4DX5D

Transport of drugs by the multidrug transporter acrb involves an access and a deep binding pocket that are separated by a switch-loop
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
156
structure length
156
Chain Sequence
b'GSDLGKKLLEAARAGRDDEVRILMANGADVNAADVVGWTPLHLAAYWGHLEIVEVLLKNGADVNAYDTLGSTPLHLAAHFGHLEIVEVLLKNGADVNAKDDNGITPLHLAANRGHLEIVEVLLKYGADVNAQDKFGKTAFDISINNGNEDLAEILQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acriflavine resistance protein B
publication title Transport of drugs by the multidrug transporter AcrB involves an access and a deep binding pocket that are separated by a switch-loop.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein, transport protein
total genus 52
structure length 156
sequence length 156
chains with identical sequence E
ec nomenclature
pdb deposition date 2012-02-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4dx5D00
3ZU7B 4B93B 1BLXB 2KXPC 2AJAA 4HLLA 3J5PA 3V79K 1YCSB 4BETA 5CBNA 3EHQA 5ITZF 3UI2A 5AN8A 5EN5D 5HKPA 3NBNB 4GMRA 1D9SA 2J8SD 1AP7A 3C5RA 4DX7D 5AQAA 5FINA 3J5QB 2NYJA 4GPMA 4U96D 4QFVA 2ZGGA 2XZDG 5CEDB 3W9GA 3TWQA 5AQ9A 3T9KA 1BU9A 3NOCD 2XEEA 3EU9A 4RLYA 4DX1A 5CEAA 3TWRA 3UXGA 4C48B 2PNNA 4DX2A 2Y1LE 4U8YD 2B0OE 3HG0D 4Z68A 3JXJA 3W9FA 4U95D 5HS0A 2A5EA 5AARA 2F8XK 3V31A 4HRMB 5KWDA 1MX6A 1N0QA 1N11A 2ETBA 4HRNA 1DCQA 3HRAA 4HQDA 4O1OA 4DRXE 4F1PA 5D66A 3TWWA 1K3ZD 1K1AA 4O60A 4CZ2D 1BI8B 4K5AB 3TWXA 4K5CA 4OAUC 2MYOA 4OAVB 2XZTG 2DZOA 5EYLA 3V30A 4LG6A 1BD8A 4HRLA 4HI8A 4BERA 2F37A 3LJNA 4BESA 3KEAA 1IHBA 2DVWA 1WDYA 4QQIA 4JB8P 3T8KA 3SO8A 2ETCA 3ZKJA 1SW6A 1IKND 1MJ0A 2JABA 3B7BA 3DEOA 5AQ7A 3ZUVB 1DC2A 3Q9NC 5ENRD 5HRYA 4HNAD 5EILA 3UTMA 1YYHA 2DZNA 5FIOA 1QYMA 4U8VD 5AAOA 3NOGD 4TUMA 4YDYA 4YDWA 2VGEA 3IXEA 5ENTD 5ENSD 2ZGDA 4ATZD 4DX6D 5KBAA 3TWSA 4A63B 2XEHA 3V2OA 2BKKB 3D9HA 1SVXA 1WG0A 5ENQD 2ETAA 3JXIA 1TR4A 2KBXA 4G8KA 3F6QA 1OY3D 4F6RD 1IXVA 3JUEA 2V4HC 5AQBA 5JA4D 1AWCB 4J8YA 2DWZA 1NFIE 3EHRA 1MYOA 2FO1E 4DX5D 1A5EA 2QYJA 5JMND 1K1BA 5EYPF 1BI7B 4J7WA 5CECB 4K5BA 3V2XA 4UUCA 4BEPA 1G3NB 5CERB 4G8LA 4HB5A 3DEPA 4LNUD 4LSZE 5ENPD 2F8YA 5EIDA 2V5QC 3TWVA 4BSZB 4HI9A 1YMPA 2RFMA 4ZFHA 2BKGA 2RFAA 1OT8A 1UOHA 2Y0BG 5BXOA 3TWTA 2QC9A 2P2CP 5KNHD 5ENOD 4ZHBA 4N5QA 5CBOA 4HBDA 1MX2A 1MX4A 1S70B 2L6BA 3ZNGA 4O1PA 3TWUA 4CYMD 4DUIA 3AJIA 4NIKA 3Q9UC 3AAAC 5BXUA 5EIBE 5KNGA 2HE0A 1N0RA 2XENA 3B95A
chains in the Genus database with same CATH superfamily
5D0QD 5J90A 1QQEA 2HM8A 4OVUA 1OCZE 1OXJA 3RIBA 3CHMA 3C3OA 2P9NG 5CRUA 4L2LA 4L23A 2UY1A 3NAWA 3CHRA 1BU9A 3CSTA 2J9QA 4BSXA 1FPPA 3AU5A 3U3WA 4BTAA 2WXKA 4U8YD 3RSEG 5FJYA 2CHWA 3TXMA 3V31A 4RQIA 1Y8MA 4O1OA 4XI9A 2WXQA 4KVOA 5EKQD 3PREA 2AWIA 4DI3A 3ZN3A 3ZUVB 1IKND 3E37A 2YQ8A 2CG2A 3PZ4A 3LY8A 5EILA 4DLOA 5C2YA 4ATZD 5ENSD 2ZGDA 2YHCA 2BKKB 3WG7E 3CQGB 3ML9A 4CDNA 3G2UA 4I43A 2IF4A 1ZBPA 3FUJA 3SD5A 1RW2A 4NRHB 2GROB 4U0SA 4F3VA 4BSZB 2LUHA 2QYUA 3FUIA 4GA0A 3FUMA 4LNBA 2H6GA 2PQNA 2ZISA 2XGSA 3ZU7B 1KT1A 3ZYLA 3Q5MA 4AV7A 3DXKG 4I17A 4J8EA 1SA5A 1OWNA 1IQUA 3AG1E 4IYPA 3CR3A 5H7PA 4N2SA 2M63A 2P9SG 1Z3YA 3PEUB 3WXXA 5ANLA 1N95A 4FHKA 4ABNA 2XZTG 4RG6A 4KXKB 3T8KA 3ZKJA 4B0ZA 1MJ0A 4JL0A 4FLHA 1U2VG 3MZLB 3HXCA 3QDNA 2DZNA 4ANWA 5ARFA 4Q69A 3CVWA 2QYJA 1K1BA 1Z5SC 3UM0A 4K5BA 4L2YA 3ONKA 1E8XA 5BUZA 4N2QA 5JHBA 4YNDA 4WAFA 2VTBA 3C72A 4I6EA 4O6FA 3TG4A 3HVEA 2KCKA 2X6HA 1JPLA 1H0AA 4G26A 3DSTA 1KZPA 4NIKA 1DC2A 3B95A 2LO6A 3HYMB 4B94A 3NBNB 2P9IG 3EHQA 4GMRA 3AS5A 2A4ZA 3FUHA 5CEDB 4AY5A 4DX1A 3DPDA 3CKBA 4CGVA 2B0OE 3KD7A 1LF8A 4TXPA 4GA1A 2VGXB 3R9AB 3OXGA 5T8IA 3CVYA 1H6KA 3APFA 4APFA 4AVXA 4K5CA 4OVVA 5JJ7A 2XGMA 4BERA 3LJNA 1TJCA 2X38A 5IY5E 4Q94A 4BX9A 3ZVVA 5C1DA 1HFAA 5ENRD 1QZ2A 2Q7FA 1QYMA 5AAOA 5EDSA 4CT4A 4J6IA 3U9WA 1WG0A 3HIZA 4XE0A 3DSXA 3ZPJA 4WNFA 3C3RA 3DPYA 3QJZA 4I9CA 2NC9A 3SI5A 4HB5A 3MA5A 5LCWJ 5E75A 4DI4A 3MEKA 3PUJA 3Q7AA 2QC9A 2P2CP 4ZHBA 3VLEA 2IU1A 1SQMA 2PM6A 4GTPA 3VTXA 3D9OA 4EZKA 3AJIA 5DBKA 4U7EB 2KXPC 2LSVA 3CK7A 4GTMA 3V79K 5EN5D 2EIME 4YDEA 2H6IA 3G2WA 2XEEA 4RLYA 3PRZA 3QKYA 3LYAA 4YVOA 3EJNA 1HXIA 2VSYA 3FUFA 1LD7A 4U95D 2GW1A 2XPZA 4KMOA 1MX6A 3PH0C 3HRAA 3ASNE 4HQDA 4PS8A 4OAUC 5FQ4A 1TN8A 1NL4A 2VYIA 3CLJA 5EX3A 3FDHA 2OV8A 4U0ZA 2R59A 2GRPB 2F37A 4WUYA 1ELRA 3DXMG 3DWLG 2XCBA 3DEOA 3Q9NC 5HRYA 3URZA 1NA0A 3FTZA 2MOWA 2HO1A 2WXIA 4YDWA 2P58C 4JVSA 2KZTA 3AG2E 2V4LA 1E7UA 2WXLA 3ZYKA 3V2OA 4I2WA 1HE8A 1A17A 4YDOA 2KBXA 3EHMA 2LXMA 3E33A 4NURA 2FULA 4C9BB 2H6FA 3PZ3A 2FO1E 3DSSA 3FTXA 5ENNA 1SA4A 4HOUA 1K8KG 2I2OA 3JUIA 1O1SA 4HOTA 1N9AA 3RU0A 2V5QC 3TXNA 3TWTA 2IOLA 3Q78A 4WNEA 1V54E 3S7FA 1N0RA 1XGWA 5T3RA 1N4QA 3FUEA 2YHEA 3S7BA 4L7TA 3PNTB 2WMOA 4J0UA 3I3NA 3ZEFA 3OXFA 5BPPA 4FULA 1D8DA 1L5JA 1N11A 1DCQA 4GB9A 3E34A 3L6AA 5EYLA 1N52A 2GRRB 5HI7A 2DVWA 2RG8A 4JB8P 2CG3A 4W9RA 3D9LA 1EYHA 4E6HA 3ULEG 3QOUA 5J08A 4FHJA 4ANUA 4JW1A 3QWWA 4LCTA 2X3MA 2PZIA 3IHYA 3CVLA 4PUCA 3CHQA 5CERB 3Q7FA 2F8YA 2B6CA 1SZ9A 3MV3B 2WQ7A 2YNQA 3HXFA 1E8ZA 4I9EA 4HI9A 2XQ0A 2BKGA 1O1TA 1O1RA 4ANXA 3S2AA 4HBDA 3EHNA 3LDZA 4H7XA 3TWUA 5A6CA 4N39A 4FJYA 4AP2A 3TL5A 4AEZC 4G25A 1BLXB 4ILIA 4CRWA 5KJNA 3UKUG 3JCKC 3FU0A 3MKRA 5AN8A 5BNWA 2LAHA 4I1OB 3TAXA 5ARGA 2ZGGA 3T9KA 5G05C 3DSWA 5FQ6A 2EILE 3I4GA 4F53A 3B7RL 3W9FA 2R5SA 1U3DA 3MGBA 3OXLA 3O48A 4HRNA 1X81A 1ELKA 1K3ZD 2XRZA 4CZ2D 3IV0A 3ZHEB 2DZOA 3SY2A 4E85A 1X5BA 2J4DA 3KEAA 4WNDA 4Q96A 2ETCA 5AQ7A 4EBAA 3Q4AB 3MYVA 1KPSB 3PS6A 1IHGA 4WWNA 4G24A 3N71A 2WQHA 4FU3A 1HG2A 1TNYA 1ELWA 4RG9A 3Q15A 3ESKA 5ENQD 3IEGA 4XX5A 2WXMA 4MS6A 3D9NA 3DSUA 3RO2A 4TXQA 5EYPF 1OCCE 4KVMA 4I2ZA 2ONDA 3APCA 1FCHA 3X2QE 4GCOA 2XS1A 3HDXA 4J8FA 3GZ2A 2I9CA 1UW4B 3ZGQA 3LVQE 5CBOA 3MKQA 1TNUA 1UN9A 3FFLA 2FO7A 2JEKA 4PS3A 3D9IA 1OCRE 4LEUA 4LRZA 4ATGA 2WVIA 3ZRHA 2IJGX 2HYZA 2NYJA 2VSNA 4QFVA 4PS7A 2DIWA 4JEUA 4GTTA 1INZA 3ISMC 2PNNA 1XNFA 4FC8A 3NF1A 3MV2B 3ASFA 2BF0X 4CT0A 2Y4UA 5KWDA 1EDUA 5G04C 3SFZA 1H2UA 2GRLA 3B7SA 4N3BA 5CRVA 2LAIA 3ZYQA 3SO8A 4AY6A 3SF4A 3FU6A 3UTMA 2J49A 1HO8A 3HXBA 4K0RA 4A1GA 4CGWA 2ETAA 2AXZA 4EPZA 4GMJA 2V5FA 4CDRA 3JQ0A 1IXVA 3ASHA 3FH5A 3JUEA 1AWCB 4GTRA 3UKRG 1OWOA 3NB2A 3CVXA 3FHEA 5FZSA 2DBAA 3EDTB 4JC8A 1YMPA 4UQZA 2V8SE 4HXIA 3GZSA 5KJLA 1S70B 3AG4E 2CHXA 3CK8A 4N3CA 3FEYA 5JA4D 5AENA 3QK0A 4DJAA 4JHKA 1PAQA 4GCNA 1H2TC 4BETA 5T4YA 4GTOA 4KYOB 2J8SD 2OEWA 3C5RA 5FINA 2XZDG 2NXPA 1FT2A 1MZCA 5BW8C 4C48B 4HOSA 5CHEE 5JJ6A 2QFCA 3ZYMA 4Z68A 2IY0C 4UWLA 3UM2A 4ILGA 4UI9C 4GMLA 1H6OA 3Q73A 4OAVB 1UN8A 4JPSA 4WNGA 1IHBA 3ONLA 2KC7A 5FQ8A 3P1UA 2WXOA 3L16A 4AM9A 3ZHEA 5FTPA 2VGEA 1OCOE 3HXEA 4DX6D 4KZCA 3Q47B 3KSQA 5JHAA 1OWLA 3L82A 4F6RD 1B89A 3DSVA 3I4RB 3Q49B 4H7YA 3PZ1A 4V3IA 4A3VA 1NFIE 4CCAA 4LUNU 4BEPA 1HH8A 5EIDA 4FLBA 4IULA 3TWVA 1TNZA 5AYWD 2VSXE 2RFMA 4N5QA 1WAO1 2P9PG 3CVQA 4KZ0A 2GRNB 4CYMD 3BEEA 4B89A 2HE0A 3QNKA 1W3BA 4JEHA 3CGHA 4HLLA 3FWVA 3SQVA 3APDA 4HORA 3B13A 3RRUA 3UI2A 5HQ8A 4GZDA 3ZFWA 3CVPA 4FP7A 5CEAA 2X6FA 2OEVA 1ZU2A 5EX0A 4PDXA 3G2VA 3FH7A 3FUKA 4MLPA 4NACA 4ACLA 1DVPA 2R17C 2C2LA 2KATA 3L17A 4K5AB 5E76A 2L0IA 2J09A 3RAUA 3I5PA 3KS2A 2JABA 2P9KG 2WXNA 3SBSA 4ME2A 2IONA 5ENTD 1JCSA 4A63B 2LNIA 5G2NA 4A1SA 3P2BA 2P9UG 2BEDA 1TR4A 1OY3D 5BV0A 3LXUX 4NQ0A 2RD0A 2Y4TA 4DX5D 1TNBA 4TUUA 3L54A 2UY1B 3EIJA 4N3AA 3AS8A 3UIPC 3PVLA 4KBQA 3B7TA 1TNOA 4HOQA 5KCMA 4JHJA 5ENOD 1MQSA 2PM7A 2EIKE 4DUIA 4GYWA 5BXUA 5EIBE 3ULYA 3S7DA 3AU4A 3J5PA 5D2MC 3UT8A 1D9SA 4BY6A 2F0YA 4DX7D 2AXUA 2WPVA 4EECA 1WM5A 5LFAA 3T5XA 3TWQA 3BG1B 4L1BA 3ABKE 4TV3A 4M7CA 3HG0D 4IN3B 4HVBA 2A5EA 3ML8A 4L9PA 4HS2A 4MBGA 2VJ8A 2ETBA 3R7RA 2L0TB 1N94A 1K1AA 3TWXA 4XEIG 4WWOA 5LX8A 3ZW3A 4JHRA 2BUGA 3CVNA 3FU5A 4HNAD 5DIZA 1YYHA 4U8VD 4GZ3A 2XEHA 2Y69E 1SVXA 5CCMA 3HXDA 2RKKA 4C0EA 1HG5A 3DBSA 3E4BA 5B1BE 2X6JA 1N4PA 1MYOA 3Q75A 1TN7A 3CSFA 4AXHA 2VGXA 4J7WA 1E7VA 1DNPA 2XPYA 4LNUD 3KEZA 2OVBA 4I6JA 3L08A 5KNHD 1N54A 3EUVA 4J8SA 3FUDA 2EQXA 3AS4A 1JWFA 3FH8A 3KSLA 3C3QA 4G2VA 5G05J 2J07A 1NA3A 3R7QA 1D8EA 3QWPA 5HKPA 3Q79A 5AQAA 3FTVA 2WM9A 4GYYA 1S63A 3NOCD 2CFZA 3PDNA 3UXGA 3O4ZA 2XGOA 2LXLA 3EIQC 2WXJA 3CQCB 4AJWA 4F1PA 2WXGA 3TWWA 4TRQA 3BUAA 4G11A 1HF8A 3V30A 2VTBB 3G2SA 3HVEB 4CDMA 2OVFA 4BFRA 2R2LA 2WXPA 3FY4A 1GW6A 3UINC 1PC2A 3PZDA 3CHSA 2ZU6B 1LD8A 4GZCA 5CCLA 3CVUA 3QC1A 2VQ2A 1NP7A 1UJJA 3ASDA 5CMWA 3ZXPA 4UQXA 4Y6WA 4GA2A 1BI7B 1O5MA 2IQCA 3ABLE 2BTDA 4FA6A 4G8LA 2IO3C 3BU8A 4U07A 1LTXA 2R05A 3QWVA 4BT8A 3LY9A 2RFAA 3MCXA 2Y0BG 5BXOA 3FU3A 1BPOA 4GU5A 2VGYA 1MX4A 2WXFA 5KNGA 4BWRA 3UPVA 1RZ4A 2AJAA 4JZYA 3LCAA 3ASGA 1JCQA 3L22A 3J5QB 4ACKA 3T5VA 3FEXA 4ILHB 2XRYA 2Y1LE 3UQ3A 2MRIA 3IBEA 5G04J 3D3MA 4EBAG 1E8YA 2C0LA 4I1MA 5LOZA 4DLQA 1KLXA 1WY6A 3KAEA 4O60A 1VDYA 3R9MA 1KZOA 3S7JA 4B8AA 4HRLA 4GTSA 2XS8A 1OWMA 3CIAA 4BESA 1WDYA 3BQOA 3LJ3A 3B7UX 3B7BA 3AG3E 3NQPA 4MRUA 5FWQA 1QBQA 5FQ7A 1NI1A 4N5CA 4FADA 2H6HA 4HFGA 3DRAA 1TEZA 3TWSA 4EQFA 1NZNA 1UJKA 3F6QA 2L6JA 2FI7A 4ANVA 3EHRA 3PE4A 4AOFA 4UUCA 3D9PA 1H19A 2E0IA 1IYGA 4OYSA 1UG3A 2ZXWE 4U04A 4X8QA 3VTYA 4GAAA 4U0UA 4G23A 4J8DA 2DYRE 4O1PA 3GYZA 3AAAC 2F8XK 5CMYA 3RJVA 3IHVA 4MKTA 4C0MA 2FEZA 4BT9A 2NSZA 1YCSB 5KJMA 3K9IA 3UT7A 3W9GA 2KZTB 2AXVA 1H2VC 1TJFA 4UI9J 4UWKA 1HX8A 5B3SE 3VLFA 2WMNA 1E90A 4UWFA 4DK5A 5AJDA 1BD8A 3ZXSA 4K03A 2X6KA 4LERA 3FUNA 5M72A 1P5QA 2DCPA 4YDYA 4TUMA 1FT1A 2I6HA 2R02A 1Z6TA 2QZAA 1S0PA 3JXIA 3G2TA 4GZ6A 3OAWA 4GTQA 3SGHA 4M3OA 4EZLA 2GGFA 2I1JA 3PEVB 4R7LA 4LNGA 1IQRA 1G3NB 4A55A 3E32A 3SFYA 3DEPA 2IO2C 2QY7A 3FTWA 4DPRA 5FT9A 4JD2G 4P29A 3LY7A 4XZ4A 2GRQB 4CEMA 4U63A 4RVBA 5KJKA 4D10C 3FTYA 2WXRA 3JYSA 2HR2A 3VLDA 5BV1A 3L13A 4TXRA 3PZ2A 1ZB1A 3D9JA 3QAQA 3IKOB 3RKVA 2XPIA 3ASOE 4U96D 3T8MA 3MX3A 3EU9A 1OWPA 3QARA 2CHZA 5FZQA 5G55A 4F1SA 1YA0A 5BT1A 5AIJA 2PQRA 3FP3A 1JCRA 4KT6B 2FF4A 3ENEA 4UI9K 3RK6A 2VSOE 4HI8A 2E2EA 3FULA 5A23A 4QQIA 3LPZA 5FZRA 3CEQA 4AIFA 5A7DB 2CFUA 1SW6A 4GYOA 2X6IA 2J08A 3UM3A 5D0OD 5ANRA 5FIOA 5KBAA 2WXHA 2FBNA 1TYQG 3SBTB 2KCLA 3D9HA 3SNXA 4EZJA 3ESLA 3U64A 2V4HC 2EINE 2DWZA 3D9KA 1JUQA 4IRUA 3U66A 5CECB 3V2XA 4A3TA 3NZUA 4F7AA 4XIFA 1V55E 2IEJA 4GTVA 3LVRE 1Z3XA 4ZFHA 3BG0B 2GRMA 2L6BA 2OCCE 3FTSA 4U8HA 3SFXA 3ZNGA 3UMVA 5LCWC 2Y3AA 3CHPA 3QB2A 2XENA 4B93B 4PH4B 3TG5A 3E30A 2XEVA 3PUKA 3FTUA 1FVHA 2IFUA 3EU5A 3RO3A 5ITZF 1E96B 2EIJE 1AP7A 4JA9A 2ILRA 3U4TA 2OOEA 4YVQC 2LSUA 5AQ9A 4I1AA 3C98A 4DX2A 1QNFA 4BTBA 3MJWA 1TN6A 3JXJA 3RRNB 5HS0A 1U3CA 1N0QA 4BX8A 4UWGA 4XKBA 3PNLB 4XKCA 2AW6A 2A5UA 2XHEA 4HLEA 3RRMB 2C0MA 3CHOA 2YINA 3MKQB 5JJTA 1N4RA 4G1TA 1HU3A 3IXEA 1H6PA 3UUXA 3SHFA 2XCCA 3HHMA 1HS6A 2R03A 5AQBA 4J8YA 1A5EA 5JMND 2JLBA 3UT4A 5ENPD 3LKUA 2UWJG 3GZ1A 4JA7A 1OT8A 4B8CB 4I6GA 3ABME 1MX2A 4RSYA 5LP0A 3UM1A 2WB2A 2AVPA 4APOA 5CBNA 3JQ1A 3CV0A 2KM4A 4EHMA 4GPMA 2ZIRA 3D9MA 3CKCA 2P9LG 2L9BA 3TWRA 4FJZA 1EF1C 2I1KA 1MHQA 2KCVA 2DYSE 4URKA 3LEWA 2IOSA 1JWGA 5AARA 4HRMB 2MHKA 4DRXE 1FVFA 5D66A 4UQYA 1BI8B 1EPUA 2MYOA 5AJLA 4LG6A 3CVVA 2PL2A 4Y6CA 2V0PA 3PE3A 4XI0A 2J4BA 4WWPA 3ZIMA 3TGOA 5B1AE 3TJPA 3NZSA 1DCEA 4JXTA 4GZ5A 3NOGD 3ULQA 3UX4A 4G8KA 1KT0A 1SZAA 1Q2ZA 3UIOC 1S64A 3L9TA 4LSZE 1N4SA 3SZ7A 2WQ6A 1PY1A 1Y6IA 1UOHA 3OTNA 1HZ4A 3CK9A 4UWHA 1E8WA 3LS8A 4GPKA 3Q9UC 3GW4A 1OUVA
chains in the Genus database with same CATH topology
3ZU7B 4B93B 1BLXB 2KXPC 2AJAA 4HLLA 3J5PA 3V79K 1YCSB 4BETA 5CBNA 3EHQA 5ITZF 3UI2A 5AN8A 5EN5D 5HKPA 3NBNB 4GMRA 1D9SA 2J8SD 1AP7A 3C5RA 4DX7D 5AQAA 5FINA 3J5QB 2NYJA 4GPMA 4U96D 4QFVA 2ZGGA 2XZDG 5CEDB 3W9GA 3TWQA 5AQ9A 3T9KA 1BU9A 3NOCD 2XEEA 3EU9A 4RLYA 4DX1A 5CEAA 3TWRA 3UXGA 4C48B 2PNNA 4DX2A 2Y1LE 4U8YD 2B0OE 3HG0D 4Z68A 3JXJA 3W9FA 4U95D 5HS0A 2A5EA 5AARA 2F8XK 3V31A 4HRMB 5KWDA 1MX6A 1N0QA 1N11A 2ETBA 4HRNA 1DCQA 3HRAA 4HQDA 4O1OA 4DRXE 4F1PA 5D66A 3TWWA 1K3ZD 1K1AA 4O60A 4CZ2D 1BI8B 4K5AB 3TWXA 4K5CA 4OAUC 2MYOA 4OAVB 2XZTG 2DZOA 5EYLA 3V30A 4LG6A 1BD8A 4HRLA 4HI8A 4BERA 2F37A 3LJNA 4BESA 3KEAA 1IHBA 2DVWA 1WDYA 4QQIA 4JB8P 3T8KA 3SO8A 2ETCA 3ZKJA 1SW6A 1IKND 1MJ0A 2JABA 3B7BA 3DEOA 5AQ7A 3ZUVB 1DC2A 3Q9NC 5ENRD 5HRYA 4HNAD 5EILA 3UTMA 1YYHA 2DZNA 5FIOA 1QYMA 4U8VD 5AAOA 3NOGD 4TUMA 4YDYA 4YDWA 2VGEA 3IXEA 5ENTD 5ENSD 2ZGDA 4ATZD 4DX6D 5KBAA 3TWSA 4A63B 2XEHA 3V2OA 2BKKB 3D9HA 1SVXA 1WG0A 5ENQD 2ETAA 3JXIA 1TR4A 2KBXA 4G8KA 3F6QA 1OY3D 4F6RD 1IXVA 3JUEA 2V4HC 5AQBA 5JA4D 1AWCB 4J8YA 2DWZA 1NFIE 3EHRA 1MYOA 2FO1E 4DX5D 1A5EA 2QYJA 5JMND 1K1BA 5EYPF 1BI7B 4J7WA 5CECB 4K5BA 3V2XA 4UUCA 4BEPA 1G3NB 5CERB 4G8LA 4HB5A 3DEPA 4LNUD 4LSZE 5ENPD 2F8YA 5EIDA 2V5QC 3TWVA 4BSZB 4HI9A 1YMPA 2RFMA 4ZFHA 2BKGA 2RFAA 1OT8A 1UOHA 2Y0BG 5BXOA 3TWTA 2QC9A 2P2CP 5KNHD 5ENOD 4ZHBA 4N5QA 5CBOA 4HBDA 1MX2A 1MX4A 1S70B 2L6BA 3ZNGA 4O1PA 3TWUA 4CYMD 4DUIA 3AJIA 4NIKA 3Q9UC 3AAAC 5BXUA 5EIBE 5KNGA 2HE0A 1N0RA 2XENA 3B95A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZU7 B;  4B93 B;  1BLX B;  2KXP C;  2AJA A;  4HLL A;  3J5P A;  3V79 K;  1YCS B;  4BET A;  5CBN A;  3EHQ A;  5ITZ F;  3UI2 A;  5AN8 A;  5EN5 D;  5HKP A;  3NBN B;  4GMR A;  1D9S A;  2J8S D;  1AP7 A;  3C5R A;  4DX7 D;  5AQA A;  5FIN A;  3J5Q B;  2NYJ A;  4GPM A;  4U96 D;  4QFV A;  2ZGG A;  2XZD G;  5CED B;  3W9G A;  3TWQ A;  5AQ9 A;  3T9K A;  1BU9 A;  3NOC D;  2XEE A;  3EU9 A;  4RLY A;  4DX1 A;  5CEA A;  3TWR A;  3UXG A;  4C48 B;  2PNN A;  4DX2 A;  2Y1L E;  4U8Y D;  2B0O E;  3HG0 D;  4Z68 A;  3JXJ A;  3W9F A;  4U95 D;  5HS0 A;  2A5E A;  5AAR A;  2F8X K;  3V31 A;  4HRM B;  5KWD A;  1MX6 A;  1N0Q A;  1N11 A;  2ETB A;  4HRN A;  1DCQ A;  3HRA A;  4HQD A;  4O1O A;  4DRX E;  4F1P A;  5D66 A;  3TWW A;  1K3Z D;  1K1A A;  4O60 A;  4CZ2 D;  1BI8 B;  4K5A B;  3TWX A;  4K5C A;  4OAU C;  2MYO A;  4OAV B;  2XZT G;  2DZO A;  5EYL A;  3V30 A;  4LG6 A;  1BD8 A;  4HRL A;  4HI8 A;  4BER A;  2F37 A;  3LJN A;  4BES A;  3KEA A;  1IHB A;  2DVW A;  1WDY A;  4QQI A;  4JB8 P;  3T8K A;  3SO8 A;  2ETC A;  3ZKJ A;  1SW6 A;  1IKN D;  1MJ0 A;  2JAB A;  3B7B A;  3DEO A;  5AQ7 A;  3ZUV B;  1DC2 A;  3Q9N C;  5ENR D;  5HRY A;  4HNA D;  5EIL A;  3UTM A;  1YYH A;  2DZN A;  5FIO A;  1QYM A;  4U8V D;  5AAO A;  3NOG D;  4TUM A;  4YDY A;  4YDW A;  2VGE A;  3IXE A;  5ENT D;  5ENS D;  2ZGD A;  4ATZ D;  4DX6 D;  5KBA A;  3TWS A;  4A63 B;  2XEH A;  3V2O A;  2BKK B;  3D9H A;  1SVX A;  1WG0 A;  5ENQ D;  2ETA A;  3JXI A;  1TR4 A;  2KBX A;  4G8K A;  3F6Q A;  1OY3 D;  4F6R D;  1IXV A;  3JUE A;  2V4H C;  5AQB A;  5JA4 D;  1AWC B;  4J8Y A;  2DWZ A;  1NFI E;  3EHR A;  1MYO A;  2FO1 E;  4DX5 D;  1A5E A;  2QYJ A;  5JMN D;  1K1B A;  5EYP F;  1BI7 B;  4J7W A;  5CEC B;  4K5B A;  3V2X A;  4UUC A;  4BEP A;  1G3N B;  5CER B;  4G8L A;  4HB5 A;  3DEP A;  4LNU D;  4LSZ E;  5ENP D;  2F8Y A;  5EID A;  2V5Q C;  3TWV A;  4BSZ B;  4HI9 A;  1YMP A;  2RFM A;  4ZFH A;  2BKG A;  2RFA A;  1OT8 A;  1UOH A;  2Y0B G;  5BXO A;  3TWT A;  2QC9 A;  2P2C P;  5KNH D;  5ENO D;  4ZHB A;  4N5Q A;  5CBO A;  4HBD A;  1MX2 A;  1MX4 A;  1S70 B;  2L6B A;  3ZNG A;  4O1P A;  3TWU A;  4CYM D;  4DUI A;  3AJI A;  4NIK A;  3Q9U C;  3AAA C;  5BXU A;  5EIB E;  5KNG A;  2HE0 A;  1N0R A;  2XEN A;  3B95 A; 
#chains in the Genus database with same CATH topology
 5D0Q D;  5J90 A;  1QQE A;  2HM8 A;  4OVU A;  1OCZ E;  1OXJ A;  3RIB A;  3CHM A;  3C3O A;  2P9N G;  5CRU A;  4L2L A;  4L23 A;  2UY1 A;  3NAW A;  3CHR A;  1BU9 A;  3CST A;  2J9Q A;  4BSX A;  1FPP A;  3AU5 A;  3U3W A;  4BTA A;  2WXK A;  4U8Y D;  3RSE G;  5FJY A;  2CHW A;  3TXM A;  3V31 A;  4RQI A;  1Y8M A;  4O1O A;  4XI9 A;  2WXQ A;  4KVO A;  5EKQ D;  3PRE A;  2AWI A;  4DI3 A;  3ZN3 A;  3ZUV B;  1IKN D;  3E37 A;  2YQ8 A;  2CG2 A;  3PZ4 A;  3LY8 A;  5EIL A;  4DLO A;  5C2Y A;  4ATZ D;  5ENS D;  2ZGD A;  2YHC A;  2BKK B;  3WG7 E;  3CQG B;  3ML9 A;  4CDN A;  3G2U A;  4I43 A;  2IF4 A;  1ZBP A;  3FUJ A;  3SD5 A;  1RW2 A;  4NRH B;  2GRO B;  4U0S A;  4F3V A;  4BSZ B;  2LUH A;  2QYU A;  3FUI A;  4GA0 A;  3FUM A;  4LNB A;  2H6G A;  2PQN A;  2ZIS A;  2XGS A;  3ZU7 B;  1KT1 A;  3ZYL A;  3Q5M A;  4AV7 A;  3DXK G;  4I17 A;  4J8E A;  1SA5 A;  1OWN A;  1IQU A;  3AG1 E;  4IYP A;  3CR3 A;  5H7P A;  4N2S A;  2M63 A;  2P9S G;  1Z3Y A;  3PEU B;  3WXX A;  5ANL A;  1N95 A;  4FHK A;  4ABN A;  2XZT G;  4RG6 A;  4KXK B;  3T8K A;  3ZKJ A;  4B0Z A;  1MJ0 A;  4JL0 A;  4FLH A;  1U2V G;  3MZL B;  3HXC A;  3QDN A;  2DZN A;  4ANW A;  5ARF A;  4Q69 A;  3CVW A;  2QYJ A;  1K1B A;  1Z5S C;  3UM0 A;  4K5B A;  4L2Y A;  3ONK A;  1E8X A;  5BUZ A;  4N2Q A;  5JHB A;  4YND A;  4WAF A;  2VTB A;  3C72 A;  4I6E A;  4O6F A;  3TG4 A;  3HVE A;  2KCK A;  2X6H A;  1JPL A;  1H0A A;  4G26 A;  3DST A;  1KZP A;  4NIK A;  1DC2 A;  3B95 A;  2LO6 A;  3HYM B;  4B94 A;  3NBN B;  2P9I G;  3EHQ A;  4GMR A;  3AS5 A;  2A4Z A;  3FUH A;  5CED B;  4AY5 A;  4DX1 A;  3DPD A;  3CKB A;  4CGV A;  2B0O E;  3KD7 A;  1LF8 A;  4TXP A;  4GA1 A;  2VGX B;  3R9A B;  3OXG A;  5T8I A;  3CVY A;  1H6K A;  3APF A;  4APF A;  4AVX A;  4K5C A;  4OVV A;  5JJ7 A;  2XGM A;  4BER A;  3LJN A;  1TJC A;  2X38 A;  5IY5 E;  4Q94 A;  4BX9 A;  3ZVV A;  5C1D A;  1HFA A;  5ENR D;  1QZ2 A;  2Q7F A;  1QYM A;  5AAO A;  5EDS A;  4CT4 A;  4J6I A;  3U9W A;  1WG0 A;  3HIZ A;  4XE0 A;  3DSX A;  3ZPJ A;  4WNF A;  3C3R A;  3DPY A;  3QJZ A;  4I9C A;  2NC9 A;  3SI5 A;  4HB5 A;  3MA5 A;  5LCW J;  5E75 A;  4DI4 A;  3MEK A;  3PUJ A;  3Q7A A;  2QC9 A;  2P2C P;  4ZHB A;  3VLE A;  2IU1 A;  1SQM A;  2PM6 A;  4GTP A;  3VTX A;  3D9O A;  4EZK A;  3AJI A;  5DBK A;  4U7E B;  2KXP C;  2LSV A;  3CK7 A;  4GTM A;  3V79 K;  5EN5 D;  2EIM E;  4YDE A;  2H6I A;  3G2W A;  2XEE A;  4RLY A;  3PRZ A;  3QKY A;  3LYA A;  4YVO A;  3EJN A;  1HXI A;  2VSY A;  3FUF A;  1LD7 A;  4U95 D;  2GW1 A;  2XPZ A;  4KMO A;  1MX6 A;  3PH0 C;  3HRA A;  3ASN E;  4HQD A;  4PS8 A;  4OAU C;  5FQ4 A;  1TN8 A;  1NL4 A;  2VYI A;  3CLJ A;  5EX3 A;  3FDH A;  2OV8 A;  4U0Z A;  2R59 A;  2GRP B;  2F37 A;  4WUY A;  1ELR A;  3DXM G;  3DWL G;  2XCB A;  3DEO A;  3Q9N C;  5HRY A;  3URZ A;  1NA0 A;  3FTZ A;  2MOW A;  2HO1 A;  2WXI A;  4YDW A;  2P58 C;  4JVS A;  2KZT A;  3AG2 E;  2V4L A;  1E7U A;  2WXL A;  3ZYK A;  3V2O A;  4I2W A;  1HE8 A;  1A17 A;  4YDO A;  2KBX A;  3EHM A;  2LXM A;  3E33 A;  4NUR A;  2FUL A;  4C9B B;  2H6F A;  3PZ3 A;  2FO1 E;  3DSS A;  3FTX A;  5ENN A;  1SA4 A;  4HOU A;  1K8K G;  2I2O A;  3JUI A;  1O1S A;  4HOT A;  1N9A A;  3RU0 A;  2V5Q C;  3TXN A;  3TWT A;  2IOL A;  3Q78 A;  4WNE A;  1V54 E;  3S7F A;  1N0R A;  1XGW A;  5T3R A;  1N4Q A;  3FUE A;  2YHE A;  3S7B A;  4L7T A;  3PNT B;  2WMO A;  4J0U A;  3I3N A;  3ZEF A;  3OXF A;  5BPP A;  4FUL A;  1D8D A;  1L5J A;  1N11 A;  1DCQ A;  4GB9 A;  3E34 A;  3L6A A;  5EYL A;  1N52 A;  2GRR B;  5HI7 A;  2DVW A;  2RG8 A;  4JB8 P;  2CG3 A;  4W9R A;  3D9L A;  1EYH A;  4E6H A;  3ULE G;  3QOU A;  5J08 A;  4FHJ A;  4ANU A;  4JW1 A;  3QWW A;  4LCT A;  2X3M A;  2PZI A;  3IHY A;  3CVL A;  4PUC A;  3CHQ A;  5CER B;  3Q7F A;  2F8Y A;  2B6C A;  1SZ9 A;  3MV3 B;  2WQ7 A;  2YNQ A;  3HXF A;  1E8Z A;  4I9E A;  4HI9 A;  2XQ0 A;  2BKG A;  1O1T A;  1O1R A;  4ANX A;  3S2A A;  4HBD A;  3EHN A;  3LDZ A;  4H7X A;  3TWU A;  5A6C A;  4N39 A;  4FJY A;  4AP2 A;  3TL5 A;  4AEZ C;  4G25 A;  1BLX B;  4ILI A;  4CRW A;  5KJN A;  3UKU G;  3JCK C;  3FU0 A;  3MKR A;  5AN8 A;  5BNW A;  2LAH A;  4I1O B;  3TAX A;  5ARG A;  2ZGG A;  3T9K A;  5G05 C;  3DSW A;  5FQ6 A;  2EIL E;  3I4G A;  4F53 A;  3B7R L;  3W9F A;  2R5S A;  1U3D A;  3MGB A;  3OXL A;  3O48 A;  4HRN A;  1X81 A;  1ELK A;  1K3Z D;  2XRZ A;  4CZ2 D;  3IV0 A;  3ZHE B;  2DZO A;  3SY2 A;  4E85 A;  1X5B A;  2J4D A;  3KEA A;  4WND A;  4Q96 A;  2ETC A;  5AQ7 A;  4EBA A;  3Q4A B;  3MYV A;  1KPS B;  3PS6 A;  1IHG A;  4WWN A;  4G24 A;  3N71 A;  2WQH A;  4FU3 A;  1HG2 A;  1TNY A;  1ELW A;  4RG9 A;  3Q15 A;  3ESK A;  5ENQ D;  3IEG A;  4XX5 A;  2WXM A;  4MS6 A;  3D9N A;  3DSU A;  3RO2 A;  4TXQ A;  5EYP F;  1OCC E;  4KVM A;  4I2Z A;  2OND A;  3APC A;  1FCH A;  3X2Q E;  4GCO A;  2XS1 A;  3HDX A;  4J8F A;  3GZ2 A;  2I9C A;  1UW4 B;  3ZGQ A;  3LVQ E;  5CBO A;  3MKQ A;  1TNU A;  1UN9 A;  3FFL A;  2FO7 A;  2JEK A;  4PS3 A;  3D9I A;  1OCR E;  4LEU A;  4LRZ A;  4ATG A;  2WVI A;  3ZRH A;  2IJG X;  2HYZ A;  2NYJ A;  2VSN A;  4QFV A;  4PS7 A;  2DIW A;  4JEU A;  4GTT A;  1INZ A;  3ISM C;  2PNN A;  1XNF A;  4FC8 A;  3NF1 A;  3MV2 B;  3ASF A;  2BF0 X;  4CT0 A;  2Y4U A;  5KWD A;  1EDU A;  5G04 C;  3SFZ A;  1H2U A;  2GRL A;  3B7S A;  4N3B A;  5CRV A;  2LAI A;  3ZYQ A;  3SO8 A;  4AY6 A;  3SF4 A;  3FU6 A;  3UTM A;  2J49 A;  1HO8 A;  3HXB A;  4K0R A;  4A1G A;  4CGW A;  2ETA A;  2AXZ A;  4EPZ A;  4GMJ A;  2V5F A;  4CDR A;  3JQ0 A;  1IXV A;  3ASH A;  3FH5 A;  3JUE A;  1AWC B;  4GTR A;  3UKR G;  1OWO A;  3NB2 A;  3CVX A;  3FHE A;  5FZS A;  2DBA A;  3EDT B;  4JC8 A;  1YMP A;  4UQZ A;  2V8S E;  4HXI A;  3GZS A;  5KJL A;  1S70 B;  3AG4 E;  2CHX A;  3CK8 A;  4N3C A;  3FEY A;  5JA4 D;  5AEN A;  3QK0 A;  4DJA A;  4JHK A;  1PAQ A;  4GCN A;  1H2T C;  4BET A;  5T4Y A;  4GTO A;  4KYO B;  2J8S D;  2OEW A;  3C5R A;  5FIN A;  2XZD G;  2NXP A;  1FT2 A;  1MZC A;  5BW8 C;  4C48 B;  4HOS A;  5CHE E;  5JJ6 A;  2QFC A;  3ZYM A;  4Z68 A;  2IY0 C;  4UWL A;  3UM2 A;  4ILG A;  4UI9 C;  4GML A;  1H6O A;  3Q73 A;  4OAV B;  1UN8 A;  4JPS A;  4WNG A;  1IHB A;  3ONL A;  2KC7 A;  5FQ8 A;  3P1U A;  2WXO A;  3L16 A;  4AM9 A;  3ZHE A;  5FTP A;  2VGE A;  1OCO E;  3HXE A;  4DX6 D;  4KZC A;  3Q47 B;  3KSQ A;  5JHA A;  1OWL A;  3L82 A;  4F6R D;  1B89 A;  3DSV A;  3I4R B;  3Q49 B;  4H7Y A;  3PZ1 A;  4V3I A;  4A3V A;  1NFI E;  4CCA A;  4LUN U;  4BEP A;  1HH8 A;  5EID A;  4FLB A;  4IUL A;  3TWV A;  1TNZ A;  5AYW D;  2VSX E;  2RFM A;  4N5Q A;  1WAO 1;  2P9P G;  3CVQ A;  4KZ0 A;  2GRN B;  4CYM D;  3BEE A;  4B89 A;  2HE0 A;  3QNK A;  1W3B A;  4JEH A;  3CGH A;  4HLL A;  3FWV A;  3SQV A;  3APD A;  4HOR A;  3B13 A;  3RRU A;  3UI2 A;  5HQ8 A;  4GZD A;  3ZFW A;  3CVP A;  4FP7 A;  5CEA A;  2X6F A;  2OEV A;  1ZU2 A;  5EX0 A;  4PDX A;  3G2V A;  3FH7 A;  3FUK A;  4MLP A;  4NAC A;  4ACL A;  1DVP A;  2R17 C;  2C2L A;  2KAT A;  3L17 A;  4K5A B;  5E76 A;  2L0I A;  2J09 A;  3RAU A;  3I5P A;  3KS2 A;  2JAB A;  2P9K G;  2WXN A;  3SBS A;  4ME2 A;  2ION A;  5ENT D;  1JCS A;  4A63 B;  2LNI A;  5G2N A;  4A1S A;  3P2B A;  2P9U G;  2BED A;  1TR4 A;  1OY3 D;  5BV0 A;  3LXU X;  4NQ0 A;  2RD0 A;  2Y4T A;  4DX5 D;  1TNB A;  4TUU A;  3L54 A;  2UY1 B;  3EIJ A;  4N3A A;  3AS8 A;  3UIP C;  3PVL A;  4KBQ A;  3B7T A;  1TNO A;  4HOQ A;  5KCM A;  4JHJ A;  5ENO D;  1MQS A;  2PM7 A;  2EIK E;  4DUI A;  4GYW A;  5BXU A;  5EIB E;  3ULY A;  3S7D A;  3AU4 A;  3J5P A;  5D2M C;  3UT8 A;  1D9S A;  4BY6 A;  2F0Y A;  4DX7 D;  2AXU A;  2WPV A;  4EEC A;  1WM5 A;  5LFA A;  3T5X A;  3TWQ A;  3BG1 B;  4L1B A;  3ABK E;  4TV3 A;  4M7C A;  3HG0 D;  4IN3 B;  4HVB A;  2A5E A;  3ML8 A;  4L9P A;  4HS2 A;  4MBG A;  2VJ8 A;  2ETB A;  3R7R A;  2L0T B;  1N94 A;  1K1A A;  3TWX A;  4XEI G;  4WWO A;  5LX8 A;  3ZW3 A;  4JHR A;  2BUG A;  3CVN A;  3FU5 A;  4HNA D;  5DIZ A;  1YYH A;  4U8V D;  4GZ3 A;  2XEH A;  2Y69 E;  1SVX A;  5CCM A;  3HXD A;  2RKK A;  4C0E A;  1HG5 A;  3DBS A;  3E4B A;  5B1B E;  2X6J A;  1N4P A;  1MYO A;  3Q75 A;  1TN7 A;  3CSF A;  4AXH A;  2VGX A;  4J7W A;  1E7V A;  1DNP A;  2XPY A;  4LNU D;  3KEZ A;  2OVB A;  4I6J A;  3L08 A;  5KNH D;  1N54 A;  3EUV A;  4J8S A;  3FUD A;  2EQX A;  3AS4 A;  1JWF A;  3FH8 A;  3KSL A;  3C3Q A;  4G2V A;  5G05 J;  2J07 A;  1NA3 A;  3R7Q A;  1D8E A;  3QWP A;  5HKP A;  3Q79 A;  5AQA A;  3FTV A;  2WM9 A;  4GYY A;  1S63 A;  3NOC D;  2CFZ A;  3PDN A;  3UXG A;  3O4Z A;  2XGO A;  2LXL A;  3EIQ C;  2WXJ A;  3CQC B;  4AJW A;  4F1P A;  2WXG A;  3TWW A;  4TRQ A;  3BUA A;  4G11 A;  1HF8 A;  3V30 A;  2VTB B;  3G2S A;  3HVE B;  4CDM A;  2OVF A;  4BFR A;  2R2L A;  2WXP A;  3FY4 A;  1GW6 A;  3UIN C;  1PC2 A;  3PZD A;  3CHS A;  2ZU6 B;  1LD8 A;  4GZC A;  5CCL A;  3CVU A;  3QC1 A;  2VQ2 A;  1NP7 A;  1UJJ A;  3ASD A;  5CMW A;  3ZXP A;  4UQX A;  4Y6W A;  4GA2 A;  1BI7 B;  1O5M A;  2IQC A;  3ABL E;  2BTD A;  4FA6 A;  4G8L A;  2IO3 C;  3BU8 A;  4U07 A;  1LTX A;  2R05 A;  3QWV A;  4BT8 A;  3LY9 A;  2RFA A;  3MCX A;  2Y0B G;  5BXO A;  3FU3 A;  1BPO A;  4GU5 A;  2VGY A;  1MX4 A;  2WXF A;  5KNG A;  4BWR A;  3UPV A;  1RZ4 A;  2AJA A;  4JZY A;  3LCA A;  3ASG A;  1JCQ A;  3L22 A;  3J5Q B;  4ACK A;  3T5V A;  3FEX A;  4ILH B;  2XRY A;  2Y1L E;  3UQ3 A;  2MRI A;  3IBE A;  5G04 J;  3D3M A;  4EBA G;  1E8Y A;  2C0L A;  4I1M A;  5LOZ A;  4DLQ A;  1KLX A;  1WY6 A;  3KAE A;  4O60 A;  1VDY A;  3R9M A;  1KZO A;  3S7J A;  4B8A A;  4HRL A;  4GTS A;  2XS8 A;  1OWM A;  3CIA A;  4BES A;  1WDY A;  3BQO A;  3LJ3 A;  3B7U X;  3B7B A;  3AG3 E;  3NQP A;  4MRU A;  5FWQ A;  1QBQ A;  5FQ7 A;  1NI1 A;  4N5C A;  4FAD A;  2H6H A;  4HFG A;  3DRA A;  1TEZ A;  3TWS A;  4EQF A;  1NZN A;  1UJK A;  3F6Q A;  2L6J A;  2FI7 A;  4ANV A;  3EHR A;  3PE4 A;  4AOF A;  4UUC A;  3D9P A;  1H19 A;  2E0I A;  1IYG A;  4OYS A;  1UG3 A;  2ZXW E;  4U04 A;  4X8Q A;  3VTY A;  4GAA A;  4U0U A;  4G23 A;  4J8D A;  2DYR E;  4O1P A;  3GYZ A;  3AAA C;  2F8X K;  5CMY A;  3RJV A;  3IHV A;  4MKT A;  4C0M A;  2FEZ A;  4BT9 A;  2NSZ A;  1YCS B;  5KJM A;  3K9I A;  3UT7 A;  3W9G A;  2KZT B;  2AXV A;  1H2V C;  1TJF A;  4UI9 J;  4UWK A;  1HX8 A;  5B3S E;  3VLF A;  2WMN A;  1E90 A;  4UWF A;  4DK5 A;  5AJD A;  1BD8 A;  3ZXS A;  4K03 A;  2X6K A;  4LER A;  3FUN A;  5M72 A;  1P5Q A;  2DCP A;  4YDY A;  4TUM A;  1FT1 A;  2I6H A;  2R02 A;  1Z6T A;  2QZA A;  1S0P A;  3JXI A;  3G2T A;  4GZ6 A;  3OAW A;  4GTQ A;  3SGH A;  4M3O A;  4EZL A;  2GGF A;  2I1J A;  3PEV B;  4R7L A;  4LNG A;  1IQR A;  1G3N B;  4A55 A;  3E32 A;  3SFY A;  3DEP A;  2IO2 C;  2QY7 A;  3FTW A;  4DPR A;  5FT9 A;  4JD2 G;  4P29 A;  3LY7 A;  4XZ4 A;  2GRQ B;  4CEM A;  4U63 A;  4RVB A;  5KJK A;  4D10 C;  3FTY A;  2WXR A;  3JYS A;  2HR2 A;  3VLD A;  5BV1 A;  3L13 A;  4TXR A;  3PZ2 A;  1ZB1 A;  3D9J A;  3QAQ A;  3IKO B;  3RKV A;  2XPI A;  3ASO E;  4U96 D;  3T8M A;  3MX3 A;  3EU9 A;  1OWP A;  3QAR A;  2CHZ A;  5FZQ A;  5G55 A;  4F1S A;  1YA0 A;  5BT1 A;  5AIJ A;  2PQR A;  3FP3 A;  1JCR A;  4KT6 B;  2FF4 A;  3ENE A;  4UI9 K;  3RK6 A;  2VSO E;  4HI8 A;  2E2E A;  3FUL A;  5A23 A;  4QQI A;  3LPZ A;  5FZR A;  3CEQ A;  4AIF A;  5A7D B;  2CFU A;  1SW6 A;  4GYO A;  2X6I A;  2J08 A;  3UM3 A;  5D0O D;  5ANR A;  5FIO A;  5KBA A;  2WXH A;  2FBN A;  1TYQ G;  3SBT B;  2KCL A;  3D9H A;  3SNX A;  4EZJ A;  3ESL A;  3U64 A;  2V4H C;  2EIN E;  2DWZ A;  3D9K A;  1JUQ A;  4IRU A;  3U66 A;  5CEC B;  3V2X A;  4A3T A;  3NZU A;  4F7A A;  4XIF A;  1V55 E;  2IEJ A;  4GTV A;  3LVR E;  1Z3X A;  4ZFH A;  3BG0 B;  2GRM A;  2L6B A;  2OCC E;  3FTS A;  4U8H A;  3SFX A;  3ZNG A;  3UMV A;  5LCW C;  2Y3A A;  3CHP A;  3QB2 A;  2XEN A;  4B93 B;  4PH4 B;  3TG5 A;  3E30 A;  2XEV A;  3PUK A;  3FTU A;  1FVH A;  2IFU A;  3EU5 A;  3RO3 A;  5ITZ F;  1E96 B;  2EIJ E;  1AP7 A;  4JA9 A;  2ILR A;  3U4T A;  2OOE A;  4YVQ C;  2LSU A;  5AQ9 A;  4I1A A;  3C98 A;  4DX2 A;  1QNF A;  4BTB A;  3MJW A;  1TN6 A;  3JXJ A;  3RRN B;  5HS0 A;  1U3C A;  1N0Q A;  4BX8 A;  4UWG A;  4XKB A;  3PNL B;  4XKC A;  2AW6 A;  2A5U A;  2XHE A;  4HLE A;  3RRM B;  2C0M A;  3CHO A;  2YIN A;  3MKQ B;  5JJT A;  1N4R A;  4G1T A;  1HU3 A;  3IXE A;  1H6P A;  3UUX A;  3SHF A;  2XCC A;  3HHM A;  1HS6 A;  2R03 A;  5AQB A;  4J8Y A;  1A5E A;  5JMN D;  2JLB A;  3UT4 A;  5ENP D;  3LKU A;  2UWJ G;  3GZ1 A;  4JA7 A;  1OT8 A;  4B8C B;  4I6G A;  3ABM E;  1MX2 A;  4RSY A;  5LP0 A;  3UM1 A;  2WB2 A;  2AVP A;  4APO A;  5CBN A;  3JQ1 A;  3CV0 A;  2KM4 A;  4EHM A;  4GPM A;  2ZIR A;  3D9M A;  3CKC A;  2P9L G;  2L9B A;  3TWR A;  4FJZ A;  1EF1 C;  2I1K A;  1MHQ A;  2KCV A;  2DYS E;  4URK A;  3LEW A;  2IOS A;  1JWG A;  5AAR A;  4HRM B;  2MHK A;  4DRX E;  1FVF A;  5D66 A;  4UQY A;  1BI8 B;  1EPU A;  2MYO A;  5AJL A;  4LG6 A;  3CVV A;  2PL2 A;  4Y6C A;  2V0P A;  3PE3 A;  4XI0 A;  2J4B A;  4WWP A;  3ZIM A;  3TGO A;  5B1A E;  3TJP A;  3NZS A;  1DCE A;  4JXT A;  4GZ5 A;  3NOG D;  3ULQ A;  3UX4 A;  4G8K A;  1KT0 A;  1SZA A;  1Q2Z A;  3UIO C;  1S64 A;  3L9T A;  4LSZ E;  1N4S A;  3SZ7 A;  2WQ6 A;  1PY1 A;  1Y6I A;  1UOH A;  3OTN A;  1HZ4 A;  3CK9 A;  4UWH A;  1E8W A;  3LS8 A;  4GPK A;  3Q9U C;  3GW4 A;  1OUV A; 
#chains in the Genus database with same CATH homology
 3ZU7 B;  4B93 B;  1BLX B;  2KXP C;  2AJA A;  4HLL A;  3J5P A;  3V79 K;  1YCS B;  4BET A;  5CBN A;  3EHQ A;  5ITZ F;  3UI2 A;  5AN8 A;  5EN5 D;  5HKP A;  3NBN B;  4GMR A;  1D9S A;  2J8S D;  1AP7 A;  3C5R A;  4DX7 D;  5AQA A;  5FIN A;  3J5Q B;  2NYJ A;  4GPM A;  4U96 D;  4QFV A;  2ZGG A;  2XZD G;  5CED B;  3W9G A;  3TWQ A;  5AQ9 A;  3T9K A;  1BU9 A;  3NOC D;  2XEE A;  3EU9 A;  4RLY A;  4DX1 A;  5CEA A;  3TWR A;  3UXG A;  4C48 B;  2PNN A;  4DX2 A;  2Y1L E;  4U8Y D;  2B0O E;  3HG0 D;  4Z68 A;  3JXJ A;  3W9F A;  4U95 D;  5HS0 A;  2A5E A;  5AAR A;  2F8X K;  3V31 A;  4HRM B;  5KWD A;  1MX6 A;  1N0Q A;  1N11 A;  2ETB A;  4HRN A;  1DCQ A;  3HRA A;  4HQD A;  4O1O A;  4DRX E;  4F1P A;  5D66 A;  3TWW A;  1K3Z D;  1K1A A;  4O60 A;  4CZ2 D;  1BI8 B;  4K5A B;  3TWX A;  4K5C A;  4OAU C;  2MYO A;  4OAV B;  2XZT G;  2DZO A;  5EYL A;  3V30 A;  4LG6 A;  1BD8 A;  4HRL A;  4HI8 A;  4BER A;  2F37 A;  3LJN A;  4BES A;  3KEA A;  1IHB A;  2DVW A;  1WDY A;  4QQI A;  4JB8 P;  3T8K A;  3SO8 A;  2ETC A;  3ZKJ A;  1SW6 A;  1IKN D;  1MJ0 A;  2JAB A;  3B7B A;  3DEO A;  5AQ7 A;  3ZUV B;  1DC2 A;  3Q9N C;  5ENR D;  5HRY A;  4HNA D;  5EIL A;  3UTM A;  1YYH A;  2DZN A;  5FIO A;  1QYM A;  4U8V D;  5AAO A;  3NOG D;  4TUM A;  4YDY A;  4YDW A;  2VGE A;  3IXE A;  5ENT D;  5ENS D;  2ZGD A;  4ATZ D;  4DX6 D;  5KBA A;  3TWS A;  4A63 B;  2XEH A;  3V2O A;  2BKK B;  3D9H A;  1SVX A;  1WG0 A;  5ENQ D;  2ETA A;  3JXI A;  1TR4 A;  2KBX A;  4G8K A;  3F6Q A;  1OY3 D;  4F6R D;  1IXV A;  3JUE A;  2V4H C;  5AQB A;  5JA4 D;  1AWC B;  4J8Y A;  2DWZ A;  1NFI E;  3EHR A;  1MYO A;  2FO1 E;  4DX5 D;  1A5E A;  2QYJ A;  5JMN D;  1K1B A;  5EYP F;  1BI7 B;  4J7W A;  5CEC B;  4K5B A;  3V2X A;  4UUC A;  4BEP A;  1G3N B;  5CER B;  4G8L A;  4HB5 A;  3DEP A;  4LNU D;  4LSZ E;  5ENP D;  2F8Y A;  5EID A;  2V5Q C;  3TWV A;  4BSZ B;  4HI9 A;  1YMP A;  2RFM A;  4ZFH A;  2BKG A;  2RFA A;  1OT8 A;  1UOH A;  2Y0B G;  5BXO A;  3TWT A;  2QC9 A;  2P2C P;  5KNH D;  5ENO D;  4ZHB A;  4N5Q A;  5CBO A;  4HBD A;  1MX2 A;  1MX4 A;  1S70 B;  2L6B A;  3ZNG A;  4O1P A;  3TWU A;  4CYM D;  4DUI A;  3AJI A;  4NIK A;  3Q9U C;  3AAA C;  5BXU A;  5EIB E;  5KNG A;  2HE0 A;  1N0R A;  2XEN A;  3B95 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...