4DX5D

Transport of drugs by the multidrug transporter acrb involves an access and a deep binding pocket that are separated by a switch-loop
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
156
structure length
156
Chain Sequence
GSDLGKKLLEAARAGRDDEVRILMANGADVNAADVVGWTPLHLAAYWGHLEIVEVLLKNGADVNAYDTLGSTPLHLAAHFGHLEIVEVLLKNGADVNAKDDNGITPLHLAANRGHLEIVEVLLKYGADVNAQDKFGKTAFDISINNGNEDLAEILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Transport of drugs by the multidrug transporter AcrB involves an access and a deep binding pocket that are separated by a switch-loop.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein, transport protein
molecule keywords Acriflavine resistance protein B
total genus 52
structure length 156
sequence length 156
chains with identical sequence E
ec nomenclature
pdb deposition date 2012-02-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4dx5D00
2B0OE 1AWCB 3D9HA 3NOGD 5EIDA 5EYPF 1N11A 3V30A 3W9FA 3UI2A 4HQDA 3UTMA 3Q9NC 5AQBA 4HRNA 5HRYA 3EU9A 3DEOA 1YYHA 2QC9A 4HBDA 5ENOD 4K5CA 5ENTD 3TWRA 1QYMA 1YMPA 1N0QA 2DWZA 4BEPA 4C48B 2F37A 3AJIA 5BXUA 1BI7B 4ATZD 4F1PA 4BSZB 4Z68A 5CBOA 3B7BA 1AP7A 2VGEA 2BKKB 2RFAA 2Y0BG 5JMND 2L6BA 3EHQA 4LG6A 5EYLA 1UOHA 5ENSD 3ZUVB 1D9SA 4HRMB 2DZOA 1A5EA 1MX6A 4HI9A 5JA4D 4G8KA 2Y1LE 1WDYA 4NIKA 4DX7D 4U95D 1BU9A 1DC2A 1BLXB 3TWSA 2PNNA 4BESA 3ZU7B 4GPMA 4J7WA 3V31A 3TWQA 5EN5D 2JABA 2KBXA 2KXPC 4U8YD 1DCQA 5ENQD 5CERB 4LNUD 4CYMD 3T8KA 3HRAA 4O1OA 5AN8A 1K1BA 2DVWA 5KWDA 2P2CP 4JB8P 3KEAA 2A5EA 3NOCD 2F8YA 3SO8A 4DRXE 2HE0A 4BETA 2ETBA 4O1PA 1IXVA 3DEPA 4HLLA 5KNGA 3TWWA 5FIOA 3HG0D 5CEDB 3J5QB 4UUCA 2NYJA 3JUEA 3NBNB 2DZNA 5ITZF 5KBAA 3V2XA 1YCSB 1MYOA 3IXEA 5HS0A 3TWVA 4N5QA 3TWTA 2V4HC 4YDYA 4U96D 2XZTG 4LSZE 1K1AA 4U8VD 4YDWA 3TWUA 5AAOA 3TWXA 4OAUC 1NFIE 2ETAA 4DX5D 3ZNGA 5ENRD 4RLYA 3Q9UC 5EILA 4B93B 3C5RA 4K5BA 3V2OA 4HNAD 4BERA 2ZGDA 5BXOA 4F6RD 4K5AB 1K3ZD 3V79K 1IKND 4G8LA 4O60A 4QQIA 2FO1E 5CBNA 4HB5A 3ZKJA 1N0RA 4J8YA 5HKPA 3JXIA 2J8SD 1TR4A 3J5PA 2ZGGA 5AARA 4DX6D 1SVXA 4DX2A 2XZDG 3W9GA 2ETCA 4QFVA 2BKGA 4A63B 2V5QC 1MX4A 4HRLA 3F6QA 3B95A 1MX2A 2MYOA 2RFMA 1OT8A 5D66A 2XEEA 5FINA 4OAVB 1G3NB 5AQAA 5AQ9A 5EIBE 1MJ0A 1SW6A 3T9KA 4ZHBA 3AAAC 4TUMA 5ENPD 4GMRA 3EHRA 2QYJA 3JXJA 5CEAA 1BD8A 1S70B 5KNHD 5CECB 4ZFHA 2XEHA 1IHBA 4HI8A 2AJAA 1WG0A 3UXGA 1OY3D 4DX1A 5AQ7A 4CZ2D 2XENA 1BI8B 2F8XK 4DUIA 3LJNA
chains in the Genus database with same CATH superfamily
2IJGX 2J4DA 3ASGA 3U3WA 3W9FA 4HQDA 4LCTA 4BX8A 5ENTD 1ZBPA 5BUZA 4BSZB 3AG1E 3Q47B 1H6PA 2VJ8A 4WWNA 2OOEA 2NC9A 3O4ZA 3AS8A 1TJFA 3AU5A 3QDNA 3O48A 4GZDA 4EBAA 2QZAA 1FT1A 1HH8A 2ETBA 3TWWA 3R7RA 5KBAA 5ITZF 3V2XA 4NQ0A 4EZJA 3DXMG 2FULA 3FTWA 4HOUA 4K5AB 3FTSA 2WQHA 1N0RA 1OCRE 1SA5A 1TR4A 3PVLA 1TN6A 2V0PA 3D9IA 4PH4B 4I6GA 3WXXA 3KD7A 3ZIMA 2X38A 3VLDA 3Q49B 1E8WA 1MX4A 4DPRA 1SZAA 2PL2A 2YHCA 4ME2A 1OT8A 4L2LA 1OWNA 1NA3A 4AIFA 4GU5A 3JCKC 4GTQA 4PDXA 3DPYA 3ABLE 4B89A 1U3DA 4YDOA 2YHEA 3FUHA 2DCPA 3QKYA 2X6JA 4DK5A 5BXUA 2VSYA 5EKQD 1E96B 1WDYA 3VLFA 3CVWA 3TWQA 2GW1A 5CMWA 4U8YD 4C0MA 2P58C 3HDXA 4N2QA 4UQYA 4OYSA 3SO8A 5LCWJ 3DXKG 3ZVVA 2IEJA 2WXKA 4L1BA 2ILRA 2IF4A 3DRAA 4EQFA 3I4GA 3R9AB 3LXUX 3DSXA 4XZ4A 3ZFWA 2ETAA 4F3VA 4J6IA 2LXMA 4BTBA 4B93B 4W9RA 1IKND 4QQIA 3JXIA 1A17A 3FH8A 1Z3YA 4XX5A 5AARA 2XZDG 4MBGA 3QARA 5C2YA 3PUKA 1H19A 3F6QA 3ZYLA 2MYOA 4NACA 5D0QD 4A55A 5CHEE 4UWKA 3ONKA 3APCA 4ZHBA 2GRQB 5LX8A 3TL5A 3L22A 4GTSA 4JVSA 3FU5A 4J8FA 3L13A 4KVOA 1BI8B 2VQ2A 3HYMB 4UI9J 3FFLA 3UI2A 2E2EA 2L0TB 3JUIA 3DEOA 4XI9A 4CEMA 4P29A 3ABME 2GRRB 4UQXA 5JMND 4LG6A 3BG1B 2J09A 3RK6A 3FTXA 2J07A 1Y6IA 1DC2A 2KATA 1OCOE 2I2OA 3CKCA 1S0PA 4LERA 3RIBA 2ZIRA 3NOCD 2F8YA 4CDMA 3S7JA 3K9IA 3ISMC 4U8VD 1OWPA 4GTTA 1HO8A 3QNKA 4RLYA 4APFA 4HNAD 4JHJA 2HM8A 2XGOA 2C2LA 2J08A 3QOUA 4GTPA 1TYQG 4DX2A 2VSOE 4Q69A 3FUEA 1D8DA 1G3NB 5EIBE 1UN8A 1ELRA 4E85A 3CVNA 2R03A 4J8EA 3SFYA 3EDTB 5CECB 1MQSA 5G2NA 3TJPA 3LVRE 3UM2A 2YNQA 4CZ2D 3PZ2A 4ILGA 1AWCB 4GZ6A 4PS3A 4LNGA 3L82A 2MRIA 2P9LG 5JJ7A 3FULA 4I1MA 3B7UX 4YDEA 5EYLA 3CSFA 4JEHA 2ZXWE 3N71A 1ZB1A 3ZW3A 5T4YA 3B13A 3Q5MA 2KZTA 3HRAA 4Y6WA 5AJDA 5KWDA 1L5JA 2R05A 1NL4A 1N4PA 1ELKA 2R17C 3D9MA 3HG0D 2XEVA 4Q94A 3FP3A 4FJYA 4JD2G 3UQ3A 3D9OA 4FA6A 4PS8A 4KZCA 2B6CA 2OEVA 4DLOA 3SHFA 1NZNA 4BERA 3C5RA 1FCHA 4A3TA 4KXKB 1N4SA 4J8YA 5HQ8A 1E8YA 2ZGGA 1OCZE 2MOWA 2WXNA 3FDHA 2GROB 1X5BA 2ETCA 3X2QE 5CMYA 1MX2A 4OAVB 3U4TA 2J4BA 4FC8A 2VYIA 5CRVA 2IOLA 1MJ0A 3CVPA 3Q78A 1EF1C 2EQXA 1OWMA 2PM6A 5KNHD 3CVQA 4ANUA 5AJLA 4G23A 1WG0A 3SQVA 2WXFA 2X3MA 5JHAA 2OVBA 2UY1B 1NA0A 3LJNA 4ANXA 2OV8A 2KZTB 3SF4A 2C0LA 3UMVA 4U0UA 3ZRHA 3CGHA 4BSXA 4KYOB 1HX8A 4FADA 1HG5A 1N9AA 5ENSD 1A5EA 4HI9A 5KJMA 3CVYA 3PZ4A 2RKKA 2XS8A 1IYGA 5A6CA 3IHYA 3L6AA 4DLQA 5EN5D 3AS5A 4CYMD 5AN8A 2A4ZA 5E75A 4GAAA 3PRZA 3FH7A 3CR3A 4AJWA 3EHNA 2E0IA 1K3ZD 4J8SA 3CVUA 4KMOA 5CBNA 5HKPA 4H7XA 3D3MA 4RG9A 3LS8A 1PAQA 2BKGA 1QNFA 3BUAA 4ILIA 2CHXA 3FTYA 2RFMA 4G26A 1N54A 2XEHA 4GYOA 1HF8A 4X8QA 1UN9A 2DBAA 4EBAG 4JA7A 3APDA 3RRMB 5EYPF 3P1UA 3UTMA 4FU3A 4K5CA 1N0QA 1LF8A 4C48B 3HVEA 3B7BA 3NZUA 3ASNE 3L54A 1H0AA 4G25A 2DZOA 4N3AA 3LJ3A 1WAO1 5J08A 3FUIA 4LNUD 5BV1A 4APOA 4HORA 5T8IA 2FI7A 3PE4A 4HOQA 4CT0A 3R7QA 3GZ1A 3TXNA 4TRQA 1OWOA 2C0MA 2P9NG 1Q2ZA 3NBNB 3C72A 4TXQA 1KLXA 1N4QA 5C1DA 3UUXA 5G05J 4U07A 4DX5D 3ASOE 4K5BA 4FHJA 2P9IG 2H6IA 2YINA 2Q7FA 3DPDA 3UINC 2ZISA 1SVXA 1TJCA 3EIQC 2AXVA 2P9PG 3SBTB 1FVFA 4I17A 2VTBA 2YQ8A 1KPSB 4GMRA 1H6OA 3EHRA 1S70B 2HO1A 3GZSA 1JWFA 2XRZA 2P9KG 3ZHEB 1HFAA 4FJZA 4U04A 3KSQA 3PNTB 4O6FA 3QWVA 1XGWA 1JCRA 1HS6A 4RQIA 3ASHA 3TWRA 3L17A 5ENOD 3NF1A 4WUYA 3UIOC 3DSUA 2WMNA 1KZOA 2BKKB 2L6BA 3EHQA 2A5UA 3LKUA 4M3OA 4BT9A 2X6HA 2VSNA 4U0ZA 1E90A 3V31A 4WNFA 5CERB 4JZYA 3OXLA 2IOSA 4JB8P 4F7AA 3C3QA 4HLLA 3T5XA 5H7PA 3J5QB 4ATGA 3OAWA 2DZNA 1YCSB 3TWTA 4YDYA 2XZTG 2I6HA 3B7TA 3FUDA 4GZ3A 3CQGB 4GPKA 3MKQB 5LOZA 3ZHEA 4B0ZA 4GA2A 3ZEFA 1V55E 2DIWA 4QFVA 1Y8MA 1TEZA 2WXHA 2FEZA 1E7UA 1HU3A 1VDYA 4YVQC 3CVVA 1E8ZA 4Y6CA 4TXPA 2PQNA 2LO6A 4I9EA 3KSLA 3D9HA 3NZSA 4AV7A 1TNBA 4PUCA 1YYHA 3LCAA 4BX9A 3AJIA 4KVMA 4YNDA 2GRLA 1AP7A 3CV0A 2WXOA 3ZUVB 3CHRA 5B1AE 3UKRG 5KJLA 2EIKE 3HXDA 4GZ5A 4J7WA 2QY7A 3R9MA 5BV0A 1NP7A 1K1BA 2EINE 3FTZA 2P2CP 3TGOA 4UQZA 4BETA 5KNGA 5IY5E 4XKCA 3FUMA 3PEVB 3ASDA 5CCLA 3TWUA 4YDWA 5FZRA 4AXHA 5AYWD 3ZPJA 4JL0A 1N4RA 3V79K 2I1KA 4O60A 2V5FA 4JEUA 3LY9A 3D9LA 1NI1A 3EUVA 1JCSA 4WWPA 4L23A 3Q4AB 3LY8A 2OVFA 2XS1A 4G2VA 1SQMA 4A1SA 5FINA 5E76A 4GTMA 3ULQA 2P9SG 3MX3A 1IQUA 3TG5A 3LPZA 5FZQA 4DX1A 2DYSE 2XENA 3PEUB 3ASFA 4LEUA 1HZ4A 5EX3A 1N11A 3FEYA 3PE3A 4C0EA 2PM7A 1HXIA 1JCQA 2QC9A 2R5SA 1HG2A 1FT2A 3L9TA 3RRUA 2H6HA 2XPZA 2LSVA 5FZSA 2IO3C 2Y0BG 1UOHA 4XEIG 3SD5A 2I1JA 1PY1A 1BU9A 3FEXA 4RG6A 2FBNA 1U2VG 3EIJA 4O1OA 2WXGA 3JQ1A 3U9WA 3KS2A 4GZCA 5D2MC 3ZYKA 3ZN3A 2X6FA 5CEDB 2NYJA 4UI9K 1K8KG 3PZDA 3MGBA 3CHQA 5M72A 4IN3B 5KCMA 2WXPA 3PNLB 3RKVA 1H2VC 3Q9UC 3G2UA 4FP7A 3NB2A 3AU4A 3OXFA 5T3RA 5HI7A 1FVHA 2V5QC 4HRLA 3B95A 2BUGA 2XEEA 2Y69E 4FHKA 3T9KA 3QWPA 1H6KA 4TUMA 4PS7A 3CIAA 3TXMA 3B7SA 5ANLA 2WB2A 3E34A 4UWFA 3IV0A 1Z6TA 4L2YA 4AM9A 2XHEA 3EJNA 4HI8A 2CG3A 2AJAA 3UXGA 5JJ6A 4WNEA 4GCNA 3C3OA 3UM1A 4DUIA 3VLEA 5EIDA 4A1GA 5AQBA 4I9CA 4C9BB 4EZKA 3MJWA 4DJAA 4U63A 2Y4UA 5B3SE 2LNIA 3D9KA 4HXIA 2J9QA 3C98A 1RW2A 3MEKA 3ABKE 4NIKA 4DX7D 4U95D 3RAUA 3RO2A 4JA9A 4ACLA 3Q15A 3FWVA 4GPMA 3B7RL 2JABA 1INZA 2V4LA 3PDNA 3IEGA 3FUNA 4CCAA 4XE0A 3KEAA 3GYZA 5A7DB 4O1PA 3JUEA 3IXEA 3UM0A 2XQ0A 5AAOA 1Z3XA 1JPLA 3OXGA 1S64A 5EILA 3KEZA 4JXTA 4HB5A 2CHWA 3PUJA 2WPVA 2L0IA 3SZ7A 1DNPA 4TUUA 4LNBA 3S7BA 3OTNA 4HLEA 5DIZA 1QQEA 2WXJA 2IFUA 2GGFA 3FU0A 1BD8A 3LVQE 3FUJA 3PZ3A 2GRMA 4FULA 3MA5A 1XNFA 4CDRA 2KCKA 2BTDA 2M63A 3G2TA 3AS4A 3Q73A 1W3BA 3QAQA 5BNWA 3WG7E 2AXUA 3LEWA 3RRNB 3GZ2A 3CVXA 3T5VA 4BEPA 2F0YA 4ATZD 3MZLB 5CBOA 4HFGA 2GRNB 1KT0A 3HXFA 2XCCA 3MCXA 3UX4A 1UJJA 4H7YA 3BU8A 2KBXA 3PS6A 1H2TC 1SZ9A 3NAWA 5A23A 1O1TA 4DRXE 4CGVA 2LXLA 1SA4A 5D0OD 5G55A 4UUCA 4N39A 2PZIA 3UPVA 1PC2A 3SFZA 5HS0A 3KAEA 4DI4A 4WNGA 1E7VA 4RVBA 4M7CA 3V2OA 2ZGDA 4CRWA 4AP2A 3BEEA 5FJYA 5FWQA 3ZKJA 2J8SD 3SY2A 3S7FA 3SBSA 2KCVA 3ESKA 2FO7A 2LUHA 4IRUA 4HVBA 1ZU2A 1HE8A 3I5PA 3LY7A 3PH0C 5G04C 3PZ1A 3DSWA 1SW6A 2P9UG 3HXBA 4K0RA 1OCCE 2WQ7A 2QYJA 2DYRE 3URZA 3D9JA 4FLHA 3MYVA 3QC1A 3L16A 4XI0A 5ENNA 5AQ7A 2Y4TA 3CEQA 4HOSA 1OUVA 4YVOA 2F8XK 3IBEA 2B0OE 3CK8A 4E6HA 3ULYA 3NOGD 2EIME 2VTBB 3IHVA 3Q9NC 4HRNA 3I3NA 2DWZA 4F1PA 2XGSA 1JWGA 4OVUA 4JPSA 4U8HA 3QK0A 3MKRA 3MKQA 3RJVA 3E37A 4HRMB 2I9CA 3CHSA 4G8KA 3LDZA 2LAHA 4R7LA 2ONDA 1TNUA 2WXRA 2R59A 1WY6A 3MV2B 2XPIA 2X6IA 5FIOA 2AW6A 3ZYMA 4ACKA 1OXJA 2AVPA 2CG2A 1MZCA 2WXLA 1U3CA 3EU5A 1KT1A 4G8LA 1X81A 1IHGA 4CGWA 1UW4B 1QZ2A 4MS6A 4ANWA 4DX6D 2AWIA 2WXQA 4N2SA 2UWJG 4GYYA 2OEWA 4IYPA 3FTVA 2CHZA 5AQAA 4U7EB 2FF4A 2KM4A 4XKBA 2CFUA 5ARFA 4L7TA 2V8SE 1N95A 1TN8A 2X6KA 3CQCB 3ONLA 4AEZC 4GMJA 3V30A 5FQ6A 4HBDA 1YMPA 3BG0B 3QB2A 3QJZA 2VGEA 3TG4A 2VGXB 3VTYA 4CT4A 5FT9A 1BLXB 4BESA 3ZU7B 2KXPC 1DCEA 5KJKA 4F1SA 3ML9A 3DEPA 1S63A 5AIJA 4NURA 2LAIA 3C3RA 5FTPA 4DI3A 4RSYA 1MYOA 3FH5A 4OVVA 4B94A 5BPPA 1IQRA 4LSZE 1NFIE 4IULA 4I1OB 1GW6A 2AXZA 4UWGA 3ULEG 3D9PA 4V3IA 3DWLG 1LD8A 4ABNA 4EPZA 2HR2A 1E8XA 3P2BA 4I43A 4WNDA 4Q96A 1TNYA 4A63B 1MHQA 1O1SA 4AY6A 1RZ4A 2RG8A 4N3CA 4GTRA 2H6FA 3ZXPA 3UKUG 1B89A 2CFZA 3CK9A 5JJTA 5J90A 3CKBA 4ILHB 3ESLA 1OWLA 4ZFHA 1ELWA 1OY3D 3JQ0A 3Q79A 3SI5A 3BQOA 3DSVA 3U66A 1DVPA 4AY5A 2BEDA 3Q7FA 5HRYA 3EU9A 4KZ0A 4I1AA 3FU3A 4GB9A 1MX6A 1O5MA 1BPOA 2Y1LE 1UJKA 3TWSA 2IO2C 2PNNA 3AG2E 4BFRA 4WAFA 3CHMA 4GYWA 1QBQA 3I4RB 4FLBA 2H6GA 3TAXA 4HOTA 2A5EA 3UIPC 4LUNU 3MV3B 3LYAA 3HXEA 5FQ4A 3FUKA 5LFAA 4AVXA 2VSXE 2WVIA 3UT8A 5EDSA 4K03A 4U96D 4G1TA 4OAUC 1K1AA 4EECA 2JLBA 3TWXA 4TV3A 2VGYA 3E33A 1N94A 5B1BE 5ENRD 3ZYQA 5BXOA 4GTOA 4CDNA 2R02A 1JUQA 4I6EA 2IQCA 3J5PA 5ANRA 4JHKA 5LP0A 3W9GA 3APFA 3S7DA 2KCLA 4BWRA 5FQ7A 3DBSA 3FU6A 4LRZA 5ENPD 1V54E 3JXJA 4AOFA 5CEAA 2HYZA 2NXPA 3S2AA 1IHBA 3L08A 3SFXA 2MHKA 2WMOA 5BT1A 3DSTA 4G24A 1UG3A 2XPYA 3JYSA 4BT8A 2WQ6A 2IY0C 3G2SA 2WXIA 3CK7A 4UWHA 2BF0X 1P5QA 2F37A 2J49A 4Z68A 4A3VA 4KT6B 4BY6A 1D9SA 2IONA 4U0SA 4URKA 5CCMA 3EHMA 5JA4D 3SGHA 2R2LA 1EYHA 1TNOA 1KZPA 2EIJE 2KC7A 3AG3E 3T8KA 4JW1A 5BW8C 2DVWA 1LD7A 1WM5A 5LCWC 3ZGQA 2HE0A 4EZLA 3HVEB 3HXCA 4GA1A 3RU0A 1FPPA 2QFCA 2GRPB 3Q75A 4XIFA 3TWVA 4N5QA 3FY4A 5EX0A 1TNZA 3ZNGA 4F53A 2WM9A 2EILE 4F6RD 3ZXSA 3CHOA 3PREA 4J0UA 4JC8A 3FHEA 3VTXA 3D9NA 3CVLA 4ANVA 4KBQA 4MKTA 3CSTA 3RSEG 3AAAC 2OCCE 5KJNA 4B8CB 3UT4A 1Z5SC 5G05C 4NRHB 4B8AA 2LSUA 4I2ZA 3T8MA 2QYUA 1QYMA 5ARGA 4BTAA 3ENEA 2IU1A 1BI7B 5FQ8A 4N3BA 1H2UA 2RFAA 4GCOA 2XCBA 4MLPA 2XGMA 5JHBA 4HS2A 3UT7A 4L9PA 2JEKA 3CLJA 3Q7AA 4GA0A 5ENQD 1DCQA 1TN7A 4EHMA 5G04J 2UY1A 3NQPA 3IKOB 5DBKA 2RD0A 1LTXA 3CHPA 3QWWA 2VGXA 3FUFA 4GMLA 3UM3A 1IXVA 2L9BA 4UWLA 4MRUA 2NSZA 3E4BA 4I2WA 2V4HC 4TXRA 4N5CA 3GW4A 1EPUA 1O1RA 2PQRA 4JHRA 4D10C 3SNXA 3G2VA 3FTUA 4G11A 2FO1E 3AG4E 5AENA 1YA0A 1EDUA 4I6JA 4J8DA 3E30A 3G2WA 5D66A 5AQ9A 3HIZA 1D8EA 2XRYA 3HHMA 1N52A 5CRUA 2Y3AA 3RO3A 3DSSA 3ML8A 3E32A 4GTVA 2L6JA 3U64A 2ZU6B 4UI9C 4WWOA 2WXMA
chains in the Genus database with same CATH topology
2B0OE 1AWCB 3D9HA 3NOGD 5EIDA 5EYPF 1N11A 3V30A 3W9FA 3UI2A 4HQDA 3UTMA 3Q9NC 5AQBA 4HRNA 5HRYA 3EU9A 3DEOA 1YYHA 2QC9A 4HBDA 5ENOD 4K5CA 5ENTD 3TWRA 1QYMA 1YMPA 1N0QA 2DWZA 4BEPA 4C48B 2F37A 3AJIA 5BXUA 1BI7B 4ATZD 4F1PA 4BSZB 4Z68A 5CBOA 3B7BA 1AP7A 2VGEA 2BKKB 2RFAA 2Y0BG 5JMND 2L6BA 3EHQA 4LG6A 5EYLA 1UOHA 5ENSD 3ZUVB 1D9SA 4HRMB 2DZOA 1A5EA 1MX6A 4HI9A 5JA4D 4G8KA 2Y1LE 1WDYA 4NIKA 4DX7D 4U95D 1BU9A 1DC2A 1BLXB 3TWSA 2PNNA 4BESA 3ZU7B 4GPMA 4J7WA 3V31A 3TWQA 5EN5D 2JABA 2KBXA 2KXPC 4U8YD 1DCQA 5ENQD 5CERB 4LNUD 4CYMD 3T8KA 3HRAA 4O1OA 5AN8A 1K1BA 2DVWA 5KWDA 2P2CP 4JB8P 3KEAA 2A5EA 3NOCD 2F8YA 3SO8A 4DRXE 2HE0A 4BETA 2ETBA 4O1PA 1IXVA 3DEPA 4HLLA 5KNGA 3TWWA 5FIOA 3HG0D 5CEDB 3J5QB 4UUCA 2NYJA 3JUEA 3NBNB 2DZNA 5ITZF 5KBAA 3V2XA 1YCSB 1MYOA 3IXEA 5HS0A 3TWVA 4N5QA 3TWTA 2V4HC 4YDYA 4U96D 2XZTG 4LSZE 1K1AA 4U8VD 4YDWA 3TWUA 5AAOA 3TWXA 4OAUC 1NFIE 2ETAA 4DX5D 3ZNGA 5ENRD 4RLYA 3Q9UC 5EILA 4B93B 3C5RA 4K5BA 3V2OA 4HNAD 4BERA 2ZGDA 5BXOA 4F6RD 4K5AB 1K3ZD 3V79K 1IKND 4G8LA 4O60A 4QQIA 2FO1E 5CBNA 4HB5A 3ZKJA 1N0RA 4J8YA 5HKPA 3JXIA 2J8SD 1TR4A 3J5PA 2ZGGA 5AARA 4DX6D 1SVXA 4DX2A 2XZDG 3W9GA 2ETCA 4QFVA 2BKGA 4A63B 2V5QC 1MX4A 4HRLA 3F6QA 3B95A 1MX2A 2MYOA 2RFMA 1OT8A 5D66A 2XEEA 5FINA 4OAVB 1G3NB 5AQAA 5AQ9A 5EIBE 1MJ0A 1SW6A 3T9KA 4ZHBA 3AAAC 4TUMA 5ENPD 4GMRA 3EHRA 2QYJA 3JXJA 5CEAA 1BD8A 1S70B 5KNHD 5CECB 4ZFHA 2XEHA 1IHBA 4HI8A 2AJAA 1WG0A 3UXGA 1OY3D 4DX1A 5AQ7A 4CZ2D 2XENA 1BI8B 2F8XK 4DUIA 3LJNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B0O E;  1AWC B;  3D9H A;  3NOG D;  5EID A;  5EYP F;  1N11 A;  3V30 A;  3W9F A;  3UI2 A;  4HQD A;  3UTM A;  3Q9N C;  5AQB A;  4HRN A;  5HRY A;  3EU9 A;  3DEO A;  1YYH A;  2QC9 A;  4HBD A;  5ENO D;  4K5C A;  5ENT D;  3TWR A;  1QYM A;  1YMP A;  1N0Q A;  2DWZ A;  4BEP A;  4C48 B;  2F37 A;  3AJI A;  5BXU A;  1BI7 B;  4ATZ D;  4F1P A;  4BSZ B;  4Z68 A;  5CBO A;  3B7B A;  1AP7 A;  2VGE A;  2BKK B;  2RFA A;  2Y0B G;  5JMN D;  2L6B A;  3EHQ A;  4LG6 A;  5EYL A;  1UOH A;  5ENS D;  3ZUV B;  1D9S A;  4HRM B;  2DZO A;  1A5E A;  1MX6 A;  4HI9 A;  5JA4 D;  4G8K A;  2Y1L E;  1WDY A;  4NIK A;  4DX7 D;  4U95 D;  1BU9 A;  1DC2 A;  1BLX B;  3TWS A;  2PNN A;  4BES A;  3ZU7 B;  4GPM A;  4J7W A;  3V31 A;  3TWQ A;  5EN5 D;  2JAB A;  2KBX A;  2KXP C;  4U8Y D;  1DCQ A;  5ENQ D;  5CER B;  4LNU D;  4CYM D;  3T8K A;  3HRA A;  4O1O A;  5AN8 A;  1K1B A;  2DVW A;  5KWD A;  2P2C P;  4JB8 P;  3KEA A;  2A5E A;  3NOC D;  2F8Y A;  3SO8 A;  4DRX E;  2HE0 A;  4BET A;  2ETB A;  4O1P A;  1IXV A;  3DEP A;  4HLL A;  5KNG A;  3TWW A;  5FIO A;  3HG0 D;  5CED B;  3J5Q B;  4UUC A;  2NYJ A;  3JUE A;  3NBN B;  2DZN A;  5ITZ F;  5KBA A;  3V2X A;  1YCS B;  1MYO A;  3IXE A;  5HS0 A;  3TWV A;  4N5Q A;  3TWT A;  2V4H C;  4YDY A;  4U96 D;  2XZT G;  4LSZ E;  1K1A A;  4U8V D;  4YDW A;  3TWU A;  5AAO A;  3TWX A;  4OAU C;  1NFI E;  2ETA A;  4DX5 D;  3ZNG A;  5ENR D;  4RLY A;  3Q9U C;  5EIL A;  4B93 B;  3C5R A;  4K5B A;  3V2O A;  4HNA D;  4BER A;  2ZGD A;  5BXO A;  4F6R D;  4K5A B;  1K3Z D;  3V79 K;  1IKN D;  4G8L A;  4O60 A;  4QQI A;  2FO1 E;  5CBN A;  4HB5 A;  3ZKJ A;  1N0R A;  4J8Y A;  5HKP A;  3JXI A;  2J8S D;  1TR4 A;  3J5P A;  2ZGG A;  5AAR A;  4DX6 D;  1SVX A;  4DX2 A;  2XZD G;  3W9G A;  2ETC A;  4QFV A;  2BKG A;  4A63 B;  2V5Q C;  1MX4 A;  4HRL A;  3F6Q A;  3B95 A;  1MX2 A;  2MYO A;  2RFM A;  1OT8 A;  5D66 A;  2XEE A;  5FIN A;  4OAV B;  1G3N B;  5AQA A;  5AQ9 A;  5EIB E;  1MJ0 A;  1SW6 A;  3T9K A;  4ZHB A;  3AAA C;  4TUM A;  5ENP D;  4GMR A;  3EHR A;  2QYJ A;  3JXJ A;  5CEA A;  1BD8 A;  1S70 B;  5KNH D;  5CEC B;  4ZFH A;  2XEH A;  1IHB A;  4HI8 A;  2AJA A;  1WG0 A;  3UXG A;  1OY3 D;  4DX1 A;  5AQ7 A;  4CZ2 D;  2XEN A;  1BI8 B;  2F8X K;  4DUI A;  3LJN A; 
#chains in the Genus database with same CATH topology
 2IJG X;  2J4D A;  3ASG A;  3U3W A;  3W9F A;  4HQD A;  4LCT A;  4BX8 A;  5ENT D;  1ZBP A;  5BUZ A;  4BSZ B;  3AG1 E;  3Q47 B;  1H6P A;  2VJ8 A;  4WWN A;  2OOE A;  2NC9 A;  3O4Z A;  3AS8 A;  1TJF A;  3AU5 A;  3QDN A;  3O48 A;  4GZD A;  4EBA A;  2QZA A;  1FT1 A;  1HH8 A;  2ETB A;  3TWW A;  3R7R A;  5KBA A;  5ITZ F;  3V2X A;  4NQ0 A;  4EZJ A;  3DXM G;  2FUL A;  3FTW A;  4HOU A;  4K5A B;  3FTS A;  2WQH A;  1N0R A;  1OCR E;  1SA5 A;  1TR4 A;  3PVL A;  1TN6 A;  2V0P A;  3D9I A;  4PH4 B;  4I6G A;  3WXX A;  3KD7 A;  3ZIM A;  2X38 A;  3VLD A;  3Q49 B;  1E8W A;  1MX4 A;  4DPR A;  1SZA A;  2PL2 A;  2YHC A;  4ME2 A;  1OT8 A;  4L2L A;  1OWN A;  1NA3 A;  4AIF A;  4GU5 A;  3JCK C;  4GTQ A;  4PDX A;  3DPY A;  3ABL E;  4B89 A;  1U3D A;  4YDO A;  2YHE A;  3FUH A;  2DCP A;  3QKY A;  2X6J A;  4DK5 A;  5BXU A;  2VSY A;  5EKQ D;  1E96 B;  1WDY A;  3VLF A;  3CVW A;  3TWQ A;  2GW1 A;  5CMW A;  4U8Y D;  4C0M A;  2P58 C;  3HDX A;  4N2Q A;  4UQY A;  4OYS A;  3SO8 A;  5LCW J;  3DXK G;  3ZVV A;  2IEJ A;  2WXK A;  4L1B A;  2ILR A;  2IF4 A;  3DRA A;  4EQF A;  3I4G A;  3R9A B;  3LXU X;  3DSX A;  4XZ4 A;  3ZFW A;  2ETA A;  4F3V A;  4J6I A;  2LXM A;  4BTB A;  4B93 B;  4W9R A;  1IKN D;  4QQI A;  3JXI A;  1A17 A;  3FH8 A;  1Z3Y A;  4XX5 A;  5AAR A;  2XZD G;  4MBG A;  3QAR A;  5C2Y A;  3PUK A;  1H19 A;  3F6Q A;  3ZYL A;  2MYO A;  4NAC A;  5D0Q D;  4A55 A;  5CHE E;  4UWK A;  3ONK A;  3APC A;  4ZHB A;  2GRQ B;  5LX8 A;  3TL5 A;  3L22 A;  4GTS A;  4JVS A;  3FU5 A;  4J8F A;  3L13 A;  4KVO A;  1BI8 B;  2VQ2 A;  3HYM B;  4UI9 J;  3FFL A;  3UI2 A;  2E2E A;  2L0T B;  3JUI A;  3DEO A;  4XI9 A;  4CEM A;  4P29 A;  3ABM E;  2GRR B;  4UQX A;  5JMN D;  4LG6 A;  3BG1 B;  2J09 A;  3RK6 A;  3FTX A;  2J07 A;  1Y6I A;  1DC2 A;  2KAT A;  1OCO E;  2I2O A;  3CKC A;  1S0P A;  4LER A;  3RIB A;  2ZIR A;  3NOC D;  2F8Y A;  4CDM A;  3S7J A;  3K9I A;  3ISM C;  4U8V D;  1OWP A;  4GTT A;  1HO8 A;  3QNK A;  4RLY A;  4APF A;  4HNA D;  4JHJ A;  2HM8 A;  2XGO A;  2C2L A;  2J08 A;  3QOU A;  4GTP A;  1TYQ G;  4DX2 A;  2VSO E;  4Q69 A;  3FUE A;  1D8D A;  1G3N B;  5EIB E;  1UN8 A;  1ELR A;  4E85 A;  3CVN A;  2R03 A;  4J8E A;  3SFY A;  3EDT B;  5CEC B;  1MQS A;  5G2N A;  3TJP A;  3LVR E;  3UM2 A;  2YNQ A;  4CZ2 D;  3PZ2 A;  4ILG A;  1AWC B;  4GZ6 A;  4PS3 A;  4LNG A;  3L82 A;  2MRI A;  2P9L G;  5JJ7 A;  3FUL A;  4I1M A;  3B7U X;  4YDE A;  5EYL A;  3CSF A;  4JEH A;  2ZXW E;  3N71 A;  1ZB1 A;  3ZW3 A;  5T4Y A;  3B13 A;  3Q5M A;  2KZT A;  3HRA A;  4Y6W A;  5AJD A;  5KWD A;  1L5J A;  2R05 A;  1NL4 A;  1N4P A;  1ELK A;  2R17 C;  3D9M A;  3HG0 D;  2XEV A;  4Q94 A;  3FP3 A;  4FJY A;  4JD2 G;  3UQ3 A;  3D9O A;  4FA6 A;  4PS8 A;  4KZC A;  2B6C A;  2OEV A;  4DLO A;  3SHF A;  1NZN A;  4BER A;  3C5R A;  1FCH A;  4A3T A;  4KXK B;  1N4S A;  4J8Y A;  5HQ8 A;  1E8Y A;  2ZGG A;  1OCZ E;  2MOW A;  2WXN A;  3FDH A;  2GRO B;  1X5B A;  2ETC A;  3X2Q E;  5CMY A;  1MX2 A;  4OAV B;  3U4T A;  2J4B A;  4FC8 A;  2VYI A;  5CRV A;  2IOL A;  1MJ0 A;  3CVP A;  3Q78 A;  1EF1 C;  2EQX A;  1OWM A;  2PM6 A;  5KNH D;  3CVQ A;  4ANU A;  5AJL A;  4G23 A;  1WG0 A;  3SQV A;  2WXF A;  2X3M A;  5JHA A;  2OVB A;  2UY1 B;  1NA0 A;  3LJN A;  4ANX A;  2OV8 A;  2KZT B;  3SF4 A;  2C0L A;  3UMV A;  4U0U A;  3ZRH A;  3CGH A;  4BSX A;  4KYO B;  1HX8 A;  4FAD A;  1HG5 A;  1N9A A;  5ENS D;  1A5E A;  4HI9 A;  5KJM A;  3CVY A;  3PZ4 A;  2RKK A;  2XS8 A;  1IYG A;  5A6C A;  3IHY A;  3L6A A;  4DLQ A;  5EN5 D;  3AS5 A;  4CYM D;  5AN8 A;  2A4Z A;  5E75 A;  4GAA A;  3PRZ A;  3FH7 A;  3CR3 A;  4AJW A;  3EHN A;  2E0I A;  1K3Z D;  4J8S A;  3CVU A;  4KMO A;  5CBN A;  5HKP A;  4H7X A;  3D3M A;  4RG9 A;  3LS8 A;  1PAQ A;  2BKG A;  1QNF A;  3BUA A;  4ILI A;  2CHX A;  3FTY A;  2RFM A;  4G26 A;  1N54 A;  2XEH A;  4GYO A;  1HF8 A;  4X8Q A;  1UN9 A;  2DBA A;  4EBA G;  4JA7 A;  3APD A;  3RRM B;  5EYP F;  3P1U A;  3UTM A;  4FU3 A;  4K5C A;  1N0Q A;  1LF8 A;  4C48 B;  3HVE A;  3B7B A;  3NZU A;  3ASN E;  3L54 A;  1H0A A;  4G25 A;  2DZO A;  4N3A A;  3LJ3 A;  1WAO 1;  5J08 A;  3FUI A;  4LNU D;  5BV1 A;  4APO A;  4HOR A;  5T8I A;  2FI7 A;  3PE4 A;  4HOQ A;  4CT0 A;  3R7Q A;  3GZ1 A;  3TXN A;  4TRQ A;  1OWO A;  2C0M A;  2P9N G;  1Q2Z A;  3NBN B;  3C72 A;  4TXQ A;  1KLX A;  1N4Q A;  5C1D A;  3UUX A;  5G05 J;  4U07 A;  4DX5 D;  3ASO E;  4K5B A;  4FHJ A;  2P9I G;  2H6I A;  2YIN A;  2Q7F A;  3DPD A;  3UIN C;  2ZIS A;  1SVX A;  1TJC A;  3EIQ C;  2AXV A;  2P9P G;  3SBT B;  1FVF A;  4I17 A;  2VTB A;  2YQ8 A;  1KPS B;  4GMR A;  1H6O A;  3EHR A;  1S70 B;  2HO1 A;  3GZS A;  1JWF A;  2XRZ A;  2P9K G;  3ZHE B;  1HFA A;  4FJZ A;  4U04 A;  3KSQ A;  3PNT B;  4O6F A;  3QWV A;  1XGW A;  1JCR A;  1HS6 A;  4RQI A;  3ASH A;  3TWR A;  3L17 A;  5ENO D;  3NF1 A;  4WUY A;  3UIO C;  3DSU A;  2WMN A;  1KZO A;  2BKK B;  2L6B A;  3EHQ A;  2A5U A;  3LKU A;  4M3O A;  4BT9 A;  2X6H A;  2VSN A;  4U0Z A;  1E90 A;  3V31 A;  4WNF A;  5CER B;  4JZY A;  3OXL A;  2IOS A;  4JB8 P;  4F7A A;  3C3Q A;  4HLL A;  3T5X A;  5H7P A;  3J5Q B;  4ATG A;  3OAW A;  2DZN A;  1YCS B;  3TWT A;  4YDY A;  2XZT G;  2I6H A;  3B7T A;  3FUD A;  4GZ3 A;  3CQG B;  4GPK A;  3MKQ B;  5LOZ A;  3ZHE A;  4B0Z A;  4GA2 A;  3ZEF A;  1V55 E;  2DIW A;  4QFV A;  1Y8M A;  1TEZ A;  2WXH A;  2FEZ A;  1E7U A;  1HU3 A;  1VDY A;  4YVQ C;  3CVV A;  1E8Z A;  4Y6C A;  4TXP A;  2PQN A;  2LO6 A;  4I9E A;  3KSL A;  3D9H A;  3NZS A;  4AV7 A;  1TNB A;  4PUC A;  1YYH A;  3LCA A;  4BX9 A;  3AJI A;  4KVM A;  4YND A;  2GRL A;  1AP7 A;  3CV0 A;  2WXO A;  3ZUV B;  3CHR A;  5B1A E;  3UKR G;  5KJL A;  2EIK E;  3HXD A;  4GZ5 A;  4J7W A;  2QY7 A;  3R9M A;  5BV0 A;  1NP7 A;  1K1B A;  2EIN E;  3FTZ A;  2P2C P;  3TGO A;  4UQZ A;  4BET A;  5KNG A;  5IY5 E;  4XKC A;  3FUM A;  3PEV B;  3ASD A;  5CCL A;  3TWU A;  4YDW A;  5FZR A;  4AXH A;  5AYW D;  3ZPJ A;  4JL0 A;  1N4R A;  3V79 K;  2I1K A;  4O60 A;  2V5F A;  4JEU A;  3LY9 A;  3D9L A;  1NI1 A;  3EUV A;  1JCS A;  4WWP A;  4L23 A;  3Q4A B;  3LY8 A;  2OVF A;  2XS1 A;  4G2V A;  1SQM A;  4A1S A;  5FIN A;  5E76 A;  4GTM A;  3ULQ A;  2P9S G;  3MX3 A;  1IQU A;  3TG5 A;  3LPZ A;  5FZQ A;  4DX1 A;  2DYS E;  2XEN A;  3PEU B;  3ASF A;  4LEU A;  1HZ4 A;  5EX3 A;  1N11 A;  3FEY A;  3PE3 A;  4C0E A;  2PM7 A;  1HXI A;  1JCQ A;  2QC9 A;  2R5S A;  1HG2 A;  1FT2 A;  3L9T A;  3RRU A;  2H6H A;  2XPZ A;  2LSV A;  5FZS A;  2IO3 C;  2Y0B G;  1UOH A;  4XEI G;  3SD5 A;  2I1J A;  1PY1 A;  1BU9 A;  3FEX A;  4RG6 A;  2FBN A;  1U2V G;  3EIJ A;  4O1O A;  2WXG A;  3JQ1 A;  3U9W A;  3KS2 A;  4GZC A;  5D2M C;  3ZYK A;  3ZN3 A;  2X6F A;  5CED B;  2NYJ A;  4UI9 K;  1K8K G;  3PZD A;  3MGB A;  3CHQ A;  5M72 A;  4IN3 B;  5KCM A;  2WXP A;  3PNL B;  3RKV A;  1H2V C;  3Q9U C;  3G2U A;  4FP7 A;  3NB2 A;  3AU4 A;  3OXF A;  5T3R A;  5HI7 A;  1FVH A;  2V5Q C;  4HRL A;  3B95 A;  2BUG A;  2XEE A;  2Y69 E;  4FHK A;  3T9K A;  3QWP A;  1H6K A;  4TUM A;  4PS7 A;  3CIA A;  3TXM A;  3B7S A;  5ANL A;  2WB2 A;  3E34 A;  4UWF A;  3IV0 A;  1Z6T A;  4L2Y A;  4AM9 A;  2XHE A;  3EJN A;  4HI8 A;  2CG3 A;  2AJA A;  3UXG A;  5JJ6 A;  4WNE A;  4GCN A;  3C3O A;  3UM1 A;  4DUI A;  3VLE A;  5EID A;  4A1G A;  5AQB A;  4I9C A;  4C9B B;  4EZK A;  3MJW A;  4DJA A;  4U63 A;  2Y4U A;  5B3S E;  2LNI A;  3D9K A;  4HXI A;  2J9Q A;  3C98 A;  1RW2 A;  3MEK A;  3ABK E;  4NIK A;  4DX7 D;  4U95 D;  3RAU A;  3RO2 A;  4JA9 A;  4ACL A;  3Q15 A;  3FWV A;  4GPM A;  3B7R L;  2JAB A;  1INZ A;  2V4L A;  3PDN A;  3IEG A;  3FUN A;  4CCA A;  4XE0 A;  3KEA A;  3GYZ A;  5A7D B;  4O1P A;  3JUE A;  3IXE A;  3UM0 A;  2XQ0 A;  5AAO A;  1Z3X A;  1JPL A;  3OXG A;  1S64 A;  5EIL A;  3KEZ A;  4JXT A;  4HB5 A;  2CHW A;  3PUJ A;  2WPV A;  2L0I A;  3SZ7 A;  1DNP A;  4TUU A;  4LNB A;  3S7B A;  3OTN A;  4HLE A;  5DIZ A;  1QQE A;  2WXJ A;  2IFU A;  2GGF A;  3FU0 A;  1BD8 A;  3LVQ E;  3FUJ A;  3PZ3 A;  2GRM A;  4FUL A;  3MA5 A;  1XNF A;  4CDR A;  2KCK A;  2BTD A;  2M63 A;  3G2T A;  3AS4 A;  3Q73 A;  1W3B A;  3QAQ A;  5BNW A;  3WG7 E;  2AXU A;  3LEW A;  3RRN B;  3GZ2 A;  3CVX A;  3T5V A;  4BEP A;  2F0Y A;  4ATZ D;  3MZL B;  5CBO A;  4HFG A;  2GRN B;  1KT0 A;  3HXF A;  2XCC A;  3MCX A;  3UX4 A;  1UJJ A;  4H7Y A;  3BU8 A;  2KBX A;  3PS6 A;  1H2T C;  1SZ9 A;  3NAW A;  5A23 A;  1O1T A;  4DRX E;  4CGV A;  2LXL A;  1SA4 A;  5D0O D;  5G55 A;  4UUC A;  4N39 A;  2PZI A;  3UPV A;  1PC2 A;  3SFZ A;  5HS0 A;  3KAE A;  4DI4 A;  4WNG A;  1E7V A;  4RVB A;  4M7C A;  3V2O A;  2ZGD A;  4CRW A;  4AP2 A;  3BEE A;  5FJY A;  5FWQ A;  3ZKJ A;  2J8S D;  3SY2 A;  3S7F A;  3SBS A;  2KCV A;  3ESK A;  2FO7 A;  2LUH A;  4IRU A;  4HVB A;  1ZU2 A;  1HE8 A;  3I5P A;  3LY7 A;  3PH0 C;  5G04 C;  3PZ1 A;  3DSW A;  1SW6 A;  2P9U G;  3HXB A;  4K0R A;  1OCC E;  2WQ7 A;  2QYJ A;  2DYR E;  3URZ A;  3D9J A;  4FLH A;  3MYV A;  3QC1 A;  3L16 A;  4XI0 A;  5ENN A;  5AQ7 A;  2Y4T A;  3CEQ A;  4HOS A;  1OUV A;  4YVO A;  2F8X K;  3IBE A;  2B0O E;  3CK8 A;  4E6H A;  3ULY A;  3NOG D;  2EIM E;  2VTB B;  3IHV A;  3Q9N C;  4HRN A;  3I3N A;  2DWZ A;  4F1P A;  2XGS A;  1JWG A;  4OVU A;  4JPS A;  4U8H A;  3QK0 A;  3MKR A;  3MKQ A;  3RJV A;  3E37 A;  4HRM B;  2I9C A;  3CHS A;  4G8K A;  3LDZ A;  2LAH A;  4R7L A;  2OND A;  1TNU A;  2WXR A;  2R59 A;  1WY6 A;  3MV2 B;  2XPI A;  2X6I A;  5FIO A;  2AW6 A;  3ZYM A;  4ACK A;  1OXJ A;  2AVP A;  2CG2 A;  1MZC A;  2WXL A;  1U3C A;  3EU5 A;  1KT1 A;  4G8L A;  1X81 A;  1IHG A;  4CGW A;  1UW4 B;  1QZ2 A;  4MS6 A;  4ANW A;  4DX6 D;  2AWI A;  2WXQ A;  4N2S A;  2UWJ G;  4GYY A;  2OEW A;  4IYP A;  3FTV A;  2CHZ A;  5AQA A;  4U7E B;  2FF4 A;  2KM4 A;  4XKB A;  2CFU A;  5ARF A;  4L7T A;  2V8S E;  1N95 A;  1TN8 A;  2X6K A;  3CQC B;  3ONL A;  4AEZ C;  4GMJ A;  3V30 A;  5FQ6 A;  4HBD A;  1YMP A;  3BG0 B;  3QB2 A;  3QJZ A;  2VGE A;  3TG4 A;  2VGX B;  3VTY A;  4CT4 A;  5FT9 A;  1BLX B;  4BES A;  3ZU7 B;  2KXP C;  1DCE A;  5KJK A;  4F1S A;  3ML9 A;  3DEP A;  1S63 A;  5AIJ A;  4NUR A;  2LAI A;  3C3R A;  5FTP A;  4DI3 A;  4RSY A;  1MYO A;  3FH5 A;  4OVV A;  4B94 A;  5BPP A;  1IQR A;  4LSZ E;  1NFI E;  4IUL A;  4I1O B;  1GW6 A;  2AXZ A;  4UWG A;  3ULE G;  3D9P A;  4V3I A;  3DWL G;  1LD8 A;  4ABN A;  4EPZ A;  2HR2 A;  1E8X A;  3P2B A;  4I43 A;  4WND A;  4Q96 A;  1TNY A;  4A63 B;  1MHQ A;  1O1S A;  4AY6 A;  1RZ4 A;  2RG8 A;  4N3C A;  4GTR A;  2H6F A;  3ZXP A;  3UKU G;  1B89 A;  2CFZ A;  3CK9 A;  5JJT A;  5J90 A;  3CKB A;  4ILH B;  3ESL A;  1OWL A;  4ZFH A;  1ELW A;  1OY3 D;  3JQ0 A;  3Q79 A;  3SI5 A;  3BQO A;  3DSV A;  3U66 A;  1DVP A;  4AY5 A;  2BED A;  3Q7F A;  5HRY A;  3EU9 A;  4KZ0 A;  4I1A A;  3FU3 A;  4GB9 A;  1MX6 A;  1O5M A;  1BPO A;  2Y1L E;  1UJK A;  3TWS A;  2IO2 C;  2PNN A;  3AG2 E;  4BFR A;  4WAF A;  3CHM A;  4GYW A;  1QBQ A;  3I4R B;  4FLB A;  2H6G A;  3TAX A;  4HOT A;  2A5E A;  3UIP C;  4LUN U;  3MV3 B;  3LYA A;  3HXE A;  5FQ4 A;  3FUK A;  5LFA A;  4AVX A;  2VSX E;  2WVI A;  3UT8 A;  5EDS A;  4K03 A;  4U96 D;  4G1T A;  4OAU C;  1K1A A;  4EEC A;  2JLB A;  3TWX A;  4TV3 A;  2VGY A;  3E33 A;  1N94 A;  5B1B E;  5ENR D;  3ZYQ A;  5BXO A;  4GTO A;  4CDN A;  2R02 A;  1JUQ A;  4I6E A;  2IQC A;  3J5P A;  5ANR A;  4JHK A;  5LP0 A;  3W9G A;  3APF A;  3S7D A;  2KCL A;  4BWR A;  5FQ7 A;  3DBS A;  3FU6 A;  4LRZ A;  5ENP D;  1V54 E;  3JXJ A;  4AOF A;  5CEA A;  2HYZ A;  2NXP A;  3S2A A;  1IHB A;  3L08 A;  3SFX A;  2MHK A;  2WMO A;  5BT1 A;  3DST A;  4G24 A;  1UG3 A;  2XPY A;  3JYS A;  4BT8 A;  2WQ6 A;  2IY0 C;  3G2S A;  2WXI A;  3CK7 A;  4UWH A;  2BF0 X;  1P5Q A;  2F37 A;  2J49 A;  4Z68 A;  4A3V A;  4KT6 B;  4BY6 A;  1D9S A;  2ION A;  4U0S A;  4URK A;  5CCM A;  3EHM A;  5JA4 D;  3SGH A;  2R2L A;  1EYH A;  1TNO A;  1KZP A;  2EIJ E;  2KC7 A;  3AG3 E;  3T8K A;  4JW1 A;  5BW8 C;  2DVW A;  1LD7 A;  1WM5 A;  5LCW C;  3ZGQ A;  2HE0 A;  4EZL A;  3HVE B;  3HXC A;  4GA1 A;  3RU0 A;  1FPP A;  2QFC A;  2GRP B;  3Q75 A;  4XIF A;  3TWV A;  4N5Q A;  3FY4 A;  5EX0 A;  1TNZ A;  3ZNG A;  4F53 A;  2WM9 A;  2EIL E;  4F6R D;  3ZXS A;  3CHO A;  3PRE A;  4J0U A;  4JC8 A;  3FHE A;  3VTX A;  3D9N A;  3CVL A;  4ANV A;  4KBQ A;  4MKT A;  3CST A;  3RSE G;  3AAA C;  2OCC E;  5KJN A;  4B8C B;  3UT4 A;  1Z5S C;  5G05 C;  4NRH B;  4B8A A;  2LSU A;  4I2Z A;  3T8M A;  2QYU A;  1QYM A;  5ARG A;  4BTA A;  3ENE A;  2IU1 A;  1BI7 B;  5FQ8 A;  4N3B A;  1H2U A;  2RFA A;  4GCO A;  2XCB A;  4MLP A;  2XGM A;  5JHB A;  4HS2 A;  3UT7 A;  4L9P A;  2JEK A;  3CLJ A;  3Q7A A;  4GA0 A;  5ENQ D;  1DCQ A;  1TN7 A;  4EHM A;  5G04 J;  2UY1 A;  3NQP A;  3IKO B;  5DBK A;  2RD0 A;  1LTX A;  3CHP A;  3QWW A;  2VGX A;  3FUF A;  4GML A;  3UM3 A;  1IXV A;  2L9B A;  4UWL A;  4MRU A;  2NSZ A;  3E4B A;  4I2W A;  2V4H C;  4TXR A;  4N5C A;  3GW4 A;  1EPU A;  1O1R A;  2PQR A;  4JHR A;  4D10 C;  3SNX A;  3G2V A;  3FTU A;  4G11 A;  2FO1 E;  3AG4 E;  5AEN A;  1YA0 A;  1EDU A;  4I6J A;  4J8D A;  3E30 A;  3G2W A;  5D66 A;  5AQ9 A;  3HIZ A;  1D8E A;  2XRY A;  3HHM A;  1N52 A;  5CRU A;  2Y3A A;  3RO3 A;  3DSS A;  3ML8 A;  3E32 A;  4GTV A;  2L6J A;  3U64 A;  2ZU6 B;  4UI9 C;  4WWO A;  2WXM A; 
#chains in the Genus database with same CATH homology
 2B0O E;  1AWC B;  3D9H A;  3NOG D;  5EID A;  5EYP F;  1N11 A;  3V30 A;  3W9F A;  3UI2 A;  4HQD A;  3UTM A;  3Q9N C;  5AQB A;  4HRN A;  5HRY A;  3EU9 A;  3DEO A;  1YYH A;  2QC9 A;  4HBD A;  5ENO D;  4K5C A;  5ENT D;  3TWR A;  1QYM A;  1YMP A;  1N0Q A;  2DWZ A;  4BEP A;  4C48 B;  2F37 A;  3AJI A;  5BXU A;  1BI7 B;  4ATZ D;  4F1P A;  4BSZ B;  4Z68 A;  5CBO A;  3B7B A;  1AP7 A;  2VGE A;  2BKK B;  2RFA A;  2Y0B G;  5JMN D;  2L6B A;  3EHQ A;  4LG6 A;  5EYL A;  1UOH A;  5ENS D;  3ZUV B;  1D9S A;  4HRM B;  2DZO A;  1A5E A;  1MX6 A;  4HI9 A;  5JA4 D;  4G8K A;  2Y1L E;  1WDY A;  4NIK A;  4DX7 D;  4U95 D;  1BU9 A;  1DC2 A;  1BLX B;  3TWS A;  2PNN A;  4BES A;  3ZU7 B;  4GPM A;  4J7W A;  3V31 A;  3TWQ A;  5EN5 D;  2JAB A;  2KBX A;  2KXP C;  4U8Y D;  1DCQ A;  5ENQ D;  5CER B;  4LNU D;  4CYM D;  3T8K A;  3HRA A;  4O1O A;  5AN8 A;  1K1B A;  2DVW A;  5KWD A;  2P2C P;  4JB8 P;  3KEA A;  2A5E A;  3NOC D;  2F8Y A;  3SO8 A;  4DRX E;  2HE0 A;  4BET A;  2ETB A;  4O1P A;  1IXV A;  3DEP A;  4HLL A;  5KNG A;  3TWW A;  5FIO A;  3HG0 D;  5CED B;  3J5Q B;  4UUC A;  2NYJ A;  3JUE A;  3NBN B;  2DZN A;  5ITZ F;  5KBA A;  3V2X A;  1YCS B;  1MYO A;  3IXE A;  5HS0 A;  3TWV A;  4N5Q A;  3TWT A;  2V4H C;  4YDY A;  4U96 D;  2XZT G;  4LSZ E;  1K1A A;  4U8V D;  4YDW A;  3TWU A;  5AAO A;  3TWX A;  4OAU C;  1NFI E;  2ETA A;  4DX5 D;  3ZNG A;  5ENR D;  4RLY A;  3Q9U C;  5EIL A;  4B93 B;  3C5R A;  4K5B A;  3V2O A;  4HNA D;  4BER A;  2ZGD A;  5BXO A;  4F6R D;  4K5A B;  1K3Z D;  3V79 K;  1IKN D;  4G8L A;  4O60 A;  4QQI A;  2FO1 E;  5CBN A;  4HB5 A;  3ZKJ A;  1N0R A;  4J8Y A;  5HKP A;  3JXI A;  2J8S D;  1TR4 A;  3J5P A;  2ZGG A;  5AAR A;  4DX6 D;  1SVX A;  4DX2 A;  2XZD G;  3W9G A;  2ETC A;  4QFV A;  2BKG A;  4A63 B;  2V5Q C;  1MX4 A;  4HRL A;  3F6Q A;  3B95 A;  1MX2 A;  2MYO A;  2RFM A;  1OT8 A;  5D66 A;  2XEE A;  5FIN A;  4OAV B;  1G3N B;  5AQA A;  5AQ9 A;  5EIB E;  1MJ0 A;  1SW6 A;  3T9K A;  4ZHB A;  3AAA C;  4TUM A;  5ENP D;  4GMR A;  3EHR A;  2QYJ A;  3JXJ A;  5CEA A;  1BD8 A;  1S70 B;  5KNH D;  5CEC B;  4ZFH A;  2XEH A;  1IHB A;  4HI8 A;  2AJA A;  1WG0 A;  3UXG A;  1OY3 D;  4DX1 A;  5AQ7 A;  4CZ2 D;  2XEN A;  1BI8 B;  2F8X K;  4DUI A;  3LJN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...