4DX5D

Transport of drugs by the multidrug transporter acrb involves an access and a deep binding pocket that are separated by a switch-loop
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
156
structure length
156
Chain Sequence
GSDLGKKLLEAARAGRDDEVRILMANGADVNAADVVGWTPLHLAAYWGHLEIVEVLLKNGADVNAYDTLGSTPLHLAAHFGHLEIVEVLLKNGADVNAKDDNGITPLHLAANRGHLEIVEVLLKYGADVNAQDKFGKTAFDISINNGNEDLAEILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Transport of drugs by the multidrug transporter AcrB involves an access and a deep binding pocket that are separated by a switch-loop.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein, transport protein
molecule keywords Acriflavine resistance protein B
total genus 52
structure length 156
sequence length 156
chains with identical sequence E
ec nomenclature
pdb deposition date 2012-02-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4dx5D00
1N0QA 1SVXA 3DEOA 3JXIA 3NOCD 3UXGA 3DEPA 2P2CP 4HRMB 3J5QB 1BD8A 3F6QA 5AQ7A 5CBNA 1BLXB 5BXUA 4ZHBA 2F37A 2B0OE 4J7WA 5ENPD 4G8LA 4HRNA 3W9FA 5HKPA 2DZOA 2KXPC 5AAOA 1MX6A 1D9SA 4HLLA 1OT8A 4O1OA 2DZNA 1MYOA 5HS0A 5CEAA 5KBAA 5FIOA 4YDWA 1BI7B 5ENRD 2QC9A 5AN8A 1YYHA 5ENTD 2BKGA 4HNAD 5AQAA 3UTMA 1K1AA 3B95A 4U8YD 4BEPA 2VGEA 3ZNGA 1NFIE 4HI9A 2J8SD 5CEDB 2ETBA 1N0RA 1G3NB 1UOHA 2QYJA 1IKND 3D9HA 3Q9NC 4U95D 2PNNA 5FINA 3TWUA 4JB8P 2DWZA 5AQBA 4DRXE 1MX2A 2F8XK 1N11A 4HI8A 2ETAA 2XEHA 1IXVA 3T9KA 4BESA 1IHBA 2RFAA 3V2XA 4U96D 5HRYA 3TWSA 2A5EA 4GMRA 3KEAA 3V2OA 5EYPF 1YCSB 5CERB 4BSZB 4OAVB 2F8YA 1K1BA 5ITZF 5D66A 3Q9UC 3EU9A 4DX6D 5EILA 2JABA 3AAAC 4LG6A 1DC2A 5JMND 4ZFHA 4BERA 3HRAA 3TWXA 4OAUC 3JUEA 1MX4A 4G8KA 3TWQA 3EHRA 5ENSD 4HBDA 5AQ9A 4BETA 4DX7D 4F6RD 5EN5D 5EYLA 3TWWA 5AARA 1YMPA 2ETCA 2BKKB 3AJIA 4QQIA 3C5RA 4UUCA 2MYOA 2Y1LE 2DVWA 5ENQD 4QFVA 1DCQA 4N5QA 2HE0A 4F1PA 4C48B 4GPMA 1AWCB 1MJ0A 4J8YA 4HQDA 4DX1A 2ZGDA 3IXEA 1OY3D 2XEEA 5EIDA 4DX2A 3NBNB 4CZ2D 5CECB 3ZUVB 5KNHD 3B7BA 3TWRA 3HG0D 3NOGD 1TR4A 2XZDG 3JXJA 4A63B 2XENA 2XZTG 1WDYA 1QYMA 4K5CA 5JA4D 2FO1E 1AP7A 4O60A 4K5BA 4O1PA 3W9GA 2ZGGA 3ZU7B 3J5PA 3SO8A 3ZKJA 2V5QC 1BI8B 4ATZD 1K3ZD 3EHQA 4HRLA 5CBOA 4Z68A 1S70B 3LJNA 2RFMA 1WG0A 4LNUD 3V79K 2V4HC 3UI2A 4U8VD 4LSZE 3V31A 3V30A 4CYMD 4DUIA 4NIKA 5KNGA 3TWVA 2KBXA 2Y0BG 4K5AB 5ENOD 3TWTA 4B93B 1A5EA 2NYJA 5BXOA 1BU9A 4YDYA 4DX5D 4HB5A 5EIBE 4TUMA 1SW6A 4RLYA 5KWDA 3T8KA 2L6BA 2AJAA
chains in the Genus database with same CATH superfamily
2LSUA 3UXGA 2IONA 3DEPA 4JXTA 1BD8A 4L2YA 3ZYKA 3PEVB 2EQXA 2CG3A 3FTUA 4DPRA 1D9SA 3L22A 2I1KA 2VSOE 5CEAA 5ENTD 1OWMA 2BKGA 4N3CA 4U8YD 3UIOC 3CVXA 5LCWJ 2L0TB 4CT0A 2YNQA 3LY7A 3D9IA 3FP3A 3MKQB 1OCZE 5HRYA 5T3RA 5EYPF 3MX3A 5CERB 4EZLA 5CRUA 3AAAC 3LKUA 3S7BA 2PM6A 1X81A 2PQNA 4UWKA 5E76A 2RG8A 4JC8A 3D9JA 1LTXA 3KEZA 5AARA 2BKKB 4GZCA 4EHMA 4HOUA 4DLOA 1HX8A 2V4LA 4N5QA 2HR2A 4HVBA 1OWOA 5ENNA 2HYZA 4DX2A 3E30A 4I6GA 5DIZA 5AYWD 5D0OD 4YVOA 3Q7AA 4KMOA 1TJCA 4A63B 2LO6A 4E85A 2FF4A 3ZXPA 4L23A 4UQZA 4O1PA 3ZU7B 2EIKE 4ATZD 3ONKA 3EHQA 3LJNA 3UI2A 1XGWA 1LD7A 2XCCA 4N2QA 3V31A 4AY6A 5KNGA 2I6HA 2Y4UA 2IJGX 1QQEA 3Q79A 4MBGA 4GMLA 5AQ7A 4FU3A 3MKRA 3IEGA 5AAOA 2DZOA 4J0UA 3UKUG 4BEPA 4CDRA 3C3OA 2FO7A 3DXKG 2LSVA 3D9PA 3VLDA 3AU5A 2ETAA 3N71A 2XS1A 4FC8A 1S0PA 2KZTB 1ELKA 4TRQA 2C0LA 4HORA 1TN7A 3ABME 4DJAA 4FP7A 4GTQA 2GRMA 4OAUC 2P9PG 3PUJA 1B89A 3EIJA 5ARGA 3Q47B 2Y3AA 4CGVA 3C5RA 3AU4A 2VSXE 1ZBPA 4C48B 3E4BA 4GPMA 4KXKB 3ZUVB 3E32A 3VLEA 5JA4D 2FO1E 5CBOA 3PH0C 2WXOA 3TGOA 4U8VD 4LSZE 1EPUA 1ELWA 1Q2ZA 3SI5A 3SHFA 2KCKA 3ML8A 1A5EA 3BUAA 4U8HA 3GZSA 2HO1A 4RLYA 3RIBA 4CEMA 2AVPA 3PVLA 2CHXA 2P9UG 4ATGA 3ZPJA 2C0MA 4YDEA 5KBAA 4YDWA 1TNZA 3ZNGA 1NFIE 3MZLB 3ZGQA 4OYSA 3QDNA 1SQMA 2PL2A 3HVEA 3JUIA 3D9HA 4U95D 4CGWA 3HHMA 2F8XK 3UM2A 2P9KG 4G1TA 2GRQB 1PY1A 3RO2A 5KJLA 5EX0A 2F8YA 5JHAA 5FZSA 3CHRA 4NQ0A 1DC2A 1P5QA 4BX9A 1E8YA 4G8KA 1N4QA 1E96B 4A1GA 5BV1A 4WWPA 4UUCA 4JA9A 4LUNU 2WXMA 3Q7FA 1KT1A 1FVHA 5E75A 4PUCA 2XZDG 1Z3XA 4GPKA 2GRLA 5C1DA 1KZOA 3PZ2A 3AS5A 4JHRA 4JW1A 3W9GA 1NL4A 4A55A 3LY8A 1W3BA 2RKKA 3ASHA 4PH4B 3ZHEA 1O1SA 4P29A 2KBXA 3LY9A 2XPZA 4KYOB 2ZISA 4DK5A 4B0ZA 5D0QD 2UWJG 4J7WA 3BEEA 3F6QA 3BG1B 3FUDA 3Q78A 4RSYA 4HLLA 1OT8A 4XE0A 2UY1A 5LP0A 2M63A 2Y4TA 1IHGA 1TYQG 2CHWA 2LXMA 3OXLA 2AWIA 5FINA 3CVWA 4ACLA 2EILE 4BESA 5B3SE 3BU8A 2QZAA 2XGOA 4CDMA 3G2WA 1SA4A 3EU9A 3FHEA 3RO3A 3MEKA 4ACKA 5FJYA 4L1BA 4U0SA 5CCLA 3TWQA 1DCEA 5BNWA 2DYRE 4I2WA 1INZA 1HS6A 3UUXA 3KAEA 4XKCA 2BF0X 4XKBA 3MKQA 1E7UA 3EUVA 4YNDA 3G2SA 3PNLB 4YVQC 5EX3A 2WXNA 3OAWA 2VGXB 4O60A 5G2NA 4KZ0A 2X6HA 1BI8B 2EIJE 3QWVA 4PS7A 2IQCA 4G2VA 3O48A 2VGYA 5CRVA 3ASGA 4HB5A 2OVFA 3CHQA 2YHCA 2WXLA 2VSNA 4DI3A 3CVQA 3ZHEB 3IBEA 3C72A 1OCRE 5CCMA 2XPIA 3UT4A 4UI9J 3CKCA 4F7AA 4AV7A 2QC9A 4F3VA 2R03A 4UI9K 2XRZA 1DNPA 1H6KA 4I9EA 1MZCA 4N3BA 2J4DA 2XPYA 4LNGA 3AG4E 3IHVA 1IHBA 1H19A 5FZRA 4GMJA 4WNFA 3BG0B 2FBNA 1H2VC 1FCHA 2X6JA 1K1BA 3ESKA 2LNIA 5AJDA 3RRUA 3OXFA 4GA0A 3MA5A 1HH8A 2GGFA 4HOQA 3UT8A 2VSYA 4KBQA 2IFUA 3SD5A 5LCWC 1WAO1 4G11A 2J9QA 3JXJA 4LRZA 3NF1A 3O4ZA 4CT4A 2FULA 3DSSA 3PS6A 1V55E 3ZKJA 3RAUA 4Z68A 5JJ6A 3CHOA 1N9AA 4LNUD 4FJYA 4CYMD 2OVBA 2XGSA 3DSTA 5M72A 1N52A 1ZB1A 3SNXA 3PZDA 1SW6A 5FIOA 3EHNA 2CHZA 4JHJA 3PE3A 5JJTA 2P9IG 4ZHBA 2WQ7A 1NI1A 3FUJA 5G04J 4O1OA 4GTOA 3CK9A 5AQAA 3B95A 3CVYA 5A7DB 5D2MC 4I6EA 5KJMA 1NA3A 1XNFA 4RQIA 1IXVA 1FT1A 3CSFA 3D9LA 4MLPA 3KEAA 1JWGA 3SGHA 2EIME 3ZYQA 5ITZF 5DBKA 5EILA 3EU5A 2WXJA 3RKVA 4ZFHA 3CHPA 3QWWA 3TWXA 2XQ0A 4HBDA 2XGMA 3L17A 5EN5D 3FFLA 5ARFA 2JEKA 4WWNA 4XEIG 3C98A 3KD7A 3CEQA 3CIAA 1HG2A 1N94A 4N3AA 1TR4A 3DSUA 4XI9A 2Q7FA 4R7LA 1QYMA 3SF4A 3E34A 3ZRHA 5IY5E 4GYOA 4F1SA 3D9KA 5HQ8A 3AS8A 4KT6B 4BT8A 2OEVA 5EIBE 2WB2A 4I17A 3VLFA 1WM5A 5FT9A 3CQGB 4RG9A 3PUKA 1S64A 3FUMA 4IYPA 3ASOE 4BTBA 2QY7A 4HRNA 1KLXA 2CG2A 3CSTA 5CHEE 3T8MA 3FUEA 1MYOA 1UW4B 3JYSA 4JHKA 4WNDA 4EECA 5ENRD 1LF8A 5FQ4A 3UTMA 3QB2A 4WNGA 1UOHA 3FH7A 1IKND 2J07A 5BPPA 1MX2A 1JCRA 2DCPA 1TNOA 3Q15A 4FADA 1N54A 2ILRA 5AJLA 3DSXA 3KSLA 5ANRA 4I1OB 2H6FA 4ILHB 4B94A 4I1MA 5LOZA 1E8ZA 4OVUA 2GW1A 3IKOB 3FY4A 2IY0C 3JCKC 1BPOA 4J8FA 3PRZA 4ABNA 3TAXA 4J8YA 4DX1A 1E8XA 5B1AE 5EIDA 2R17C 4CZ2D 3B7BA 1HU3A 3CGHA 2X6KA 3ONLA 3MV3B 4K03A 3HXCA 3NZSA 3UQ3A 1OCCE 3HXBA 3CQCB 4DLQA 3URZA 4AM9A 3P2BA 3ZIMA 4GB9A 2P9NG 4JEHA 4AP2A 4HNAD 1IQUA 3ZEFA 3QAQA 5G05C 5A23A 4MRUA 2F37A 1WY6A 4G8LA 2KXPC 2FI7A 1MX6A 2WXHA 4BTAA 1RZ4A 3UT7A 3CV0A 4GTSA 3CVNA 3ASFA 1N0RA 1JUQA 4B8AA 3TJPA 3AG1E 4GTMA 4ME2A 2RFAA 4CCAA 3LVQE 3ASDA 3QOUA 3UMVA 4OAVB 2JABA 3QK0A 3I5PA 3CVLA 1H6PA 5G05J 1L5JA 4BETA 4TXQA 2ZXWE 3BQOA 2WXRA 4F1PA 1D8EA 1TNYA 4HQDA 1Y8MA 3DRAA 3ULQA 1JPLA 2VTBA 3APCA 5KNHD 3LVRE 1D8DA 3X2QE 3FTZA 4UWLA 4URKA 3L08A 2WXKA 2XZTG 1AP7A 4FLHA 1TJFA 3DSVA 3FULA 4HRLA 4U7EB 1O1TA 2KATA 4L7TA 4GA1A 4NIKA 3FU3A 4HOSA 3GZ2A 3QWPA 3CVVA 3FU5A 5G55A 4ILGA 4LNBA 1E7VA 4KVMA 3G2UA 3DXMG 4GTPA 4PS3A 2YHEA 3TG5A 3ML9A 3PE4A 5ENPD 5HS0A 3I3NA 1NZNA 4ILIA 2VJ8A 3FEYA 1FPPA 3ZW3A 2L9BA 4GYWA 1OCOE 1X5BA 3HYMB 1EF1C 5D66A 5FQ7A 2XHEA 4JPSA 4I2ZA 3ISMC 4M3OA 2NXPA 4U0UA 4G26A 3FU0A 3HVEB 3MGBA 4IRUA 1AWCB 2HM8A 1K8KG 2ZGDA 3IXEA 1OY3D 2IOSA 3CVPA 3SFYA 3PNTB 4BY6A 4FJZA 3ABKE 4JA7A 1H2UA 4XI0A 2V4HC 3D9NA 3KS2A 2I1JA 3TWVA 2BTDA 1E8WA 4H7XA 2IOLA 4TXRA 5BW8C 1KZPA 3DEOA 3FUHA 5KCMA 4U63A 1IQRA 4BT9A 4TUUA 4U07A 3SBSA 3CHMA 5AN8A 4GZ6A 5CMYA 1UJJA 3NQPA 3B7RL 4JEUA 3I4GA 5EDSA 4UQXA 4CDNA 2DWZA 5AQBA 3JQ0A 4HI8A 3PEUB 2KZTA 3FH5A 2LXLA 4U96D 3UINC 3TWSA 4ANXA 2A5UA 4HOTA 2IF4A 3EIQC 3Q9UC 3GYZA 2CFZA 4G25A 2MRIA 2V8SE 3UM0A 5ENSD 4DX7D 4EQFA 5G04C 2DVWA 3U64A 4QFVA 1MHQA 3U66A 3UM1A 2ZIRA 4FLBA 3ULEG 1N4RA 4Y6CA 3U4TA 4IN3B 1NA0A 1HO8A 2E0IA 3GW4A 3PZ3A 3SY2A 3UKRG 3S2AA 2V5QC 3PDNA 2E2EA 4GTVA 4TXPA 2YQ8A 3RU0A 3QC1A 4O6FA 1SA5A 4GTRA 4BFRA 2X3MA 4PS8A 4YDYA 3UM3A 5KWDA 1ELRA 4WWOA 3HXEA 2WM9A 4LERA 1SVXA 3NOCD 4RVBA 3FUFA 2PQRA 3FUNA 3Q73A 4XX5A 4HI9A 3U3WA 3PREA 2BUGA 4J8DA 3FTYA 2YINA 3JQ1A 4AXHA 2AXUA 3T9KA 5EKQD 3V2OA 3PZ4A 2VQ2A 4C9BB 3DPYA 3CR3A 3NZUA 3D3MA 4B89A 4BERA 3HRAA 4E6HA 2WQ6A 3R9AB 2L6JA 2J49A 3IHYA 4QQIA 1OXJA 2Y1LE 4GZDA 3VTYA 4AOFA 4C0EA 2GRNB 1SZAA 4I43A 2NSZA 4A3TA 5LX8A 1V54E 4LCTA 4UWHA 4I1AA 5A6CA 4HFGA 2RFMA 3C3RA 1H2TC 3ZYLA 1U3DA 2V0PA 1N4PA 1JCQA 3FWVA 1BU9A 4AVXA 2ZU6B 2VTBB 3L16A 2AJAA 5FWQA 4JL0A 3FTXA 2WVIA 5C2YA 3QNKA 5FTPA 4KZCA 4WNEA 1BI7B 1K1AA 3FTSA 4NRHB 2J8SD 3S7DA 1TN8A 3SZ7A 2KCVA 3APDA 2PNNA 2KC7A 4FHJA 2X6FA 2IO2C 3CKBA 3V2XA 4ANVA 3D9OA 3T5XA 4UWFA 2FEZA 2WXPA 5BV0A 4BSZB 3SQVA 4DX6D 4U0ZA 2OOEA 5JMND 1HZ4A 3QKYA 3ZXSA 2R59A 2LAHA 3ENEA 3ZVVA 2QYUA 5AQ9A 3MJWA 3TWWA 4CRWA 5ENQD 3L13A 3RRMB 1MQSA 2HE0A 5BT1A 4I6JA 5BUZA 5CECB 3EHMA 1ZU2A 3HG0D 4G23A 5AIJA 3PZ1A 2R2LA 2R02A 1OUVA 3R9MA 4TV3A 1HXIA 3B13A 3Q75A 2V5FA 2ZGGA 4WAFA 1E90A 3IV0A 4AEZC 3DSWA 2L0IA 2WXIA 3Q4AB 3NB2A 4YDOA 4DUIA 3HIZA 1HF8A 3DPDA 3E33A 3FH8A 5ENOD 5BXOA 2AW6A 2OCCE 4TUMA 3AG2E 3G2TA 3C3QA 2H6HA 4WUYA 3T8KA 2H6GA 3B7TA 4PDXA 4JZYA 2PM7A 4Q94A 3J5QB 3FEXA 1BLXB 5BXUA 2B0OE 3R7QA 5HKPA 2A4ZA 4LEUA 3WXXA 1TNUA 2ETBA 2OV8A 2KM4A 1A17A 1G3NB 1FT2A 5JHBA 2IEJA 2DIWA 1S63A 2J08A 5FQ6A 2R5SA 4U04A 3L54A 2XEHA 3SFXA 4GTTA 5B1BE 2PZIA 2A5EA 4GMRA 2AXZA 3GZ1A 4BWRA 5T8IA 4A1SA 5J08A 1TNBA 4K0RA 3TXNA 1YA0A 4C0MA 1TN6A 3WG7E 2MOWA 3UPVA 1LD8A 2WXQA 3FTWA 4F6RD 5CEDB 1YMPA 3AJIA 3LDZA 1MJ0A 3UIPC 2EINE 2R05A 3ZYMA 3NOGD 3MCXA 3K9IA 1Z6TA 1HFAA 3AG3E 1WDYA 4GYYA 4N5CA 3J5PA 1Z3YA 2DYSE 1WG0A 3S7FA 4GAAA 3RSEG 4ANWA 2BEDA 2CFUA 3RRNB 1RW2A 1U2VG 5CMWA 4DX5D 2GROB 2WXGA 2C2LA 3LYAA 4Q96A 3P1UA 4Q69A 1N0QA 3ASNE 4X8QA 2P9LG 4EPZA 4HRMB 3TG4A 5CBNA 3ZFWA 3DWLG 2DZNA 5HI7A 4FULA 4BX8A 3AS4A 4GCOA 4XZ4A 3L6AA 2VGXA 3EDTB 3HXDA 2QYJA 5ANLA 3Q9NC 2I9CA 3TWUA 4GCNA 2JLBA 4GA2A 3LS8A 2XEVA 4APFA 1YCSB 4N2SA 2MHKA 3RK6A 3FTVA 2XCBA 4AIFA 4IULA 1KPSB 1DVPA 1DCQA 2X6IA 1IYGA 4HS2A 3NBNB 2XS8A 5LFAA 1NP7A 3TWRA 5KJNA 2GRPB 3LEWA 4XIFA 1U3CA 1EDUA 3CK8A 3D9MA 1Y6IA 3ZN3A 1QZ2A 3VTXA 2X38A 3SO8A 1UG3A 2ONDA 3V30A 2Y0BG 3E37A 4J6IA 3LPZA 5FZQA 5KJKA 1GW6A 3UX4A 4GZ5A 1KT0A 3B7UX 3JXIA 3HXFA 2P2CP 3SFZA 4EBAA 2WMNA 3EJNA 1UN9A 3KSQA 4FHKA 2J09A 3HDXA 4JD2G 4NACA 2H6IA 1UN8A 4MS6A 3TL5A 2IU1A 3L9TA 2DBAA 1QBQA 4JB8P 1UJKA 4L9PA 4BSXA 1HG5A 1HE8A 3S7JA 1N95A 2WXFA 2Y69E 3FDHA 4AY5A 1PAQA 4EZKA 4L2LA 3Q49B 1QNFA 2P9SG 2KCLA 4JVSA 2IO3C 1N4SA 3ABLE 3JUEA 3EHRA 4F53A 3ULYA 3OTNA 2ETCA 3LCAA 2MYOA 1OWLA 1OWNA 4OVVA 3R7RA 1PC2A 3DBSA 4GU5A 3FUIA 3I4RB 4W9RA 5AENA 2XENA 4K5CA 3FU6A 4K5BA 5JJ7A 3U9WA 4D10C 1S70B 3L82A 4I9CA 4KVOA 3V79K 3CK7A 3B7SA 4AJWA 3TWTA 5FQ8A 4B93B 2NYJA 5J90A 4APOA 4EBAG 3SBTB 2L6BA 3NAWA 4J8SA 2WQHA 4UQYA 4V3IA 4GZ3A 3W9FA 1OWPA 3LXUX 4J8EA 2LAIA 1YYHA 2WMOA 1O5MA 5H7PA 2VGEA 4B8CB 2B6CA 2J4BA 2VYIA 3FUKA 1EYHA 4ANUA 1JCSA 4G24A 4DI4A 4DRXE 1N11A 3ESLA 1Z5SC 4MKTA 3TXMA 3MV2B 3QJZA 2NC9A 1FVFA 4LG6A 3APFA 2F0YA 4UWGA 5T4YA 1H0AA 1MX4A 4Y6WA 4HXIA 4H7YA 5EYLA 2LUHA 3OXGA 2QFCA 4RG6A 4A3VA 2I2OA 1O1RA 3RJVA 4M7CA 2XEEA 4UI9C 3CHSA 4EZJA 4HLEA 1H6OA 2UY1B 4NURA 1JWFA 3CVUA 2RD0A 2AXVA 4FA6A 2OEWA 1SZ9A 2WPVA 3G2VA 3LJ3A 1VDYA 1K3ZD 4N39A 3QARA 2GRRB 3CLJA 2XRYA 3T5VA 4K5AB 3MYVA 2P58C 3Q5MA 1TEZA
chains in the Genus database with same CATH topology
1N0QA 1SVXA 3DEOA 3JXIA 3NOCD 3UXGA 3DEPA 2P2CP 4HRMB 3J5QB 1BD8A 3F6QA 5AQ7A 5CBNA 1BLXB 5BXUA 4ZHBA 2F37A 2B0OE 4J7WA 5ENPD 4G8LA 4HRNA 3W9FA 5HKPA 2DZOA 2KXPC 5AAOA 1MX6A 1D9SA 4HLLA 1OT8A 4O1OA 2DZNA 1MYOA 5HS0A 5CEAA 5KBAA 5FIOA 4YDWA 1BI7B 5ENRD 2QC9A 5AN8A 1YYHA 5ENTD 2BKGA 4HNAD 5AQAA 3UTMA 1K1AA 3B95A 4U8YD 4BEPA 2VGEA 3ZNGA 1NFIE 4HI9A 2J8SD 5CEDB 2ETBA 1N0RA 1G3NB 1UOHA 2QYJA 1IKND 3D9HA 3Q9NC 4U95D 2PNNA 5FINA 3TWUA 4JB8P 2DWZA 5AQBA 4DRXE 1MX2A 2F8XK 1N11A 4HI8A 2ETAA 2XEHA 1IXVA 3T9KA 4BESA 1IHBA 2RFAA 3V2XA 4U96D 5HRYA 3TWSA 2A5EA 4GMRA 3KEAA 3V2OA 5EYPF 1YCSB 5CERB 4BSZB 4OAVB 2F8YA 1K1BA 5ITZF 5D66A 3Q9UC 3EU9A 4DX6D 5EILA 2JABA 3AAAC 4LG6A 1DC2A 5JMND 4ZFHA 4BERA 3HRAA 3TWXA 4OAUC 3JUEA 1MX4A 4G8KA 3TWQA 3EHRA 5ENSD 4HBDA 5AQ9A 4BETA 4DX7D 4F6RD 5EN5D 5EYLA 3TWWA 5AARA 1YMPA 2ETCA 2BKKB 3AJIA 4QQIA 3C5RA 4UUCA 2MYOA 2Y1LE 2DVWA 5ENQD 4QFVA 1DCQA 4N5QA 2HE0A 4F1PA 4C48B 4GPMA 1AWCB 1MJ0A 4J8YA 4HQDA 4DX1A 2ZGDA 3IXEA 1OY3D 2XEEA 5EIDA 4DX2A 3NBNB 4CZ2D 5CECB 3ZUVB 5KNHD 3B7BA 3TWRA 3HG0D 3NOGD 1TR4A 2XZDG 3JXJA 4A63B 2XENA 2XZTG 1WDYA 1QYMA 4K5CA 5JA4D 2FO1E 1AP7A 4O60A 4K5BA 4O1PA 3W9GA 2ZGGA 3ZU7B 3J5PA 3SO8A 3ZKJA 2V5QC 1BI8B 4ATZD 1K3ZD 3EHQA 4HRLA 5CBOA 4Z68A 1S70B 3LJNA 2RFMA 1WG0A 4LNUD 3V79K 2V4HC 3UI2A 4U8VD 4LSZE 3V31A 3V30A 4CYMD 4DUIA 4NIKA 5KNGA 3TWVA 2KBXA 2Y0BG 4K5AB 5ENOD 3TWTA 4B93B 1A5EA 2NYJA 5BXOA 1BU9A 4YDYA 4DX5D 4HB5A 5EIBE 4TUMA 1SW6A 4RLYA 5KWDA 3T8KA 2L6BA 2AJAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N0Q A;  1SVX A;  3DEO A;  3JXI A;  3NOC D;  3UXG A;  3DEP A;  2P2C P;  4HRM B;  3J5Q B;  1BD8 A;  3F6Q A;  5AQ7 A;  5CBN A;  1BLX B;  5BXU A;  4ZHB A;  2F37 A;  2B0O E;  4J7W A;  5ENP D;  4G8L A;  4HRN A;  3W9F A;  5HKP A;  2DZO A;  2KXP C;  5AAO A;  1MX6 A;  1D9S A;  4HLL A;  1OT8 A;  4O1O A;  2DZN A;  1MYO A;  5HS0 A;  5CEA A;  5KBA A;  5FIO A;  4YDW A;  1BI7 B;  5ENR D;  2QC9 A;  5AN8 A;  1YYH A;  5ENT D;  2BKG A;  4HNA D;  5AQA A;  3UTM A;  1K1A A;  3B95 A;  4U8Y D;  4BEP A;  2VGE A;  3ZNG A;  1NFI E;  4HI9 A;  2J8S D;  5CED B;  2ETB A;  1N0R A;  1G3N B;  1UOH A;  2QYJ A;  1IKN D;  3D9H A;  3Q9N C;  4U95 D;  2PNN A;  5FIN A;  3TWU A;  4JB8 P;  2DWZ A;  5AQB A;  4DRX E;  1MX2 A;  2F8X K;  1N11 A;  4HI8 A;  2ETA A;  2XEH A;  1IXV A;  3T9K A;  4BES A;  1IHB A;  2RFA A;  3V2X A;  4U96 D;  5HRY A;  3TWS A;  2A5E A;  4GMR A;  3KEA A;  3V2O A;  5EYP F;  1YCS B;  5CER B;  4BSZ B;  4OAV B;  2F8Y A;  1K1B A;  5ITZ F;  5D66 A;  3Q9U C;  3EU9 A;  4DX6 D;  5EIL A;  2JAB A;  3AAA C;  4LG6 A;  1DC2 A;  5JMN D;  4ZFH A;  4BER A;  3HRA A;  3TWX A;  4OAU C;  3JUE A;  1MX4 A;  4G8K A;  3TWQ A;  3EHR A;  5ENS D;  4HBD A;  5AQ9 A;  4BET A;  4DX7 D;  4F6R D;  5EN5 D;  5EYL A;  3TWW A;  5AAR A;  1YMP A;  2ETC A;  2BKK B;  3AJI A;  4QQI A;  3C5R A;  4UUC A;  2MYO A;  2Y1L E;  2DVW A;  5ENQ D;  4QFV A;  1DCQ A;  4N5Q A;  2HE0 A;  4F1P A;  4C48 B;  4GPM A;  1AWC B;  1MJ0 A;  4J8Y A;  4HQD A;  4DX1 A;  2ZGD A;  3IXE A;  1OY3 D;  2XEE A;  5EID A;  4DX2 A;  3NBN B;  4CZ2 D;  5CEC B;  3ZUV B;  5KNH D;  3B7B A;  3TWR A;  3HG0 D;  3NOG D;  1TR4 A;  2XZD G;  3JXJ A;  4A63 B;  2XEN A;  2XZT G;  1WDY A;  1QYM A;  4K5C A;  5JA4 D;  2FO1 E;  1AP7 A;  4O60 A;  4K5B A;  4O1P A;  3W9G A;  2ZGG A;  3ZU7 B;  3J5P A;  3SO8 A;  3ZKJ A;  2V5Q C;  1BI8 B;  4ATZ D;  1K3Z D;  3EHQ A;  4HRL A;  5CBO A;  4Z68 A;  1S70 B;  3LJN A;  2RFM A;  1WG0 A;  4LNU D;  3V79 K;  2V4H C;  3UI2 A;  4U8V D;  4LSZ E;  3V31 A;  3V30 A;  4CYM D;  4DUI A;  4NIK A;  5KNG A;  3TWV A;  2KBX A;  2Y0B G;  4K5A B;  5ENO D;  3TWT A;  4B93 B;  1A5E A;  2NYJ A;  5BXO A;  1BU9 A;  4YDY A;  4DX5 D;  4HB5 A;  5EIB E;  4TUM A;  1SW6 A;  4RLY A;  5KWD A;  3T8K A;  2L6B A;  2AJA A; 
#chains in the Genus database with same CATH topology
 2LSU A;  3UXG A;  2ION A;  3DEP A;  4JXT A;  1BD8 A;  4L2Y A;  3ZYK A;  3PEV B;  2EQX A;  2CG3 A;  3FTU A;  4DPR A;  1D9S A;  3L22 A;  2I1K A;  2VSO E;  5CEA A;  5ENT D;  1OWM A;  2BKG A;  4N3C A;  4U8Y D;  3UIO C;  3CVX A;  5LCW J;  2L0T B;  4CT0 A;  2YNQ A;  3LY7 A;  3D9I A;  3FP3 A;  3MKQ B;  1OCZ E;  5HRY A;  5T3R A;  5EYP F;  3MX3 A;  5CER B;  4EZL A;  5CRU A;  3AAA C;  3LKU A;  3S7B A;  2PM6 A;  1X81 A;  2PQN A;  4UWK A;  5E76 A;  2RG8 A;  4JC8 A;  3D9J A;  1LTX A;  3KEZ A;  5AAR A;  2BKK B;  4GZC A;  4EHM A;  4HOU A;  4DLO A;  1HX8 A;  2V4L A;  4N5Q A;  2HR2 A;  4HVB A;  1OWO A;  5ENN A;  2HYZ A;  4DX2 A;  3E30 A;  4I6G A;  5DIZ A;  5AYW D;  5D0O D;  4YVO A;  3Q7A A;  4KMO A;  1TJC A;  4A63 B;  2LO6 A;  4E85 A;  2FF4 A;  3ZXP A;  4L23 A;  4UQZ A;  4O1P A;  3ZU7 B;  2EIK E;  4ATZ D;  3ONK A;  3EHQ A;  3LJN A;  3UI2 A;  1XGW A;  1LD7 A;  2XCC A;  4N2Q A;  3V31 A;  4AY6 A;  5KNG A;  2I6H A;  2Y4U A;  2IJG X;  1QQE A;  3Q79 A;  4MBG A;  4GML A;  5AQ7 A;  4FU3 A;  3MKR A;  3IEG A;  5AAO A;  2DZO A;  4J0U A;  3UKU G;  4BEP A;  4CDR A;  3C3O A;  2FO7 A;  3DXK G;  2LSV A;  3D9P A;  3VLD A;  3AU5 A;  2ETA A;  3N71 A;  2XS1 A;  4FC8 A;  1S0P A;  2KZT B;  1ELK A;  4TRQ A;  2C0L A;  4HOR A;  1TN7 A;  3ABM E;  4DJA A;  4FP7 A;  4GTQ A;  2GRM A;  4OAU C;  2P9P G;  3PUJ A;  1B89 A;  3EIJ A;  5ARG A;  3Q47 B;  2Y3A A;  4CGV A;  3C5R A;  3AU4 A;  2VSX E;  1ZBP A;  4C48 B;  3E4B A;  4GPM A;  4KXK B;  3ZUV B;  3E32 A;  3VLE A;  5JA4 D;  2FO1 E;  5CBO A;  3PH0 C;  2WXO A;  3TGO A;  4U8V D;  4LSZ E;  1EPU A;  1ELW A;  1Q2Z A;  3SI5 A;  3SHF A;  2KCK A;  3ML8 A;  1A5E A;  3BUA A;  4U8H A;  3GZS A;  2HO1 A;  4RLY A;  3RIB A;  4CEM A;  2AVP A;  3PVL A;  2CHX A;  2P9U G;  4ATG A;  3ZPJ A;  2C0M A;  4YDE A;  5KBA A;  4YDW A;  1TNZ A;  3ZNG A;  1NFI E;  3MZL B;  3ZGQ A;  4OYS A;  3QDN A;  1SQM A;  2PL2 A;  3HVE A;  3JUI A;  3D9H A;  4U95 D;  4CGW A;  3HHM A;  2F8X K;  3UM2 A;  2P9K G;  4G1T A;  2GRQ B;  1PY1 A;  3RO2 A;  5KJL A;  5EX0 A;  2F8Y A;  5JHA A;  5FZS A;  3CHR A;  4NQ0 A;  1DC2 A;  1P5Q A;  4BX9 A;  1E8Y A;  4G8K A;  1N4Q A;  1E96 B;  4A1G A;  5BV1 A;  4WWP A;  4UUC A;  4JA9 A;  4LUN U;  2WXM A;  3Q7F A;  1KT1 A;  1FVH A;  5E75 A;  4PUC A;  2XZD G;  1Z3X A;  4GPK A;  2GRL A;  5C1D A;  1KZO A;  3PZ2 A;  3AS5 A;  4JHR A;  4JW1 A;  3W9G A;  1NL4 A;  4A55 A;  3LY8 A;  1W3B A;  2RKK A;  3ASH A;  4PH4 B;  3ZHE A;  1O1S A;  4P29 A;  2KBX A;  3LY9 A;  2XPZ A;  4KYO B;  2ZIS A;  4DK5 A;  4B0Z A;  5D0Q D;  2UWJ G;  4J7W A;  3BEE A;  3F6Q A;  3BG1 B;  3FUD A;  3Q78 A;  4RSY A;  4HLL A;  1OT8 A;  4XE0 A;  2UY1 A;  5LP0 A;  2M63 A;  2Y4T A;  1IHG A;  1TYQ G;  2CHW A;  2LXM A;  3OXL A;  2AWI A;  5FIN A;  3CVW A;  4ACL A;  2EIL E;  4BES A;  5B3S E;  3BU8 A;  2QZA A;  2XGO A;  4CDM A;  3G2W A;  1SA4 A;  3EU9 A;  3FHE A;  3RO3 A;  3MEK A;  4ACK A;  5FJY A;  4L1B A;  4U0S A;  5CCL A;  3TWQ A;  1DCE A;  5BNW A;  2DYR E;  4I2W A;  1INZ A;  1HS6 A;  3UUX A;  3KAE A;  4XKC A;  2BF0 X;  4XKB A;  3MKQ A;  1E7U A;  3EUV A;  4YND A;  3G2S A;  3PNL B;  4YVQ C;  5EX3 A;  2WXN A;  3OAW A;  2VGX B;  4O60 A;  5G2N A;  4KZ0 A;  2X6H A;  1BI8 B;  2EIJ E;  3QWV A;  4PS7 A;  2IQC A;  4G2V A;  3O48 A;  2VGY A;  5CRV A;  3ASG A;  4HB5 A;  2OVF A;  3CHQ A;  2YHC A;  2WXL A;  2VSN A;  4DI3 A;  3CVQ A;  3ZHE B;  3IBE A;  3C72 A;  1OCR E;  5CCM A;  2XPI A;  3UT4 A;  4UI9 J;  3CKC A;  4F7A A;  4AV7 A;  2QC9 A;  4F3V A;  2R03 A;  4UI9 K;  2XRZ A;  1DNP A;  1H6K A;  4I9E A;  1MZC A;  4N3B A;  2J4D A;  2XPY A;  4LNG A;  3AG4 E;  3IHV A;  1IHB A;  1H19 A;  5FZR A;  4GMJ A;  4WNF A;  3BG0 B;  2FBN A;  1H2V C;  1FCH A;  2X6J A;  1K1B A;  3ESK A;  2LNI A;  5AJD A;  3RRU A;  3OXF A;  4GA0 A;  3MA5 A;  1HH8 A;  2GGF A;  4HOQ A;  3UT8 A;  2VSY A;  4KBQ A;  2IFU A;  3SD5 A;  5LCW C;  1WAO 1;  4G11 A;  2J9Q A;  3JXJ A;  4LRZ A;  3NF1 A;  3O4Z A;  4CT4 A;  2FUL A;  3DSS A;  3PS6 A;  1V55 E;  3ZKJ A;  3RAU A;  4Z68 A;  5JJ6 A;  3CHO A;  1N9A A;  4LNU D;  4FJY A;  4CYM D;  2OVB A;  2XGS A;  3DST A;  5M72 A;  1N52 A;  1ZB1 A;  3SNX A;  3PZD A;  1SW6 A;  5FIO A;  3EHN A;  2CHZ A;  4JHJ A;  3PE3 A;  5JJT A;  2P9I G;  4ZHB A;  2WQ7 A;  1NI1 A;  3FUJ A;  5G04 J;  4O1O A;  4GTO A;  3CK9 A;  5AQA A;  3B95 A;  3CVY A;  5A7D B;  5D2M C;  4I6E A;  5KJM A;  1NA3 A;  1XNF A;  4RQI A;  1IXV A;  1FT1 A;  3CSF A;  3D9L A;  4MLP A;  3KEA A;  1JWG A;  3SGH A;  2EIM E;  3ZYQ A;  5ITZ F;  5DBK A;  5EIL A;  3EU5 A;  2WXJ A;  3RKV A;  4ZFH A;  3CHP A;  3QWW A;  3TWX A;  2XQ0 A;  4HBD A;  2XGM A;  3L17 A;  5EN5 D;  3FFL A;  5ARF A;  2JEK A;  4WWN A;  4XEI G;  3C98 A;  3KD7 A;  3CEQ A;  3CIA A;  1HG2 A;  1N94 A;  4N3A A;  1TR4 A;  3DSU A;  4XI9 A;  2Q7F A;  4R7L A;  1QYM A;  3SF4 A;  3E34 A;  3ZRH A;  5IY5 E;  4GYO A;  4F1S A;  3D9K A;  5HQ8 A;  3AS8 A;  4KT6 B;  4BT8 A;  2OEV A;  5EIB E;  2WB2 A;  4I17 A;  3VLF A;  1WM5 A;  5FT9 A;  3CQG B;  4RG9 A;  3PUK A;  1S64 A;  3FUM A;  4IYP A;  3ASO E;  4BTB A;  2QY7 A;  4HRN A;  1KLX A;  2CG2 A;  3CST A;  5CHE E;  3T8M A;  3FUE A;  1MYO A;  1UW4 B;  3JYS A;  4JHK A;  4WND A;  4EEC A;  5ENR D;  1LF8 A;  5FQ4 A;  3UTM A;  3QB2 A;  4WNG A;  1UOH A;  3FH7 A;  1IKN D;  2J07 A;  5BPP A;  1MX2 A;  1JCR A;  2DCP A;  1TNO A;  3Q15 A;  4FAD A;  1N54 A;  2ILR A;  5AJL A;  3DSX A;  3KSL A;  5ANR A;  4I1O B;  2H6F A;  4ILH B;  4B94 A;  4I1M A;  5LOZ A;  1E8Z A;  4OVU A;  2GW1 A;  3IKO B;  3FY4 A;  2IY0 C;  3JCK C;  1BPO A;  4J8F A;  3PRZ A;  4ABN A;  3TAX A;  4J8Y A;  4DX1 A;  1E8X A;  5B1A E;  5EID A;  2R17 C;  4CZ2 D;  3B7B A;  1HU3 A;  3CGH A;  2X6K A;  3ONL A;  3MV3 B;  4K03 A;  3HXC A;  3NZS A;  3UQ3 A;  1OCC E;  3HXB A;  3CQC B;  4DLQ A;  3URZ A;  4AM9 A;  3P2B A;  3ZIM A;  4GB9 A;  2P9N G;  4JEH A;  4AP2 A;  4HNA D;  1IQU A;  3ZEF A;  3QAQ A;  5G05 C;  5A23 A;  4MRU A;  2F37 A;  1WY6 A;  4G8L A;  2KXP C;  2FI7 A;  1MX6 A;  2WXH A;  4BTA A;  1RZ4 A;  3UT7 A;  3CV0 A;  4GTS A;  3CVN A;  3ASF A;  1N0R A;  1JUQ A;  4B8A A;  3TJP A;  3AG1 E;  4GTM A;  4ME2 A;  2RFA A;  4CCA A;  3LVQ E;  3ASD A;  3QOU A;  3UMV A;  4OAV B;  2JAB A;  3QK0 A;  3I5P A;  3CVL A;  1H6P A;  5G05 J;  1L5J A;  4BET A;  4TXQ A;  2ZXW E;  3BQO A;  2WXR A;  4F1P A;  1D8E A;  1TNY A;  4HQD A;  1Y8M A;  3DRA A;  3ULQ A;  1JPL A;  2VTB A;  3APC A;  5KNH D;  3LVR E;  1D8D A;  3X2Q E;  3FTZ A;  4UWL A;  4URK A;  3L08 A;  2WXK A;  2XZT G;  1AP7 A;  4FLH A;  1TJF A;  3DSV A;  3FUL A;  4HRL A;  4U7E B;  1O1T A;  2KAT A;  4L7T A;  4GA1 A;  4NIK A;  3FU3 A;  4HOS A;  3GZ2 A;  3QWP A;  3CVV A;  3FU5 A;  5G55 A;  4ILG A;  4LNB A;  1E7V A;  4KVM A;  3G2U A;  3DXM G;  4GTP A;  4PS3 A;  2YHE A;  3TG5 A;  3ML9 A;  3PE4 A;  5ENP D;  5HS0 A;  3I3N A;  1NZN A;  4ILI A;  2VJ8 A;  3FEY A;  1FPP A;  3ZW3 A;  2L9B A;  4GYW A;  1OCO E;  1X5B A;  3HYM B;  1EF1 C;  5D66 A;  5FQ7 A;  2XHE A;  4JPS A;  4I2Z A;  3ISM C;  4M3O A;  2NXP A;  4U0U A;  4G26 A;  3FU0 A;  3HVE B;  3MGB A;  4IRU A;  1AWC B;  2HM8 A;  1K8K G;  2ZGD A;  3IXE A;  1OY3 D;  2IOS A;  3CVP A;  3SFY A;  3PNT B;  4BY6 A;  4FJZ A;  3ABK E;  4JA7 A;  1H2U A;  4XI0 A;  2V4H C;  3D9N A;  3KS2 A;  2I1J A;  3TWV A;  2BTD A;  1E8W A;  4H7X A;  2IOL A;  4TXR A;  5BW8 C;  1KZP A;  3DEO A;  3FUH A;  5KCM A;  4U63 A;  1IQR A;  4BT9 A;  4TUU A;  4U07 A;  3SBS A;  3CHM A;  5AN8 A;  4GZ6 A;  5CMY A;  1UJJ A;  3NQP A;  3B7R L;  4JEU A;  3I4G A;  5EDS A;  4UQX A;  4CDN A;  2DWZ A;  5AQB A;  3JQ0 A;  4HI8 A;  3PEU B;  2KZT A;  3FH5 A;  2LXL A;  4U96 D;  3UIN C;  3TWS A;  4ANX A;  2A5U A;  4HOT A;  2IF4 A;  3EIQ C;  3Q9U C;  3GYZ A;  2CFZ A;  4G25 A;  2MRI A;  2V8S E;  3UM0 A;  5ENS D;  4DX7 D;  4EQF A;  5G04 C;  2DVW A;  3U64 A;  4QFV A;  1MHQ A;  3U66 A;  3UM1 A;  2ZIR A;  4FLB A;  3ULE G;  1N4R A;  4Y6C A;  3U4T A;  4IN3 B;  1NA0 A;  1HO8 A;  2E0I A;  3GW4 A;  3PZ3 A;  3SY2 A;  3UKR G;  3S2A A;  2V5Q C;  3PDN A;  2E2E A;  4GTV A;  4TXP A;  2YQ8 A;  3RU0 A;  3QC1 A;  4O6F A;  1SA5 A;  4GTR A;  4BFR A;  2X3M A;  4PS8 A;  4YDY A;  3UM3 A;  5KWD A;  1ELR A;  4WWO A;  3HXE A;  2WM9 A;  4LER A;  1SVX A;  3NOC D;  4RVB A;  3FUF A;  2PQR A;  3FUN A;  3Q73 A;  4XX5 A;  4HI9 A;  3U3W A;  3PRE A;  2BUG A;  4J8D A;  3FTY A;  2YIN A;  3JQ1 A;  4AXH A;  2AXU A;  3T9K A;  5EKQ D;  3V2O A;  3PZ4 A;  2VQ2 A;  4C9B B;  3DPY A;  3CR3 A;  3NZU A;  3D3M A;  4B89 A;  4BER A;  3HRA A;  4E6H A;  2WQ6 A;  3R9A B;  2L6J A;  2J49 A;  3IHY A;  4QQI A;  1OXJ A;  2Y1L E;  4GZD A;  3VTY A;  4AOF A;  4C0E A;  2GRN B;  1SZA A;  4I43 A;  2NSZ A;  4A3T A;  5LX8 A;  1V54 E;  4LCT A;  4UWH A;  4I1A A;  5A6C A;  4HFG A;  2RFM A;  3C3R A;  1H2T C;  3ZYL A;  1U3D A;  2V0P A;  1N4P A;  1JCQ A;  3FWV A;  1BU9 A;  4AVX A;  2ZU6 B;  2VTB B;  3L16 A;  2AJA A;  5FWQ A;  4JL0 A;  3FTX A;  2WVI A;  5C2Y A;  3QNK A;  5FTP A;  4KZC A;  4WNE A;  1BI7 B;  1K1A A;  3FTS A;  4NRH B;  2J8S D;  3S7D A;  1TN8 A;  3SZ7 A;  2KCV A;  3APD A;  2PNN A;  2KC7 A;  4FHJ A;  2X6F A;  2IO2 C;  3CKB A;  3V2X A;  4ANV A;  3D9O A;  3T5X A;  4UWF A;  2FEZ A;  2WXP A;  5BV0 A;  4BSZ B;  3SQV A;  4DX6 D;  4U0Z A;  2OOE A;  5JMN D;  1HZ4 A;  3QKY A;  3ZXS A;  2R59 A;  2LAH A;  3ENE A;  3ZVV A;  2QYU A;  5AQ9 A;  3MJW A;  3TWW A;  4CRW A;  5ENQ D;  3L13 A;  3RRM B;  1MQS A;  2HE0 A;  5BT1 A;  4I6J A;  5BUZ A;  5CEC B;  3EHM A;  1ZU2 A;  3HG0 D;  4G23 A;  5AIJ A;  3PZ1 A;  2R2L A;  2R02 A;  1OUV A;  3R9M A;  4TV3 A;  1HXI A;  3B13 A;  3Q75 A;  2V5F A;  2ZGG A;  4WAF A;  1E90 A;  3IV0 A;  4AEZ C;  3DSW A;  2L0I A;  2WXI A;  3Q4A B;  3NB2 A;  4YDO A;  4DUI A;  3HIZ A;  1HF8 A;  3DPD A;  3E33 A;  3FH8 A;  5ENO D;  5BXO A;  2AW6 A;  2OCC E;  4TUM A;  3AG2 E;  3G2T A;  3C3Q A;  2H6H A;  4WUY A;  3T8K A;  2H6G A;  3B7T A;  4PDX A;  4JZY A;  2PM7 A;  4Q94 A;  3J5Q B;  3FEX A;  1BLX B;  5BXU A;  2B0O E;  3R7Q A;  5HKP A;  2A4Z A;  4LEU A;  3WXX A;  1TNU A;  2ETB A;  2OV8 A;  2KM4 A;  1A17 A;  1G3N B;  1FT2 A;  5JHB A;  2IEJ A;  2DIW A;  1S63 A;  2J08 A;  5FQ6 A;  2R5S A;  4U04 A;  3L54 A;  2XEH A;  3SFX A;  4GTT A;  5B1B E;  2PZI A;  2A5E A;  4GMR A;  2AXZ A;  3GZ1 A;  4BWR A;  5T8I A;  4A1S A;  5J08 A;  1TNB A;  4K0R A;  3TXN A;  1YA0 A;  4C0M A;  1TN6 A;  3WG7 E;  2MOW A;  3UPV A;  1LD8 A;  2WXQ A;  3FTW A;  4F6R D;  5CED B;  1YMP A;  3AJI A;  3LDZ A;  1MJ0 A;  3UIP C;  2EIN E;  2R05 A;  3ZYM A;  3NOG D;  3MCX A;  3K9I A;  1Z6T A;  1HFA A;  3AG3 E;  1WDY A;  4GYY A;  4N5C A;  3J5P A;  1Z3Y A;  2DYS E;  1WG0 A;  3S7F A;  4GAA A;  3RSE G;  4ANW A;  2BED A;  2CFU A;  3RRN B;  1RW2 A;  1U2V G;  5CMW A;  4DX5 D;  2GRO B;  2WXG A;  2C2L A;  3LYA A;  4Q96 A;  3P1U A;  4Q69 A;  1N0Q A;  3ASN E;  4X8Q A;  2P9L G;  4EPZ A;  4HRM B;  3TG4 A;  5CBN A;  3ZFW A;  3DWL G;  2DZN A;  5HI7 A;  4FUL A;  4BX8 A;  3AS4 A;  4GCO A;  4XZ4 A;  3L6A A;  2VGX A;  3EDT B;  3HXD A;  2QYJ A;  5ANL A;  3Q9N C;  2I9C A;  3TWU A;  4GCN A;  2JLB A;  4GA2 A;  3LS8 A;  2XEV A;  4APF A;  1YCS B;  4N2S A;  2MHK A;  3RK6 A;  3FTV A;  2XCB A;  4AIF A;  4IUL A;  1KPS B;  1DVP A;  1DCQ A;  2X6I A;  1IYG A;  4HS2 A;  3NBN B;  2XS8 A;  5LFA A;  1NP7 A;  3TWR A;  5KJN A;  2GRP B;  3LEW A;  4XIF A;  1U3C A;  1EDU A;  3CK8 A;  3D9M A;  1Y6I A;  3ZN3 A;  1QZ2 A;  3VTX A;  2X38 A;  3SO8 A;  1UG3 A;  2OND A;  3V30 A;  2Y0B G;  3E37 A;  4J6I A;  3LPZ A;  5FZQ A;  5KJK A;  1GW6 A;  3UX4 A;  4GZ5 A;  1KT0 A;  3B7U X;  3JXI A;  3HXF A;  2P2C P;  3SFZ A;  4EBA A;  2WMN A;  3EJN A;  1UN9 A;  3KSQ A;  4FHK A;  2J09 A;  3HDX A;  4JD2 G;  4NAC A;  2H6I A;  1UN8 A;  4MS6 A;  3TL5 A;  2IU1 A;  3L9T A;  2DBA A;  1QBQ A;  4JB8 P;  1UJK A;  4L9P A;  4BSX A;  1HG5 A;  1HE8 A;  3S7J A;  1N95 A;  2WXF A;  2Y69 E;  3FDH A;  4AY5 A;  1PAQ A;  4EZK A;  4L2L A;  3Q49 B;  1QNF A;  2P9S G;  2KCL A;  4JVS A;  2IO3 C;  1N4S A;  3ABL E;  3JUE A;  3EHR A;  4F53 A;  3ULY A;  3OTN A;  2ETC A;  3LCA A;  2MYO A;  1OWL A;  1OWN A;  4OVV A;  3R7R A;  1PC2 A;  3DBS A;  4GU5 A;  3FUI A;  3I4R B;  4W9R A;  5AEN A;  2XEN A;  4K5C A;  3FU6 A;  4K5B A;  5JJ7 A;  3U9W A;  4D10 C;  1S70 B;  3L82 A;  4I9C A;  4KVO A;  3V79 K;  3CK7 A;  3B7S A;  4AJW A;  3TWT A;  5FQ8 A;  4B93 B;  2NYJ A;  5J90 A;  4APO A;  4EBA G;  3SBT B;  2L6B A;  3NAW A;  4J8S A;  2WQH A;  4UQY A;  4V3I A;  4GZ3 A;  3W9F A;  1OWP A;  3LXU X;  4J8E A;  2LAI A;  1YYH A;  2WMO A;  1O5M A;  5H7P A;  2VGE A;  4B8C B;  2B6C A;  2J4B A;  2VYI A;  3FUK A;  1EYH A;  4ANU A;  1JCS A;  4G24 A;  4DI4 A;  4DRX E;  1N11 A;  3ESL A;  1Z5S C;  4MKT A;  3TXM A;  3MV2 B;  3QJZ A;  2NC9 A;  1FVF A;  4LG6 A;  3APF A;  2F0Y A;  4UWG A;  5T4Y A;  1H0A A;  1MX4 A;  4Y6W A;  4HXI A;  4H7Y A;  5EYL A;  2LUH A;  3OXG A;  2QFC A;  4RG6 A;  4A3V A;  2I2O A;  1O1R A;  3RJV A;  4M7C A;  2XEE A;  4UI9 C;  3CHS A;  4EZJ A;  4HLE A;  1H6O A;  2UY1 B;  4NUR A;  1JWF A;  3CVU A;  2RD0 A;  2AXV A;  4FA6 A;  2OEW A;  1SZ9 A;  2WPV A;  3G2V A;  3LJ3 A;  1VDY A;  1K3Z D;  4N39 A;  3QAR A;  2GRR B;  3CLJ A;  2XRY A;  3T5V A;  4K5A B;  3MYV A;  2P58 C;  3Q5M A;  1TEZ A; 
#chains in the Genus database with same CATH homology
 1N0Q A;  1SVX A;  3DEO A;  3JXI A;  3NOC D;  3UXG A;  3DEP A;  2P2C P;  4HRM B;  3J5Q B;  1BD8 A;  3F6Q A;  5AQ7 A;  5CBN A;  1BLX B;  5BXU A;  4ZHB A;  2F37 A;  2B0O E;  4J7W A;  5ENP D;  4G8L A;  4HRN A;  3W9F A;  5HKP A;  2DZO A;  2KXP C;  5AAO A;  1MX6 A;  1D9S A;  4HLL A;  1OT8 A;  4O1O A;  2DZN A;  1MYO A;  5HS0 A;  5CEA A;  5KBA A;  5FIO A;  4YDW A;  1BI7 B;  5ENR D;  2QC9 A;  5AN8 A;  1YYH A;  5ENT D;  2BKG A;  4HNA D;  5AQA A;  3UTM A;  1K1A A;  3B95 A;  4U8Y D;  4BEP A;  2VGE A;  3ZNG A;  1NFI E;  4HI9 A;  2J8S D;  5CED B;  2ETB A;  1N0R A;  1G3N B;  1UOH A;  2QYJ A;  1IKN D;  3D9H A;  3Q9N C;  4U95 D;  2PNN A;  5FIN A;  3TWU A;  4JB8 P;  2DWZ A;  5AQB A;  4DRX E;  1MX2 A;  2F8X K;  1N11 A;  4HI8 A;  2ETA A;  2XEH A;  1IXV A;  3T9K A;  4BES A;  1IHB A;  2RFA A;  3V2X A;  4U96 D;  5HRY A;  3TWS A;  2A5E A;  4GMR A;  3KEA A;  3V2O A;  5EYP F;  1YCS B;  5CER B;  4BSZ B;  4OAV B;  2F8Y A;  1K1B A;  5ITZ F;  5D66 A;  3Q9U C;  3EU9 A;  4DX6 D;  5EIL A;  2JAB A;  3AAA C;  4LG6 A;  1DC2 A;  5JMN D;  4ZFH A;  4BER A;  3HRA A;  3TWX A;  4OAU C;  3JUE A;  1MX4 A;  4G8K A;  3TWQ A;  3EHR A;  5ENS D;  4HBD A;  5AQ9 A;  4BET A;  4DX7 D;  4F6R D;  5EN5 D;  5EYL A;  3TWW A;  5AAR A;  1YMP A;  2ETC A;  2BKK B;  3AJI A;  4QQI A;  3C5R A;  4UUC A;  2MYO A;  2Y1L E;  2DVW A;  5ENQ D;  4QFV A;  1DCQ A;  4N5Q A;  2HE0 A;  4F1P A;  4C48 B;  4GPM A;  1AWC B;  1MJ0 A;  4J8Y A;  4HQD A;  4DX1 A;  2ZGD A;  3IXE A;  1OY3 D;  2XEE A;  5EID A;  4DX2 A;  3NBN B;  4CZ2 D;  5CEC B;  3ZUV B;  5KNH D;  3B7B A;  3TWR A;  3HG0 D;  3NOG D;  1TR4 A;  2XZD G;  3JXJ A;  4A63 B;  2XEN A;  2XZT G;  1WDY A;  1QYM A;  4K5C A;  5JA4 D;  2FO1 E;  1AP7 A;  4O60 A;  4K5B A;  4O1P A;  3W9G A;  2ZGG A;  3ZU7 B;  3J5P A;  3SO8 A;  3ZKJ A;  2V5Q C;  1BI8 B;  4ATZ D;  1K3Z D;  3EHQ A;  4HRL A;  5CBO A;  4Z68 A;  1S70 B;  3LJN A;  2RFM A;  1WG0 A;  4LNU D;  3V79 K;  2V4H C;  3UI2 A;  4U8V D;  4LSZ E;  3V31 A;  3V30 A;  4CYM D;  4DUI A;  4NIK A;  5KNG A;  3TWV A;  2KBX A;  2Y0B G;  4K5A B;  5ENO D;  3TWT A;  4B93 B;  1A5E A;  2NYJ A;  5BXO A;  1BU9 A;  4YDY A;  4DX5 D;  4HB5 A;  5EIB E;  4TUM A;  1SW6 A;  4RLY A;  5KWD A;  3T8K A;  2L6B A;  2AJA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...