AC5A 1OFQA 2N87A 1UWQA 4ZB0A 1Z89A 5AC6A 3W7KA 3TSMA 1EC7A 1HKMA 3IKDA 3WFLA 3K4DA 1E55A 2ALDA 1RA5A 4MWAB 4E4PA 4DYJA 1XYMA 4MKVA 4PB4A 1XIFA 3NQ8A 3W76A 2W0UA 4Q4SA 3N25A 1AVAA 5KZ6A 2IF4A 1FUYA 4B5VA 3PNZA 3I65A 1K7EA 3HG2A 4BI7A 3AMDA 4M5PA 4IMFA 1VLWA 1MW2A 1HXVA 4IXXA 1Y0EA 4N42A 2ZE3A 2RH9A 1X39A 3F5LA 3LY0A 3NQ7A 3U8GA 3GM8A 1B2YA 3SSJA 1JFHA 4XG1A 1U1UA 3QHOA 3EIPA 3GS6A 1AQMA 3O5QA 1RJQA 4NNAA 1IWAA 1XCXA 1B54A 1W5PA 1JZ8A 1UZHA 2FB2A 2JK2A 4DJDC 2F2DA 1UPPA 1BXNA 4MGVA 4LV9A 4QS6A 3SGZA 4EWJA 3DI1A 1DKWA 2PCQA 2VRJA 3RO8A 1RP8A 3NPWA 1CX9A 3PZQA 1TO3A 2O9OA 4GK8A 5JU6A 5C0QA 4JTRA 1F76A 1YADA 3GHRA 2PC8A 4WR3A 1V6XA 3CT2A 5EL1A 1E5JA 3KABA 3HA1A 2C13A 1QI2A 3BAIA 4LEQA 3PFRA 3U4AA 1YLVA 1GK8A 2WVTA 3LCLA 2OFJA 1Q13A 1ODZA 1YTEA 4QLLA 3LHVA 1BSIA 1SGJA 4DRJA 2EPHA 4PB5A 2OT0A 3AISA 1K6AA 3M0YA 3N34A 1NWSA 2BWGA 4GY0A 4O50A 1XW8A 1XD0A 3AYSA 1TPB1 1FFQA 2JKPA 3G1HA 3SUTA 1UD8A 4ZVJA 5F4SA 3HV8A 3GXDA 4Z1YA 3TJLA 4JTLA 1CXLA 3KL5A 1Z48A 2HV5A 3SQSA 3MHUA 3PPGA 4LXFA 2DUAA 4FNTA 5JVLA 2PDBA 4UOJA 2G4FA 2OLAA 1ZCNA 4IM4A 4AX7A 4LY8A 3ARTA 3E0FA 1DWFM 2I1OA 5EA9A 1N8FA 2R1PA 1R7AA 3OW1A 4M51A 3K4WA 3TVAA 4PUMA 4BI5A 1NDWA 1K8CA 3FAWA 1PDZA 1TRDA 1W3IA 4MWAD 3GLCA 1YKWA 4GIYA 1XIDA 3GNXA 1J5SA 1KFWA 3SDOA 2ZQVA 1LUCB 3PZMA 1RCQA 1PZ0A 2DH3A 4BEUA 1SR0A 1UKSA 4GGBA 2O7SA 4HN8A 1PKMA 1R30A 5I0DA 4CNSA 1F6YA 4HTBA 2PLJA 5AVHA 1SFJA 1MI3A 3CYJA 4ZO9A 1UR1A 1LDCA 3LHWA 3O2LA 4TX8A 1E4IA 4K2SA 2HQAA 3GTXA 4HBEA 4M6PA 2J75A 3AS0A 3NJ3A 3JRKA 1JRBA 4OQVA 2RQSA 3QQ1A 1HIZA 3VIMA 4DRPA 4FLRA 1AW2A 3H7RA 2MLZA 4HHPA 3A24A 4CD5A 2XZ9A 3S9IA 1AH3A 2XHYA 2NQZA 5D37A 1XG4A 3QMRA 2PSNA 4PRWA 3MUXA 1E71M 3LCHA 1OEPA 4C6IA 3S1WA 3ZR5A 1KFEA 1GVOA 2ISSA 2AAMA 1Q6EA 3ZVHB 3G18A 3P0XA 2WCSA 4REQB 5FEWA 5D30A 3GHSA 3HQOA 4JCMA 4I7UA 5AHEA 3UYIA 1DJYA 2WANA 3WUGA 2XVGA 3UQNA 1E3ZA 4DZAA 1DL3A 2QHAA 3GIYA 4UB9A 1TVPA 4C6KA 2VQTA 4L64A 5I3JA 4IIEA 4YNGA 3VIOA 3D3FA 1F8IA 1SZRA 3PWGA 1XH1A 1F61A 5C6MA 3KVLA 1XR2A 3WH6A 1FWAC 2EQDA 3AMLA 4F4RA 2H9AA 1M65A 2FDSA 4NJIA 3QR3A 3IIOA 4LYRA 4N6EA 1EFZA 3AXXA 4ACYA 5I24A 1S2VA 4DELA 4DZ2A 4CD8A 2BY0A 5FF4A 2JGYA 1OT2A 3NO1A 2BG5A 2XN2A 3BDKA 3BW3A 2G3IA 4FR1A 3U9IA 3S83A 1J4HA 2WXDM 2J24A 3MWAA 3W01A 3LUTA 4P8XA 1W5NA 2M08A 2ASHA 1EJXC 2VEPA 3S5YA 4JIRA 1TX0A 3M6YA 3DI0A 3G24A 4JOMA 5D09A 3LXAA 2H3DA 4DJDA 4FAMA 3FSUA 2J66A 3NG3A 4XAPA 1UQZA 5DXYA 4EXBA 2FB3A 4IQEA 4DBEA 3VPLA 3T4CA 2Z29A 3VIJA 2HVMA 3CAWA 3PAJA 2FHBA 4MAZA 5LA0A 4ZL1A 3ARQA 2I56A 3E0WA 4HQVA 4A35A 1ZGDA 1V0MA 2I9UA 3B03A 2JF7A 1DJXA 2CKRA 1AA1B 4L7ZA 3SB0A 4V15A 5HATA 3WQGA 3BCJA 4PR4A 2GOUA 4R33A 1QJWA 5A8NA 3QPZA 1TMQA 3ABRA 1QHPA 2ZZ6A 5I02A 2Z24A 3JXVA 1ZTVA 4JQ4A 1IT7A 4UNLA 1ISVA 1J4IA 4CU6A 1GYNA 4JN6A 5JBDA 3SCNA 1YMYA 2WZHA 4PBFA 4LW7A 3AUOA 2XUCA 4FHAA 1P6BA 2YCJA 1TVLA 5E9AA 3VIGA 4DXKA 4A3HA 4J27A 4LT9A 3TJ4A 3N15A 5H8PA 1M1BA 1EXBA 3W1QA 3P84A 1CT5A 4GACA 2Q02A 1PS9A 3AHXA 3LPFA 2OWWA 2WSKA 3CQ0A 5AKQA 4ZOAA 4MSPA 1JDEA 2QV4A 3F2BA 4IQJA 4DZHA 3THQA 1B1YA 1AW5A 2QPSA 3PUGA 3DESA 5B7YA 3JW7A 1OB0A 1J4RA 3DC8A 2FHFA 3WQ4A 4KGLA 3RPMA 4TQTA 1R9YA 3M5ZA 3EDEA 1VFFA 3W6MA 4AX6A 3A5FA 4NAEB 3W7EA 4W86A 1UUOA 3RPTA 3MS8A 2E6YA 2YXXA 4C6EA 3F4CA 3WFZA 4OV9A 1XIEA 4C60A 2J6XA 1Q66A 4GG9A 3MPGA 1K8YA 4RW5A 1VC4A 1RQEA 4JL1A 2R94A 3EA1A 4XO6A 2QUVA 4GUFA 2VWTA 1OX4B 3TYUA 5I03A 1E9ZB 1EQ3A 1TPUA 3CV2A 2RUSA 5AYXA 4CQBA 3W7NA 4AW7A 3IIXA 2DY3A 4UFIA 3W72A 4OVXA 4D71A 4MYXA 3TMLA 3I68A 4M19A 1EJRC 1UPMB 2PZ0A 3UWWA 5HJYA 5I77A 4IPPA 3KACA 2FGLA 4E8DA 1ICSA 4K6AA 1M7XA 3SI9A 1KKRA 5A94A 4GINA 1M53A 1PWMA 2RDUA 3GNPA 3LBCA 2OZ8A 3MA8A 4ZPTR 1XC6A 3R7MA 3W53A 1C93A 4QITA 3D47A 3L2LA 4YIWA 2GJXA 2ZZ1A 1FWNA 3PUEA 1XINA 3K8LA 4IMDA 4N9DA 3QYSA 4X9YA 3W7CA 2CXGA 1VFTA 3RFWA 3NCOA 4ADTA 2P53A 3OVGA 5GJPA 2D22A 1ZHAA 1J01A 1RH9A 1UWUA 4ODMA 3NQAA 2DSVA 4XBJA 2WNNA 4HHMA 3PC0A 5DBUA 1KFCA 3VD9A 2H8XA 3R1ZA 2A1YA 3TFXA 4C5YA 2Q01A 2VR4A 3PBGA 1JQXA 3UETA 1YQ2A 1T0OA 3R0KA 3SRKA 4LCQA 4OBTA 1K3UA 5IDZA 5MKGA 1L0PA 2Y85A 2JIWA 4P7RA 3CB8A 3B0XA 2F61A 1M5WA 1TE6A 2XVLA 1CZ1A 2Q6ZA 2YYTA 2WKGA 5HMDA 5CZKA 5PTDA 3T1GA 3WD4A 4Z1CA 1L9WA 3T81A 4L4LA 3K13A 3MY9A 3SCOA 3EX1A 4CCEA 3W7GA 2Z2UA 4L56A 2RURA 3BG3A 1A3HA 1FH9A 4GUIA 2QJGA 1F74A 1WBHA 3R8HA 2VFEA 2IPFA 5FL0A 3OOBA 2MF9A 2E40A 1WB0A 3WEOA 1ZNNA 3KAOA 3I3EA 3CQJA 5DMYA 1UOKA 3RMJA 1UBPC 4IGMA 3GU1A 5HDRA 8RUCA 3GHUA 4D8LA 2YCEA 4GCAA 1VH7A 2Y7FA 3ZYZA 3PSWA 3RJXA 2CBIA 3VIPA 3EZ4A 3LNPA 4WRHA 4HSHA 1DXFA 3KZPA 5CJMA 3W2NA 3KWXA 4Y9MA 4PFMA 4D6EA 2A6NA 3LCWA 3A64A 3QEZA 3DFNA 4WSJA 1UR4A 3CASA 3KTXA 2POZA 3LCGA 3VIFA 3WSUA 4GISA 2ZX6A 3NSNA 3W9ZA 1DJNA 1UUMA 5KINA 3V16A 2H8ZA 5CAKA 4HJWA 3H2AA 4US5A 1KTNA 2WPGA 3DHFA 1Y5WA 3H53A 4S2CA 1JRCA 5ECVA 1W9DM 4LSBA 1SR9A 3MUAA 2QIWA 3MKKA 6PTDA 3IIVA 3UG5A 1GT8A 5DANA 4NP7A 1MQQA 2C1HA 3CGNA 5KETA 3NDZA 2REQA 4RR4A 3B0VC 5D2WA 4H9YA 3UERA 1EOMA 2TODA 3DHPA 4EPDC 4OKDA 1TMHA 3TLLA 3EX3A 3SEPA 3N9KA 3ARPA 3V36A 3BLPX 4NNBA 4CVWA 4GYFA 1QAPA 3EWZA 4YCPA 4G1NA 1XI3A 5H8MA 2DZWA 3S6TA 4OGZA 3WH8A 1VFHA 3A9IA 3AZTA 1WZLA 1MZRA 4EXQA 1UROA 5FEPA 3HTWA 3Q2DA 3LOTA 4QAWA 2NZLA 2VZTA 2V5DA 3SIMA 4FP1A 4IIHA 2PWGA 2CLKA 1YDYA 2PDLA 3O6AA 1TZZA 3AIRA 3PUOA 3QW4B 5I7GA 3NUKA 4PSRA 2INFA 3FYYA 1MUWA 1QW9A 3GVVA 3WF4A 3E1F1 3BUVA 1BYCA 1Z69A 2X8RA 3N4AA 3G1SA 5AHMA 1S5TA 3M0XA 3VOCA 4HZ6A 2EAWA 4DH0A 1WPCA 3W2JA 4HBKA 2VR2A 1W32A 2Z1VA 1IZCA 3W85A 1FKFA 4UTMA 4ODPA 1FWDC 4RK8A 1XQLA 2J79A 4O1EA 2PU1A 1GKRA 4B90A 4AD2A 3AC0A 4XZWA 4O10A 3WQWA 4KCTA 3FA5A 1MRAA 1J0ZA 2PA6A 4R88A 2KAUC 3G1YA 2B4GA 5E0KA 2G4JA 4GZEA 1GPFA 4DRNA 1FVPA 4UWMA 2NW0A 3AICA 4JX6A 4JFJA 3L9CA 3FJ4A 1H7NA 1PYMA 5AC8A 2DSKA 3K8KA 3M5VA 2C7FA 3QOKA 5CPSA 2PEVA 3DCPA 4JTQA 2WMGA 3PBVA 1KFBA 2WB5A 4PH6A 3WLHA 1KGWA 1X1OA 3UZZA 1W54A 3TDFA 4DAIA 3S9YA 5A95A 3IUDA 3MCMA 1OIMA 1EEPA 2PGRA 4Q4RA 3LENA 1S2UA 5F2GA 1FJDA 2JKEA 2QGYA 2RAGA 2CC0A 4HARA 4Y6GA 3BJFA 3QHNA 3RU6A 4Y9PA 1RZMA 4AZ5A 2B0MA 5TBOA 3CV6A 3PBMA 3IACA 1XIIA 1VYPX 4QDWA 2IKIA 3VMPA 3DBPA 5HQLA 4O0KA 3THDA 1IWPA 2EGZA 3B4UA 4UZSA 3QVQA 4DVOA 2E7FA 1AJ2A 2VD8A 1HFBA 3SN1A 1IXPA 3MBFA 4FF7A 5I78A 2Y63A 2PDIA 5FOOA 3TC7A 3KVJA 4PN2A 2FVKA 1DJZA 1F5ZA 3O9NA 3OU8A 3P61A 1K02A 3K46A 4Q22A 3EWWA 4EXAA 1K8ZA 4NZ4A 4R53A 5F2MA 2Z7GA 1M9HA 4M3PA 1EYEA 2ESCA 5BOEA 2P8CA 3AYTA 1BVZA 4XAKA 1QWKA 3NZ1A 4BF8A 4B5NA 1FRBA 2ZQTA 3C3NA 3W1XA 3WJZA 3KTCA 1E15A 1RQBA 4HK7A 3HM7A 2PODA 3PJTA 2QCCA 3UJFA 5XINA 4PUUA 3PP7A 1RD6A 4F48A 2OCZA 1DOSA 1E4NA 2QNEA 3PBUA 2ZRUA 2WHJA 5LIYX 1XUZA 1VKFA 2O9RA 2FMOA 3IJ6A 1TTJA 3FHQA 1TE1A 1US0A 1S38A 4JL2A 3N29A 3UCDA 2L5HA 4O19A 3FEMA 2RDTA 2YBUA 1H60A 2ZZ4A 1HGYA 1W2VA 1AFSA 3AXKA 3M44A 3MDYB 3TNOA 1GWJA 2Y7GA 3EDDA 1MQRA 3AMGA 1K4GA 2VZSA 4I3GA 4ACZB 2F23A 2FFCA 1L6GA 2VQUA 2A21A 1WKEA 3A4WA 4CQDA 3ZQ9A 1FWTA 2PE4A 4HNOA 4JIQA 1XIBA 1T11A 1A4LA 1AW1A 3RLUA 3DU0A 3C56A 3DN5A 1MFVA 3F4VA 4KWWA 2R14A 4WUIA 3WQFA 4QE1A 2NX3A 1XJBA 2QDDA 1D8WA 3F03K 1OG6A 3ENLA 4JAWA 4YTQA 1XH0A 4CD7A 3H4WA 1LG2A 1VCFA 2YKKA 3GUWA 3L4VA 4QJ3B 3T2QA 4NJJA 3GFYA 3M16A 4ORMA 5BXJA 3EA2A 4UTWA 4GRSA 1A3WA 1DPMA 3KOYA 4N4PA 4LVDA 1Y8BA 3V5OA 4PTXA 2ZBTA 2C8NA 3DGBA 1W3KA 4DM1A 1XM3A 4J2PA 1BKFA 1PX4A 2OX4A 3UQAA 5BROA 3ARVA 3WYZA 1DQXA 4Z2HA 1XLLA 4REQA 1GEHA 1K7XA 1JNEA 3CQHA 4DHGA 2IPJA 4YXGA 3UJEA 3JR2A 5MF5A 4NUWA 3TJXA 2YXGA 1U22A 3GBDA 1FWWA 1OFPA 3U5YA 4JNMA 2ACSA 3GNRA 1K6WA 2OMAA 4MYAA 1KBIA 4BF9A 4X22A 3R2GA 4JTAA 2H6RA 4W89A 4XZNX 5G2HA 3FOKA 3P8IA 1SZNA 3BSMA 2ZR5A 4MMWA 2DGAA 4F40A 4KW2A 3DOPA 2DFAA 4LAUA 3G0SA 1XFCA 3GPKA 3Q4DA 2NQLA 3L65A 1JD9A 2PS2A 3W7LA 1X96A 3QXBA 4ILSA 5HUOA 3GYCA 1H11A 1LROA 1QNPA 2JEPA 2GYIA 1W26A 3CQKA 3BLEA 3UYCA 4IT6A 2Y8UA 7ENLA 3E02A 2BY2A 1C7TA 1R3WA 1Z32X 4WQ6A 3B8SA 4HU8A 1W9VA 1LLOA 3WLQA 5C2CA 1ITXA 4H9XA 1MXGA 1DHPA 2PGEA 3NAVA 4IQLA 3EMZA 2KGJA 4PSPA 3FY1A 2XWEA 1RK6A 3W1PA 4PMNA 4G8TA 1T41A 3DG3A 1KKOA 4NXSA 4W8LA 1RAKA 4EOUA 3VCRA 3Q94A 1FA2A 4PEKA 3UI4A 3TK7A 3O15A 2XIIA 1TVNA 2PFHA 4RE2A 4YHEA 1IX5A 3EOUA 2Y61A 3SQMA 3QTPA 2Z1BA 2FYMA 2X1TA 3DG6A 1UASA 4L9ZA 5HUPA 3CC1A 3M0VA 3WQCA 1JCTA 3OQ8A 2IQDA 4D6DA 2CZ5A 4DM2A 1ONEA 2UBPC 2PDYA 1BQGA 3JYMA 2NVCA 2OVLA 1A5BA 1DXEA 1PBKA 3ZWSA 5JIWA 5LNSA 2P1FA 3MSGA 2X0SA 4QGCA 1EO5A 3W2UA 5D38A 4HSOA 4QTGA 4HNTA 1XPYA 4GO8A 3T7VA 2VRKA 4TV5A 4MHBA 4ZCWA 2P50A 1H09A 1K9FA 1WXYA 1JYNA 3NL3A 1FWJC 1QNOA 5FF0A 3ABZA 4ALDA 1WV2A 2WJFA 3S2LA 1CGYA 4A3YA 1GRJA 4DRMA 3CZJA 1VBUA 4DBUA 3BICA 4GOAA 3HPAA 3VM5A 4YTUA 3VNYA 3SRDA 4W9PA 3GZ3A 4NU7A 4F0LA 1LZOA 2ZDSA 1J0IA 1RPKA 1PPIA 2D0FA 1GQNA 1B5TA 2QVNA 3BMWA 3BGGA 1MNZA 1TV8A 3ALGA 1QTWA 4RXGA 5HWMA 2IKJA 1FH7A 3V75A 4EF8A 1TZ9A 1JUEA 5H1WA 2VTFA 4NI3A 3DYOA 4LAXA 2J88A 4B91A 1FKDA 4L1XA 4NG3A 2Y24A 1ODUA 5HKGA 4IG2A 5CPMA 3AIEA 1GJUA 4P5UA 3MANA 2YW3A 1B3OA 3C5QA 3ITTA 4ZMGA 3TAKA 1VLIA 2G95A 2IXUA 5H6HA 3ZOAA 1CWYA 2XPKA 3N18A 2AQWA 3QZ6A 5C7VA 3G1VA 4DPPA 4RL3A 3T0DA 3PAOA 1OINA 3BV7A 3W73A 3AIUA 1FHUA 1L6YA 1GQKA 4AXKA 4U84A 1Q6FA 5EGRA 5AFDA 3QC3A 2E6DA 4DRKA 1VQTA 3UZWA 3UNDA 5DCBA 2Q5AA 3M0IA 3VGGA 3WLSA 1CGWA 2NXIA 1BWKA 4HMNA 4CKQA 4EE9A 2MUCA 4B9YA 3BLKA 4WDUA 3BCDA 3MUCA 3ITCA 3VNZA 2B7OA 2RSEA 5B8IC 4Q4KA 4FIRA 2CLOA 3N04A 5BU9A 3VDBA 1PWLA 3I7SA 3PR2A 5E9XA 3VD5A 4P8WA 3A3XA 3HG5A 1R2TA 3FAXA 1UR2A 5DN1A 1H5VA 2AWGA 1RJPA 2GSEA 4J3ZA 4MDPA 3RX4A 2AGTA 2PDHA 3GQYA 3IIZA 4GD0A 1TPVA 4M0XA 4W8AA 4DIAA 2EXOA 4H04A 5G4WA 4F0MA 4XTDA 1E1FA 2W5FA 4O8RA 4FALA 4E4UA 3O6YX 3APGA 2WC3A 1EIXA 4U5KA 2XPBA 1MUCA 4LV4A 2PTWA 4TR9A 3CBWA 3WMBA 3STGA 1HG3A 1WXJA 4EPBC 1E6SM 3BJTA 3GG8A 4HA4A 3BANA 1VF8A 3CZLA 4KCVA 3W26A 3PZNA 2EBNA 1IXOA 4JNYA 3P8JA 2C16A 1XICA 4FF5A 4Q8OA 4JQ3A 1JL8A 3HMCA 2ZXBA 1XG3A 4M1RA 3S1GA 3KL0A 3FSTA 1LOSA 1JDFA 1H51A 5HOSA 4HOWA 5DCDA 2BGSA 2PPPA 3ZJ6A 2ON3A 4L4OA 1OVDA 4O16A 3WQDA 3RGCA 1UZ1A 2Z1WA 1VEOA 4XV0A 5K9CA 4H9VA 3BVJA 2VR5A 3W74A 4G7EB 5HW8A 3LMZA 1NWUA 1WKDA 5H8UA 2V3EA 3OYXA 3Q45A 2V6AA 2HPIA 4H2CA 1TELA 2WHMA 4ROQA 2QV5A 3VKAA 2DEPA 3C0SA 4LUTB 1IIHA 3GDRA 4UFJA 1S5WA 4XX6A 5DIVA 5EMJA 4U85A 3AIVA 4GFSA 1UB3A 4JS3A 1Q6UA 1EP2A 4CCCA 1BGGA 3OHMB 4NRSA 3ALFA 3MUIA 4J3XA 1TREA 3OA3A 5KZEA 3FXYA 2CBJA 4DLMA 3VOHA 4IT4A 1NAL1 2YB4A 2WHKA 3SSZA 1XGDA 5HANA 4Q8NA 3H9RB 4JYFA 1W31A 2A7NA 4FB7A 2PPGA 8XIMA 4C90A 2MPHA 3N14A 1GOIA 2R9RA 5FKYA 4KRZA 5C2GA 1UR8A 4MDOA 3FS2A 2VN1A 3K2GA 4IXHA 3GIPA 4M29A 1SJAA 5LHFA 3WJYA 4FS9A 2G3JA 3GU2A 1XIMA 1SW3A 4LB4A 3G1XA 1VYSX 4RZ4A 4NZ5A 2KX9A 2VYOA 1ISXA 1A7XA 5D2VA 1EJTC 4JFKA 4Q33A 4PBEA 2R82A 2QCLA 1EP1A 1F4HA 3A6OA 4GZIA 3WX7A 1J2WA 3TDBA 1GG0A 5IFTA 5EY5A 2ZA3A 2E68A 2QJMA 1DHKA 3A5VA 4RDVA 3W7MA 3EWUA 1ZBCA 3SUVA 1QPOA 4NY2A 1V6VA 3UXAA 3FA3A 4LUIA 3N6QA 4QEEA 5HINA 2M2AA 4WXZA 1GVIA 2J9ZA 3CYVA 7XIMA 4DI8A 2ZZ3A 2EJAA 1P1MA 4N02A 4G9PA 4J3TA 2ISVA 3RIKA 2CWNA 1ZY9A 1MRQA 1W17A 4LX4A 1VB9A 3I6EA 4POCA 4O1CA 3C0QA 4JR5A 2P4VA 2Q3OA 3QC0A 1W9XA 1GVFA 2E9MA 4GBUA 3NOYA 3SCSA 3SAZA 1M68A 1PX8A 5D9NA 3GZAA 4HB7A 3ODKA 1SU5A 4KWUA 3HJZA 1FCVA 1GVSA 3UT0A 3MMUA 1ICQA 4Q4MA 1K8XA 3TTSA 2BV9A 1LL7A 1KM6A 4RE3A 2HVNA 3AHVA 4S39A 1UJQA 6REQA 4H9TA 2TAAA 3STCA 2OODA 4YPJA 2PD5A 4K1WA 4WKHA 4W9QA 1W5MA 5EFFA 3DKLA 2IMRA 3B8DA 5DQPA 3GDTA 3A22A 3OZMA 2F9RA 5D2YA 4FXJA 3USZA 5C8BB 5C9WA 3MYPA 4ADSA 3A3HA 3O06A 5DITA 3B8WA 4E3TA 3MP5A 3CWHA 1XWYA 1ADOA 1F40A 4LBRA 1C91A 3H4XA 3LRLA 3VTRA 1W9PA 3MI3A 2DSZA 4GJ1A 3FK4A 3S2MA 3LGDA 3ERPA 1V7AA 3BK0A 2OG9A 3FGCA 3VGEA 3WF0A 5I3HA 3A4XA 2J77A 4ZR8A 5CC5A 4DJFA 1I1WA 1KXHA 4F0RA 3HGRA 3V0SA 1QASA 1ENUA 2TMDA 1EX1A 1EP3A 2BVYA 2D2HA 2VT0A 3MW7A 3MSDA 4GIVA 4LS0A 3KX6A 3FCPA 4KF1A 1X1ZA 1TPFA 3AYRA 3IAPA 2X7VA 4IFKA 3RR1A 2WWDA 5IFPA 4J4KA 1L6SA 5D2TA 8TIMA 1KBLA 2VCAA 1WUFA 4JN7A 4RDZA 2FDMA 1BEUA 4H4IA 1EC8A 5CPTA 1Q7ZA 3B8TA 2V5LA 2BOFX 5GNZA 2XWDA 1GUVA 1NFGA 2BXZA 3PBYA 2J7GA 4LTSA 1EHAA 3GD6A 3RU8X 6TAAA 4ERAA 4QRNA 4DO5A 4DY1A 4WSKA 1V6UA 3KFTA 3PG9A 3QH2A 1RK5A 3LU2A 4XZLX 3TN5A 4GXWA 4J5NA 4O11A 3WNMA 1DYSA 5A8PA 1W3TA 4MTVA 2ODOA 2HROA 1ZAHA 1UR3M 3NSXA 1TTQA 4O53A 5LGZA 5DO8A 1NFPA 4RUBA 1R3RA 2BX7A 2O92A 4FSAA 3PK7A 4GY7A 4G2PA 2RHGA 1VIZA 2VX6A 4LRTA 3BURA 3D0CA 2RJGA 4UFMA 4Z42C 4OFCA 4O14A 1LBFA 1NH6A 3KRZA 5ABHA 4QROA 3O5KA 1JEZA 2ZFAA 1F6KA 5F1UA 3O5DA 2X1RA 4OV4A 3TYEA 3F2DA 5E1QA 1UP0A 1YPXA 2QMJA 1SJDA 4B4FA 4EWND 1TPWA 3URNA 4EVZA 4LH8A 4A8IA 4Y90A 1HKIA 1CDGA 2WBKA 4B3KA 3SGGA 2Y70A 1P0BA 3ATYA 1KT1A 1OZMA 2DZVA 3OB8A 4HZ7A 1EDQA 3F5KA 2F84A 2DVTA 3TMQA 4FNQA 2ATSA 5L6UA 3B04A 4MZ8A 4TW8A 2QULA 3DUGA 4GBDA 3OLDA 4KRUA 3U48A 7ODCA 5C70A 1Q6HA 4I7VA 3GTYX 3ORWA 4E2VA 3NQVA 1Q4WA 2QDHA 1AUSL 4NZCA 4W93A 4XZBA 3NIYA 4DJDD 3GIQA 3FN9A 3W71A 1HKJA 1FKHA 4TW6A 2BODX 5C5YA 4WKFA 4I5XA 1FQ0A 2BHZA 6A3HA 2GGIA 4UXDA 2DVUA 2V2HA 3NPXA 5CZJA 2JGQA 4WGHA 1X97A 4OWGA 4FXRA 1ZQ5A 3G2GA 1KQZA 1RVGA 3F2CA 1EEXA 4CNOA 3QMTA 3WBXA 2EG7A 3JYJA 1Q5MA 4LF1A 2HS6A 1JYWA 3PZUA 3TN6A 4NL1A 3AHTA 3LBOA 1A5LC 3W7PA 2CZFA 1Q6IA 3H2OA 1E6QM 4XTIA 1H3GA 1JDDA 1KRCC 2YCKX 1T5AA 4ADUA 4LWWA 3CK5A 1SJBA 4AF0A 1LCOA 5G4EA 2V3FA 4C6DA 1I9CB 3IIPA 1XKJA 3EB2A 4L5ZA 4TNSA 2VC9A 2FGZA 5CPOA 3TOPA 3BXWA 4H6KA 2QW5A 3W38A 3P6LA 4YS1A 3QHMA 1JZ7A 2YL8A 1PIFA 3SCQA 5DT5A 1OZQA 1UKOA 5D8ZA 3ID7A 2FZ8A 1FKTA 1E1EA 1B3XA 1IEXA 5I2UA 2Y89A 3CPGA 2TSYA 4M6VA 5C9RA 3W70A 2PDKA 1H1ZA 1TR9A 4BF7A 5CAHA 4LUJA 2Z25A 4WK9A 4LOCA 1FWHC 2WZIA 2V0TA 3HFYA 3INPA 2V3DA 3VABA 1TWWA 2CHOA 1CPUA 4H1ZA 5J04A 4UQCA 5KZDA 1QO2A 3AAMA 2C91A 2ZA1A 3SN4A 2EEXA 4N9CA 2PDMA 3FVMA 3IVUA 3DFPA 4PUNA 3B8IA 3VCCA 5CBJA 4XD6A 1EWEA 3LQGA 3CEPA 1QPKA 4H7VA 1DWJM 2PDPA 3B0PA 4XBKA 1TQXA 3QPYA 4NZFA 3B0UX 3CL6A 3S2CA 4UR9A 4ZXOA 3EWDA 4M56A 2PV2A 4B5TA 1V3MA 2HJPA 3KOFA 1JJKA 1QPNA 3QR0A 3UZJA 3T6CA 3SR7A 2FFIA 4N19A 4Z0SA 4YVVA 1QBBA 1PCWA 3H8AA 3NDYA 4TV6A 1L6WA 5FI8A 5I00A 3PZ9A 1OK6A 2EPOA 1RLCL 2NWSA 3K30A 3NO3A 4PRTA 3RDKA 4PBGA 1VFSA 5JH8A 5KSWA 1PEZA 4TIMA 4CN1A 1E4LA 1V02E 1TPC1 1LLWA 4KMQA 3FHAA 1LOLA 2X0YA 2XVNA 3VOFA 4P2VA 1TPEA 3H55A 4R85A 3GW0A 3G5EA 1AH4A 2P3ZA 1QI3A 1VJZA 1KV8A 3AXIA 1JZ3A 3GTFA 1JUBA 1UR0A 2VCCA 5AZ1A 3CL8A 2AMGA 4XO7A 4LC6A 5GPRA 5LYRA 2ZX9A 3TSBA 2D9FA 1TYGA 3T42A 4G2DA 1CYGA 5HPCA 4MZ1A 4M6QA 4GQQA 3GNNA 1KC7A 1J0YA 3WLOA 1CGVA 3O5LA 3P3BA 3WZ0E 1OCNA 1H63A 3BLFA 4Z08A 3PSVA 4KFNA 3HJEA 3GR4A 1PKYA 4TVUA 2VKZG 4GNKB 1PYFA 1R9HA 4TU1A 3VDGA 1NSJA 1LRTA 2C1IA 4MWAA 1L2UA 3MMWA 2DJXA 3TYZA 2INEA 3ES7A 3UJRA 4Z2IA 1UP3A 1VRDA 5L9FA 1VENA 3LGEA 5DBTA 1F8AB 1I45A 4E3VA 3AMKA 4W8BA 2J13A 3H22A 2Z1SA 4E38A 3UVAA 3ZT5A 4HPHA 2FGBA 2CETA 3RM8A 1EJSC 3UVIA 4LGXA 4FXSA 1GTHA 3PHAA 2QEZA 4ZEPA 2YDAA 1B57A 1J93A 4MY9A 4JQ2A 1L1PA 1OYAA 1W1A1 1SMDA 3KUMA 4W7VA 2UZ9A 4JFTA 1IF2A 1TWIA 3SCVA 1CXHA 1RV8A 4DXVA 2QUNA 5DY3A 3FAPA 1LWJA 1EGZA 1MXDA 3A23A 4QCFA 3TR2A 5JBEA 1J6PA 5HXMA 1HO4A 3W7HA 3QFEA 4RNHA 4MVAA 2VVSA 3OVPA 3CUXA 9RUBA 1CLVA 3M0ZA 4WVXA 3CMJA 4IGHA 2WNZA 3LTPA 2D0GA 4RE0A 3SFKA 4KQZA 2HK0A 2Q09A 3UR2A 1DBTA 1T96A 4US5D 3WMLA 4AZIA 2OU4A 4QR6A 2D69A 1R5YA 3KDOA 1M7PA 1CCWB 3K5XA 4QNWA 1PJ9A 4JPGA 3S5ZA 4XD3A 5HWBA 1TV4A 2YB1A 3B0YA 2NV2A 4YTTA 1H0IA 3ZSSA 1W56A 4UFKA 4CNUA 4AYGA 2ZUTA 2NXGA 3CHDA 4XSMA 3FA4A 4HJFA 1UQYA 1WO2A 2VOTA 5AHFA 1WDRA 2QUUA 3AZRA 3W2KA 2P3EA 3R4IA 1BGAA 2E77A 1B9ZA 2BOGX 2ZA2A 4UTTC 3NQFA 1TB3A 1U1JA 4QG6A 2FAPA 5EMKA 5J5RA 5FA5A 2ZUWA 3N2TA 2Y88A 1RSCA 3VAWA 1TFVA 3EMQA 2YL6A 1MW1A 2VFDA 3N3MA 3LRKA 2PBCA 4I5RA 1S1PA 3UPBA 2FPTA 3LM7A 4MNLA 1R85A 1V6TA 2OKOA 1TWDA 4D72A 4IGNA 3UCCA 2O9PA 3UWEA 2YCIX 4ZQCA 2QVHA 1F7BA 2O56A 3P80A 3JU2A 4CU7A 4J3VA 4WX2A 2X16A 2Z00A 3W22A 3RAOA 1N1AA 4QE5A 1HX0A 3O6CA 3IJQA 2OWXA 2PWFA 3WH9A 5HNUA 4F2TA 5I06A 1KM0A 1VBRA 5LNRA 3VOJA 4NXKA 2WSPA 3GR8A 3QBUA 4O0QA 1H1NA 3BOLA 7REQA 1CGXA 3WLKX 1YBQA 2VC5A 1UZ4A 4IPNB 4K38A 2VCDA 2XG9A 3MO7A 4AZCA 3NSMA 4CN6A 1W1TA 1H2JA 4DF1A 3ONCA 2J4GA 2A7PA 4Q8WA 1JI1A 3E5PA 4WD0A 3EOSA 1RVKA 2G97A 2XZ7A 1E0UA 1F05A 2P8BA 1CTNA 1DIDA 1OFEA 4CNPA 3WK2A 4WZHA 1J0HA 3KAHA 1H7OA 2V67A 1E6RA 1W37A 2YLLA 1J4EA 4K1GA 5EMLA 2P88A 4XD5A 4Z2JA 5AECA 4AWSA 1EYMA 2XP6A 2DUXA 1MZHA 1XRFA 1S2AA 3LA4A 3CPUA 2IPGA 3UQBA 1HJXA 4HU4A 3MHGA 4LCRA 3VNIA 3WN6A 5JXQA 3AHYA 4GI8A 1EL3A 3M46A 1AH0A 3N2BA 1B4EA 1LM1A 4J3UA 3U2OA 5I3FA 1J6YA 5BCAA 3R89A 3AZSA 1M41A 1I6NA 4OOUA 3RCNA 5CC6A 1W1ZA 3TA6A 1VIWA 4DRQA 1CXIA 1QI5A 2YOCA 1F2JA 2Y8VA 1SUXA 4AEOA 1E43A 4LPCA 5U7SA 7TIMA 2OO6A 5CJ5A 1GOMA 3L5LA 2YR1A 1B30A 3IRDA 3TROA 4H8NA 4FOUA 4CNTA 5LNVA 1FKRA 4TW7A 3RPDA 1MNSA 2I9EA 3B4YA 5ABEA 2H90A 3VYLA 1OD8A 4Y9AA 3ITOA 3RLHA 3SFWA 5EB8A 3WKZA 2HMCA 4IIDA 4ZPVR 1L2QA 3N11A