4DX5D

Transport of drugs by the multidrug transporter acrb involves an access and a deep binding pocket that are separated by a switch-loop
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
156
structure length
156
Chain Sequence
GSDLGKKLLEAARAGRDDEVRILMANGADVNAADVVGWTPLHLAAYWGHLEIVEVLLKNGADVNAYDTLGSTPLHLAAHFGHLEIVEVLLKNGADVNAKDDNGITPLHLAANRGHLEIVEVLLKYGADVNAQDKFGKTAFDISINNGNEDLAEILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Transport of drugs by the multidrug transporter AcrB involves an access and a deep binding pocket that are separated by a switch-loop.
pubmed doi rcsb
molecule keywords Acriflavine resistance protein B
molecule tags Membrane protein, transport protein
source organism Escherichia coli
total genus 52
structure length 156
sequence length 156
chains with identical sequence E
ec nomenclature
pdb deposition date 2012-02-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4dx5D00
3HG0D 4QQIA 2KXPC 2ZGDA 5ENOD 4DX6D 4DX5D 4C48B 1BD8A 2V4HC 5D66A 3UI2A 2P2CP 3JUEA 3KEAA 4K5CA 5CBOA 1NFIE 1AWCB 3DEOA 3EHRA 2F37A 3Q9NC 1DCQA 2KBXA 1YYHA 1SVXA 3AAAC 3B7BA 4HRLA 4RLYA 1A5EA 3DEPA 3ZU7B 5JA4D 3J5PA 4UUCA 4J7WA 1MX2A 3C5RA 3AJIA 2DVWA 3F6QA 5FINA 3ZNGA 2Y0BG 4K5AB 5ENRD 2HE0A 3B95A 5HS0A 3V30A 4CZ2D 2AJAA 2QC9A 1YMPA 3TWTA 3Q9UC 4LG6A 1OT8A 3NOGD 4HLLA 5AQ9A 4DX2A 5EILA 5AQBA 2FO1E 2XEEA 4TUMA 4ZFHA 5AAOA 1K1AA 5EIBE 2QYJA 5ENSD 3IXEA 3V31A 1MX6A 4B93B 5ITZF 4BESA 4HQDA 2A5EA 4U96D 5EIDA 4U8YD 4BERA 3TWXA 1BI7B 3V2OA 5CECB 4N5QA 4F6RD 1YCSB 3TWQA 2RFAA 1WDYA 4G8KA 3UTMA 5KNGA 4DUIA 4HI8A 2VGEA 2XZDG 4O1PA 3NBNB 3W9FA 4O60A 2BKKB 1SW6A 4LSZE 1D9SA 1MJ0A 3LJNA 1G3NB 2PNNA 2V5QC 5JMND 5KWDA 5ENTD 1K1BA 3EU9A 3TWSA 3HRAA 5KNHD 4J8YA 4JB8P 4DRXE 4HRMB 5HRYA 2J8SD 1K3ZD 3JXJA 3JXIA 4O1OA 2MYOA 2DWZA 5BXUA 3T8KA 1AP7A 3W9GA 3TWUA 2Y1LE 4ZHBA 5EYLA 4OAUC 4DX7D 3ZUVB 2F8YA 5AN8A 5ENQD 4F1PA 5BXOA 4BEPA 4DX1A 4GMRA 5CEAA 1IKND 4ATZD 1IHBA 2XEHA 4U95D 1IXVA 3EHQA 5AQ7A 4CYMD 5CBNA 1MX4A 2L6BA 5AARA 1N11A 1WG0A 4GPMA 4K5BA 4G8LA 1S70B 2ETBA 4HI9A 4HB5A 4BSZB 3V79K 1BLXB 1N0RA 4HRNA 2ETAA 3T9KA 3UXGA 5CEDB 3J5QB 2ZGGA 1OY3D 1TR4A 5CERB 2DZNA 2BKGA 2JABA 1N0QA 2XZTG 3NOCD 5HKPA 2ETCA 3TWVA 5AQAA 3D9HA 3TWWA 3ZKJA 1UOHA 1DC2A 4NIKA 5FIOA 1MYOA 3TWRA 1BU9A 4U8VD 5EYPF 3SO8A 5EN5D 2NYJA 4YDYA 5ENPD 5KBAA 2XENA 4LNUD 4QFVA 1QYMA 4A63B 4YDWA 3V2XA 4OAVB 2DZOA 1BI8B 2B0OE 4Z68A 2F8XK 2RFMA 4HBDA 4HNAD 4BETA
chains in the Genus database with same CATH superfamily
2NSZA 5D66A 2WXLA 2KZTB 4K5CA 3EHRA 3L82A 4HORA 2CHZA 2NC9A 3B95A 5JHBA 2EQXA 3Q9UC 1VDYA 1INZA 3GZ2A 1ZU2A 4CGVA 5ENSD 3AS4A 1LF8A 1HXIA 4JHKA 4GTQA 2RFAA 4G8KA 1ELKA 3UTMA 2YHEA 2YQ8A 5JMND 3OXFA 5KWDA 3R7RA 2E2EA 4LUNU 4ACLA 1L5JA 3T8KA 3TAXA 1IYGA 4L2YA 2WQ6A 3ZHEA 4FLBA 2UY1B 1E96B 1HH8A 1D8DA 4ANUA 4HOSA 5BW8C 1WM5A 3CVLA 4ILIA 1OXJA 1S63A 4K5BA 4V3IA 3PUJA 2XCBA 4J8FA 3CV0A 3OXGA 3T9KA 3QNKA 3UXGA 5J90A 1W3BA 1OY3D 3UM3A 3FTXA 1FVFA 3TWVA 2CFZA 5EYPF 4AJWA 1PC2A 2DZOA 4Z68A 4I17A 1SQMA 3Q4AB 4BETA 1SVXA 1ELRA 3UM1A 3DWLG 3U66A 2KCVA 4Q94A 4A3TA 4BWRA 4LG6A 3I5PA 4LNGA 4FHJA 1OUVA 4I43A 1DVPA 3ASFA 3MV2B 2MHKA 3BU8A 3ESKA 3LVQE 5CCMA 5KNGA 4GYOA 1KT1A 4GCNA 1N95A 3MJWA 4JZYA 1ELWA 3AS8A 2DYSE 3MGBA 1EDUA 1N54A 3PE3A 1K3ZD 3L9TA 3W9GA 3CSFA 4LERA 1H6PA 4FULA 4XEIG 2KC7A 5FQ7A 2LAIA 4W9RA 3QDNA 4OYSA 1E90A 3DSTA 5KJNA 5D0OD 4F7AA 1S70B 3E33A 3IV0A 4BSZB 3TG5A 1BLXB 2OV8A 3CHQA 4YNDA 3HVEB 3ZIMA 5ANRA 4G25A 4RSYA 4MRUA 3TWRA 3P1UA 2XQ0A 4CEMA 2V4LA 1X5BA 4AM9A 5T4YA 3NZUA 4N5CA 4HBDA 2X38A 1FPPA 3FUKA 3EU5A 4DX6D 4C48B 4KBQA 3X2QE 2I1JA 3PZ4A 2LAHA 2GRNB 3I4RB 4FP7A 2KM4A 2LUHA 3CR3A 4UUCA 2EIJE 1UG3A 3NOGD 1H0AA 4BSXA 4E6HA 4TXQA 3HXBA 4BESA 4HQDA 4U8YD 2LSUA 4GMJA 3PDNA 1E8ZA 1JCSA 3UMVA 2PZIA 2J49A 4LEUA 1V55E 3ABME 4TRQA 4LCTA 5CRUA 4U0ZA 3MKQB 3EHNA 4OAUC 3UIOC 4AY5A 3LKUA 3ASHA 4A1SA 3Q7FA 4GTPA 4MLPA 3UT4A 4NACA 3ZXPA 2E0IA 1QZ2A 2QYUA 2EILE 3UINC 3CEQA 4UWGA 2AW6A 3FTWA 1YA0A 2FI7A 3E34A 1NI1A 5AJDA 4HFGA 3GW4A 2IOLA 4AXHA 3FU5A 3D9HA 3TWWA 1UOHA 4BFRA 4PH4B 5JJ6A 3QWPA 3QARA 3N71A 5G04J 2UWJG 3L16A 1IQUA 2H6IA 3E37A 3QOUA 3CVWA 3JUEA 3KEAA 3Q5MA 3FUEA 2RKKA 2WXPA 1DCQA 5KJMA 5LCWJ 1MZCA 5E76A 4URKA 3CVVA 5ARFA 4GMLA 2Y0BG 5HS0A 1ZBPA 4L23A 2FBNA 4JHJA 4A3VA 4DX2A 4GA1A 2R05A 4EZLA 2CHXA 3D9MA 2BKKB 3KSQA 2VGXA 3UIPC 4J8YA 3CGHA 3MYVA 3SF4A 4WWOA 4FJZA 4C0EA 3SNXA 1KZOA 1QNFA 3EDTB 3Q79A 4ME2A 3S7BA 5BXOA 4BEPA 4G2VA 3UT8A 3AG4E 3G2TA 4I6JA 4CYMD 3PH0C 3LS8A 4JEUA 3TL5A 5B3SE 3JUIA 4XIFA 2R02A 4M3OA 2ONDA 5B1AE 3WG7E 4XKCA 4AOFA 1HG5A 3HXFA 2KZTA 4EBAA 4FLHA 4G23A 3QKYA 3SI5A 3EJNA 3MA5A 4KVOA 1Z6TA 2WQHA 1V54E 2ZGDA 1HG2A 4U7EB 3DEOA 2CHWA 1N4QA 4IULA 1SA4A 4BX8A 3G2UA 3QWVA 4J7WA 3ULYA 3FY4A 3ENEA 5ENRD 2HE0A 4FA6A 1OT8A 1UJKA 5JJ7A 5AAOA 4RG6A 1LTXA 3RU0A 5AIJA 2WMNA 1SA5A 3ZYQA 4FU3A 4KT6B 3FH8A 2UY1A 1TNOA 4Y6WA 3B7UX 5CHEE 2LO6A 3EU9A 4JD2G 2CFUA 1OWNA 2J8SD 3RAUA 5BXUA 1NL4A 4BY6A 3EUVA 4DX7D 3FUIA 3ESLA 3FUDA 4HLEA 4HXIA 2IO3C 3D3MA 3KSLA 4DX1A 3FFLA 1E7UA 2L6BA 2IQCA 1HU3A 4CCAA 4KZ0A 4Y6CA 1OCCE 2Y4TA 3LVRE 2IO2C 5HKPA 4L2LA 1PY1A 3ZPJA 1HS6A 4TV3A 1QYMA 3CK8A 2ZXWE 5G55A 1EYHA 3ASNE 3FTUA 1A5EA 4MBGA 4M7CA 3F6QA 3L13A 2YNQA 3GZ1A 3R7QA 3NB2A 4CZ2D 5AQBA 3QB2A 3DSUA 5FJYA 4AVXA 2HO1A 4XI9A 5ITZF 1RZ4A 4U96D 3B7TA 3TWXA 2RD0A 2J4BA 1QQEA 3CK7A 4H7YA 3CHMA 3FTSA 2GROB 2P9SG 1G3NB 3UUXA 1OCRE 1OCZE 1KZPA 3MCXA 4GZ5A 4UWLA 5EYLA 4XE0A 5BUZA 2X6HA 1LD8A 1IKND 1N4SA 3HVEA 4EHMA 3D9PA 1HO8A 4ILHB 2ZU6B 2J9QA 3FTVA 3L22A 4D10C 4HOUA 2FULA 4U8HA 2A5UA 5G04C 2BKGA 4GAAA 2XZTG 2IONA 3BG1B 2XPZA 3O48A 1Z3YA 5LCWC 1WY6A 4CGWA 2AWIA 3CVQA 3FULA 3ZVVA 3CVPA 2QY7A 1LD7A 3LY7A 3ZYLA 4N39A 2JEKA 2L9BA 3B13A 3BQOA 4RLYA 3HXDA 4UQZA 2Y4UA 3LCAA 3CKCA 3L6AA 3P2BA 1IHGA 4HOTA 5CCLA 2FO1E 2XCCA 2GRLA 2QYJA 3MKQA 2A5EA 4A55A 5FTPA 5DBKA 3TWQA 3VLDA 4GTMA 4UQYA 1N4PA 3NBNB 2VSXE 4KXKB 4LSZE 4PS8A 3AS5A 3LJNA 3E30A 4YDOA 2LXMA 2C0MA 3DSWA 4FJYA 3ZW3A 2KCLA 5HRYA 5DIZA 4O1OA 1TNYA 3TJPA 4ACKA 2MOWA 3ZFWA 4MS6A 4F1SA 3CHRA 1U3CA 4N3BA 2AVPA 1U3DA 4L1BA 3FDHA 4EBAG 1N4RA 4J8SA 5G05J 1QBQA 2KATA 4J0UA 1S0PA 3QJZA 3D9IA 3ONLA 3CVXA 3T8MA 3RKVA 4FC8A 3NOCD 3ZKJA 1KT0A 2L0TB 3G2WA 4U07A 5FQ8A 3PZ3A 5ENPD 4JPSA 5A7DB 4OAVB 3B7RL 1DCEA 3S2AA 3LY8A 1Y6IA 4GTOA 1HZ4A 2P9KG 4OVUA 2OCCE 3TXMA 3QK0A 4EQFA 3QWWA 2DVWA 5EKQD 5T8IA 1YMPA 1H2TC 3FU6A 4HVBA 5AQ9A 4U63A 2H6FA 2IFUA 3LPZA 3ZXSA 5CECB 3B7SA 4UWFA 4R7LA 4HI8A 2VGEA 3SFYA 4O60A 3CIAA 5ANLA 1JCRA 1TN6A 2V8SE 2OOEA 4JB8P 2WMOA 1AP7A 1N9AA 3TWUA 2XGOA 4DLOA 3OTNA 4GB9A 3S7JA 5KJLA 3K9IA 4CDNA 3FEXA 3CVUA 2C0LA 3RRUA 4WNGA 3HXCA 4K03A 3Q49B 4GCOA 3G2VA 3AG1E 3ASOE 5CERB 2JABA 1JPLA 2P9PG 2DBAA 4I2ZA 1H19A 4U8VD 1HFAA 2WXFA 4AP2A 4YDWA 3SHFA 3D9KA 4UI9K 1E8YA 4YVOA 1JCQA 3T5XA 4DI4A 3LJ3A 2X3MA 4L7TA 3SY2A 4B94A 4GA0A 4WNFA 5ARGA 1YYHA 4C0MA 2OEVA 2X6JA 3PZDA 1MX2A 2DCPA 3C5RA 4X8QA 4RVBA 1MHQA 3ISMC 1FT2A 4KYOB 4ANXA 4E85A 5EILA 1B89A 3RIBA 1TEZA 3SGHA 2YHCA 4GZ3A 1SW6A 4KMOA 5HQ8A 1FT1A 2L6JA 4LRZA 1X81A 4HRMB 5AJLA 4FADA 2WQ7A 2P58C 4ZHBA 5T3RA 4UI9J 4B89A 3ZN3A 5AN8A 2AXUA 2XPIA 1RW2A 3L17A 3T5VA 3FH5A 2LSVA 1HE8A 1O5MA 3EIJA 4B8AA 3CHOA 3EHMA 1XNFA 2WXIA 3V79K 3ABLE 4HRNA 3IEGA 4UQXA 2XHEA 4MKTA 3FU0A 2WXMA 4WUYA 2H6HA 3MEKA 3CHPA 5AQAA 1DC2A 5FIOA 1MYOA 1NP7A 3I3NA 2LNIA 3SO8A 2LXLA 3E32A 5KBAA 1SZ9A 3HXEA 4JC8A 3UKRG 4H7XA 3D9OA 2WXNA 3LY9A 2P9LG 1BD8A 4JVSA 3GZSA 2XGMA 4EZKA 2HR2A 5D0QD 4UWHA 5M72A 3AAAC 4EZJA 4TXPA 4I1MA 1UN8A 4J6IA 2XRYA 3NAWA 1HF8A 2WXKA 4J8DA 3ONKA 5B1BE 2JLBA 5C2YA 4TUMA 3CK9A 1K1AA 3V31A 5EX0A 4AY6A 4GYWA 3OAWA 4F6RD 2VSNA 4GU5A 4G26A 2I1KA 2CG2A 2KCKA 1K1BA 4AEZC 4XI0A 3HHMA 2VTBB 3ASGA 2Y1LE 1UW4B 2BF0X 2VSYA 5G05C 4KVMA 5CMYA 2X6KA 3UM0A 4GTTA 2EIME 5D2MC 4HI9A 4HB5A 3NQPA 2PM7A 5ENNA 3Q73A 3DPYA 5E75A 2ZGGA 3FTYA 3Q75A 3ML9A 1O1SA 4WWNA 1H6KA 4U04A 5BT1A 1O1TA 1TNZA 5EN5D 2IY0C 3HIZA 4U0UA 1Z5SC 2VSOE 3RJVA 3UM2A 3MZLB 5IY5E 4QQIA 2KXPC 3SD5A 1Z3XA 2ILRA 4DX5D 4JEHA 2X6FA 2IU1A 3WXXA 2J09A 3PZ1A 3FHEA 3J5PA 4BT9A 3BUAA 5CMWA 3UQ3A 4ATGA 2AJAA 1N94A 3D9JA 5KCMA 3U4TA 2XRZA 3PREA 2XEEA 4ZFHA 4I1AA 3RO3A 5EIBE 2A4ZA 4BERA 4GYYA 5LX8A 3FU3A 3C3RA 4JA7A 3KS2A 2GGFA 2GRPB 3HRAA 4DRXE 1DNPA 4I9CA 3APFA 2GW1A 4ABNA 5FT9A 2P9UG 5ENQD 4N2QA 4GMRA 5J08A 2RG8A 4G24A 2WVIA 2X6IA 1Q2ZA 4PUCA 4A1GA 2R2LA 4JA9A 1JWGA 3TGOA 4RG9A 3JQ1A 4RQIA 3DXMG 3UX4A 1TR4A 3D9LA 2GRRB 2WXOA 4FHKA 3CVNA 2R59A 4LNUD 3L08A 3V2XA 1TNUA 3CKBA 4GZDA 2FF4A 1E8WA 4F3VA 1UN9A 5AYWD 2P9NG 2PQNA 5JA4D 3ZYKA 3ULQA 4DK5A 3VLEA 2DYRE 3AG2E 1FVHA 2XPYA 4DPRA 4Q69A 2V0PA 5FZQA 2Y3AA 3UKUG 3IXEA 4GPKA 1MX6A 3C98A 3IHVA 3V2OA 1BI7B 4NQ0A 5BV1A 1E7VA 3W9FA 3FEYA 1MJ0A 3OXLA 2V5QC 5ENTD 3BEEA 3U64A 4UI9C 2H6GA 1TJFA 3O4ZA 3RRMB 3LEWA 2MYOA 2WXHA 2C2LA 2ZIRA 1E8XA 5EX3A 3DXKG 3E4BA 3UT7A 3DPDA 3QAQA 1WG0A 3PUKA 4NRHB 4XKBA 3URZA 3DSSA 2OVBA 2L0IA 4NURA 3DSVA 1N0QA 3VLFA 1KLXA 2J4DA 1NA3A 1TN7A 3MKRA 4I1OB 3HDXA 2B0OE 4YDEA 4KZCA 1P5QA 3ZRHA 2RFMA 5JHAA 4I2WA 3S7DA 3PEUB 1OWPA 5ENOD 1S64A 4G1TA 1AWCB 2WXQA 3I4GA 2F37A 5LOZA 1TNBA 3ZU7B 4UWKA 2Y69E 3AU5A 5FINA 4OVVA 3TWTA 3S7FA 2HYZA 1MQSA 1IQRA 3IKOB 3JYSA 5A6CA 2Q7FA 4DLQA 3R9MA 3BG0B 3LYAA 5KNHD 3UPVA 2NXPA 4PDXA 4CT0A 4N3CA 1ZB1A 3KEZA 4B0ZA 3JXIA 1N52A 3EIQC 3ZGQA 3PRZA 1WAO1 3FP3A 2GRMA 2MRIA 3PNTB 3AU4A 2BUGA 5FQ6A 3PZ2A 1H2UA 2QZAA 4U95D 4EECA 3MV3B 5CBNA 1N11A 4GPMA 2EINE 3FUNA 2J07A 1XGWA 3ZHEB 1N0RA 4I6GA 2WXGA 2WPVA 2DZNA 2FEZA 3KAEA 2ETCA 3FH7A 3IBEA 4N3AA 5C1DA 1BU9A 4L9PA 3ABKE 4U0SA 2NYJA 4YDYA 2YINA 4ANVA 3FWVA 5FWQA 3HG0D 3L54A 4ANWA 2V4HC 3UI2A 2XGSA 5H7PA 1GW6A 4BTAA 1NA0A 3CHSA 2IF4A 1D8EA 2PQRA 4K5AB 2QC9A 2XEVA 5A23A 4CT4A 3FUHA 4GTVA 4C9BB 2VTBA 2WM9A 3FUMA 3RSEG 4G11A 2IEJA 4N5QA 1YCSB 2XZDG 4GTRA 2B6CA 1A17A 4PS3A 4I6EA 2OVFA 1EF1C 1UJJA 2FO7A 3FUFA 3APDA 3CSTA 2WXJA 4BTBA 1OWLA 3Q7AA 1JWFA 2F8YA 4F1PA 3SFZA 2F0YA 3C72A 4XZ4A 5LP0A 2XEHA 2I9CA 3EHQA 3RO2A 2AXVA 4APOA 4G8LA 2ETBA 2BEDA 5BV0A 4GZ6A 5BNWA 4XX5A 2ETAA 4I9EA 3DSXA 3PNLB 2IJGX 2IOSA 2PL2A 4BT8A 4WAFA 4CDRA 2J08A 3SFXA 2R17C 2F8XK 2VJ8A 1D9SA 2OEWA 4JL0A 1NFIE 3SQVA 5BPPA 3Q15A 3NF1A 3B7BA 4HRLA 5AENA 3FUJA 2WXRA 4IRUA 4HOQA 1FCHA 3ZNGA 4F53A 3V30A 3Q47B 4JHRA 5CRVA 2I6HA 5G2NA 4B93B 5EIDA 4APFA 3MX3A 5JJTA 4JXTA 1TJCA 1HX8A 3PS6A 1H2VC 1O1RA 1Y8MA 4O6FA 3VTXA 3R9AB 3JXJA 3ULEG 2EIKE 3CQCB 1K8KG 3PEVB 2WB2A 2PM6A 3ZEFA 2HM8A 3LXUX 4EPZA 1IHBA 1BPOA 5FZSA 4P29A 3RK6A 3PE4A 1MX4A 4IYPA 1PAQA 3U9WA 3D9NA 2VYIA 1NZNA 5EDSA 3Q78A 2CG3A 2M63A 3LDZA 3SBSA 1TYQG 4PS7A 2BTDA 4NIKA 2XS1A 3DBSA 2XENA 4A63B 4QFVA 4JW1A 3DRAA 2R5SA 1SZAA 4J8EA 4DI3A 3PVLA 4ILGA 2P2CP 5CBOA 3Q9NC 2KBXA 4GTSA 1KPSB 3DEPA 3CQGB 4CDMA 3AJIA 3VTYA 4BX9A 3SBTB 5KJKA 3IHYA 1U2VG 5FZRA 3C3QA 4HLLA 2V5FA 4Q96A 1EPUA 3QC1A 3ASDA 4YVQC 4DJAA 2AXZA 2P9IG 4CRWA 2XS8A 5FQ4A 4HS2A 1WDYA 3SZ7A 4DUIA 4O1PA 4LNBA 3FTZA 4GA2A 2PNNA 4GZCA 3KD7A 3TWSA 3TXNA 5LFAA 4WNDA 2DWZA 1JUQA 3G2SA 1OWOA 3CVYA 3TG4A 3ZUVB 3JCKC 3APCA 3NZSA 2VGXB 4ATZD 3HYMB 5CEAA 3C3OA 2VGYA 2ZISA 1IXVA 5AQ7A 3U3WA 2I2OA 5AARA 2QFCA 4IN3B 4AV7A 2GRQB 3ZYMA 2DIWA 3AG3E 1OWMA 3RRNB 5CEDB 3J5QB 2VQ2A 4TUUA 2R03A 3ML8A 4TXRA 3CLJA 4WWPA 1H6OA 3GYZA 4AIFA 1TN8A 3JQ0A 5HI7A 4N2SA 1OCOE 1BI8B 4B8CB 4WNEA 4K0RA 4HNAD
chains in the Genus database with same CATH topology
3HG0D 4QQIA 2KXPC 2ZGDA 5ENOD 4DX6D 4DX5D 4C48B 1BD8A 2V4HC 5D66A 3UI2A 2P2CP 3JUEA 3KEAA 4K5CA 5CBOA 1NFIE 1AWCB 3DEOA 3EHRA 2F37A 3Q9NC 1DCQA 2KBXA 1YYHA 1SVXA 3AAAC 3B7BA 4HRLA 4RLYA 1A5EA 3DEPA 3ZU7B 5JA4D 3J5PA 4UUCA 4J7WA 1MX2A 3C5RA 3AJIA 2DVWA 3F6QA 5FINA 3ZNGA 2Y0BG 4K5AB 5ENRD 2HE0A 3B95A 5HS0A 3V30A 4CZ2D 2AJAA 2QC9A 1YMPA 3TWTA 3Q9UC 4LG6A 1OT8A 3NOGD 4HLLA 5AQ9A 4DX2A 5EILA 5AQBA 2FO1E 2XEEA 4TUMA 4ZFHA 5AAOA 1K1AA 5EIBE 2QYJA 5ENSD 3IXEA 3V31A 1MX6A 4B93B 5ITZF 4BESA 4HQDA 2A5EA 4U96D 5EIDA 4U8YD 4BERA 3TWXA 1BI7B 3V2OA 5CECB 4N5QA 4F6RD 1YCSB 3TWQA 2RFAA 1WDYA 4G8KA 3UTMA 5KNGA 4DUIA 4HI8A 2VGEA 2XZDG 4O1PA 3NBNB 3W9FA 4O60A 2BKKB 1SW6A 4LSZE 1D9SA 1MJ0A 3LJNA 1G3NB 2PNNA 2V5QC 5JMND 5KWDA 5ENTD 1K1BA 3EU9A 3TWSA 3HRAA 5KNHD 4J8YA 4JB8P 4DRXE 4HRMB 5HRYA 2J8SD 1K3ZD 3JXJA 3JXIA 4O1OA 2MYOA 2DWZA 5BXUA 3T8KA 1AP7A 3W9GA 3TWUA 2Y1LE 4ZHBA 5EYLA 4OAUC 4DX7D 3ZUVB 2F8YA 5AN8A 5ENQD 4F1PA 5BXOA 4BEPA 4DX1A 4GMRA 5CEAA 1IKND 4ATZD 1IHBA 2XEHA 4U95D 1IXVA 3EHQA 5AQ7A 4CYMD 5CBNA 1MX4A 2L6BA 5AARA 1N11A 1WG0A 4GPMA 4K5BA 4G8LA 1S70B 2ETBA 4HI9A 4HB5A 4BSZB 3V79K 1BLXB 1N0RA 4HRNA 2ETAA 3T9KA 3UXGA 5CEDB 3J5QB 2ZGGA 1OY3D 1TR4A 5CERB 2DZNA 2BKGA 2JABA 1N0QA 2XZTG 3NOCD 5HKPA 2ETCA 3TWVA 5AQAA 3D9HA 3TWWA 3ZKJA 1UOHA 1DC2A 4NIKA 5FIOA 1MYOA 3TWRA 1BU9A 4U8VD 5EYPF 3SO8A 5EN5D 2NYJA 4YDYA 5ENPD 5KBAA 2XENA 4LNUD 4QFVA 1QYMA 4A63B 4YDWA 3V2XA 4OAVB 2DZOA 1BI8B 2B0OE 4Z68A 2F8XK 2RFMA 4HBDA 4HNAD 4BETA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HG0 D;  4QQI A;  2KXP C;  2ZGD A;  5ENO D;  4DX6 D;  4DX5 D;  4C48 B;  1BD8 A;  2V4H C;  5D66 A;  3UI2 A;  2P2C P;  3JUE A;  3KEA A;  4K5C A;  5CBO A;  1NFI E;  1AWC B;  3DEO A;  3EHR A;  2F37 A;  3Q9N C;  1DCQ A;  2KBX A;  1YYH A;  1SVX A;  3AAA C;  3B7B A;  4HRL A;  4RLY A;  1A5E A;  3DEP A;  3ZU7 B;  5JA4 D;  3J5P A;  4UUC A;  4J7W A;  1MX2 A;  3C5R A;  3AJI A;  2DVW A;  3F6Q A;  5FIN A;  3ZNG A;  2Y0B G;  4K5A B;  5ENR D;  2HE0 A;  3B95 A;  5HS0 A;  3V30 A;  4CZ2 D;  2AJA A;  2QC9 A;  1YMP A;  3TWT A;  3Q9U C;  4LG6 A;  1OT8 A;  3NOG D;  4HLL A;  5AQ9 A;  4DX2 A;  5EIL A;  5AQB A;  2FO1 E;  2XEE A;  4TUM A;  4ZFH A;  5AAO A;  1K1A A;  5EIB E;  2QYJ A;  5ENS D;  3IXE A;  3V31 A;  1MX6 A;  4B93 B;  5ITZ F;  4BES A;  4HQD A;  2A5E A;  4U96 D;  5EID A;  4U8Y D;  4BER A;  3TWX A;  1BI7 B;  3V2O A;  5CEC B;  4N5Q A;  4F6R D;  1YCS B;  3TWQ A;  2RFA A;  1WDY A;  4G8K A;  3UTM A;  5KNG A;  4DUI A;  4HI8 A;  2VGE A;  2XZD G;  4O1P A;  3NBN B;  3W9F A;  4O60 A;  2BKK B;  1SW6 A;  4LSZ E;  1D9S A;  1MJ0 A;  3LJN A;  1G3N B;  2PNN A;  2V5Q C;  5JMN D;  5KWD A;  5ENT D;  1K1B A;  3EU9 A;  3TWS A;  3HRA A;  5KNH D;  4J8Y A;  4JB8 P;  4DRX E;  4HRM B;  5HRY A;  2J8S D;  1K3Z D;  3JXJ A;  3JXI A;  4O1O A;  2MYO A;  2DWZ A;  5BXU A;  3T8K A;  1AP7 A;  3W9G A;  3TWU A;  2Y1L E;  4ZHB A;  5EYL A;  4OAU C;  4DX7 D;  3ZUV B;  2F8Y A;  5AN8 A;  5ENQ D;  4F1P A;  5BXO A;  4BEP A;  4DX1 A;  4GMR A;  5CEA A;  1IKN D;  4ATZ D;  1IHB A;  2XEH A;  4U95 D;  1IXV A;  3EHQ A;  5AQ7 A;  4CYM D;  5CBN A;  1MX4 A;  2L6B A;  5AAR A;  1N11 A;  1WG0 A;  4GPM A;  4K5B A;  4G8L A;  1S70 B;  2ETB A;  4HI9 A;  4HB5 A;  4BSZ B;  3V79 K;  1BLX B;  1N0R A;  4HRN A;  2ETA A;  3T9K A;  3UXG A;  5CED B;  3J5Q B;  2ZGG A;  1OY3 D;  1TR4 A;  5CER B;  2DZN A;  2BKG A;  2JAB A;  1N0Q A;  2XZT G;  3NOC D;  5HKP A;  2ETC A;  3TWV A;  5AQA A;  3D9H A;  3TWW A;  3ZKJ A;  1UOH A;  1DC2 A;  4NIK A;  5FIO A;  1MYO A;  3TWR A;  1BU9 A;  4U8V D;  5EYP F;  3SO8 A;  5EN5 D;  2NYJ A;  4YDY A;  5ENP D;  5KBA A;  2XEN A;  4LNU D;  4QFV A;  1QYM A;  4A63 B;  4YDW A;  3V2X A;  4OAV B;  2DZO A;  1BI8 B;  2B0O E;  4Z68 A;  2F8X K;  2RFM A;  4HBD A;  4HNA D;  4BET A; 
#chains in the Genus database with same CATH topology
 2NSZ A;  5D66 A;  2WXL A;  2KZT B;  4K5C A;  3EHR A;  3L82 A;  4HOR A;  2CHZ A;  2NC9 A;  3B95 A;  5JHB A;  2EQX A;  3Q9U C;  1VDY A;  1INZ A;  3GZ2 A;  1ZU2 A;  4CGV A;  5ENS D;  3AS4 A;  1LF8 A;  1HXI A;  4JHK A;  4GTQ A;  2RFA A;  4G8K A;  1ELK A;  3UTM A;  2YHE A;  2YQ8 A;  5JMN D;  3OXF A;  5KWD A;  3R7R A;  2E2E A;  4LUN U;  4ACL A;  1L5J A;  3T8K A;  3TAX A;  1IYG A;  4L2Y A;  2WQ6 A;  3ZHE A;  4FLB A;  2UY1 B;  1E96 B;  1HH8 A;  1D8D A;  4ANU A;  4HOS A;  5BW8 C;  1WM5 A;  3CVL A;  4ILI A;  1OXJ A;  1S63 A;  4K5B A;  4V3I A;  3PUJ A;  2XCB A;  4J8F A;  3CV0 A;  3OXG A;  3T9K A;  3QNK A;  3UXG A;  5J90 A;  1W3B A;  1OY3 D;  3UM3 A;  3FTX A;  1FVF A;  3TWV A;  2CFZ A;  5EYP F;  4AJW A;  1PC2 A;  2DZO A;  4Z68 A;  4I17 A;  1SQM A;  3Q4A B;  4BET A;  1SVX A;  1ELR A;  3UM1 A;  3DWL G;  3U66 A;  2KCV A;  4Q94 A;  4A3T A;  4BWR A;  4LG6 A;  3I5P A;  4LNG A;  4FHJ A;  1OUV A;  4I43 A;  1DVP A;  3ASF A;  3MV2 B;  2MHK A;  3BU8 A;  3ESK A;  3LVQ E;  5CCM A;  5KNG A;  4GYO A;  1KT1 A;  4GCN A;  1N95 A;  3MJW A;  4JZY A;  1ELW A;  3AS8 A;  2DYS E;  3MGB A;  1EDU A;  1N54 A;  3PE3 A;  1K3Z D;  3L9T A;  3W9G A;  3CSF A;  4LER A;  1H6P A;  4FUL A;  4XEI G;  2KC7 A;  5FQ7 A;  2LAI A;  4W9R A;  3QDN A;  4OYS A;  1E90 A;  3DST A;  5KJN A;  5D0O D;  4F7A A;  1S70 B;  3E33 A;  3IV0 A;  4BSZ B;  3TG5 A;  1BLX B;  2OV8 A;  3CHQ A;  4YND A;  3HVE B;  3ZIM A;  5ANR A;  4G25 A;  4RSY A;  4MRU A;  3TWR A;  3P1U A;  2XQ0 A;  4CEM A;  2V4L A;  1X5B A;  4AM9 A;  5T4Y A;  3NZU A;  4N5C A;  4HBD A;  2X38 A;  1FPP A;  3FUK A;  3EU5 A;  4DX6 D;  4C48 B;  4KBQ A;  3X2Q E;  2I1J A;  3PZ4 A;  2LAH A;  2GRN B;  3I4R B;  4FP7 A;  2KM4 A;  2LUH A;  3CR3 A;  4UUC A;  2EIJ E;  1UG3 A;  3NOG D;  1H0A A;  4BSX A;  4E6H A;  4TXQ A;  3HXB A;  4BES A;  4HQD A;  4U8Y D;  2LSU A;  4GMJ A;  3PDN A;  1E8Z A;  1JCS A;  3UMV A;  2PZI A;  2J49 A;  4LEU A;  1V55 E;  3ABM E;  4TRQ A;  4LCT A;  5CRU A;  4U0Z A;  3MKQ B;  3EHN A;  4OAU C;  3UIO C;  4AY5 A;  3LKU A;  3ASH A;  4A1S A;  3Q7F A;  4GTP A;  4MLP A;  3UT4 A;  4NAC A;  3ZXP A;  2E0I A;  1QZ2 A;  2QYU A;  2EIL E;  3UIN C;  3CEQ A;  4UWG A;  2AW6 A;  3FTW A;  1YA0 A;  2FI7 A;  3E34 A;  1NI1 A;  5AJD A;  4HFG A;  3GW4 A;  2IOL A;  4AXH A;  3FU5 A;  3D9H A;  3TWW A;  1UOH A;  4BFR A;  4PH4 B;  5JJ6 A;  3QWP A;  3QAR A;  3N71 A;  5G04 J;  2UWJ G;  3L16 A;  1IQU A;  2H6I A;  3E37 A;  3QOU A;  3CVW A;  3JUE A;  3KEA A;  3Q5M A;  3FUE A;  2RKK A;  2WXP A;  1DCQ A;  5KJM A;  5LCW J;  1MZC A;  5E76 A;  4URK A;  3CVV A;  5ARF A;  4GML A;  2Y0B G;  5HS0 A;  1ZBP A;  4L23 A;  2FBN A;  4JHJ A;  4A3V A;  4DX2 A;  4GA1 A;  2R05 A;  4EZL A;  2CHX A;  3D9M A;  2BKK B;  3KSQ A;  2VGX A;  3UIP C;  4J8Y A;  3CGH A;  3MYV A;  3SF4 A;  4WWO A;  4FJZ A;  4C0E A;  3SNX A;  1KZO A;  1QNF A;  3EDT B;  3Q79 A;  4ME2 A;  3S7B A;  5BXO A;  4BEP A;  4G2V A;  3UT8 A;  3AG4 E;  3G2T A;  4I6J A;  4CYM D;  3PH0 C;  3LS8 A;  4JEU A;  3TL5 A;  5B3S E;  3JUI A;  4XIF A;  2R02 A;  4M3O A;  2OND A;  5B1A E;  3WG7 E;  4XKC A;  4AOF A;  1HG5 A;  3HXF A;  2KZT A;  4EBA A;  4FLH A;  4G23 A;  3QKY A;  3SI5 A;  3EJN A;  3MA5 A;  4KVO A;  1Z6T A;  2WQH A;  1V54 E;  2ZGD A;  1HG2 A;  4U7E B;  3DEO A;  2CHW A;  1N4Q A;  4IUL A;  1SA4 A;  4BX8 A;  3G2U A;  3QWV A;  4J7W A;  3ULY A;  3FY4 A;  3ENE A;  5ENR D;  2HE0 A;  4FA6 A;  1OT8 A;  1UJK A;  5JJ7 A;  5AAO A;  4RG6 A;  1LTX A;  3RU0 A;  5AIJ A;  2WMN A;  1SA5 A;  3ZYQ A;  4FU3 A;  4KT6 B;  3FH8 A;  2UY1 A;  1TNO A;  4Y6W A;  3B7U X;  5CHE E;  2LO6 A;  3EU9 A;  4JD2 G;  2CFU A;  1OWN A;  2J8S D;  3RAU A;  5BXU A;  1NL4 A;  4BY6 A;  3EUV A;  4DX7 D;  3FUI A;  3ESL A;  3FUD A;  4HLE A;  4HXI A;  2IO3 C;  3D3M A;  3KSL A;  4DX1 A;  3FFL A;  1E7U A;  2L6B A;  2IQC A;  1HU3 A;  4CCA A;  4KZ0 A;  4Y6C A;  1OCC E;  2Y4T A;  3LVR E;  2IO2 C;  5HKP A;  4L2L A;  1PY1 A;  3ZPJ A;  1HS6 A;  4TV3 A;  1QYM A;  3CK8 A;  2ZXW E;  5G55 A;  1EYH A;  3ASN E;  3FTU A;  1A5E A;  4MBG A;  4M7C A;  3F6Q A;  3L13 A;  2YNQ A;  3GZ1 A;  3R7Q A;  3NB2 A;  4CZ2 D;  5AQB A;  3QB2 A;  3DSU A;  5FJY A;  4AVX A;  2HO1 A;  4XI9 A;  5ITZ F;  1RZ4 A;  4U96 D;  3B7T A;  3TWX A;  2RD0 A;  2J4B A;  1QQE A;  3CK7 A;  4H7Y A;  3CHM A;  3FTS A;  2GRO B;  2P9S G;  1G3N B;  3UUX A;  1OCR E;  1OCZ E;  1KZP A;  3MCX A;  4GZ5 A;  4UWL A;  5EYL A;  4XE0 A;  5BUZ A;  2X6H A;  1LD8 A;  1IKN D;  1N4S A;  3HVE A;  4EHM A;  3D9P A;  1HO8 A;  4ILH B;  2ZU6 B;  2J9Q A;  3FTV A;  3L22 A;  4D10 C;  4HOU A;  2FUL A;  4U8H A;  2A5U A;  5G04 C;  2BKG A;  4GAA A;  2XZT G;  2ION A;  3BG1 B;  2XPZ A;  3O48 A;  1Z3Y A;  5LCW C;  1WY6 A;  4CGW A;  2AWI A;  3CVQ A;  3FUL A;  3ZVV A;  3CVP A;  2QY7 A;  1LD7 A;  3LY7 A;  3ZYL A;  4N39 A;  2JEK A;  2L9B A;  3B13 A;  3BQO A;  4RLY A;  3HXD A;  4UQZ A;  2Y4U A;  3LCA A;  3CKC A;  3L6A A;  3P2B A;  1IHG A;  4HOT A;  5CCL A;  2FO1 E;  2XCC A;  2GRL A;  2QYJ A;  3MKQ A;  2A5E A;  4A55 A;  5FTP A;  5DBK A;  3TWQ A;  3VLD A;  4GTM A;  4UQY A;  1N4P A;  3NBN B;  2VSX E;  4KXK B;  4LSZ E;  4PS8 A;  3AS5 A;  3LJN A;  3E30 A;  4YDO A;  2LXM A;  2C0M A;  3DSW A;  4FJY A;  3ZW3 A;  2KCL A;  5HRY A;  5DIZ A;  4O1O A;  1TNY A;  3TJP A;  4ACK A;  2MOW A;  3ZFW A;  4MS6 A;  4F1S A;  3CHR A;  1U3C A;  4N3B A;  2AVP A;  1U3D A;  4L1B A;  3FDH A;  4EBA G;  1N4R A;  4J8S A;  5G05 J;  1QBQ A;  2KAT A;  4J0U A;  1S0P A;  3QJZ A;  3D9I A;  3ONL A;  3CVX A;  3T8M A;  3RKV A;  4FC8 A;  3NOC D;  3ZKJ A;  1KT0 A;  2L0T B;  3G2W A;  4U07 A;  5FQ8 A;  3PZ3 A;  5ENP D;  4JPS A;  5A7D B;  4OAV B;  3B7R L;  1DCE A;  3S2A A;  3LY8 A;  1Y6I A;  4GTO A;  1HZ4 A;  2P9K G;  4OVU A;  2OCC E;  3TXM A;  3QK0 A;  4EQF A;  3QWW A;  2DVW A;  5EKQ D;  5T8I A;  1YMP A;  1H2T C;  3FU6 A;  4HVB A;  5AQ9 A;  4U63 A;  2H6F A;  2IFU A;  3LPZ A;  3ZXS A;  5CEC B;  3B7S A;  4UWF A;  4R7L A;  4HI8 A;  2VGE A;  3SFY A;  4O60 A;  3CIA A;  5ANL A;  1JCR A;  1TN6 A;  2V8S E;  2OOE A;  4JB8 P;  2WMO A;  1AP7 A;  1N9A A;  3TWU A;  2XGO A;  4DLO A;  3OTN A;  4GB9 A;  3S7J A;  5KJL A;  3K9I A;  4CDN A;  3FEX A;  3CVU A;  2C0L A;  3RRU A;  4WNG A;  3HXC A;  4K03 A;  3Q49 B;  4GCO A;  3G2V A;  3AG1 E;  3ASO E;  5CER B;  2JAB A;  1JPL A;  2P9P G;  2DBA A;  4I2Z A;  1H19 A;  4U8V D;  1HFA A;  2WXF A;  4AP2 A;  4YDW A;  3SHF A;  3D9K A;  4UI9 K;  1E8Y A;  4YVO A;  1JCQ A;  3T5X A;  4DI4 A;  3LJ3 A;  2X3M A;  4L7T A;  3SY2 A;  4B94 A;  4GA0 A;  4WNF A;  5ARG A;  1YYH A;  4C0M A;  2OEV A;  2X6J A;  3PZD A;  1MX2 A;  2DCP A;  3C5R A;  4X8Q A;  4RVB A;  1MHQ A;  3ISM C;  1FT2 A;  4KYO B;  4ANX A;  4E85 A;  5EIL A;  1B89 A;  3RIB A;  1TEZ A;  3SGH A;  2YHC A;  4GZ3 A;  1SW6 A;  4KMO A;  5HQ8 A;  1FT1 A;  2L6J A;  4LRZ A;  1X81 A;  4HRM B;  5AJL A;  4FAD A;  2WQ7 A;  2P58 C;  4ZHB A;  5T3R A;  4UI9 J;  4B89 A;  3ZN3 A;  5AN8 A;  2AXU A;  2XPI A;  1RW2 A;  3L17 A;  3T5V A;  3FH5 A;  2LSV A;  1HE8 A;  1O5M A;  3EIJ A;  4B8A A;  3CHO A;  3EHM A;  1XNF A;  2WXI A;  3V79 K;  3ABL E;  4HRN A;  3IEG A;  4UQX A;  2XHE A;  4MKT A;  3FU0 A;  2WXM A;  4WUY A;  2H6H A;  3MEK A;  3CHP A;  5AQA A;  1DC2 A;  5FIO A;  1MYO A;  1NP7 A;  3I3N A;  2LNI A;  3SO8 A;  2LXL A;  3E32 A;  5KBA A;  1SZ9 A;  3HXE A;  4JC8 A;  3UKR G;  4H7X A;  3D9O A;  2WXN A;  3LY9 A;  2P9L G;  1BD8 A;  4JVS A;  3GZS A;  2XGM A;  4EZK A;  2HR2 A;  5D0Q D;  4UWH A;  5M72 A;  3AAA C;  4EZJ A;  4TXP A;  4I1M A;  1UN8 A;  4J6I A;  2XRY A;  3NAW A;  1HF8 A;  2WXK A;  4J8D A;  3ONK A;  5B1B E;  2JLB A;  5C2Y A;  4TUM A;  3CK9 A;  1K1A A;  3V31 A;  5EX0 A;  4AY6 A;  4GYW A;  3OAW A;  4F6R D;  2VSN A;  4GU5 A;  4G26 A;  2I1K A;  2CG2 A;  2KCK A;  1K1B A;  4AEZ C;  4XI0 A;  3HHM A;  2VTB B;  3ASG A;  2Y1L E;  1UW4 B;  2BF0 X;  2VSY A;  5G05 C;  4KVM A;  5CMY A;  2X6K A;  3UM0 A;  4GTT A;  2EIM E;  5D2M C;  4HI9 A;  4HB5 A;  3NQP A;  2PM7 A;  5ENN A;  3Q73 A;  3DPY A;  5E75 A;  2ZGG A;  3FTY A;  3Q75 A;  3ML9 A;  1O1S A;  4WWN A;  1H6K A;  4U04 A;  5BT1 A;  1O1T A;  1TNZ A;  5EN5 D;  2IY0 C;  3HIZ A;  4U0U A;  1Z5S C;  2VSO E;  3RJV A;  3UM2 A;  3MZL B;  5IY5 E;  4QQI A;  2KXP C;  3SD5 A;  1Z3X A;  2ILR A;  4DX5 D;  4JEH A;  2X6F A;  2IU1 A;  3WXX A;  2J09 A;  3PZ1 A;  3FHE A;  3J5P A;  4BT9 A;  3BUA A;  5CMW A;  3UQ3 A;  4ATG A;  2AJA A;  1N94 A;  3D9J A;  5KCM A;  3U4T A;  2XRZ A;  3PRE A;  2XEE A;  4ZFH A;  4I1A A;  3RO3 A;  5EIB E;  2A4Z A;  4BER A;  4GYY A;  5LX8 A;  3FU3 A;  3C3R A;  4JA7 A;  3KS2 A;  2GGF A;  2GRP B;  3HRA A;  4DRX E;  1DNP A;  4I9C A;  3APF A;  2GW1 A;  4ABN A;  5FT9 A;  2P9U G;  5ENQ D;  4N2Q A;  4GMR A;  5J08 A;  2RG8 A;  4G24 A;  2WVI A;  2X6I A;  1Q2Z A;  4PUC A;  4A1G A;  2R2L A;  4JA9 A;  1JWG A;  3TGO A;  4RG9 A;  3JQ1 A;  4RQI A;  3DXM G;  3UX4 A;  1TR4 A;  3D9L A;  2GRR B;  2WXO A;  4FHK A;  3CVN A;  2R59 A;  4LNU D;  3L08 A;  3V2X A;  1TNU A;  3CKB A;  4GZD A;  2FF4 A;  1E8W A;  4F3V A;  1UN9 A;  5AYW D;  2P9N G;  2PQN A;  5JA4 D;  3ZYK A;  3ULQ A;  4DK5 A;  3VLE A;  2DYR E;  3AG2 E;  1FVH A;  2XPY A;  4DPR A;  4Q69 A;  2V0P A;  5FZQ A;  2Y3A A;  3UKU G;  3IXE A;  4GPK A;  1MX6 A;  3C98 A;  3IHV A;  3V2O A;  1BI7 B;  4NQ0 A;  5BV1 A;  1E7V A;  3W9F A;  3FEY A;  1MJ0 A;  3OXL A;  2V5Q C;  5ENT D;  3BEE A;  3U64 A;  4UI9 C;  2H6G A;  1TJF A;  3O4Z A;  3RRM B;  3LEW A;  2MYO A;  2WXH A;  2C2L A;  2ZIR A;  1E8X A;  5EX3 A;  3DXK G;  3E4B A;  3UT7 A;  3DPD A;  3QAQ A;  1WG0 A;  3PUK A;  4NRH B;  4XKB A;  3URZ A;  3DSS A;  2OVB A;  2L0I A;  4NUR A;  3DSV A;  1N0Q A;  3VLF A;  1KLX A;  2J4D A;  1NA3 A;  1TN7 A;  3MKR A;  4I1O B;  3HDX A;  2B0O E;  4YDE A;  4KZC A;  1P5Q A;  3ZRH A;  2RFM A;  5JHA A;  4I2W A;  3S7D A;  3PEU B;  1OWP A;  5ENO D;  1S64 A;  4G1T A;  1AWC B;  2WXQ A;  3I4G A;  2F37 A;  5LOZ A;  1TNB A;  3ZU7 B;  4UWK A;  2Y69 E;  3AU5 A;  5FIN A;  4OVV A;  3TWT A;  3S7F A;  2HYZ A;  1MQS A;  1IQR A;  3IKO B;  3JYS A;  5A6C A;  2Q7F A;  4DLQ A;  3R9M A;  3BG0 B;  3LYA A;  5KNH D;  3UPV A;  2NXP A;  4PDX A;  4CT0 A;  4N3C A;  1ZB1 A;  3KEZ A;  4B0Z A;  3JXI A;  1N52 A;  3EIQ C;  3ZGQ A;  3PRZ A;  1WAO 1;  3FP3 A;  2GRM A;  2MRI A;  3PNT B;  3AU4 A;  2BUG A;  5FQ6 A;  3PZ2 A;  1H2U A;  2QZA A;  4U95 D;  4EEC A;  3MV3 B;  5CBN A;  1N11 A;  4GPM A;  2EIN E;  3FUN A;  2J07 A;  1XGW A;  3ZHE B;  1N0R A;  4I6G A;  2WXG A;  2WPV A;  2DZN A;  2FEZ A;  3KAE A;  2ETC A;  3FH7 A;  3IBE A;  4N3A A;  5C1D A;  1BU9 A;  4L9P A;  3ABK E;  4U0S A;  2NYJ A;  4YDY A;  2YIN A;  4ANV A;  3FWV A;  5FWQ A;  3HG0 D;  3L54 A;  4ANW A;  2V4H C;  3UI2 A;  2XGS A;  5H7P A;  1GW6 A;  4BTA A;  1NA0 A;  3CHS A;  2IF4 A;  1D8E A;  2PQR A;  4K5A B;  2QC9 A;  2XEV A;  5A23 A;  4CT4 A;  3FUH A;  4GTV A;  4C9B B;  2VTB A;  2WM9 A;  3FUM A;  3RSE G;  4G11 A;  2IEJ A;  4N5Q A;  1YCS B;  2XZD G;  4GTR A;  2B6C A;  1A17 A;  4PS3 A;  4I6E A;  2OVF A;  1EF1 C;  1UJJ A;  2FO7 A;  3FUF A;  3APD A;  3CST A;  2WXJ A;  4BTB A;  1OWL A;  3Q7A A;  1JWF A;  2F8Y A;  4F1P A;  3SFZ A;  2F0Y A;  3C72 A;  4XZ4 A;  5LP0 A;  2XEH A;  2I9C A;  3EHQ A;  3RO2 A;  2AXV A;  4APO A;  4G8L A;  2ETB A;  2BED A;  5BV0 A;  4GZ6 A;  5BNW A;  4XX5 A;  2ETA A;  4I9E A;  3DSX A;  3PNL B;  2IJG X;  2IOS A;  2PL2 A;  4BT8 A;  4WAF A;  4CDR A;  2J08 A;  3SFX A;  2R17 C;  2F8X K;  2VJ8 A;  1D9S A;  2OEW A;  4JL0 A;  1NFI E;  3SQV A;  5BPP A;  3Q15 A;  3NF1 A;  3B7B A;  4HRL A;  5AEN A;  3FUJ A;  2WXR A;  4IRU A;  4HOQ A;  1FCH A;  3ZNG A;  4F53 A;  3V30 A;  3Q47 B;  4JHR A;  5CRV A;  2I6H A;  5G2N A;  4B93 B;  5EID A;  4APF A;  3MX3 A;  5JJT A;  4JXT A;  1TJC A;  1HX8 A;  3PS6 A;  1H2V C;  1O1R A;  1Y8M A;  4O6F A;  3VTX A;  3R9A B;  3JXJ A;  3ULE G;  2EIK E;  3CQC B;  1K8K G;  3PEV B;  2WB2 A;  2PM6 A;  3ZEF A;  2HM8 A;  3LXU X;  4EPZ A;  1IHB A;  1BPO A;  5FZS A;  4P29 A;  3RK6 A;  3PE4 A;  1MX4 A;  4IYP A;  1PAQ A;  3U9W A;  3D9N A;  2VYI A;  1NZN A;  5EDS A;  3Q78 A;  2CG3 A;  2M63 A;  3LDZ A;  3SBS A;  1TYQ G;  4PS7 A;  2BTD A;  4NIK A;  2XS1 A;  3DBS A;  2XEN A;  4A63 B;  4QFV A;  4JW1 A;  3DRA A;  2R5S A;  1SZA A;  4J8E A;  4DI3 A;  3PVL A;  4ILG A;  2P2C P;  5CBO A;  3Q9N C;  2KBX A;  4GTS A;  1KPS B;  3DEP A;  3CQG B;  4CDM A;  3AJI A;  3VTY A;  4BX9 A;  3SBT B;  5KJK A;  3IHY A;  1U2V G;  5FZR A;  3C3Q A;  4HLL A;  2V5F A;  4Q96 A;  1EPU A;  3QC1 A;  3ASD A;  4YVQ C;  4DJA A;  2AXZ A;  2P9I G;  4CRW A;  2XS8 A;  5FQ4 A;  4HS2 A;  1WDY A;  3SZ7 A;  4DUI A;  4O1P A;  4LNB A;  3FTZ A;  4GA2 A;  2PNN A;  4GZC A;  3KD7 A;  3TWS A;  3TXN A;  5LFA A;  4WND A;  2DWZ A;  1JUQ A;  3G2S A;  1OWO A;  3CVY A;  3TG4 A;  3ZUV B;  3JCK C;  3APC A;  3NZS A;  2VGX B;  4ATZ D;  3HYM B;  5CEA A;  3C3O A;  2VGY A;  2ZIS A;  1IXV A;  5AQ7 A;  3U3W A;  2I2O A;  5AAR A;  2QFC A;  4IN3 B;  4AV7 A;  2GRQ B;  3ZYM A;  2DIW A;  3AG3 E;  1OWM A;  3RRN B;  5CED B;  3J5Q B;  2VQ2 A;  4TUU A;  2R03 A;  3ML8 A;  4TXR A;  3CLJ A;  4WWP A;  1H6O A;  3GYZ A;  4AIF A;  1TN8 A;  3JQ0 A;  5HI7 A;  4N2S A;  1OCO E;  1BI8 B;  4B8C B;  4WNE A;  4K0R A;  4HNA D; 
#chains in the Genus database with same CATH homology
 3HG0 D;  4QQI A;  2KXP C;  2ZGD A;  5ENO D;  4DX6 D;  4DX5 D;  4C48 B;  1BD8 A;  2V4H C;  5D66 A;  3UI2 A;  2P2C P;  3JUE A;  3KEA A;  4K5C A;  5CBO A;  1NFI E;  1AWC B;  3DEO A;  3EHR A;  2F37 A;  3Q9N C;  1DCQ A;  2KBX A;  1YYH A;  1SVX A;  3AAA C;  3B7B A;  4HRL A;  4RLY A;  1A5E A;  3DEP A;  3ZU7 B;  5JA4 D;  3J5P A;  4UUC A;  4J7W A;  1MX2 A;  3C5R A;  3AJI A;  2DVW A;  3F6Q A;  5FIN A;  3ZNG A;  2Y0B G;  4K5A B;  5ENR D;  2HE0 A;  3B95 A;  5HS0 A;  3V30 A;  4CZ2 D;  2AJA A;  2QC9 A;  1YMP A;  3TWT A;  3Q9U C;  4LG6 A;  1OT8 A;  3NOG D;  4HLL A;  5AQ9 A;  4DX2 A;  5EIL A;  5AQB A;  2FO1 E;  2XEE A;  4TUM A;  4ZFH A;  5AAO A;  1K1A A;  5EIB E;  2QYJ A;  5ENS D;  3IXE A;  3V31 A;  1MX6 A;  4B93 B;  5ITZ F;  4BES A;  4HQD A;  2A5E A;  4U96 D;  5EID A;  4U8Y D;  4BER A;  3TWX A;  1BI7 B;  3V2O A;  5CEC B;  4N5Q A;  4F6R D;  1YCS B;  3TWQ A;  2RFA A;  1WDY A;  4G8K A;  3UTM A;  5KNG A;  4DUI A;  4HI8 A;  2VGE A;  2XZD G;  4O1P A;  3NBN B;  3W9F A;  4O60 A;  2BKK B;  1SW6 A;  4LSZ E;  1D9S A;  1MJ0 A;  3LJN A;  1G3N B;  2PNN A;  2V5Q C;  5JMN D;  5KWD A;  5ENT D;  1K1B A;  3EU9 A;  3TWS A;  3HRA A;  5KNH D;  4J8Y A;  4JB8 P;  4DRX E;  4HRM B;  5HRY A;  2J8S D;  1K3Z D;  3JXJ A;  3JXI A;  4O1O A;  2MYO A;  2DWZ A;  5BXU A;  3T8K A;  1AP7 A;  3W9G A;  3TWU A;  2Y1L E;  4ZHB A;  5EYL A;  4OAU C;  4DX7 D;  3ZUV B;  2F8Y A;  5AN8 A;  5ENQ D;  4F1P A;  5BXO A;  4BEP A;  4DX1 A;  4GMR A;  5CEA A;  1IKN D;  4ATZ D;  1IHB A;  2XEH A;  4U95 D;  1IXV A;  3EHQ A;  5AQ7 A;  4CYM D;  5CBN A;  1MX4 A;  2L6B A;  5AAR A;  1N11 A;  1WG0 A;  4GPM A;  4K5B A;  4G8L A;  1S70 B;  2ETB A;  4HI9 A;  4HB5 A;  4BSZ B;  3V79 K;  1BLX B;  1N0R A;  4HRN A;  2ETA A;  3T9K A;  3UXG A;  5CED B;  3J5Q B;  2ZGG A;  1OY3 D;  1TR4 A;  5CER B;  2DZN A;  2BKG A;  2JAB A;  1N0Q A;  2XZT G;  3NOC D;  5HKP A;  2ETC A;  3TWV A;  5AQA A;  3D9H A;  3TWW A;  3ZKJ A;  1UOH A;  1DC2 A;  4NIK A;  5FIO A;  1MYO A;  3TWR A;  1BU9 A;  4U8V D;  5EYP F;  3SO8 A;  5EN5 D;  2NYJ A;  4YDY A;  5ENP D;  5KBA A;  2XEN A;  4LNU D;  4QFV A;  1QYM A;  4A63 B;  4YDW A;  3V2X A;  4OAV B;  2DZO A;  1BI8 B;  2B0O E;  4Z68 A;  2F8X K;  2RFM A;  4HBD A;  4HNA D;  4BET A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...