4DWSD

Crystal structure of a chitinase from the yersinia entomophaga toxin complex
Total Genus 191
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
191
sequence length
539
structure length
532
Chain Sequence
PTENIPSPILVEDKYTEETYSRPDVNFKEDGSQGNLSYTATRVCAPMYNHYVGDKTKPKLSAYITDWCQYDARLDGGGSKEEERGRGFDLATLMQNPATYDRLIFSFLGICGDIGNSKKVQEVWDGWNAQAPSLGLPQIGGHIVPLDPYGDLGTARNVGLPPESADTSIESGTFLPYYQQNRAAGLLGGLRELQKKAHAMGHKLDLAFSIGGWSLSSYFSALAENPDERRVFVASVVDFFVRFPMFSCVDIDWEYPGGGGDEGNISSDKDGENYVLLIKELRSALDSRFGYSNREISIACSGVALKKSNIDQLVANGLDNIYLMSYDFFGTIWADYIGHHTNLYSPKDPGEQELFDLSAEAAIDYLHNELGIPMEIHLGYANYGRSAVGGDLTTRQYTNGPALGTMENGAPEFFDIVKNYMDAEHSLSMGKNGFVLMTDTNADADFLFSEAKGHFISLDTPRTVKQKGEYAAKNKLGGVFSWSGDQDCGLLANAAREGLGYVADSNQETIDMGPLYNPGKEIYLKSISEIKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chi2
publication title The BC component of ABC toxins is an RHS-repeat-containing protein encapsulation device.
pubmed doi rcsb
source organism Yersinia entomophaga
molecule tags Sugar binding protein
total genus 191
structure length 532
sequence length 539
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2012-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4dwsD01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4dwsD02
1QNPA 4Q22A 3VUPA 1R86A 1U30A 2X2YA 4WSKA 5DT5A 4GQQA 4HMCA 4AEFA 5IXEA 8CGTA 4WKFA 5IFPA 1QVBA 5CXPA 1VBUA 1G01A 2XM2A 1E43A 1Q6DA 1Q4NX 1SMAA 1US3A 4M24A 1EOKA 4JCMA 1GOIA 2D1ZA 5E6ZA 4AIUA 2XSBA 5LA2A 2WKLA 1JZ6A 2YL6A 4NF7A 3THDA 4NZCA 3GH5A 2W67A 5CGTA 3VOCA 1ECEA 2DSWA 5D9PA 4B16A 1E3ZA 3CLWA 2VR4A 2G3IA 4PCTA 5A6LA 5CPTA 4JAWA 3J7HA 4HMEA 1GOMA 4HU8A 1B3XA 3AXIA 3EMZA 3MUZ1 3OZOA 4ZEPA 1HKMA 4FMVA 2ZXDA 3UG3A 3KL0A 2D0HA 1Q6CA 1E3XA 3ARYA 1UH3A 3AS1A 3SCVA 2MANA 4W86A 3OA5A 3K4AA 3VGEA 1CECA 2DH2A 3POCA 3WDHA 1E4IA 1B30A 1OB0A 1QNSA 1LWHA 3NIYA 3GYCA 4OIFA 1TMQA 4Z2IA 1F4HA 3GH4A 4BA0A 4UQCA 3WNMA 1JYXA 3M46A 4P8UA 4D1IA 1B3WA 2UWFA 2XVKA 3T0BA 3VIOA 1IV8A 1BYAA 1ISZA 4URIA 1KXTA 2DSZA 3UR7A 5CSUA 3AMLA 1LL4A 1ODZA 2WVVB 3B9DA 2VZOA 1GNXA 2DH3A 4Z2GA 2HVMA 2RGMA 5BXSA 1HJWA 1SFSA 2EXOA 3OG2A 4PUDA 1BYCA 1BVZA 1UWSA 3ZT5A 3OGSA 2E9MA 3HN3A 2ZICA 1W1YA 2QV4A 3K46A 3QR3A 2VX4A 2BHYA 2W91A 2VRKA 1K9EA 4CD8A 5A8PA 4L4OA 1TFVA 1C7SA 3AFBA 5A95A 1C8QA 4DUVA 4GIAA 4J3VA 4CGTA 4UQEA 5TD4A 1E0XA 1C8XA 3WH5A 4LYRA 5A6KA 4U3CA 5E09A 2PI6A 2XWDA 2CETA 2AMGA 4UFKA 3AIWA 4GXPA 1VEPA 2PF0A 4H7VA 2V38A 2BHZA 3VGGA 3W29A 3EDEA 5EFFA 1TZ7A 2EPMX 1JF6A 2YL9A 2WVSA 4E4PA 1KBKA 3VD3A 1WKYA 3BSGA 1J0HA 2E9BA 3VIHA 4FF5A 1JNEA 1JDCA 6A3HA 1J01A 3GXIA 1WE5A 1XGZA 4D6FA 3VIIA 1HKJA 2DSUA 5BWFA 2AOSA 4MJ4A 2WW5A 5A1AA 3CMGA 2ZXAA 3WBEA 2WMHA 1E0VA 3N9KA 4OBSA 1LQ0A 1KXVA 2DT2A 1GVIA 3N18A 1XH0A 1MW3A 4B15A 1FH8A 1G5AA 2XIBA 1W3LA 4PYSA 3ARQA 3FY1A 3VIGA 1UA3A 4WSJA 3AIRA 3LPOA 5E6YA 2E40A 1VEMA 3WD2A 1V0MA 5A2CA 1NP0A 3OIHA 4UCFA 1EXPA 2XGIA 3OZPA 1GQKA 4AD1A 4UOZA 4W5ZA 3OLDA 2UY5A 4M82A 2WYSA 3MV11 3PZOA 4RE2A 4DWSD 1JI2A 4GO8A 4EK7A 2XPKA 3RM4A 1FH9A 4YHGA 1VB9A 5D8WA 3VIPA 2E0PA 4J27A 1K9DA 2VRJA 4H8HA 3BAKA 4U2ZA 5DT7A 3SCNA 1J11A 4CD7A 1ZJBA 3W37A 5DEZA 2PWEA 4CD4A 3UERA 1PIFA 1E1FA 1CGVA 2OSXA 1WB0A 3AZTA 2WKGA 1UD4A 2J47A 3RO8A 4JFSA 1B0IA 1J10A 1JDAA 1NOFA 4BQ5A 2ZUWA 4PMQA 5ECUA 2W63A 3MUY1 3RIKA 4DWSB 3OB8A 4TX6A 8A3HA 3MMUA 2F2HA 1HJSA 3WENA 1GQJA 4B9ZA 1XH1A 2WMGA 2WHJA 2G3MA 3BAWA 7CGTA 1M01A 3FN9A 3M7SA 2BVDA 1XD1A 3TTYA 5BRQA 5IHRA 1OSEA 3TTSA 1JYWA 4LX4A 1UHVA 2JIWA 3MSGA 3UETA 3SCTA 1LF1A 2WBGA 3WD4A 1LWJA 1PX8A 2ZXQA 2J77A 3N1AA 1M03A 3O9NA 2WXDM 3CH9A 1CIUA 5CQ1A 3ZJ7A 4J3UA 4UZUA 3LPFA 1CZ1A 2VX5A 3T0DA 4MNLA 2Y5EA 4PSRA 4JFVA 1EQCA 2WMJA 3AISA 1NWTA 3WF0A 5CGMA 2F61A 3OLGA 3U7BA 5C70A 1LL7A 3WL1A 2WMFA 3ARXA 1OD0A 3FW6A 3NSXA 1RP8A 5E0CA 3EMCA 3B9EA 2CNCA 4H8UA 4GZEA 3DECA 2D3LA 4WKAA 4OOZA 2TAAA 2QLYA 3WEMA 1W9VA 3ALGA 2J7DA 3MUIA 2WHMA 5D8ZA 1PX4A 5DFAA 1TA3A 3SCRA 5A94A 5IDIA 1S46A 2Y24A 1BPLB 1H1NA 2XVLA 3WQ4A 3A4XA 4ACZA 1ZBVA 5EFDA 1HN1A 1NH6A 5GPRA 3OGRA 2BNJA 3VDAA 2DT0A 2C8NA 3WDRA 1V3KA 1BHGA 3NJ3A 4Q7NA 3WF1A 2WBKA 2YDSA 1EO5A 1PEZA 3JUGA 2ZE0A 2OWXA 3AXHA 3VIKA 2VC9A 3PTMA 3PZGA 1GHSA 2WB5A 4J7RA 1CXIA 3ARSA 3VIMA 2WMIA 1V6UA 1J0KA 3WDIA 1BQCA 2QPSA 5CSYA 3U7VA 1LL6A 2Z1SA 3APGA 2J78A 1JZ3A 3VNZA 4M80A 4BQ2A 4W8LA 1G0CA 2CESA 1A47A 4PEEA 2OWCA 3VX1A 1QPKA 2IUZA 3BAXA 3BMWA 5A6BA 1JXJA 1IZKA 2YL8A 4DWSA 1E72M 3L4YA 4EKJA 2W61A 3WELA 4TVDA 2UY2A 3AHZA 4MB1A 3MMDA 5JUVA 3UCQA 2DT1A 5CPQA 1MQRA 5A6MA 3WF3A 4H2CA 4M8UA 4C7FA 5BXRA 3WQ8A 5FIPA 3OLIA 3WY1A 3CHCA 1Q6EA 3ZIZA 2ZUVA 1UQYA 1OBAA 1NM9A 4GI9A 2FDMA 1W9XA 2CKRA 2A3BA 1DWAM 1L8NA 4QLLA 2WHLA 4ZXOA 3WIJA 4P8VA 3AYSA 3K8KA 5EBAA 3WH8A 3FNDA 1G9HA 4HZ8A 2Y8VA 1CGXA 3CHEA 4AEEA 2CITA 2GDUA 3AQUA 2FGLA 4NSBA 3WEZA 1ISYA 1OD8A 4KRTA 1EDTA 1NQ6A 2IXUA 2BS9A 1W9UA 1V3JA 3WUEA 1C93A 3L4VA 2FH6A 5GNXA 1O6IA 3DHUA 3WNPA 1BTCA 1HF6A 2X1IA 4Z2LA 2ZX9A 4XZBA 4C7DA 1QW8A 2NT0A 2XVNA 2C7FA 3BLPX 2QPUA 3PTKA 3ZR5A 3ZMRA 4HOWA 3W26A 1H0IA 3RPMA 1N82A 4OOUA 1HJXA 3D3AA 1J0JA 1FFRA 3PZTA 5DMYA 3AI0A 1PX3A 3SCWA 1X6LA 1V3MA 7TAAA 1ITCA 4TVUA 6CGTA 4HU0A 4NI3A 1EGZA 2EJ1A 4R27A 1VJZA 4W87A 2B31A 2E8YA 1V0NA 1KXHA 2WLZA 3BXWA 4JFUA 5EB8A 3WDQA 3WF4A 1CLVA 1CXKA 1WDPA 3A3HA 5E70A 4AISA 4S3KA 3MANA 1UKTA 2VCBA 1K6AA 1DEDA 3WD3A 5A6JA 2VVSA 2WM0A 1Z32X 3OLEA 2WHKA 4M1RA 4ACYA 1VRXA 2WC3A 1ZS2A 4ATDA 5A8QA 2WVTA 4J3SA 3AHYA 4W7UA 1GUVA 1DWJM 3N17A 2VOTA 4UFIA 1E0WA 1UZ4A 4PMYA 2YL5A 2O9PA 4UFHA 4JZ5A 4P7LA 2BXZA 3F5LA 1KCLA 1E6NA 3GXDA 2X8RA 1E4LA 4J3WA 4AC1X 4D6IA 2ZX8A 4QLKA 3WEOA 3KEHA 2GVYA 3M6DA 3NSNA 4MNMA 2VURA 3SCQA 4QFUA 4W85A 4F66A 3W24A 3PN8A 3CZJA 2EBNA 1H41A 4W8BA 1GOOA 2YDQA 1KGUA 1GOQA 3GZAA 3ZJ6A 4U5KA 1QI2A 3IAQA 4J28A 2OYLA 4U5IA 1EDGA 4MDOA 3ARUA 2WZEA 1E5JA 1X1NA 4P8WA 4K68A 1TUXA 1W3JA 2CYGA 3WFZA 1JIBA 3VD9A 4ATWA 3AMDA 5LYRA 3VO0A 4IUGA 1KQZA 2VL4A 1W3KA 1CXFA 3TP4A 4D6GA 4S3JA 1GQLA 2XTKA 4WJXA 1BG9A 4AW7A 2W92A 1OGSA 2DSKA 3AMGA 1KR0A 1LJYA 4QCFA 5BYWA 1BYDA 1NARA 2VQUA 2X0YA 1BAGA 3L4XA 3L2MA 3EDJA 2BXYA 3DHPA 4W93A 1J12A 2XM1A 3FXYA 3F5JA 4F9DA 4FLSA 1JZ2A 3WNNA 2VQTA 1YHTA 4PTWA 1JDDA 4AIOA 2WC7A 2BHUA 4V27A 1EHNA 2JFEX 1R85A 5ABGA 2WWDA 2E8ZA 1SYTA 3LMYA 5AYBA 3ZSSA 1V03A 1DTUA 1CGTA 4A3HA 5AY7A 1NP2A 2YA2A 3L2LA 3GM8A 4HZ6A 3AS2A 2ZX7A 1GQIA 1MW1A 3PZIA 3PHAA 4A4AA 4ZE5A 3FHQA 5M03A 3BGAA 4QLJA 2E9LA 3WSUA 4PMVA 1JF5A 1RH9A 3HU7A 3WNLA 3W81A 4DM1A 1W1VA 2XFFA 5A8MA 1HNYA 3NDYA 1HJQA 4JFTA 1WZMA 1KGWA 2CBVA 2WVUA 1CBGA 4DM2A 4GINA 1B2YA 1W9BM 1V08A 1JAKA 5AC4A 1U2YA 4CU6A 1CTNA 3SUSA 4U2YA 3VD4A 2WCGA 2G41A 3WDPP 2XHYA 5FOOA 1MXGA 1E6SM 2GFTA 3W0KA 1BF2A 1XCXA 3AMCA 4IPNB 3WUFA 1B90A 3WMCA 1CDGA 3QHNA 3BCDA 4RL3A 3WQ5A 3FHAA 4QAWA 1Y7VA 5A8OA 3SUTA 2YKKA 3VGHA 3MSDA 1MVYA 3NDZA 1ZBWA 2YJQA 2PC8A 1PZ3A 1TA3B 4J3TA 2BVTA 2J8GA 3IANA 3L4ZA 3AS0A 4W89A 2DEPA 4AZIA 4X9YA 4N0RA 4ACZB 3PBGA 3VGBA 4PMUA 1JYNA 5I78A 4FK9A 3VX0A 1D2KA 1VFUA 4W84A 1XSIA 4ZENA 4TOQA 2WAGA 1OM0A 5AC5A 4MPKA 5E9AA 1UWUA 2V5CA 5CG0A 4UOJA 1AMYA 1KB3A 4ZXLA 2XGBA 3BCFA 2IXVA 1QBAA 1ISWA 1J18A 3WH7A 5E0FA 3W28A 2WMIB 2YDRA 4BZYA 1GCYA 2VZUA 4MAZA 4CN1A 4PUEA 2VNCA 1HJVA 3WD1A 1DWIM 3BC9A 2JEPA 1ISXA 3L4TA 5BROA 3ZQ9A 5LA0A 2EPOA 4ZE4A 4UQBA 3VKKA 5FD0A 2X0HA 2ZUMA 3VIFA 1PZ2A 5KZ6A 4PTMA 2YA0A 4E8DA 3VMOA 3WD0A 1CNVA 1EO7A 1MQQA 1E9LA 2FGZA 3K8MA 3W25A 2ZUSA 1MWOA 4B3LA 3BAJA 3QGVA 1XC6A 3MO4A 3EYPA 4WK9A 2D24A 1HVXA 3CUFA 2OYMA 2X09A 1UA7A 4XV0A 1EDQA 1BLIA 3BMVA 4CUCA 1V3IA 1ESWA 1OIFA 1QBBA 3BSHA 3AIVA 2V3FA 3DYPA 1NWRA 3TTOA 2WMKA 4CKQA 4XZWA 3OBAA 1JI1A 4JL2A 1WP6A 2XVGA 1EH9A 4EANA 1QHOA 2OSYA 4OBRA 3RMEA 4GPNA 4OUEA 5ABFA 3AICA 1CGYA 1WPCA 2EQDA 4JHZA 1E6XM 4LGXA 2PBGA 4KRUA 4TTUA 4H41A 4TXEA 2BY1A 4GQRA 1V6WA 1CGWA 1C3FA 4AWEA 1UR2A 4KWUA 4HPHA 2J7FA 1E1EA 2ZUNA 1EHAA 3SCPA 5HNNA 4N42A 1E4NA 1UKPA 2G3JA 2ZWZA 3VD5A 1AQHA 2D22A 3SUVA 1V6YA 1HKKA 3MMWA 4WF7A 5JIPA 2GJXB 2YBTA 2Y2WA 4QP0A 3T2OA 1KXQA 3CZEA 1V3HA 3UEQA 1QHPA 3AOFA 5JBEA 1W1PA 9CGTA 4GO9A 3WNOA 1CPUA 3WH6A 2EPLX 3ZT7A 2BY2A 3DYOA 1XYZA 4M81A 4H8VA 3ECQA 1UD8A 5LA1A 2PWDA 2J74A 3VDHA 3GDBA 4E8CA 5D9NA 4AZ5A 3G6MA 2PBOA 3NCOA 1Q6GA 1E73M 2D23A 1GHRA 2WC4A 4AZ7A 1OGGA 2WCAA 1QI4A 1CXEA 4UR9A 1B3ZA 4ZFMA 2OSWA 4DUXA 2QHAA 3K8LA 4CCDA 1GOWA 1K9TA 2V3DA 4X0VA 1GZJA 3GNRA 2WCSA 3U5YA 1J9YA 1UWRA 4BS0A 1UH2A 1UR8A 1H2JA 1XV8A 4UOQA 3IJ9A 4PTVA 3IAPA 1JZ7A 4V2XA 1C7TA 2WSKA 5M17A 2UY4A 2PWFA 3VDBA 1MXDA 2Q8XA 2G8ZA 3CGTA 3GNOA 1RPKA 1UR1A 3QOMA 1CGUA 3VMNA 2CXGA 1E6PA 4HOZA 2WK2A 1VAHA 1UH4A 1MW0A 1VJSA 1US2A 4UZSA 1H5VA 5I79A 4CCEA 2VX7A 3AIBA 1HL8A 1BYBA 4OZOA 4P7QA 4CVUA 3W4RA 2FHFA 3ARRA 4D6HA 1VF8A 1UZ1A 1AVAA 4MB5A 3AIUA 4H04A 1ZJAA 4E2OA 2XYLA 3BAIA 4EAMA 3DYMA 3NSMA 1JXKA 5BXPA 4BQ3A 1HXJA 1GW1A 2E4TA 3FAWA 2ZUTA 1UQZA 3VGFA 2FHCA 4TX8A 1DP0A 1MYRA 2VJXA 4AZ6A 4YN5A 4PMNA 2DIEA 1JFXA 1UKQA 3AZRA 4KH2A 5I2UA 1V02E 4JKMA 1FHLA 3VD7A 1PIGA 3K4DA 2DQXA 1MFUA 2V3EA 3VTRA 3HJEA 2JF7A 2PWGA 1NWUA 3ARZA 5CJ5A 3W27A 1QOXA 4JKLA 2OYKA 1V02A 2WZIA 5F7UA 1AQMA 4UTFA 4HZ7A 3IK2A 5FL1A 4M29A 2V3GA 4MNKA 3VVGA 1PPIA 4W5UA 2DPEA 3T09A 4HA1A 4P7RA 3D5HA 1VFOA 1TVNA 2GJXA 4CD6A 4BQ4A 1PBGA 1LG2A 1R7OA 4LXFA 5CPSA 1OGBA 5A8NA 3BAYA 2QMKA 4HP5A 1UD2A 4FLRA 3IJ7A 3ARTA 5GQBA 5HDRA 3WMSA 1EA9C 5FL0A 2CBIA 3CO4A 1C91A 4FLOA 1HJUA 1SR0A 3SEPA 4MNJA 1HVQA 4KMQA 2W62A 1E6RA 4HPGA 3W6MA 1NWSA 3TA9A 4GZIA 1JD9A 1UWTA 1QW9A 1D3CA 1SMDA 4JCLA 2JEQA 3VM7A 4AZBA 3GBEA 3SIMA 4AD0A 2CKSA 4JFWA 3WQWA 3CPUA 3WUBA 2GK1B 2EPNA 1OIMA 2J4GA 2CEQA 3PTQA 4HTYA 5I23A 5JH8A 4WIWA 1ODUA 2ZWYA 2DT3A 3AHTA 3CHDA 1H09A 1CXLA 2D20A 2VZVA 2ZX6A 1WZAA 1FP8A 3WMBA 1QI5A 1H4PA 2YA1A 3A47A 5GNYA 4AD5A 4ML4A 4V28A 3A4AA 1WNOA 2ZUUA 3T2PA 3S6TA 5A69A 3S2CA 3T08A 3BH4A 3AZSA 1R8LA 3AHXA 5A6AA 1OINA 4AD2A 4KGLA 4M56A 1DWGM 2O9RA 4JIEA 2A3CA 5A3HA 2X05A 2VUYA 1ZBKA 4AYSA 2J7BA 3TOPA 3WL0A 3SURA 4AZGA 1WO2A 3I3BA 3GBDA 5I3DA 2XFRA 4AZCB 4OKDA 1OCQA 2ZXBA 4A3YA 3E1F1 1W2PA 1W1TA 1QNQA 1GOKA 3POHA 1XHGA 2FHBA 4GI8A 3A4WA 4F9JA 1W91A 5I6SA 3VINA 3WDJA 3PZNA 4U33A 3SCUA 3F4VA 3O2LA 1W3HA 3RM9A 1CWYA 4L4PA 1HIZA 3ZR6A 2DGAA 5HBFA 2YLAA 5AYIA 1NOUA 3EDDA 4W88A 3CZLA 4AIEA 4Z2JA 4D71A 1XCWA 2VI0A 3W53A 3CUHA 5D9MA 1TE1A 3AMKA 4PMXA 1GORA 1E71M 1W9PA 2EPKX 1UD3A 5ABEA 5KEZA 5CLWA 1QI3A 3TTQA 1VEOA 4QDMA 4DUWA 4RE3A 1I75A 1E6ZA 1GJUA 4D1JA 1E70M 3U57A 4ATLA 3RJYA 1WZKA 3AJ7A 2QF8A 2JALA 5GNZA 1HX0A 1JG9A 4IPLA 4MJ2A 3N12A 4TTGA 1W9DM 1W32A 2EO7A 1E5NA 5CZKA 2GK1A 1K9FA 3TONA 5HPCA 4JHOA 3M07A 3O6AA 5DF0A 4TUFA 1ZL1A 3KL3A 3EBVA 3CUIA 1B31A 5FKYA 3W82A 4MB4A 2HISA 3AIEA 1D7FA 4X0NA 1V6XA 1J0ZA 1CYGA 2XIIA 3VILA 5ABFB 3PZ9A 4XB3A 1H49A 3QHMA 2VX6A 2WSPA 4UQ9A 2G3NA 2CBJA 3AYRA 3QHOA 2WPGA 3VM5A 1JYVA 2NW0A 2ZX5A 2BVYA 2E3ZA 3WN6A 4PTXA 2CCRA 4JKKA 1HT6A 5I77A 1BVNP 2D2OA 1TR1A 5HPOA 2DIJA 3ALFA 3KL5A 3PZVA 2VZTA 3ARWA 2J62A 3UG5A 1G94A 4AD3A 1R7AA 4MB3A 2GJRA 3CTTA 4AZCA 5A2BA 1JD7A 5A2AA 1AQ0A 5C71A 3T0AA 1JAEA 3W38A 3ZT6A 1P6WA 1CEOA 3EMQA 4W8AA 3CUGA 1QI0A 1QNRA 2A3AA 2ZIDA 5ABHA 1OWQA 4B3KA 1UKSA 2VT0A 3VNYA 2VZSA 1IZJA 5HOSA 1ISVA 2J7EA 2GUYA 2W4XA 5JIWA 1FA2A 1VENA 4IM4A 1EQPA 4FLQA 1FOBA 3MS8A 3RM8A 2PB1A 1B9ZA 1E6QM 3GH7A 3CBWA 3MUAA 3RILA 1V6VA 4W7VA 5M3WA 3CUJA 1OT1A 3VPLA 1EOMA 1JZ5A 2NSXA 1WDQA 4D6JA 2WWCA 4PMOA 5A6BD 5BCAA 3MV01 3VMPA 1KQYA 3THCA 1KGXA 3B9AA 3WQVA 4R5EA 3RDKA 3A6OA 2VMFA 1WZLA 2CBUA 1E55A 1UD6A 4DWSC 1V0LA 4B9YA 5JBDA 3WBAA 4P7OA 1W2VA 4GZJA 4WKHA 1R87A 3SCOA 4CD5A 1C90A 3PZQA 1JNDA 4PMZA 1KWGA 1BFNA 2D0FA 1MFVA 2WZHA 2G4FA 4BCEA 1CLXA 2O9TA 3GXMA 4UFLA 1HL9A 3CIVA 4AMCA 1WCGA 1KR1A 2XWEA 2J7HA 3VDCA 3KWXA 1CENA 1H3GA 3SUWA 6TAAA 2WVVA 4AZHA 1HP4A 1GPFA 1B3VA 3L4UA 1JGIA 3DC0A 1TVPA 1NOWA 1I1WA 4LPCA 1H0GA 2BY0A 5EMYA 4RE4A 3IJ8A 5IFTA 4U3AA 4PN2A 1A3HA 1E56A 2VTFA 4PMDA 5FCZA 1BGGA 2J79A 1UR9A 5JBFA 3QOKA 3N13A 4HA3A 4NRRA 3VU2A 1UYQA 3ZJKA 3PZMA 2GSJA 2NT1A 3I3EA 3WFLA 2CERA 4Z2HA 1C8YA 5HXMA 5I24A 1E15A 4KGJA 2QMJA 1GONA 4Z2KA 2GJPA 5CLTA 1HP5A 2YLLA 3ZM8A 1VFMA 1DHKA 5C8BB 2WLYA 1U33A 1UWQA 1B3YA 1HKIA 3OGVA 4NRSA 1YQ2A 1FHDA 1KBBA 3MU7A 2XUCA 1LG1A 1QNOA 1UR4A 1IT0A 4PBGA 3BLKA 4BF7A 2YOCA 4CCCA 4GKLA 1VIWA 3K1DA 3RCNA 4JL1A 1UKOA 3CZ8A 2JE8A 1UG6A 2BFGA 3LPGA 2WNWA 3CZGA 1XH2A 4LYQA 4Y7EA 3HMCA 2PWHA 3RJXA 4D6CA 1UUQA 3EDFA 4D6DA 2GDVA 1ZU8A 1OT2A 4GI6A 3KZSA 1V3LA 1BSIA 4AXNA 2CPUA 3AXXA 1UOKA 3B8SA 1RD6A 4WLCA 4CN4A 2ZOXA 2DSVA 3AROA 1ZBCA 2W5FA 3AIQA 3WKZA 1E4MM 4PMRA 2A3EA 2CHNA 1KFWA 1X6NA 2VCAA 4XUYA 3ARPA 2XSAA 4UNIA 3AHVA 2J25A 1CXHA 2OWWA 1DWFM 1ITXA 3ARVA 2AAAA 1ZB5A 2JIEA 4F8XA 2EEXA 1H11A 2Y4SA 3T2QA 3SUUA 2VR5A 4TVCA 4UQDA 2XJ7A 2D3NA 4LYPA 1MW2A 2ESCA 4UFMA 4IISA 2A3HA 4MAVA 1UR0A 4AY1A 1QHZA 2WANA 3WH9A 3EDKA 2VVNA 3MKKA 5A6SA 1J0IA 1C92A 2VCCA 3ZO9A 4CN6A 1UD5A 2J8FA 5M5DA 3I3DA 2VRQA 4CU8A 1GVYA 3GXFA 3II1A 4YHEA 2Y8KA 1M7XA 5I0DA 3N11A 3ZJ8A 4U31A 1BGAA 3UR8A 1XSJA 2BY3A 3VIJA 3AS3A 1M53A 4YPJA 3GTNA 3UESA 2RGLA 1L0PA 1XRVA 4P7NA 3KE0A 1TCMA 2VO5A 1JFHA 1XYFA 3ZOAA 2DDXA 4QCEA 7A3HA 4UFJA 3G6LA 2CIPA 1M04A 4F79A 1G1YA 1KCKA 1JZ4A 3CZKA 4XX6A 2CHOA 1Q6FA 1WDRA 4CVWA 4CU7A 4MDPA 1XSKA 3WF2A 3WNKA 2O9OA 4D72A 1FP9A 3N15A 1VBRA 4OJYA 3WUGA 1MQPA 1JZ8A 1DWHM 1EIBA 4PCSA 1PAMA 1J0YA 1TG7A 1WAWA 1WDSA 2YBUA 2F8QA 5BRPA 3L4WA 1I1XA 1PJ9A 4PSPA 5DO8A 4AD4A 3UG4A 4LQ1A 1UWIA 1B1YA 4EE9A 4MTVA 2JF6A 3W6LA 4D6EA 3PZUA 4HOXA 5IHSA 4HA4A 1GJWA 1RP9A 5D9OA 1V0KA 4J3XA 2J7GA 3WQ6A 2BV9A 1VFFA 5BXTA 2XFYA 2Z1KA 4P8XA 1FFQA 3FAXA 1LLOA 3VGDA 4UQAA 1E40A 1FH7A 2UY3A 1JL8A 3NUKA 2YIHA 2O92A 3N04A 1O7AA 1F4AA 4W7WA 3SCSA 4HMDA 4C7GA 2OLHA 2W66A 4MADA 2D0GA 4PRWA 3GNPA 3NYDA 3LPPA 3U5UA 1KWKA 3F5KA 2XVPA 3CMJA 2XG9A 3CHFA 2J75A 2V5DA 2C0HA 2FH8A 1XD0A 2J7CA 5D4YA 5I5RA 3ZSTA 1BG4A
chains in the Genus database with same CATH superfamily
4UTTA 4Q22A 2QUVA 4V1XA 1EX5A 3TUUA 3S5NA 3W71A 4GQQA 4HMCA 4C6PA 1UZHA 4WKFA 1GYMA 2X7VA 3BV7A 1Q65A 3MQTA 3W1LA 3NQCA 2XM2A 2V67A 4JQ2A 4QNWA 3NGFA 1EOKA 5HJLA 5FSDC 3B0UX 3CV2A 4DLMA 2Y61A 3UNDA 1JZ6A 3QV8A 2YL6A 4JFKA 1R3QA 2Z4GA 4NZCA 3HGOA 5CGTA 5T8GA 5D9PA 2B4GA 3S42A 2WZMA 4QQ3A 4AH7A 4YYFA 2VR4A 2G3IA 3URBA 2H90A 5CPTA 1WBJA 2G5WA 3G77A 3IJLA 3J7HA 4HMEA 4UDMA 4HU8A 1B3XA 3AXIA 2X16A 2NV2A 1HKMA 4FMVA 2ZXDA 1R3RA 4LBRA 3KL0A 3QFEA 3H2EA 1H51A 1E3XA 1DJWA 1UH3A 3HTWA 2PGRA 3MJYA 4W86A 3OA5A 2NLYA 2PDPA 1A4LA 1OB0A 1QNSA 1UASA 3QH2A 3NIYA 4IQ2A 1ZY9A 2KR7A 2PV2A 2CLOA 1KRMA 3M46A 2MUCA 1THFD 3QM3A 4F0LA 1BKFA 2UWFA 5C9XA 2B7OA 3EX6A 4O4WA 4YIWA 4M6QA 1IV8A 1BYAA 5LGZA 1YEYA 2F2DA 3G3DA 3EWBX 2Z27A 4XVEA 6REQA 3B9DA 1GNXA 4OVXA 2EGZA 4NZ3A 3PFMA 2DZPA 1SFSA 2FJUB 3GG8A 1BYCA 1BVZA 3OGSA 3M5VA 3HN3A 2HJPA 1W1YA 2W91A 2VRKA 1K9EA 5A8PA 2IKHA 4G56A 5DIUA 5U7SA 2IKIA 4CQAA 2HPMA 5T9BG 3WH5A 4KFNA 3E74A 2AMGA 2NUWA 4C6DA 1XKJA 4L65A 2ZQVA 4GXPA 3TZNA 1VQTA 2FLIA 1TZ7A 3NPWA 2J9ZA 4PUKA 4GUGA 1P0DA 3QZAA 3G2GA 2E9BA 4UTWA 1JDCA 2V9DA 5AFDA 4KERA 3C8NA 2FJKA 1XGZA 3PP7A 3O15A 3WQEA 5AYXA 5BWFA 1JQVA 2PP1A 3DG7A 3EX2A 4H6KA 1FWNA 1O5KA 3MPGA 3W00A 1ZQ5A 3CMGA 3N9KA 4TW7A 1XH0A 4B15A 1KM3A 3TYEA 5DCDA 1G5AA 3DI0A 4DYEA 3QEZA 1UA3A 2OGYA 4Q3MA 3BOXA 2E40A 1VEMA 4Y2WA 4MUPA 4Z1DA 1NP0A 3KCJA 4BI7A 1LROA 2GLKA 2ZC1A 1ONXA 2FFCA 3RX3A 1LOLA 3FYPA 2ISVA 1OFAA 4DWSD 1JI2A 4FXFA 1P0EA 4AY7A 3RM4A 1FH9A 1XLBA 4R9XA 3V0TA 3KRZA 4IOTA 3G0SA 3BCJA 1PTGA 3RO6A 2VRJA 4S3AA 3HO8A 3H2AA 4HHHA 4CD7A 2ANUA 2FZDA 2ALDA 1PIFA 3KFTA 4HGXA 1ZUAX 4GX8A 1CGVA 2Z1VA 4MKVA 4C6QA 4FA3A 1VGAA 1W37A 3PRDA 2BOFX 2J47A 4FEZA 1J10A 1XYBA 3IUIA 5MKGB 3TJIA 1VS1A 1R3TA 4EVZA 4IPXA 2ZUWA 4A35A 4ZQPA 4QDWA 4FAPA 4DWSB 8A3HA 1QPFA 3DC8A 3WENA 4BWLC 3DKJA 3OOQA 2DG9A 2WHJA 3BAWA 2YYTA 1H7NA 3FN9A 4A21A 1A5SA 3FGCA 5LGXA 1V77A 4O1FA 2G4JA 3GYEA 4FX7A 1Q7ZA 2VC6A 5BRQA 2Z28A 3LCXA 3O5QA 1XP3A 4LX4A 4C6LA 2JIWA 1GVSA 3MSGA 4XZMX 4NJKA 4NZJA 1W0MA 3IJIA 1LF1A 2CZFA 2AKMA 4N19A 1FKIA 2J77A 7ODCA 3TLLA 1CIUA 5J5DA 4XIMA 2BODX 3RHGA 4E4UA 2J8TA 4S39A 3S6OA 3CTLA 1MZHA 4KFPA 4PSRA 3UJSA 3QQ0A 2QPXA 4CNPA 4XAFA 3WL1A 3JZEA 3G8EA 2OCZA 1RP8A 5E0CA 3EMCA 1KNWA 4MZ8A 1T8QA 4DAFA 4LB4A 4Q8MA 4E6MA 3KBJA 4KCWA 1EYMA 2TAAA 1O5RA 1LUCB 3CWOX 1YDOA 2NWSA 3MUIA 2XP3A 2QEZA 4K8EA 4LAOA 1ADOA 2HRWA 1PWLA 1TA3A 3LS9A 4HCLA 5HA7A 3HFTA 1LRNA 2OZTA 2A6LA 1ZBVA 5EFDA 1IIHA 3GIQA 2HZGA 4B5SA 2Q71A 3VDAA 4XD5A 4OUIA 4RKAA 1RQEA 5H6HA 1GTHA 1BHGA 2F23A 1MUCA 1D7IA 4Q7NA 1KBJA 3WF1A 2YDSA 3W83A 3K5XA 3JUGA 3VIKA 1TWSA 2QW5A 1QO2A 4NNBA 3LV6A 1QXLA 2A1YA 3T7VA 1NDWA 1JRBA 1UB3A 4HKPA 1OZMA 4JFLA 2Y7GA 2HV5A 5CSYA 5FJIA 4YJ5A 1YE4A 2J78A 4EPKA 1TJ2A 1G4PA 4M80A 4W8LA 3TSMA 1A47A 2OWCA 1ICSA 2P8BA 1P7TB 4RDZA 3H53A 1VCVA 1AMKA 1RQBA 3BMWA 4UTMA 1JXJA 2YL8A 1TTQA 3L4YA 2C14A 4EKJA 1F8AB 3Q58A 3LQLA 4M0XA 5AN7A 4TVDA 3B8TA 6TIMA 5GVJA 3U2ZA 3G1DA 3GXNA 3W7LA 1IXQA 5HUOA 4M8UA 4C7FA 4R85A 4CLMA 4GYJA 2ZQSA 1GVRA 1EGVA 5FA5A 1Q6EA 2ZUVA 3ATZA 3HA1A 3M0KA 2CKRA 2A3BA 1DWAM 4O16A 3BQ6A 5D38A 2WHLA 1NQKA 2H9AA 4J3ZA 3R0DA 4HZ8A 4L72B 3IUDA 3S2JA 4H6EA 4NSBA 5JQ9A 3DERA 1EL3A 2E1DA 3SN1A 4TW8A 3P81A 1S2VA 1W9UA 1TTJA 2O4QA 5FJRA 4I9AA 4FR1A 4ZQCA 1YDNA 2VHLA 4C7DA 2ZX9A 4JTGA 4X9SA 3BLPX 2QPUA 3OYZA 3PTKA 1TREA 3W2JA 3QFWA 2RUSA 3TNOA 2XN1A 3NZPA 1W3IA 1PXGA 1HJXA 4REQA 3D3AA 3PZTA 3OOBA 4GZ7A 3SCWA 1V3MA 1Z9AA 5BRBA 1QDSA 1RZMA 4AMAA 4NI3A 1IEVA 1DIOA 3MHUA 4W87A 2OB3A 3I7QA 1V0NA 2C1GA 2B7PA 1JRCA 4CEXC 3JXVA 4JFUA 4S38A 1OG0A 3WDQA 1CXKA 1WDPA 3DBNA 4RNJA 4AHOA 1UKTA 1K6AA 2GGIA 3N2MA 2PDYA 3OLEA 4ACYA 1R9ZA 1YPFA 4J3SA 4AWUA 2PURA 1DWJM 3N17A 2WM1A 2VOTA 5LIWX 4AFYA 1I2RA 1YKWA 1UZ4A 3EX1A 1YYAA 4GHRA 3QTGA 2R24A 1Y5WA 1XBVA 4P7LA 2J88A 3F5LA 1KCLA 3IRDA 1I2NA 4H6RA 4DPQA 4H6QA 1AJ0A 2GVYA 4DJDA 4GFIA 4MNMA 1ME9A 5KZMA 4FNPA 1YADA 4F66A 4JTQA 1A5NC 3CXOA 3S1XA 4G6CA 3PN8A 4U85A 2OQLA 2F2KA 4AVOA 1GOOA 3C0SA 1CCWB 4MJZA 3ZJ6A 4U5KA 4YTQA 4J28A 2OYLA 5DMLA 4MDOA 2WZEA 1E5JA 4GOAA 1REQB 3WFZA 3OYXA 4JN8A 5T26A 2YDAA 4DZ3A 5LYRA 3UPBA 1J5TA 4IUGA 2NZLA 2VL4A 4IGHA 3M16A 3GR4A 1GQLA 2XP9A 4AWSA 5AHLA 3M47A 3GO2A 2OX1A 1KRBC 4RZBA 4HU3A 3VKBA 4QCFA 2QGYA 1ZK6A 2VQUA 2X0YA 1BAGA 1DL3A 2M08A 1KRCC 3L2MA 1L6YA 2WO5A 4HYRA 1J8VA 1FX6A 4F0MA 1RXOB 3P8IA 4J1OA 3VA8A 3FXYA 4MHBA 2YCEA 3WMLA 2PODA 1FDZA 1MEIA 4RDVA 4GH1A 4PB3A 3LMYA 5AYBA 1DTUA 3P60A 8TIMA 1NP2A 3NQDA 2PDCA 4HZ6A 2HS6A 4DX3A 1SW0A 4MIMA 4IQJA 1W1IE 1MW1A 3PZIA 1Q6RA 3PHAA 3BLIA 3NO1A 4IPIA 1M65A 1Y65A 1J2WA 1LP6A 1DQWA 3WSUA 3O5JA 3M41A 4PMVA 6XIAA 1YATA 5C0QA 3EOLA 4IQCA 1V8EA 3WNLA 1M1BA 3W81A 4ZVJA 4LY8A 1D7HA 2XFFA 4JIQA 2NVAA 1J4EA 3SI9A 3T40A 1YMYA 3PUOA 2OQHA 5CCZA 3ICJA 3EAUA 3LK6A 4DXKA 1AH0A 1A5OC 1GVEA 3SUSA 5FF2A 4U2YA 1A7XA 3KBWA 3RRAA 2KI3A 1SO4A 2WCGA 3HGSA 1XF0A 2PDKA 1XFCA 4XVDA 5FOOA 4MLRA 1MXGA 4US5D 4A8NA 4IPNB 5D2YA 3WUFA 3HG4A 3BCDA 3BMBA 1Y7VA 4KQZA 4JBRA 1JCHB 3ENLA 2XIMA 4IT1A 1ZBWA 2YJQA 3KHJA 4IQEA 2PC8A 1KV8A 1X8FA 5CZ0A 4AUBA 1EUAA 4E4FA 3GFXA 4JTAA 2ABBA 4HQVA 1W3NA 3UZJA 4C6FA 4C60A 1ZHAA 4X9YA 4ACZB 3VGBA 4WY0A 2IMRA 1JYNA 5I78A 1WOBA 3VX0A 4ODKA 4ICNA 2RDWA 4W84A 2WAGA 1OM0A 5AC5A 3BPWA 3NQGA 1LOSA 5E9AA 2JGQA 3E96A 4UOJA 3S1VA 3NURA 3KOZA 4ZSTA 2XGBA 3BCFA 4FOUA 4UTIA 1QBAA 2R1NA 2PD5A 3W2KA 1J18A 4HA0A 3W72A 3FDKA 4DF0A 3CWNA 4CN1A 3N4FA 4QROA 4DPPA 1R30A 2JEPA 1ISXA 1EJWC 4ZTYA 1GKQA 1CLKA 1F6YA 3ZQ9A 5LA0A 2EPOA 1FKJA 3NGJA 3OZMA 1RVKA 1YTKA 2X0HA 2ZUMA 1PZ2A 1YPXA 4XK2A 1MQQA 1E9LA 2RQSA 1SZNA 2FGZA 1H7RA 5G1YA 4LNCA 3E2SA 2PDNA 1XC6A 3EYPA 1BTMA 4IJRA 2DW7A 4M6VA 2X09A 1I2PA 3APYA 1FVPA 4HSOA 1KFCA 3BMVA 1V3IA 5G4EA 4WXZA 3AIVA 2LLEA 4DBEA 3DYPA 1NWRA 4INFA 3ZWSA 3OEXA 1EC8A 3W22A 3N3MA 4PULA 1XUZA 2XVGA 4J5NA 2Y7FA 1CGYA 1WPCA 4C65A 1LT7A 1P0BA 3WK1A 2PGWA 1R3SA 4RR4A 3LUTA 4IGMA 4Q32A 4TTUA 1OY0A 1RJRA 5FJOA 1AH3A 4YTRA 2WKJA 3NZGA 3ZLGA 1IX5A 4IH3A 1CGWA 4BI6A 5K2ZA 2VWSA 2C16A 3CUZA 2ZUNA 4CEUC 1XLJA 2ZWZA 2D2GA 3SUVA 5K4XA 3AU6A 3MMWA 3LSCA 2GJXB 5LXEA 2YBTA 4QP0A 3T2OA 3NQVA 3VC5A 1V3HA 5G5IA 1RCOB 5JBEA 2R1PA 3WNOA 3PWAA 3KVLA 2VEPA 4XAGA 3ECQA 2VDGA 3EWDA 1HXVA 3VNDA 2J74A 3VDHA 3H12A 2OXNA 3IUHA 3G6MA 3NCOA 3BZJA 1NELA 3VABA 1Q6GA 2A21A 2WC4A 2DUAA 3UW6A 3G1RA 3H4GA 4UR9A 3LHUA 2OSWA 2TYSA 4CCDA 4G2DA 2ZR4A 1V5XA 4FALA 2YCKX 3GNRA 2XFWA 1XV8A 4OT7A 4UOQA 3ODKA 4JTFA 4V2XA 1C7TA 2WSKA 5M17A 1VPQA 3VDBA 4RCXA 3CGTA 4IFRA 3M0IA 3GVQA 3UG8A 5EKYA 2VGIA 1UH4A 1VJSA 4AEOA 5TIMA 1H5VA 5GPGA 5I79A 2VX7A 3AIBA 4JQAA 4PEKA 2TMDA 1KTCA 3HPZA 3QKEA 3CYJA 1AUSL 5G4HC 1Q63A 3NQAA 3G22A 3AIUA 4H04A 2V5KA 4I3GA 1I0BA 5J5RA 3K1GA 4DBDA 4PUJA 4BQ3A 1HXJA 1GW1A 3V0SA 5B7ZA 3FAWA 5HMFA 3MMTA 3CAWA 1EBHA 2PPNA 1VLWA 1JFXA 1UKQA 1J6PA 1H1ZA 1XBYA 3K4DA 1MFUA 2DZSA 4O52A 3VTRA 2VFEA 2DVUA 4GQBA 4J2PA 1L2QA 4QSHA 2VP8A 4UTFA 4ZA0A 4HZ7A 1QAPA 3IK2A 3U4AA 4M29A 2I9UA 3S8HA 3SY8A 4MNKA 1NU5A 3NAVA 4XKYA 1VFOA 4G7EA 4L6OA 1PBGA 3V3WA 2I16A 4HP5A 6ENLA 1UD2A 4FLRA 2FZ8A 1I45A 3EX3A 5GQBA 3TMQA 3WMSA 2CBIA 3PNZA 3SEPA 1HVQA 4QJ3B 2W62A 1E6RA 3UXKA 3QBUA 3W6MA 3TCEA 2OLSA 1EJRC 4JIIX 4OECA 3W7JA 1MNSA 1TJRA 2AWGA 4JCLA 3GBEA 5LIXX 4AD0A 1VZWA 1MDLA 3IS4A 5HWCA 2KZHA 1AJZA 3C2FA 3OBEA 1JJKA 2CEQA 4Z1AA 5JH8A 4Q8UA 4WIWA 1ODUA 2XZ9A 2DT3A 4PBFA 4S3GA 4DELA 3AO0A 3NPUA 1H09A 2VZVA 3HJZA 1YTEA 1XLGA 2GGEA 2YA1A 1X1OA 2OG9A 3EXSA 2O0TA 4QE5A 4V28A 1WNOA 4Q4KA 4MUZA 1YIXA 1FWHC 1NIUA 3T2PA 3S6TA 3FJLA 4TMCA 4GWEA 3SR7A 2SFPA 4A8LA 1H61A 2ZDRA 4ODQA 4KGLA 1C9DA 4JIEA 2VUYA 3TOPA 3R8RA 4AZGA 1WO2A 3I3BA 1PZ1A 4OKDA 3BLOA 1AD1A 2CZDA 3R8HA 1X96A 4IFKB 2X41A 2QQ6A 4A3YA 3MO7A 1W1TA 1QNQA 3POHA 1XHGA 5BMWA 4F9JA 5F2GA 2OLAA 5H1WA 1W91A 4GY7A 3VINA 3WDJA 1O95A 3SY1A 2Z0IA 4UMAA 3F4VA 4Y9PA 3UZWA 3LM3A 4DRQA 4L4PA 1GQNA 1HIZA 2C6QA 3CV6A 1TV5A 4O1BA 5HBFA 3AALA 3R7MA 7ENLA 5CJMA 2DFAA 4W88A 4AY8A 4Z2JA 4D71A 1XCWA 3JS3A 2E68A 1AG1O 3UPWA 1DVJA 2J6XA 3W86A 1EYWA 5AHFA 3D0CA 1F5ZA 1KM0A 4GNJA 2V63A 2KE0A 2PV3A 2QJMA 1ZAJA 1UD3A 5ABEA 3R6IA 1NTHA 1SGJA 1PINA 1XLDA 4MG4A 1DJGA 3TTQA 1RAKA 1VEOA 3CK5A 4RE3A 3TVAA 2ZRYA 5L9FA 1GJUA 2UBPC 4Z1YA 3AJ7A 3L5LA 2QF8A 3KRSA 5GNZA 1W6TA 4O0KA 3NVTA 1XJBA 2ZTJA 2ZRUA 4TTGA 1W9DM 4KT2A 3CAKA 3BW3A 5GJMA 4QG8A 2QYGA 4QX4A 5IM51 4NHVA 4F3HA 3EGJA 3KVKA 1KFBA 4K7YA 3O07A 3HB9A 3O6AA 5DF0A 3BE7A 3CUIA 5FKYA 1KLYA 4K3ZA 4MB4A 3EY6A 3LOTA 5HINA 3STCA 5BW6A 3GW3A 1ZALA 2Y62A 3GR7A 3BWWA 3VILA 5ABFB 1P43A 3UYCA 4XB3A 3QHMA 4FIRA 3OVGA 1D9EA 1GZ1A 2WSPA 4UQ9A 2CBJA 3AYRA 4MWAE 4WCJA 3QHOA 2ZX5A 5DY2A 2E3ZA 4FOJA 3WN6A 3B8UA 1E51A 1Q7MA 4LS1A 5I77A 2QCGA 4EIVA 2WJDA 3E0IA 2D2OA 4DNMA 3MZNA 1RLDA 3BLLA 2VZTA 3HQ1A 3R79A 2J9YA 1BRLA 2NVCA 2VYOA 1IEWA 2PU0A 1R7AA 1FXPA 1ZNNA 1XIGA 2P50A 1W5PA 2IQDA 3PWGA 3CTTA 4AZCA 4BEUA 3EOSA 3TU9A 3E0VA 4DYJA 2W79A 4OU1A 3EMQA 2H8XA 4LUJA 1RSCA 5AHMA 5ABHA 3RG6A 3VNYA 1ICPA 5JIWA 2KGJA 3VKJA 4S3FA 3KAHA 3RM8A 2VGGA 1XUUA 3HURA 1IYXA 4I6VA 3DG6A 1B9ZA 4PB5A 5ENLA 5HT1A 3UVAA 3MUAA 1V6VA 4LRSA 4W7VA 1F73A 5DELA 1EOMA 1FTXA 4R9OA 3NYZA 1WDQA 4DT4A 2WWCA 4PMOA 2I5QA 2QV5A 2FDSA 5BU9A 1KQYA 3TN3A 3WQVA 1U83A 3A6OA 1WZLA 1V0LA 1TPEA 2Z7GA 4B5NA 4EPDC 4WKHA 1T8XA 3SCOA 4CD5A 1C90A 2MF9A 1ZP4A 1JNDA 3H4WA 3BURA 3NTPA 4DH0A 2G4FA 4BCEA 3NVDA 3U3HA 4JX5A 2O9TA 4UFLA 1HL9A 3CIVA 1JVNA 3BICA 3H24A 3HF3A 1WCGA 2J7HA 1CENA 1PYMA 3EB4A 4IFOA 2P5NA 3DFSA 4I9JA 2WJZA 2HS8A 1V79A 2DU2A 4XAKA 3GKAA 1TVPA 1XI3A 1NOWA 5EMYA 4RLIA 4GIYA 2A7PA 4PR4A 4LUTA 1FWGC 2WJEA 2MLYA 5CZSA 4JEJA 1UYQA 4H00A 2GSJA 4GVFA 3HV9A 3WFLA 4R7WA 5HXMA 5I24A 1YXYA 3DFNA 4KGJA 4H9VA 1GONA 1HP5A 1UC4A 1U33A 1TWIA 4NRSA 1AW5A 2BB0A 3VOIA 1FHDA 3MU7A 2XUCA 1LG1A 2E7FA 1XRFA 2ZZ5A 4JEQA 9RUBA 4PBGA 4CCCA 3RCNA 3GC4A 3GWQA 3RNDA 3SRHA 3LLFA 3CZGA 4B5WA 4DXVA 2TRSA 1EJSC 4JY9A 1L2UA 4Q6XA 3JZUA 4US6A 1XPGA 3RJXA 2QGHA 2R82A 3K13A 4D6CA 4MSSA 4W9PA 3O0KA 2PRLA 1XM3A 1IGSA 3KZSA 2CPUA 3CC1A 2IPFA 3B8SA 4CN4A 1ADSA 3IJ6A 3W1TA 5BXJA 8XIAA 4C6JA 3AIQA 3GVRA 3N2XA 4JQ3A 2CHNA 2VCAA 4XUYA 3ARPA 2EKGA 2XSAA 4UNIA 4N02A 1CXHA 3R43A 3LY0A 3ANUA 3WLQA 2AAAA 2OZ8A 2JIEA 4F4RA 4IMGA 3O5PA 2Y4SA 4HPXA 3SUUA 4TVCA 2XJ7A 4LYPA 1GK8A 2BASA 2XN0A 3GTXA 4UFMA 2WSQA 1A4MA 5FAJA 2YYUA 4EF9A 5CAHA 4MAVA 2V0TA 4O13A 2WANA 3PK7A 3W84A 2VVNA 1TIWA 3EWCA 1J0IA 1PKYA 4I5XA 4GISA 2R9RA 2VCCA 3QQWA 2FAPA 1UD5A 1BWVA 1F3WA 1LBFA 4ZPVR 2FQIA 4X2PA 2Y8KA 4ZB5A 1M7XA 3A5VA 2GVJA 5I0DA 4ODOA 1CW2A 4LVFA 3C0QA 2XPBA 2OJPA 4HN8A 4C90A 3R10A 1XISA 6ALDA 1EC9A 1XRVA 2PLMA 3H23A 1TCMA 2VO5A 1JFHA 4LUSB 3ZOAA 2Z2UA 2CIPA 4P5UA 4F79A 3QRHA 4HSNA 3TXZA 1KCKA 1JZ4A 5AC7A 3AWNA 5FEPA 2I56A 1QT1A 2IQTA 4Q8NA 4MDPA 2Z25A 4D72A 1FP9A 1JQXA 1GT8A 3MUCA 3WUGA 3PC0A 1XR2A 1WAWA 1A3XA 5LIYX 3IKGA 2YBUA 2F8QA 4JTUA 4PUUA 3UNTA 3GX9A 3V75A 4Z17A 2QIWA 1PJ9A 4C6KA 1ICQA 1XC4A 4AD4A 1VKFA 3WH0A 2DW6A 3CH0A 3EEGA 4GBDA 1XLFA 4IT6A 5I7GA 5AC8A 4GJ1A 3BJTA 2C1IA 3ELFA 5D9OA 3ZVHA 4J3XA 2J7GA 1PB0A 3OVQA 1VFFA 5BXTA 2XFYA 2Z1KA 3L2IA 4O11A 1RVGA 1T6MA 3W2UA 1LLOA 1NSGA 2FKPA 1O5QA 2UY3A 1JULA 4C6BA 1FWIC 2YIHA 4F48A 4Y9MA 1F4AA 3S3GA 4W7WA 3SCSA 2I57A 4DZ2A 1IEQA 1VFHA 2PCEA 3IGUA 5E5CA 2E6AA 4DJFC 4XZIA 3LPPA 3U2CA 1AD4A 2Q5AA 1OQFA 4OE7A 2XG9A 3CHFA 4KESA 1PKLA 4DJEA 5C9RA 2V5DA 3H2FA 3HIJA 2XIQA 3ZSTA 3R0KA 3CT2A 2ZRZA 3LRMA 3EB2A 4MMWA 5DN1A 4WSKA 3I6RA 1PE1A 4AEFA 4MWAB 4IWWA 3NM1A 3S2LA 4N7QA 3O5LA 3PPFA 4HHPA 1VBUA 2GOKA 1G01A 1OVDA 5CSRA 5K9CA 1Q6DA 1Q4NX 3LA4A 2DV0A 1ROUA 4IX0A 4JCMA 1GOIA 2D1ZA 5AOUA 1K7XA 2WKLA 3W7DA 3GUGA 4NF7A 3THDA 1EPVA 5I02A 3GH5A 2IW0A 1WDWA 2PLCA 1SZRA 2DSWA 3W1MA 1E3ZA 4H83A 4NAFA 1SJCA 1TTPA 3WYZA 2ZVRA 1J79A 3OZOA 3MUZ1 1J6OA 3GB6A 2D0HA 2YXGA 3NO5A 3OQ8A 5I3GA 1KV5A 1WOAA 3AS1A 3EPOA 3BGGA 3K4AA 1DKWA 3POCA 4LCSA 1LWHA 1G7VA 1ME7A 1QU4A 3SN4A 1TMQA 3LNPA 4Z2IA 4LAKA 2YW3A 4UQCA 3S2MA 2XINA 2ALRA 1RPXA 3CWHA 2MNTA 4IPPA 1RUSA 4URIA 1S5NA 1GTEA 3FV9A 2JKPA 3UR7A 3GTYX 1WA3A 1V7AA 2F38A 3FSUA 5HR6A 3AMLA 4QQUA 4WOZA 1LL4A 3ES8A 1ODZA 2WVVB 2PWVA 4UNLA 1A80A 3E02A 3GNXA 2DH3A 2HROA 3JW7A 5BXSA 2ONEA 1HJWA 3OG2A 1I60A 1ONRA 3QR0A 3N4AA 2ZICA 3K46A 1F3XA 3QR3A 2BHYA 4CD8A 1W5QA 2PSNA 1SJDA 4J3VA 1P1XA 2Z2AA 4UQEA 5TD4A 1E0XA 4LOCA 2WZTA 4IP4A 2CETA 2G0WA 4UFKA 3WK3A 3UQAA 2V38A 3VGGA 3ERPA 5EFFA 5PTDA 1Y8BA 2EPMX 2PZNA 3BOFA 1JF6A 4GKTA 3QTPA 4E4PA 1KBKA 3VD3A 1I8JA 1J0HA 1ZENA 3PBYA 4OV4A 3VZXA 4FF5A 2F21A 6A3HA 4D6FA 1ITUA 2QJGA 1GYNA 3GHRA 3GVGA 1FAPA 4J35A 3NQBA 5T9CE 2DSUA 1YBQB 2OQYA 3KHDA 4WJ8A 2LGOA 2AOSA 3NQ2A 2ZXAA 2WMHA 1E0VA 4HNOA 4NXKA 1LQ0A 4TYOA 3H6OA 4WSJA 3RR1A 3KXQA 3LPOA 5E6YA 2R14A 3W2LA 4MSPA 3WD2A 1V0MA 5A2CA 3OIHA 1FHVA 2XGIA 2V5BA 1NJJA 3KCLA 4F0SA 1GQKA 1A50A 2PDWA 2Y6ZA 2WYSA 3QSTA 3BG3A 3C61A 2Y1HA 3PZOA 1JDFA 2FPTA 2PDXA 1U22A 4GYFA 2EPHA 5ABTA 4FO4A 4GUFA 3R1ZA 3VIPA 4JTIA 4J27A 3BAKA 2OPJA 3BG5A 1FKFA 1ZJBA 4DB7A 3F4DA 3TC5A 1N8IA 3UERA 3W70A 4JTLA 1FKKA 1WB0A 1BWKA 2WKGA 3TYCA 3RO8A 4JFSA 4Z1CA 3REQA 5FJPA 2ETNA 3RLGA 4PMQA 4WDUA 1NAL1 4H8NA 2W63A 4PUMA 1S38A 4V15A 1XIIA 3OB8A 1E1CB 2QT3A 4M5PA 4PA8A 4TX6A 3LXCA 4HVXA 3R2GA 3KM8A 4GYPA 1TV7A 4JD4A 3P67A 1XH1A 4K6AA 2OFJA 3LD5A 2WMGA 3DKLA 4UCGA 4A3QA 2Q01A 3B05A 2CWNA 1M01A 4L7ZA 3ID7A 2BVDA 2Q02A 1XX1A 4M7SA 1GVOA 3S5OA 1VFLA 5HW8A 1JYWA 1S2AA 4HARA 1WKFA 1OK4A 1XIJA 1QJWA 1Q2RA 2PP0A 3WD4A 1LWJA 3C52A 2RAGA 1W5MA 2WXDM 4XQ6A 3EIPA 3CH9A 1FQ0A 1XYMA 4UZUA 3LPFA 4QG6A 1CZ1A 2VX5A 4FOKA 5HNRA 4NNAA 3DH7A 2PTZA 1EQCA 3WF0A 2XP8A 5CGMA 2F61A 1EFZA 3U7BA 4IICA 2WMFA 5DBTA 2E6FA 2CNCA 1NMWA 3EKLA 1TE6A 4GZEA 3VCRA 1EWDA 3UA3A 1SW7A 2ACQA 2QLYA 1QO5A 1Z89A 2HXTA 5JXQA 3B7XA 2QUUA 1LCOA 1VCFA 3GXPA 2WHMA 3EWXA 1PX4A 5DFAA 3SCRA 1E9ZB 1SZEA 2TODA 4ZPWR 1H1NA 3M0HA 1YE6A 2XVLA 4A2RA 3A4XA 4EAYA 1SR9A 1NH6A 2BNJA 3E0FA 2DT0A 4LS2A 3GPKA 4IJBA 2QCFA 1O1HA 3NJ3A 3SJ3A 2WBKA 1YTDA 2OWXA 3AXHA 2BTMA 3PZGA 5FEZA 2GPTA 3MP4A 3ARSA 3G5EA 3IV3A 4WJEA 3UI4A 4TX9A 3W2NA 5I03A 1J0KA 1OC7A 1HG3A 1IEXA 4YVPA 4MY8A 3U7VA 1F40A 1B4EA 4GY0A 1F76A 3W23A 3LU2A 1JZ3A 2EF9A 4ADSA 3VNZA 4XWUA 4LJ3A 2CESA 1VYSX 3SADA 2IUZA 3BAXA 5BOFA 3NZRA 2A3LA 2VGFA 5E93A 5A6BA 4DWSA 1F07A 2EAWA 4GXWA 2ITKA 3EKZA 3B8IA 3LGEA 4CCZA 4JYDA 1O1ZA 3C56A 4B5VA 5FF7A 4PCFA 2I17A 4LF1A 3MMDA 5JUVA 4KS0A 2FZ9A 5D32A 1NY1A 1I2QA 5A6MA 5BXRA 4LAVA 3JYJA 1UBSA 3WQ8A 3S1UA 4AX7A 2D2HA 1BF6A 4F2TA 3DFYA 3C5QA 5FSEC 3ZIZA 5EMMA 1UQYA 3GDKA 1FHUA 1NM9A 4TO8A 1JNTA 2YZ5A 2C1HA 5D2XA 4UTKA 4O54A 1P0KA 4AF0B 2IF4A 3USZA 3PBWA 3K8KA 3OJGA 1G9HA 3SRFA 2Y8VA 3T0TA 4AEEA 2CITA 4GUHA 3AQUA 2FGLA 4W9TA 3WEZA 4H3DA 4KRTA 3WQGA 3BOLA 3EPMA 4LV4A 5CKSA 2IXUA 3CGNA 2BS9A 5D75A 5C7HA 3FA3A 4H9ZA 1TRDA 2Z29A 3L4VA 2FH6A 3HOJA 3M5ZA 1LUCA 1GOXA 1HF6A 2PDBA 4LEQA 4AX6A 3NZQA 4WHBA 2NT0A 2XVNA 2WOQA 3ATYA 3ZR5A 3WQPA 2ZZ6A 4L9XA 1F7BA 3P8JA 3SAZA 3I6TA 5D2VA 1J0JA 1FFRA 3M5XA 3F2CA 1X6LA 7TAAA 1ITCA 4TVUA 6CGTA 3EB3A 3ZFHA 4R27A 1VJZA 3DENA 4OHQA 2V30A 2L5HA 4O1DA 5I98A 1WYIA 3M0ZA 3M64A 5DCBA 5JU6A 2E25A 4S3EA 5EB8A 3WF4A 3A3HA 4O0ZA 2NQLA 2BOGX 2VCBA 3KCEA 1PV8A 3B06A 1DEDA 3QJAA 3U2EA 5AYZA 1OHLA 5A6JA 2WM0A 1Z32X 1W1A1 3O06A 2WC3A 4ATDA 4PRTA 2WVTA 3WBYA 3W7PA 5I3JA 4WVXA 3VNLA 1E0WA 3QV7A 4YWSA 1Q1CA 3KRBA 1XLLA 5G2IA 4NIRA 4XTDA 2O9PA 4GXMA 2BXZA 3LLXA 1RY0A 4D6IA 1Q13A 1OFOA 3WEOA 1C8VA 3M6DA 5FEXA 4OTKA 3NSNA 3A13A 2Y5JA 2E5BA 1MZRA 4QIBA 2VURA 5H8PA 3SCQA 1UUOA 4DYKA 3WBXA 4UTHA 3LENA 3CZJA 4LB3A 1TELA 3OO2A 1J5SA 5HTGA 3ABQA 2YDQA 1KTNA 1KGUA 4WD0A 2QDGA 2GGGA 1L9WA 2OEKA 1W3JA 5DBUA 1BEUA 2X2GA 4FNUA 4N9BA 1K70A 3W85A 4ZQMA 3NZ1A 2WQDA 4V1YA 2A5HA 1W3KA 5LNVA 1AODA 1UCWA 4WJXA 2X42A 2ZBTA 1KR0A 1LJYA 3LLDA 3KP1A 3BO9A 3VKCA 3IK8A 3EDJA 4RXFA 4B3ZA 1YNQA 1TWZA 4GA8A 3W7IA 2ODOA 3BARA 3DGRA 1FKXA 5LNWA 3W01A 2XM1A 2HBXA 3I4KA 3WNNA 4W9QA 2VQTA 1YHTA 4H7ZA 1A5CA 3LCHA 2BHUA 4V27A 2VFFA 5B80A 2X40A 5I3IA 5F2LA 3M0LA 2VD9A 1OK6A 3NL5A 2YA2A 3GDTA 4LAUA 3AS2A 3P93A 5T91A 4Q33A 3CB3A 3H26A 4QLJA 2NQ5A 2Y89A 4J40A 3FGCB 4XBSA 4IMDA 4O1EA 3N3TA 4IJCA 4MVAA 3HU7A 3MI3A 4DM1A 1EZWA 1RQHA 3ZS4A 1WZMA 2CBVA 3GS6A 2WVUA 1B2YA 2VEFA 2PZ0A 4LT9A 1V08A 1JAKA 2DJLA 5AC4A 3NPXA 5AKQA 1VIZA 5C6MA 3UU0A 3WJSA 5BOEA 1XCXA 3AMCA 4IQDA 4RL3A 3CQKA 2OODA 4JY8A 4QAWA 3DGBA 5A8OA 3FKRA 3WLHA 4Q8QA 3MSDA 1UOZA 3NDZA 3PR9A 4GQGA 1NDVA 4G2PA 4DRKA 3K4WA 1REQA 1PZ3A 1TA3B 3IANA 4NKCA 4W89A 1UBPC 4AZIA 4N0RA 3PBGA 4FK9A 3VAWA 1F74A 4XD4A 4UNKA 3L23A 4PTNA 2G3FA 3E3HA 1EEPA 4ZXLA 3AC0A 5AB3A 3D3FA 3W28A 2IQ0A 2PU1A 1QW7A 4BZYA 3NM3A 1QK2A 4PUEA 1DWIM 3BC9A 3KZPA 3LRLA 3L4TA 4L5ZA 4ZE4A 4UQBA 3C2RA 3NQ7A 1A0CA 1RV8A 3VIFA 1DORA 3L21A 3RR4A 2O56A 3WD0A 3URQA 3PAJA 2BWGA 1B9BA 3UQIA 2KAUC 4GC3A 7XIMA 4I8DA 5J8LA 3ZVIA 3BAJA 1TVLA 5CH9A 2H3DA 2ADAA 3KOFA 4M51A 3RPDA 5IDZA 4YU1A 4IGNA 1EDQA 3UQBA 5KETA 3NWRA 4C6OA 4CUCA 1ESWA 1IXNA 5EMLA 1QBBA 2R1LA 4O18A 4Q8PA 3T4CA 5CPLA 3U8GA 3MT1A 1FJDA 3JU2A 4DBUA 1SO5A 2HE5A 2EULA 3KTXA 1PKMA 2INFA 3OBAA 1JI1A 1EH9A 4EANA 3W7KA 1TRIA 4NG3A 1QHOA 4U84A 2OSYA 4GPNA 4OBRA 1F2JA 2H9AB 5M1TA 2G95A 1PSCA 4XSLA 1E6XM 5LIKX 4H41A 3K30A 1PBKA 1XRTA 2I7GA 1V6WA 1DIKA 2HK1A 1C3FA 4AWEA 4CNNA 3NEHA 1EHAA 1E4NA 2E6DA 1LT8A 2D22A 1V6YA 1HKKA 4N9CA 4WF7A 2Y2WA 3ITGA 4N4PA 3P80A 2B0MA 1DXFA 1NF0A 3IVSA 3P7YA 3AOFA 1ROTA 1KKRA 1VFTA 1CPUA 4R7OA 3SSZA 4GCAA 3DFTA 1LQ2A 2PE4A 3ZT7A 3VOGA 2BY2A 4M81A 4US5A 5LA1A 2LPVA 2XGZA 4GC4A 2ISSA 4DJED 2PWUA 3CIXA 2REQA 4E8CA 4JDBA 4AZ5A 2RUQA 4YVVA 1OZQA 3GIYA 2PBOA 1XGEA 3P5YA 2WCAA 2OKOA 4ZMGA 1B3ZA 3QXBA 4GH3A 1D6OA 1R46A 4WDWA 2V3DA 1PIIA 1GZJA 1SPQA 3MCNA 4DRHA 1XBXA 3IJ9A 3L67A 1QTWA 1H60A 1PTDA 4Z42C 3H2CA 5C9ZA 2Q8XA 2G8ZA 4HCDA 1RR2A 3GNOA 3QOMA 1RA5A 2ISFA 3F03K 1VAHA 1XIEA 4UZSA 4FZIA 1OG6A 3MHFA 4I7VA 4CCEA 1JGMA 1VPXA 1HL8A 4P7QA 1ECQA 3FCPA 3F2DA 3W4RA 4XD6A 3ARRA 4D6HA 1UZ1A 3QZ6A 3N9SA 1AVAA 4MB5A 1ZJAA 5LHEA 4B2DD 4JTSA 3BAIA 3PANA 2RHGA 3WLMA 3N4EA 3QV6A 3V5CA 2QUTA 4JQ4A 2OT0A 4BI5A 1UQZA 2VJXA 4LRTA 3MDWA 4BWLA 1MUMA 4AZ6A 5C2GA 3BVJA 2FVMA 4Z08A 4PMNA 4XO6A 2DIEA 3LHWA 4XIAA 3DN5A 4JKMA 4LVAA 3VD7A 1PIGA 4H9MA 2V3EA 3HJEA 3TN4A 1ITQA 1EX1A 2E5CA 3DFQA 3PUDA 3W27A 5CJ5A 4JKLA 4Q4RA 2OYKA 1V02A 5F7UA 4NY2A 3ONBA 4QE4A 5FL1A 3DHDA 1O68A 3T09A 1Q6QA 2GJXA 3DU0A 1LG2A 4LXFA 2ZE3A 3BAYA 2QMKA 1EIXA 3W7RA 4RXGA 3O5RA 1N8WA 3ARTA 3V7PA 5HDRA 4NAEA 3AXMA 3HQOA 4RX0A 5FL0A 3EWYA 3UWYA 3CO4A 4RUBA 4LH8A 2V5JA 3MI2A 1QOQA 4MNJA 4K7VA 4JTHA 2RJHA 1LWIA 4NASA 4YCPA 1RD5A 3G1HA 4GZIA 4W9OA 4JYSA 4IL0A 1RCXB 1QW9A 1OCNA 3ABSA 3VM7A 4AZBA 4E2DA 3CPUA 4PFMA 2P88A 3WUBA 3B04A 2J4GA 3RX2A 3PTQA 4HTYA 5I23A 3F4NA 3T4WA 4MGVA 3H55A 1JCLA 3C2YA 2QZRA 2ZX6A 3QGKC 3WMBA 4QR6A 4R33A 1QI5A 3KDNA 1RALA 3QZEA 1ZJIA 4M6PA 1X7IA 3VAVA 3A4AA 2OKTA 4R3UA 1W1B1 1ADDA 4QE1A 1A5BA 3S2CA 2HDJA 3BH4A 4ZBCA 3AHXA 3F2BA 1KFKA 2D73A 5A6TC 1XYCA 3LI0A 2E6YA 5A3HA 2C15A 2X05A 2G37A 4AYSA 4F2UA 3WL0A 3SURA 3GU9A 3ZLFA 1ALDA 3GBDA 5XIAA 1KBIA 1JCYA 1G4EA 5CG7A 4DQWA 3E1F1 3S46A 4ZO9A 2CZ5A 3GAKA 3A24A 2HNHA 1TQJA 5HMSA 4JICA 4TV6A 4MOZA 3A4WA 2AAMA 5I6SA 4H7CA 4MFEA 5FJJA 4O17A 3W7NA 3WLOA 4ZS6A 3UF9A 2BZNA 4KBXA 2VXNA 3TN6A 2DGAA 2YLAA 1NOUA 3CZLA 1IWPA 4ERIA 3IJQA 2VI0A 2I1OA 3TN5A 2V5LA 2CLEA 2YZRA 3CUHA 5D9MA 1TE1A 5IOBA 3W3OA 1JUBA 4IXHA 5KEZA 4DHGA 4NILA 5CLWA 1TUFA 4KCUA 2HSAA 4Y9OA 1E70M 3ITYA 4ATLA 3STGA 3WLKX 5DRCA 4I7WA 3KAFA 1TV8A 1WAUA 3TYUA 2NQ9A 3UZZA 2EO7A 1SFTA 4ONVA 1E5NA 5U4NA 3W7MA 2OU4A 2C13A 3KVMA 3WG6A 5CZKA 2GQ8A 2ZC8A 2HBVA 3FIGA 4JHOA 1KA9F 1B31A 1SUXA 1ENUA 4PE8A 1UPMB 1J0ZA 3DFPA 1X38A 2E28A 3LZ5A 3GC2A 3KTCA 2XZ7A 3RGTA 3M9YA 2VX6A 1IT8A 2WPGA 3VM5A 1QPLA 3BG9A 1VD6A 4HSHA 3MB9A 3B8WA 2ZQUA 4Q7BA 4JKKA 4QS5A 4WOQA 5F2IA 1BVNP 4M3PA 4YTTA 1SQ7A 1BVWA 4JFMA 3W7GA 3SM0A 3PZVA 4UMCA 3VCNA 3ARWA 1AZ1A 3UG5A 3MYOA 1QK0A 2YB1A 4I7UA 1Q6HA 1BXCA 3M1ZA 1HO1A 4HNLA 3NFUA 1AQ0A 3TJXA 2NSOA 5KTLA 3PR2A 4TR9A 4DXXA 1QNRA 2YFNA 3T8LA 4HHMA 1OWQA 4B3KA 1UKSA 1CX9A 1IZJA 5HOSA 3T44A 1OF8A 2NXIA 3BLDA 1QWGA 2GUYA 3PULA 3WLLA 4IM4A 1EQPA 4GD0A 2PB1A 3HQPA 3AUJA 4QEHA 4QNEA 1E6QM 3CBWA 4FS9A 3TJLA 2V2DA 1MUWA 1OT1A 2A6NA 1JZ5A 2NSXA 2Y8UA 3EWWA 5A6BD 3DCPA 3C6CA 3MV01 3TOYA 2XH4A 1OX4B 2DZXA 3FVDA 3B9AA 3O5EA 2VEMA 4B9YA 5DITA 3TA6A 2A85A 4L3NA 4P7OA 3N6JA 3KAOA 3LXBA 3DX5A 2A2IA 4UB9A 2Y63A 3EOEA 3H21A 3KBNA 4RDYA 1KWGA 1MFVA 2WZHA 3HFYA 2V82A 1E0UA 2ZR6A 4AMCA 3KWXA 6TAAA 4AZHA 1EYEA 1HP4A 4JNMA 4H9XA 3GXTA 3L4UA 1I1WA 1ME8A 1H0GA 2BY0A 4UMBA 2QJHA 4RE4A 2ZQTA 3ITXA 2H8ZA 3D47A 3ZR4A 1LRTA 4XG1A 1Z8AA 5DX7A 3UYIA 2GQ3A 3C4UA 4DO5A 1UR9A 3PG8A 4NZ5A 4CQDA 2FVLA 3QOKA 2QXWA 3N13A 4NRRA 4X3ZA 2M1IA 3W2MA 3QYSA 4RZ5A 1IQ8A 2QMJA 1SSGA 3Q4DA 4Z2KA 2GJPA 2AL1A 2XIOA 3GAYA 5HQEA 1Q7QA 5C8BB 4RNFA 1UWQA 3OGVA 1HKIA 4ZO8A 1KBBA 4Q4QA 4JYEA 1F3TA 1QNOA 1N7KA 5E1QA 4XKYB 1IT7A 3K1DA 1UZDA 4G7EB 1GVQA 2JE8A 3GHTA 1UG6A 4DEFA 2WNWA 1XH2A 4Y7EA 1WV2A 1R47A 1VBJA 3HMCA 2PWHA 3KP0A 4G8TA 3EDFA 4D6DA 1QPNA 2GDVA 9XIAA 3DFOA 4KF1A 3WQFA 4DY1A 3SBFA 4EWND 4IPJA 3AXXA 3LI1A 1M41A 1Q6UA 1RD6A 4U86A 1PYFA 1HKWA 1OF6A 4XTIA 4HN4A 3AROA 2JKEA 2FTPA 1ZBCA 4XZHA 4JYFA 3PBVA 1RBAA 2VR2A 4B91A 1FWSA 3PRBA 2FMOA 4PBEA 3AHVA 1ZGDA 2J25A 2J9XA 4YXGA 1BKHA 3MCMA 1XG4A 2C79A 3EEZA 1FWJC 1ZB5A 1FUYA 4JQ1A 4LAMA 3T2QA 2YBVA 3B4YA 3GNNA 4UQDA 1AL7A 2D3NA 2C18A 1TPUA 4IISA 2A3HA 1UJPA 1QHZA 4BF8A 2QNEA 3EDKA 3IK4A 4NX5A 3MKKA 3DG3A 3EA2A 3MWCA 1C92A 4CN6A 1SSDA 3M0XA 2J8FA 5M5DA 2QUNA 2VRQA 1MEHA 1AJ2A 1OC6A 3BDKA 3II1A 3THQA 2VCDA 3CJPA 4L56A 3ZJ8A 1ZAIA 1BGAA 3N73A 4GBUA 1W1ZA 2V6AA 4J2MA 3R89A 3VNJA 2KFWA 2I14A 3VIJA 4YPJA 3W1AA 3GTNA 3M0JA 4L64A 4AU0A 3OHIA 1M68A 4JTDA 1UP0A 3OU8A 1XIMA 3WLIA 3MP3A 3OZYA 4A3UA 4UFJA 1M5WA 3B0PA 1Q3NA 2VDHA 5JVLA 3T0CA 3LB0A 1JUEA 3CU2A 3AJXA 4ROPA 1GWJA 1WDRA 4CVWA 1P5QA 4CU7A 1E44A 1Z6KA 3WF2A 3TR9A 1FKLA 4LBSA 4ICMA 1MQPA 4LC8A 5DO2A 4DZHA 2BP1A 3NQ8A 4IMEA 3M43A 7REQB 3HBLA 1XLCA 3SN0A 1GG1A 4WR3A 3KABA 3TDFA 2Y7EA 1L6WA 5DO8A 4L6HA 3T07A 3OG3A 2ZYFA 2NX3A 3V4BA 3WZ0E 2XH2A 2YCLB 4MTVA 1OFPA 4H9UA 3W6LA 4NYUA 2DUZA 4HOXA 3B4UA 2AQWA 1TX2A 3TYZA 4HA4A 3WQ6A 4GK8A 4P8XA 1EGMA 1FFQA 2QJIA 4DO4A 3LERA 4MY9A 2Y7DA 2PA6A 3NUKA 4NYYA 1JEZA 2DZWA 3W87A 2OLHA 3Q2DA 4D8ZA 4RW5A 4GFSA 2O7SA 5CPNA 4GG9A 2VFDA 3GNPA 3NYDA 3U5UA 1GW9A 2ASHA 2XVPA 2PN0A 2E09A 3PJTA 3IGSA 2J75A 4YTSA 1ZRQA 1QNPA 3VUPA 1R86A 1DPMA 1U30A 1BKSA 1DXEA 5DT5A 4DRPA 4J4KA 3WLSA 3KBVA 3BGJA 3RLUA 3CHVA 1BRLB 4KKXA 1QVBA 4U4MA 5D2TA 4C6MA 4DRNA 3T55A 4FHAA 3SGUA 2BGNE 2CW6A 2CLKA 1SMAA 4M24A 4AAJA 1EA0A 4RV3A 3MTWA 1WXJA 1JPKA 1FWTA 3A5FA 5AC6A 5E6ZA 2YSWA 3KX6A 1NDYA 1DQUA 4BF9A 1V7YA 1OX5A 3LGDA 2W67A 4LUSA 4RZ6A 3VOCA 1TIMA 1ECEA 2VELA 4RJEA 4B16A 4MYXA 3DBPA 3CLWA 4XAYA 2INZA 4PCTA 1KCZA 3IVUA 4ZEPA 3UG3A 3R4IA 3QV9A 3RCYA 1JVWA 4J4OA 4DZ5A 2DUXA 4BKNA 1CI1A 2MANA 3VGEA 1TWDA 1E4IA 4FB7A 2JQXA 1VH7A 1ZPTA 3MP5A 4Q8VA 3SGGA 4GVGA 3YPIA 3OVRA 1F4HA 1P1MA 1JYXA 4P8UA 4G9PA 2DVXA 3RFAA 3BJFA 4FI4A 1KXTA 3B8VA 5HW6A 4FPSA 5K9XA 4MZYA 4HHLA 2DSZA 3G1AA 1LBMA 5CSUA 4EPBC 3JVAA 3TH6A 4A3RA 4Z2GA 2H3BA 4PUDA 1XLIA 1UWSA 1L6GA 2E9MA 4DIPA 3VC6A 1S1PA 3AXKA 3WQCA 3VE9A 2QV4A 1WBHA 3BANA 2VX4A 5TNVA 3V5FA 5CAKA 4Y8FA 4DUVA 1C8XA 3MI6A 4POCA 5A6KA 5E09A 3W1QA 2PI6A 2XWDA 2O7QA 3AIWA 5FJUA 1VEPA 2PF0A 3EDEA 1EB3A 4KEVA 3LMZA 2YL9A 2WVSA 3PFRA 2ZA3A 3P0XA 3QPYA 4C6NA 3VIHA 4ODLA 3CV1A 1SO3A 2X1SA 1HKJA 3FSTA 5CC5A 4MJ4A 2WW5A 4HK6A 5A1AA 3WBEA 3H7VA 4OBSA 3H2NA 1RK5A 2PMQA 3LHVA 1FH8A 1W3LA 3O3RA 3FY1A 1R3VA 1VCGA 2TPSA 1YXDA 2R8WA 2HNEA 1IWBA 1MNZA 4UCFA 1EXPA 4GJIA 3OZPA 3F7JA 3B03A 1PO9A 2OMAA 4UOZA 2L2SA 3WX7A 2ZA1A 4W5ZA 3OLDA 2FYMA 4M82A 3NNTA 2WQPA 2FB3A 2Z2BA 1DE5A 2KX9A 2OEJA 5AVHA 5IBXC 1UUMA 3O5GA 5HWMA 2ATMA 3RN6A 4EK7A 3OTRA 1R9XA 4YHGA 1VB9A 4IIDA 5D8WA 1K9DA 3L68A 1PKNA 3N6HA 3Q37A 4FNSA 3I4EA 2TSYA 1J11A 2Y0FA 2Z00A 3SCNA 2OX4A 1VFSA 4K36A 3QY8A 4PGLA 2PWEA 4CD4A 3OP2A 4RNHA 4M1BA 3GK0A 2QJJA 1MRAA 1TPVA 2OSXA 1GKRA 4WY0F 2V8ZA 1UD4A 3UXAA 1JPHA 1NOFA 4BQ5A 3G3MA 3QPEA 2PTDA 3N2TA 2Z6IA 3MUY1 3N2OA 3RIKA 3GDRA 3Q67A 3WK0A 1YLVA 3C3UA 3SSJA 4OFCA 4O1CA 1I4NA 4PCNA 1GQJA 3CAQA 4Y9AA 1S3HA 3H4XA 3VKAA 2OELA 5EY5A 1Y5VA 2RJGA 3M7SA 3KAIA 4KCTA 2WJFA 3TTYA 5IHRA 1OSEA 6PTDA 3TTSA 1UHVA 1B4KA 2PDHA 3U2OA 4AHPA 1EF2A 3MYPA 1PX8A 2ZXQA 3UJEA 5DY3A 1M03A 4MF4A 3ONCA 1TZ9A 1OFQA 5HWBA 3L12A 3TFCA 4IUOA 3Q65A 2AGTA 3UI6A 4MNLA 4JFVA 4YNGA 1NWTA 2VFIA 3LHTA 5C70A 1LL7A 1G67A 3UBPC 3GHUA 1OD0A 4UIOA 3B9EA 3DAQA 3L0GA 2QAPA 4WKAA 3OVPA 4OOZA 5HUAA 1X7FA 3WEMA 1W9VA 4J4NA 1DJQA 3ALGA 3SIZA 4ZO6A 1EF3A 5D8ZA 3R0UA 2Y85A 3ZVHB 4ODPA 2Y24A 4UR8A 4IIFA 1BPLB 3N2CA 2D69A 3ZLHA 3NI6A 1HN1A 1T5AA 2J66A 3M44A 5GPRA 3OGRA 2C8NA 3WDRA 1O60A 5H8UA 1EO5A 1ZP3A 1PEZA 2ZE0A 2VC9A 4RW3A 1Z41A 2PPOA 2WB5A 4J7RA 1CXIA 3HQNA 2DZVA 2ABAA 3VIMA 2WMIA 1F05A 3HMJG 1BQCA 2QPSA 3UP8A 2RSEA 1LL6A 2Z1SA 4NZFA 3UF8A 3IEBA 4BQ2A 3EOUA 3SY5A 1G0CA 2PS2A 4GRSA 3RF9A 2BX7A 1IZKA 3SZ8A 1E72M 2DORA 2W61A 2AGKA 4LF2A 4XBJA 4R53A 3WELA 4XKMA 4C1KA 3AHZA 1W54A 3B3DA 1XDMA 2PTXA 1M9HA 1MQRA 2GGHA 3WF3A 3S9ZA 4GE8A 4H2CA 5FIPA 3OLIA 3WY1A 4DAIA 1H7WA 3CHCA 1MI3A 2YPIA 2B81A 1WXYA 3TYAA 1B54A 3P84A 1Q2SA 3UVIA 3E0WA 1OBAA 4NAFB 3VZZA 2FDMA 1LTDA 4L80A 3B0VC 1W9XA 3FFSA 2DZTA 1R9YA 1L8NA 3NQ6A 4QLLA 4ZXOA 1FRBA 1LZOA 5F4SA 5DRIA 4ZOCA 3IV8A 1EPXA 4ZO7A 5EBAA 3WH8A 2WNZA 2G97A 3CLMA 1G6CA 1ISYA 1XQKA 3PPCA 1OD8A 3M4HA 4BK9A 2BG5A 3URNA 3BMXA 3F4CA 1GRJA 1G4SA 4LV9A 2PDGA 4CNUA 1V3JA 4DF2A 2Q3RA 4GIVA 1FKHA 1JR1A 1U5JA 4ZQRA 3S1GA 3SW6A 3LSBA 3WUEA 1C93A 5GNXA 3DHUA 1BTCA 2X1IA 4Z2LA 4S2BA 5BOOA 1QW8A 3BL3A 2ZZ7A 3VFCA 3R94A 3NEVA 1H63A 3W26A 2GJNA 3GNDA 1N82A 3W7EA 3R5EA 1M7PA 4AB4A 5F4XA 2EG6A 5J04A 3DHFA 1CB2A 4PB4A 4HBKA 2WLZA 1K8YA 4AXKA 5AHIA 3S5SA 1TV3A 3WLPA 3PB2A 4IIGA 3CL8A 4NX0A 3VOHA 5E70A 4S3KA 2K8IA 3RU8X 1GG0A 4CQCA 2VVSA 4M1RA 1VRXA 4BY3A 1EEXA 4WUIA 1ZS2A 4EOUA 1MMFA 4IP7A 1XLAA 3PBUA 3TW6A 4MWAC 3ABXA 5EGRA 4UFIA 1S2CA 1P48A 5HAOA 4FXJA 4NJGA 2ZZ2A 1I0DA 3L0KA 4UFHA 4JZ5A 4JPGA 3GXDA 5BWAA 2ZX8A 3ITTA 3OPSA 3KEHA 4M7TA 2GJLA 3KBSA 1VBHA 1OYAA 1PDZA 4WZHA 4E3VA 2VN1A 4C6IA 4QT3A 5E9XA 1GVFA 4W85A 3RFWA 1GEQA 2NXHA 4OBTA 3KTSA 1H41A 4W8BA 2Q8LA 1U5VA 1FXQA 1FCVA 3WJXA 1GOQA 2QKFA 1RLCL 3GIPA 1QI2A 4JTKA 4U5IA 1EDGA 3STEA 4ZR8A 4ERGA 1KT1A 1X1NA 4F0HA 4ALDA 4K68A 1TUXA 2ZVIA 2V2HA 2CYGA 3CASA 2UV8G 3VD9A 4ATWA 3AMDA 3GD6A 1IR1A 3VO0A 3PG9A 4TQTA 1QUMA 4DVOA 2X30A 3GLCA 4BHYA 3G1XA 1KQZA 1JNSA 4AF0A 4LS0A 1SZGA 1CXFA 4PUWA 4D6GA 3THAA 1VLIA 2VFHA 4YLWA 1XG3A 4AW7A 4R88A 1KBLA 1BSLA 2X7WA 1BYDA 3A3WA 3ORWA 3L4XA 3PY2A 3EWZA 4ZTXA 2X1UA 2BXYA 1PWMA 4W93A 1J12A 3A12A 1HQTA 3IIXA 3F5JA 1S5WA 4FLSA 2CLLA 3SFKA 1R9HA 1S2UA 4PTWA 1JDDA 4PODA 4AIOA 2ZRXA 2WC7A 3REQB 3GDLA 2Z1BA 4I5RA 1EHNA 1A5KC 2JFEX 5ABGA 1RCQA 2WWDA 4ZPTR 3KOWA 2HMCA 1RJPA 3L2LA 3GM8A 1D8CA 5I06A 2YCJA 2FZBA 1GEHA 3QW3A 4QS6A 2ZX7A 1GQIA 1MXSA 2PPPA 3FHQA 3P0WA 4B4HA 5KSWA 2E9LA 3APTA 4LFYA 4JFJA 4OV9A 3LG3A 1FDYA 3UJ2A 4YVXA 3H7RA 2OGJA 1W1VA 1S5TA 3EPNA 3NDYA 5CZTA 2ZRVA 4JFTA 3NR0A 2RUCA 1KGWA 2PLKA 3QMTA 1BXNA 4GINA 4NQ1A 4O8RA 4Q8OA 2YXXA 1U1UA 2IS7A 3LBOA 3W6YA 3STPA 2P0OA 3OA3A 4DJFA 3VD4A 1HL2A 3VOJA 2G41A 3WDPP 4QG9A 2XHYA 4N4QA 2FZMA 1E6SM 4IIBA 1BF2A 3E5PA 2R6OA 1TZZA 1H5YA 1R0MA 5KINA 1CDGA 3QHNA 4N9DA 3JRKA 4HJFA 1DHPA 1GKPA 3FHAA 2YKKA 4LALA 3LBCA 3XISA 3QY6A 1ZJHA 4QHRA 5DMNA 2LJ4A 4KETA 2XP4A 4I9TA 4J3TA 5D09A 2BVTA 3IIZA 3L4ZA 3MC5A 3AS0A 2ZKMX 3FKKA 3AYVA 3IIOA 5I3HA 3H54A 1D2KA 1VFUA 4ZENA 2ZZ1A 2C0AA 4TOQA 5CJNA 2N87A