4DX5D

Transport of drugs by the multidrug transporter acrb involves an access and a deep binding pocket that are separated by a switch-loop
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
156
structure length
156
Chain Sequence
GSDLGKKLLEAARAGRDDEVRILMANGADVNAADVVGWTPLHLAAYWGHLEIVEVLLKNGADVNAYDTLGSTPLHLAAHFGHLEIVEVLLKNGADVNAKDDNGITPLHLAANRGHLEIVEVLLKYGADVNAQDKFGKTAFDISINNGNEDLAEILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acriflavine resistance protein B
publication title Transport of drugs by the multidrug transporter AcrB involves an access and a deep binding pocket that are separated by a switch-loop.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein, transport protein
total genus 52
structure length 156
sequence length 156
chains with identical sequence E
ec nomenclature
pdb deposition date 2012-02-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4dx5D00
1OY3D 2DZNA 1TR4A 3V2XA 4OAUC 2FO1E 5HS0A 2F37A 2BKKB 4J8YA 5KNGA 4ZFHA 1WDYA 3ZKJA 3J5PA 4YDWA 5HKPA 3W9FA 3D9HA 3JUEA 4BERA 5AN8A 1YYHA 4DX1A 4K5BA 3Q9UC 5BXOA 1MJ0A 3W9GA 5JMND 5ENPD 2PNNA 3AAAC 4BESA 1MX2A 2B0OE 3AJIA 4DX6D 4HQDA 1BI8B 3LJNA 5BXUA 5EILA 1IKND 2V4HC 4K5CA 1AP7A 1YCSB 1K1AA 2XZTG 1MX4A 3TWUA 3Q9NC 2QYJA 1MX6A 3UTMA 3HRAA 3NOCD 3V30A 1OT8A 3V79K 4LSZE 5KNHD 3T9KA 4DX5D 3TWSA 4F1PA 4NIKA 1AWCB 5ENOD 3TWTA 3KEAA 4A63B 3V2OA 2VGEA 4BETA 4QFVA 4LNUD 3C5RA 2BKGA 4HI8A 3NOGD 3JXJA 4TUMA 4HRNA 1BU9A 2XEHA 5KWDA 2F8YA 4JB8P 3F6QA 2NYJA 5AARA 5FIOA 5FINA 1K3ZD 4CYMD 4HI9A 5AQ7A 2JABA 5EYPF 1N0QA 2ETCA 3TWQA 4C48B 1IHBA 4ATZD 3DEOA 3TWRA 5AAOA 2J8SD 4O1OA 3TWWA 2RFAA 3TWVA 4Z68A 1N11A 4DRXE 5CECB 4OAVB 2KBXA 5D66A 1IXVA 3V31A 4U96D 3ZNGA 4QQIA 1QYMA 2HE0A 2L6BA 2ETAA 5ENRD 1G3NB 1A5EA 2DZOA 4HRMB 3T8KA 5ITZF 4U8VD 3DEPA 4CZ2D 2DVWA 2XEEA 3UI2A 4DUIA 3UXGA 4F6RD 4HNAD 4G8KA 5AQAA 1K1BA 4HRLA 3SO8A 4HB5A 5CERB 5JA4D 1UOHA 3ZU7B 3HG0D 5AQ9A 4GMRA 2ZGGA 5CBNA 3B7BA 3JXIA 2MYOA 4G8LA 1D9SA 4K5AB 1NFIE 4O1PA 4LG6A 5CEAA 4U95D 4BSZB 2RFMA 2F8XK 3EU9A 2ETBA 3B95A 5CBOA 2V5QC 5ENSD 5EN5D 4DX7D 2P2CP 1MYOA 4HBDA 1YMPA 1DCQA 1SVXA 3TWXA 1DC2A 1WG0A 5KBAA 4RLYA 3EHQA 4HLLA 4U8YD 5ENTD 1BLXB 3EHRA 1S70B 3IXEA 1SW6A 2DWZA 2Y0BG 5ENQD 4UUCA 2XENA 4BEPA 5EIBE 4J7WA 1BI7B 2AJAA 2XZDG 2QC9A 2ZGDA 2Y1LE 4B93B 4DX2A 4ZHBA 2KXPC 4O60A 3ZUVB 5CEDB 4GPMA 5AQBA 3NBNB 4YDYA 1BD8A 2A5EA 5EYLA 5HRYA 1N0RA 3J5QB 4N5QA 5EIDA
chains in the Genus database with same CATH superfamily
4G25A 4HS2A 2KCKA 2WXJA 3MX3A 2PQNA 3RJVA 3Q7AA 4I6GA 3SF4A 3PZ3A 3QDNA 4KYOB 4AIFA 1MHQA 3ABLE 2XGOA 4ANVA 3C3OA 3SNXA 4CDMA 5KJNA 3V79K 4LSZE 3PE4A 5FQ8A 1OCCE 2I6HA 4GMLA 4EQFA 2CFZA 4CT0A 5KWDA 3FWVA 3QAQA 1V54E 4J8SA 2JABA 1H6KA 2QY7A 4WWPA 5AAOA 3HXEA 1QNFA 4U96D 1KLXA 2GRRB 5A7DB 1OWMA 1JWGA 3D9JA 4J8EA 1PC2A 2EIJE 2H6HA 5ANRA 3UINC 2RFMA 3EU9A 4HOSA 1QBQA 3ABME 5G04C 3ML9A 3TWXA 5ANLA 4H7YA 4Q96A 3EHQA 3FUDA 2XS1A 3RRMB 1W3BA 4AVXA 4GZCA 4B93B 4ZHBA 4HLEA 2GW1A 4JC8A 3HXFA 3LY9A 4CRWA 3KD7A 3G2UA 4N5QA 1LD8A 4IULA 2LXLA 3IEGA 3ASNE 5JJ7A 4YDWA 1BPOA 1NI1A 2QZAA 4APFA 3TL5A 1FCHA 4K5BA 3Q49B 3ZYLA 2LO6A 1KPSB 5G2NA 3ZYKA 1N52A 3HYMB 3EJNA 2IY0C 3V30A 3UIOC 2XPZA 4Q69A 2CHZA 3TWTA 4UWFA 4A63B 4XI0A 2OVBA 4BT8A 5CCMA 3URZA 5EX0A 4C9BB 3ZXPA 1H19A 2IF4A 5D66A 4I17A 1O5MA 2ETAA 5ENRD 3CK8A 1A5EA 1HS6A 5B1BE 4FLHA 2XRYA 3UXGA 4G8KA 2LAHA 2V4LA 5AQ9A 5JHBA 4GMRA 2ZGGA 2VJ8A 3NQPA 2MYOA 2XGMA 1UJJA 4BSZB 5FZQA 3ONKA 2V5QC 1H6PA 2R59A 5BNWA 3EDTB 2IOSA 4U8YD 3OXGA 2Y0BG 3EHNA 2Y1LE 2JEKA 3CK9A 5HI7A 2KXPC 3G2SA 1OXJA 2VGYA 1TNOA 2XEVA 3ZVVA 5HRYA 3TG4A 5JJTA 3ENEA 3LY7A 2WXKA 4AEZC 4Y6WA 1MJ0A 2YNQA 3LPZA 4G11A 3UX4A 3E34A 5AIJA 3TWUA 4B0ZA 3APDA 3DRAA 2EQXA 2LSVA 3UKUG 3V2OA 5LFAA 1TNUA 1JCQA 3CHMA 3U3WA 2FULA 3UT7A 3SFZA 3D9NA 3ZYMA 3JQ1A 1N94A 1HH8A 1SQMA 4I43A 2E2EA 3R7RA 3HG0D 3AU4A 3FUEA 3L9TA 4GYWA 3JCKC 3ZXSA 3KEZA 3FU0A 2EILE 3HDXA 1EF1C 2JLBA 2L0IA 3MKQB 1SW6A 4R7LA 5EIBE 4N3AA 4KVMA 5KCMA 4ANWA 1E90A 3FUJA 1EPUA 2RD0A 3FTWA 3IHVA 3T5XA 4JL0A 5CEDB 3TJPA 1FT1A 1OWPA 4XEIG 3ZRHA 2XS8A 4EBAA 2X6IA 4J8YA 3ZKJA 4GTQA 5LCWC 4L1BA 2WXQA 2WQHA 2BEDA 3D9OA 4J6IA 4XKCA 1U3DA 3LJNA 1IKND 3N71A 1Z6TA 2I9CA 1IQUA 2LSUA 3GZ2A 4HI8A 3TXNA 5G05J 3L82A 4JB8P 3E30A 5AQ7A 3MV2B 1E96B 2AWIA 1XNFA 4HOUA 3ZNGA 3ZIMA 4GZDA 3DBSA 4NACA 3IKOB 4KZ0A 3SFXA 4RVBA 3SO8A 3ZPJA 3CVXA 3IHYA 3PS6A 1NFIE 2LAIA 3QWVA 1WG0A 1RW2A 4RLYA 5DBKA 3D9PA 3BEEA 3AG2E 3KSQA 3FTSA 3CVVA 1TN6A 2HYZA 5ENNA 4GTOA 1X81A 3B7TA 4PS8A 1BD8A 3ISMC 3J5QB 4WNEA 4BWRA 1TR4A 3AS4A 5HS0A 2AVPA 2WXPA 1WDYA 3PEUB 3X2QE 5HQ8A 3D9HA 3RRUA 3DSTA 4U0UA 3O48A 1JCSA 3SFYA 2C0LA 4LUNU 1D8DA 2V4HC 1TNZA 4PH4B 3UTMA 3I4GA 1E8YA 4NURA 3DSXA 3FTYA 2WMOA 2IONA 1FVHA 3JXJA 3QB2A 3DPYA 5AARA 3CIAA 2RKKA 3B7UX 1P5QA 4CYMD 4EHMA 4ATZD 1HX8A 2J8SD 3TWVA 2XPYA 4WNDA 3NAWA 2QFCA 4QQIA 2L6BA 2DZOA 2RG8A 4LNBA 1OUVA 1JWFA 4U0ZA 3K9IA 5AQAA 5CERB 4HB5A 3LXUX 1WM5A 1N4RA 5CEAA 3OTNA 1NA3A 2V0PA 1RZ4A 2VSXE 2PM7A 2Y3AA 5A23A 5EN5D 3ZYQA 2MRIA 3UT8A 2X3MA 3D9IA 4BX9A 4PS3A 4A3VA 3ONLA 1HG2A 4BEPA 2ONDA 1EYHA 3FP3A 4CGVA 1S64A 2XZDG 3ASDA 3AS5A 2UY1B 4W9RA 4NQ0A 2PZIA 4FULA 4O6FA 5EYLA 3R9AB 3T5VA 4JEHA 1Z3YA 3Q73A 4N2QA 3U64A 2XPIA 2H6FA 4JW1A 3I3NA 4GYYA 4DX6D 3FUKA 2A4ZA 4EPZA 4JA9A 2PQRA 2KATA 5KNHD 3TWSA 2BTDA 3ULQA 3PZ2A 4GTRA 4FLBA 4F53A 2XCBA 3BQOA 5C2YA 2OVFA 3LVRE 2J08A 2IU1A 4GYOA 3L17A 4LNGA 4JPSA 3HXDA 1OCRE 3DEOA 2FF4A 3CR3A 4JXTA 2P9PG 2RFAA 4EZLA 4OAVB 1N11A 4XE0A 3SD5A 3FTUA 5D0QD 3E32A 2VTBB 2J07A 3BG1B 1TNBA 4HORA 2ILRA 3DEPA 3MGBA 1B89A 3L13A 3DXMG 5BV0A 4L9PA 3GW4A 3HXBA 2ETBA 3QOUA 2X6KA 3LJ3A 3U9WA 1EDUA 2NC9A 4G26A 1IYGA 4UWGA 1BLXB 1S70B 3FULA 2IO2C 3QWPA 1YA0A 4DI3A 2E0IA 4I1AA 3CQCB 4L2YA 5CMWA 3Q78A 5EIDA 2EIKE 2CG3A 4FA6A 2WXMA 2BKKB 3JQ0A 5HKPA 2GRNB 3AAAC 2QYUA 4EBAG 1OCZE 2P9SG 3MJWA 1BI8B 3R7QA 1Q2ZA 3Q9NC 1OT8A 2FBNA 4I1MA 2J4DA 1NA0A 4DI4A 2P9UG 4LNUD 4C0MA 3HHMA 3JYSA 2J9QA 5EYPF 4MLPA 4O1OA 1HE8A 4UWLA 4GA2A 4JHRA 3D9LA 3DWLG 4CEMA 4LRZA 1NP7A 4B94A 1N95A 5JA4D 3KS2A 3RO2A 3SBSA 3SY2A 2R17C 1XGWA 1DCEA 2KCLA 3HIZA 5ENSD 4AP2A 4DX7D 4TXPA 3PUKA 4HBDA 4U7EB 4GZ3A 4F7AA 3DXKG 3CHSA 1N9AA 4I6EA 4ATGA 3ULEG 1N54A 3ABKE 2MHKA 4YNDA 3ZUVB 4BTAA 2WXFA 2OOEA 1UG3A 4UI9K 4YDEA 2R2LA 4AJWA 3CHRA 4BERA 4PS7A 2DYSE 3CHOA 3RKVA 2YINA 1SA4A 5CHEE 2I1JA 5BPPA 2GROB 3NOCD 3NB2A 4CDRA 5LOZA 3T9KA 4NIKA 5J90A 2WXRA 4BETA 3NOGD 3DSVA 2F8YA 5FIOA 4HFGA 3S7DA 4JVSA 2Y69E 1Z5SC 3HVEB 4GTMA 5AYWD 3UUXA 2P9NG 4GZ6A 1D8EA 4GA0A 4Z68A 3RRNB 3PH0C 3WG7E 4ILGA 2WXNA 1G3NB 1HF8A 2L9BA 5A6CA 4J8FA 3CSTA 1TEZA 1K1BA 4I6JA 2EIME 4GCNA 3FTVA 1E7VA 1L5JA 3PRZA 3QC1A 5DIZA 3S7FA 1HZ4A 4GTSA 3Q5MA 1A17A 2X38A 3EHRA 2P9LG 5CRUA 3ASGA 3FHEA 1BI7B 3LVQE 3OXLA 4KZCA 1ZB1A 3D3MA 3PUJA 5T3RA 2A5EA 3NZSA 3C3RA 3V2XA 4HVBA 4GTPA 5AN8A 3B13A 3FFLA 5JMND 4UQZA 5ENPD 2PNNA 1IHGA 4FHJA 2VSYA 4K0RA 3CVPA 4PDXA 4QFVA 2GGFA 4P29A 4KVOA 3RIBA 2IO3C 3UM3A 3UPVA 3CVWA 2P9IG 1N0QA 3UM2A 3VLDA 4G1TA 3ESKA 2LNIA 2YHEA 3E4BA 2CHXA 1O1TA 4GCOA 4AXHA 2HE0A 3R9MA 4DUIA 3P1UA 4F6RD 4LERA 4D10C 2IFUA 3DPDA 1UOHA 4L23A 5CBNA 4WNFA 3DSSA 3LS8A 4O1PA 2F8XK 4Q94A 4URKA 4C0EA 1TYQG 3B7SA 1MYOA 3FUMA 1YMPA 1SVXA 2IEJA 3ZHEB 1O1SA 2CHWA 3EHMA 3SI5A 4L7TA 3FDHA 4ABNA 1GW6A 2WQ6A 2WXGA 1KT0A 4V3IA 5B1AE 3VLEA 2KM4A 4N39A 3DSUA 3SHFA 3Q79A 1UN8A 2J09A 2C0MA 4DLOA 3GZSA 2WQ7A 1YYHA 5AJLA 3EIJA 1QZ2A 1MX2A 2X6FA 4OVVA 4IN3B 4XKBA 2P9KG 3EU5A 2YHCA 2YQ8A 1HFAA 1LF8A 4FADA 3MKQA 2NSZA 1AWCB 1Y8MA 2ZXWE 1SZ9A 3C5RA 5C1DA 3UIPC 1E7UA 2WXLA 2XEHA 4MRUA 2R05A 3G2VA 4AY5A 3BU8A 5ARFA 5FINA 1K3ZD 1E8WA 3VLFA 3PZDA 3CVNA 3TWRA 4MBGA 2ZIRA 3PREA 3CKBA 1VDYA 3PZ4A 3CVUA 2Y4UA 2X6JA 3UI2A 2IJGX 4JEUA 4YVQC 3MZLB 3B7BA 3JXIA 2VYIA 2DBAA 3HXCA 2AXZA 2UWJG 2VGXB 3APCA 4ACKA 1FT2A 5KJKA 3CVQA 4FJZA 3GZ1A 4HLLA 5ENTD 4U8HA 2AXUA 2B6CA 5CMYA 2CFUA 3UM0A 4CCAA 3RSEG 4UWHA 4AM9A 2ZISA 2WMNA 1N0RA 4JZYA 4ANXA 5KJLA 4N3BA 2DCPA 4CT4A 1MZCA 2ZU6B 2DZNA 3SQVA 3J5PA 3LYAA 3NZUA 4UQYA 3Q9UC 5BXOA 2GRQB 3W9GA 4GB9A 2XHEA 3G2WA 5FZSA 1JPLA 3Q15A 3JUIA 4K5CA 3IV0A 4NRHB 5H7PA 3PZ1A 5FT9A 3TGOA 1H2UA 4N5CA 3ZW3A 4UI9J 2X6HA 3FUNA 4ACLA 3Q7FA 4FP7A 1WAO1 4TUMA 5LCWJ 3UKRG 1BU9A 3L22A 3S7BA 1DVPA 2PM6A 3CGHA 3CKCA 5EKQD 3ULYA 5AJDA 1ELKA 4HOQA 5FQ7A 4WWNA 5LP0A 1FVFA 4OYSA 5ITZF 2H6GA 4H7XA 5FQ6A 1X5BA 3CVYA 5BW8C 3T8MA 4M3OA 2KZTB 4HXIA 4WAFA 1LD7A 3Q47B 2Y4TA 2GRLA 2L0TB 4U95D 1HU3A 2NXPA 1Z3XA 4G23A 4TXQA 1N4PA 4XZ4A 5EX3A 2DWZA 4J8DA 4YDOA 2BUGA 5D0OD 4UUCA 2WPVA 2AJAA 4IRUA 1IQRA 4CGWA 2VGXA 3Q75A 2WB2A 4JHKA 5LX8A 4N3CA 1HG5A 4YDYA 4MKTA 2FO1E 3O4ZA 5KNGA 4ZFHA 4A55A 2M63A 3ZGQA 1UJKA 2LUHA 1PAQA 4YVOA 3IBEA 3PNLB 5BT1A 3AG4E 1K1AA 1MX4A 2WXHA 3FH8A 5T4YA 3ZEFA 1NZNA 1N4QA 3GYZA 2BF0X 1JCRA 2V8SE 4GPKA 2UY1A 1QQEA 4JHJA 3F6QA 1ZBPA 4TXRA 3QK0A 4U07A 2ETCA 4C48B 3ASOE 3MYVA 3FY4A 4DRXE 3E33A 2WXIA 1IXVA 1ELWA 4KXKB 4G24A 1QYMA 4G2VA 4U8VD 3UMVA 3AU5A 4KMOA 4APOA 2OEVA 3CK7A 4GAAA 4HRLA 3I4RB 1D9SA 3CLJA 2WXOA 3CHQA 3FH5A 3CQGB 3ASFA 5CBOA 4L2LA 5M72A 4RSYA 2F0YA 1FPPA 2KZTA 2DYRE 2I2OA 3C3QA 2VQ2A 4RG9A 3FU5A 3TAXA 3CHPA 3TXMA 2OV8A 3SGHA 2IOLA 2XCCA 1KZOA 2VTBA 1ZU2A 4HOTA 3FU6A 4RQIA 4WUYA 2H6IA 5G05C 1TN8A 2J49A 4BESA 3LKUA 2XGSA 1AP7A 4A1SA 4BY6A 3WXXA 2I1KA 4DX5D 2R02A 4WWOA 5CRVA 1N4SA 3C98A 2GRPB 4HRNA 1DNPA 2XRZA 2AXVA 3RO3A 3TWQA 4I2WA 1OCOE 4JD2G 2OEWA 2KBXA 4GTTA 1TN7A 2PL2A 3E37A 3PE3A 4HRMB 4TV3A 4CZ2D 4EECA 3ZU7B 3UM1A 4FHKA 4U04A 4K5AB 4KBQA 1JUQA 3P2BA 4B8AA 3ZN3A 4IYPA 1WY6A 4X8QA 2KCVA 4BTBA 4F3VA 3EIQC 3QARA 3ESLA 3D9MA 3VTYA 4AY6A 3LY8A 3PVLA 4BT9A 4TUUA 4O60A 2XQ0A 4TRQA 3S2AA 1S63A 2Q7FA 4ME2A 3W9FA 4DX1A 3SBTB 4ILHB 2B0OE 3PNTB 4XX5A 5EILA 5IY5E 2FO7A 2QYJA 4E6HA 1TJFA 5G04J 3KEAA 4BX8A 5JHAA 2C2LA 1TJCA 3MA5A 2NYJA 2VSOE 5FQ4A 1H2TC 5KJMA 5B3SE 4U0SA 1NL4A 3FTXA 3I5PA 1IHBA 3ASHA 5FJYA 3PDNA 3MEKA 3V31A 2DIWA 5FWQA 4N2SA 3T8KA 1U2VG 4K03A 1HO8A 2DVWA 2XEEA 4GA1A 3DSWA 4B89A 3CSFA 2MOWA 5CCLA 3FU3A 4FJYA 4I9EA 4G8LA 5J08A 3AG1E 3RAUA 3FEYA 3G2TA 1DCQA 4UI9C 3TG5A 3IXEA 4DJAA 4DPRA 4AOFA 3HVEA 2FEZA 4U63A 4ILIA 2QC9A 5E75A 4DX2A 3QKYA 4CDNA 3AG3E 4J0UA 1OY3D 5JJ6A 1OWLA 4PUCA 2AW6A 1K8KG 3MV3B 4UWKA 5D2MC 4EZJA 3BG0B 1UN9A 1YCSB 4MS6A 4GU5A 2XZTG 3FH7A 4LCTA 3L08A 5BUZA 4Y6CA 3CEQA 1OWNA 3BUAA 4EZKA 2VGEA 3L16A 2BKGA 3LEWA 2IQCA 3QWWA 1U3CA 5FTPA 4DK5A 2CG2A 3EUVA 4GMJA 3CV0A 4B8CB 4ANUA 3ZFWA 5CECB 2R03A 1KT1A 3FUFA 4LEUA 3AS8A 4FC8A 5T8IA 3FEXA 3ML8A 2WVIA 4XIFA 1PY1A 3Q4AB 3OAWA 3LDZA 1HXIA 1H6OA 3L54A 4LG6A 2VSNA 3FUHA 3FUIA 3U4TA 4A1GA 1SZAA 3SZ7A 1SA5A 4F1SA 1O1RA 5ARGA 3FTZA 1Y6IA 5ENQD 2XENA 4GZ5A 2OCCE 3RU0A 1MQSA 2FI7A 4GPMA 5AQBA 2HM8A 3NBNB 4OAUC 2F37A 1H2VC 3CVLA 4RG6A 3JUEA 4JA7A 2R5SA 3APFA 4AV7A 4DLQA 4UQXA 5FZRA 3UQ3A 3AJIA 4HQDA 5BXUA 1MX6A 3HRAA 3ZHEA 1LTXA 4F1PA 5ENOD 2L6JA 4A3TA 4BSXA 3VTXA 4XI9A 2GRMA 5G55A 1TNYA 4HI9A 4GTVA 3S7JA 1INZA 1KZPA 3LCAA 3UT4A 3TWWA 2HR2A 2HO1A 4BFRA 3PEVB 1OWOA 3QNKA 4I1OB 2V5FA 2LXMA 3U66A 4HNAD 4WNGA 2J4BA 4E85A 4FU3A 2A5UA 1E8XA 3B95A 2P2CP 4I2ZA 1H0AA 3RK6A 3D9KA 1DC2A 4M7CA 2WM9A 5KBAA 4KT6B 2EINE 5EDSA 3C72A 1UW4B 3B7RL 3KSLA 1S0PA 4J7WA 3KAEA 2P58C 2KC7A 3QJZA 5E76A 3NF1A 5AENA 2ZGDA 4I9CA 3OXFA 1V55E 3MCXA 5BV1A 1ELRA 1E8ZA 3L6AA 4OVUA 3MKRA
chains in the Genus database with same CATH topology
1OY3D 2DZNA 1TR4A 3V2XA 4OAUC 2FO1E 5HS0A 2F37A 2BKKB 4J8YA 5KNGA 4ZFHA 1WDYA 3ZKJA 3J5PA 4YDWA 5HKPA 3W9FA 3D9HA 3JUEA 4BERA 5AN8A 1YYHA 4DX1A 4K5BA 3Q9UC 5BXOA 1MJ0A 3W9GA 5JMND 5ENPD 2PNNA 3AAAC 4BESA 1MX2A 2B0OE 3AJIA 4DX6D 4HQDA 1BI8B 3LJNA 5BXUA 5EILA 1IKND 2V4HC 4K5CA 1AP7A 1YCSB 1K1AA 2XZTG 1MX4A 3TWUA 3Q9NC 2QYJA 1MX6A 3UTMA 3HRAA 3NOCD 3V30A 1OT8A 3V79K 4LSZE 5KNHD 3T9KA 4DX5D 3TWSA 4F1PA 4NIKA 1AWCB 5ENOD 3TWTA 3KEAA 4A63B 3V2OA 2VGEA 4BETA 4QFVA 4LNUD 3C5RA 2BKGA 4HI8A 3NOGD 3JXJA 4TUMA 4HRNA 1BU9A 2XEHA 5KWDA 2F8YA 4JB8P 3F6QA 2NYJA 5AARA 5FIOA 5FINA 1K3ZD 4CYMD 4HI9A 5AQ7A 2JABA 5EYPF 1N0QA 2ETCA 3TWQA 4C48B 1IHBA 4ATZD 3DEOA 3TWRA 5AAOA 2J8SD 4O1OA 3TWWA 2RFAA 3TWVA 4Z68A 1N11A 4DRXE 5CECB 4OAVB 2KBXA 5D66A 1IXVA 3V31A 4U96D 3ZNGA 4QQIA 1QYMA 2HE0A 2L6BA 2ETAA 5ENRD 1G3NB 1A5EA 2DZOA 4HRMB 3T8KA 5ITZF 4U8VD 3DEPA 4CZ2D 2DVWA 2XEEA 3UI2A 4DUIA 3UXGA 4F6RD 4HNAD 4G8KA 5AQAA 1K1BA 4HRLA 3SO8A 4HB5A 5CERB 5JA4D 1UOHA 3ZU7B 3HG0D 5AQ9A 4GMRA 2ZGGA 5CBNA 3B7BA 3JXIA 2MYOA 4G8LA 1D9SA 4K5AB 1NFIE 4O1PA 4LG6A 5CEAA 4U95D 4BSZB 2RFMA 2F8XK 3EU9A 2ETBA 3B95A 5CBOA 2V5QC 5ENSD 5EN5D 4DX7D 2P2CP 1MYOA 4HBDA 1YMPA 1DCQA 1SVXA 3TWXA 1DC2A 1WG0A 5KBAA 4RLYA 3EHQA 4HLLA 4U8YD 5ENTD 1BLXB 3EHRA 1S70B 3IXEA 1SW6A 2DWZA 2Y0BG 5ENQD 4UUCA 2XENA 4BEPA 5EIBE 4J7WA 1BI7B 2AJAA 2XZDG 2QC9A 2ZGDA 2Y1LE 4B93B 4DX2A 4ZHBA 2KXPC 4O60A 3ZUVB 5CEDB 4GPMA 5AQBA 3NBNB 4YDYA 1BD8A 2A5EA 5EYLA 5HRYA 1N0RA 3J5QB 4N5QA 5EIDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OY3 D;  2DZN A;  1TR4 A;  3V2X A;  4OAU C;  2FO1 E;  5HS0 A;  2F37 A;  2BKK B;  4J8Y A;  5KNG A;  4ZFH A;  1WDY A;  3ZKJ A;  3J5P A;  4YDW A;  5HKP A;  3W9F A;  3D9H A;  3JUE A;  4BER A;  5AN8 A;  1YYH A;  4DX1 A;  4K5B A;  3Q9U C;  5BXO A;  1MJ0 A;  3W9G A;  5JMN D;  5ENP D;  2PNN A;  3AAA C;  4BES A;  1MX2 A;  2B0O E;  3AJI A;  4DX6 D;  4HQD A;  1BI8 B;  3LJN A;  5BXU A;  5EIL A;  1IKN D;  2V4H C;  4K5C A;  1AP7 A;  1YCS B;  1K1A A;  2XZT G;  1MX4 A;  3TWU A;  3Q9N C;  2QYJ A;  1MX6 A;  3UTM A;  3HRA A;  3NOC D;  3V30 A;  1OT8 A;  3V79 K;  4LSZ E;  5KNH D;  3T9K A;  4DX5 D;  3TWS A;  4F1P A;  4NIK A;  1AWC B;  5ENO D;  3TWT A;  3KEA A;  4A63 B;  3V2O A;  2VGE A;  4BET A;  4QFV A;  4LNU D;  3C5R A;  2BKG A;  4HI8 A;  3NOG D;  3JXJ A;  4TUM A;  4HRN A;  1BU9 A;  2XEH A;  5KWD A;  2F8Y A;  4JB8 P;  3F6Q A;  2NYJ A;  5AAR A;  5FIO A;  5FIN A;  1K3Z D;  4CYM D;  4HI9 A;  5AQ7 A;  2JAB A;  5EYP F;  1N0Q A;  2ETC A;  3TWQ A;  4C48 B;  1IHB A;  4ATZ D;  3DEO A;  3TWR A;  5AAO A;  2J8S D;  4O1O A;  3TWW A;  2RFA A;  3TWV A;  4Z68 A;  1N11 A;  4DRX E;  5CEC B;  4OAV B;  2KBX A;  5D66 A;  1IXV A;  3V31 A;  4U96 D;  3ZNG A;  4QQI A;  1QYM A;  2HE0 A;  2L6B A;  2ETA A;  5ENR D;  1G3N B;  1A5E A;  2DZO A;  4HRM B;  3T8K A;  5ITZ F;  4U8V D;  3DEP A;  4CZ2 D;  2DVW A;  2XEE A;  3UI2 A;  4DUI A;  3UXG A;  4F6R D;  4HNA D;  4G8K A;  5AQA A;  1K1B A;  4HRL A;  3SO8 A;  4HB5 A;  5CER B;  5JA4 D;  1UOH A;  3ZU7 B;  3HG0 D;  5AQ9 A;  4GMR A;  2ZGG A;  5CBN A;  3B7B A;  3JXI A;  2MYO A;  4G8L A;  1D9S A;  4K5A B;  1NFI E;  4O1P A;  4LG6 A;  5CEA A;  4U95 D;  4BSZ B;  2RFM A;  2F8X K;  3EU9 A;  2ETB A;  3B95 A;  5CBO A;  2V5Q C;  5ENS D;  5EN5 D;  4DX7 D;  2P2C P;  1MYO A;  4HBD A;  1YMP A;  1DCQ A;  1SVX A;  3TWX A;  1DC2 A;  1WG0 A;  5KBA A;  4RLY A;  3EHQ A;  4HLL A;  4U8Y D;  5ENT D;  1BLX B;  3EHR A;  1S70 B;  3IXE A;  1SW6 A;  2DWZ A;  2Y0B G;  5ENQ D;  4UUC A;  2XEN A;  4BEP A;  5EIB E;  4J7W A;  1BI7 B;  2AJA A;  2XZD G;  2QC9 A;  2ZGD A;  2Y1L E;  4B93 B;  4DX2 A;  4ZHB A;  2KXP C;  4O60 A;  3ZUV B;  5CED B;  4GPM A;  5AQB A;  3NBN B;  4YDY A;  1BD8 A;  2A5E A;  5EYL A;  5HRY A;  1N0R A;  3J5Q B;  4N5Q A;  5EID A; 
#chains in the Genus database with same CATH topology
 4G25 A;  4HS2 A;  2KCK A;  2WXJ A;  3MX3 A;  2PQN A;  3RJV A;  3Q7A A;  4I6G A;  3SF4 A;  3PZ3 A;  3QDN A;  4KYO B;  4AIF A;  1MHQ A;  3ABL E;  2XGO A;  4ANV A;  3C3O A;  3SNX A;  4CDM A;  5KJN A;  3V79 K;  4LSZ E;  3PE4 A;  5FQ8 A;  1OCC E;  2I6H A;  4GML A;  4EQF A;  2CFZ A;  4CT0 A;  5KWD A;  3FWV A;  3QAQ A;  1V54 E;  4J8S A;  2JAB A;  1H6K A;  2QY7 A;  4WWP A;  5AAO A;  3HXE A;  1QNF A;  4U96 D;  1KLX A;  2GRR B;  5A7D B;  1OWM A;  1JWG A;  3D9J A;  4J8E A;  1PC2 A;  2EIJ E;  2H6H A;  5ANR A;  3UIN C;  2RFM A;  3EU9 A;  4HOS A;  1QBQ A;  3ABM E;  5G04 C;  3ML9 A;  3TWX A;  5ANL A;  4H7Y A;  4Q96 A;  3EHQ A;  3FUD A;  2XS1 A;  3RRM B;  1W3B A;  4AVX A;  4GZC A;  4B93 B;  4ZHB A;  4HLE A;  2GW1 A;  4JC8 A;  3HXF A;  3LY9 A;  4CRW A;  3KD7 A;  3G2U A;  4N5Q A;  1LD8 A;  4IUL A;  2LXL A;  3IEG A;  3ASN E;  5JJ7 A;  4YDW A;  1BPO A;  1NI1 A;  2QZA A;  4APF A;  3TL5 A;  1FCH A;  4K5B A;  3Q49 B;  3ZYL A;  2LO6 A;  1KPS B;  5G2N A;  3ZYK A;  1N52 A;  3HYM B;  3EJN A;  2IY0 C;  3V30 A;  3UIO C;  2XPZ A;  4Q69 A;  2CHZ A;  3TWT A;  4UWF A;  4A63 B;  4XI0 A;  2OVB A;  4BT8 A;  5CCM A;  3URZ A;  5EX0 A;  4C9B B;  3ZXP A;  1H19 A;  2IF4 A;  5D66 A;  4I17 A;  1O5M A;  2ETA A;  5ENR D;  3CK8 A;  1A5E A;  1HS6 A;  5B1B E;  4FLH A;  2XRY A;  3UXG A;  4G8K A;  2LAH A;  2V4L A;  5AQ9 A;  5JHB A;  4GMR A;  2ZGG A;  2VJ8 A;  3NQP A;  2MYO A;  2XGM A;  1UJJ A;  4BSZ B;  5FZQ A;  3ONK A;  2V5Q C;  1H6P A;  2R59 A;  5BNW A;  3EDT B;  2IOS A;  4U8Y D;  3OXG A;  2Y0B G;  3EHN A;  2Y1L E;  2JEK A;  3CK9 A;  5HI7 A;  2KXP C;  3G2S A;  1OXJ A;  2VGY A;  1TNO A;  2XEV A;  3ZVV A;  5HRY A;  3TG4 A;  5JJT A;  3ENE A;  3LY7 A;  2WXK A;  4AEZ C;  4Y6W A;  1MJ0 A;  2YNQ A;  3LPZ A;  4G11 A;  3UX4 A;  3E34 A;  5AIJ A;  3TWU A;  4B0Z A;  3APD A;  3DRA A;  2EQX A;  2LSV A;  3UKU G;  3V2O A;  5LFA A;  1TNU A;  1JCQ A;  3CHM A;  3U3W A;  2FUL A;  3UT7 A;  3SFZ A;  3D9N A;  3ZYM A;  3JQ1 A;  1N94 A;  1HH8 A;  1SQM A;  4I43 A;  2E2E A;  3R7R A;  3HG0 D;  3AU4 A;  3FUE A;  3L9T A;  4GYW A;  3JCK C;  3ZXS A;  3KEZ A;  3FU0 A;  2EIL E;  3HDX A;  1EF1 C;  2JLB A;  2L0I A;  3MKQ B;  1SW6 A;  4R7L A;  5EIB E;  4N3A A;  4KVM A;  5KCM A;  4ANW A;  1E90 A;  3FUJ A;  1EPU A;  2RD0 A;  3FTW A;  3IHV A;  3T5X A;  4JL0 A;  5CED B;  3TJP A;  1FT1 A;  1OWP A;  4XEI G;  3ZRH A;  2XS8 A;  4EBA A;  2X6I A;  4J8Y A;  3ZKJ A;  4GTQ A;  5LCW C;  4L1B A;  2WXQ A;  2WQH A;  2BED A;  3D9O A;  4J6I A;  4XKC A;  1U3D A;  3LJN A;  1IKN D;  3N71 A;  1Z6T A;  2I9C A;  1IQU A;  2LSU A;  3GZ2 A;  4HI8 A;  3TXN A;  5G05 J;  3L82 A;  4JB8 P;  3E30 A;  5AQ7 A;  3MV2 B;  1E96 B;  2AWI A;  1XNF A;  4HOU A;  3ZNG A;  3ZIM A;  4GZD A;  3DBS A;  4NAC A;  3IKO B;  4KZ0 A;  3SFX A;  4RVB A;  3SO8 A;  3ZPJ A;  3CVX A;  3IHY A;  3PS6 A;  1NFI E;  2LAI A;  3QWV A;  1WG0 A;  1RW2 A;  4RLY A;  5DBK A;  3D9P A;  3BEE A;  3AG2 E;  3KSQ A;  3FTS A;  3CVV A;  1TN6 A;  2HYZ A;  5ENN A;  4GTO A;  1X81 A;  3B7T A;  4PS8 A;  1BD8 A;  3ISM C;  3J5Q B;  4WNE A;  4BWR A;  1TR4 A;  3AS4 A;  5HS0 A;  2AVP A;  2WXP A;  1WDY A;  3PEU B;  3X2Q E;  5HQ8 A;  3D9H A;  3RRU A;  3DST A;  4U0U A;  3O48 A;  1JCS A;  3SFY A;  2C0L A;  4LUN U;  1D8D A;  2V4H C;  1TNZ A;  4PH4 B;  3UTM A;  3I4G A;  1E8Y A;  4NUR A;  3DSX A;  3FTY A;  2WMO A;  2ION A;  1FVH A;  3JXJ A;  3QB2 A;  3DPY A;  5AAR A;  3CIA A;  2RKK A;  3B7U X;  1P5Q A;  4CYM D;  4EHM A;  4ATZ D;  1HX8 A;  2J8S D;  3TWV A;  2XPY A;  4WND A;  3NAW A;  2QFC A;  4QQI A;  2L6B A;  2DZO A;  2RG8 A;  4LNB A;  1OUV A;  1JWF A;  4U0Z A;  3K9I A;  5AQA A;  5CER B;  4HB5 A;  3LXU X;  1WM5 A;  1N4R A;  5CEA A;  3OTN A;  1NA3 A;  2V0P A;  1RZ4 A;  2VSX E;  2PM7 A;  2Y3A A;  5A23 A;  5EN5 D;  3ZYQ A;  2MRI A;  3UT8 A;  2X3M A;  3D9I A;  4BX9 A;  4PS3 A;  4A3V A;  3ONL A;  1HG2 A;  4BEP A;  2OND A;  1EYH A;  3FP3 A;  4CGV A;  1S64 A;  2XZD G;  3ASD A;  3AS5 A;  2UY1 B;  4W9R A;  4NQ0 A;  2PZI A;  4FUL A;  4O6F A;  5EYL A;  3R9A B;  3T5V A;  4JEH A;  1Z3Y A;  3Q73 A;  4N2Q A;  3U64 A;  2XPI A;  2H6F A;  4JW1 A;  3I3N A;  4GYY A;  4DX6 D;  3FUK A;  2A4Z A;  4EPZ A;  4JA9 A;  2PQR A;  2KAT A;  5KNH D;  3TWS A;  2BTD A;  3ULQ A;  3PZ2 A;  4GTR A;  4FLB A;  4F53 A;  2XCB A;  3BQO A;  5C2Y A;  2OVF A;  3LVR E;  2J08 A;  2IU1 A;  4GYO A;  3L17 A;  4LNG A;  4JPS A;  3HXD A;  1OCR E;  3DEO A;  2FF4 A;  3CR3 A;  4JXT A;  2P9P G;  2RFA A;  4EZL A;  4OAV B;  1N11 A;  4XE0 A;  3SD5 A;  3FTU A;  5D0Q D;  3E32 A;  2VTB B;  2J07 A;  3BG1 B;  1TNB A;  4HOR A;  2ILR A;  3DEP A;  3MGB A;  1B89 A;  3L13 A;  3DXM G;  5BV0 A;  4L9P A;  3GW4 A;  3HXB A;  2ETB A;  3QOU A;  2X6K A;  3LJ3 A;  3U9W A;  1EDU A;  2NC9 A;  4G26 A;  1IYG A;  4UWG A;  1BLX B;  1S70 B;  3FUL A;  2IO2 C;  3QWP A;  1YA0 A;  4DI3 A;  2E0I A;  4I1A A;  3CQC B;  4L2Y A;  5CMW A;  3Q78 A;  5EID A;  2EIK E;  2CG3 A;  4FA6 A;  2WXM A;  2BKK B;  3JQ0 A;  5HKP A;  2GRN B;  3AAA C;  2QYU A;  4EBA G;  1OCZ E;  2P9S G;  3MJW A;  1BI8 B;  3R7Q A;  1Q2Z A;  3Q9N C;  1OT8 A;  2FBN A;  4I1M A;  2J4D A;  1NA0 A;  4DI4 A;  2P9U G;  4LNU D;  4C0M A;  3HHM A;  3JYS A;  2J9Q A;  5EYP F;  4MLP A;  4O1O A;  1HE8 A;  4UWL A;  4GA2 A;  4JHR A;  3D9L A;  3DWL G;  4CEM A;  4LRZ A;  1NP7 A;  4B94 A;  1N95 A;  5JA4 D;  3KS2 A;  3RO2 A;  3SBS A;  3SY2 A;  2R17 C;  1XGW A;  1DCE A;  2KCL A;  3HIZ A;  5ENS D;  4AP2 A;  4DX7 D;  4TXP A;  3PUK A;  4HBD A;  4U7E B;  4GZ3 A;  4F7A A;  3DXK G;  3CHS A;  1N9A A;  4I6E A;  4ATG A;  3ULE G;  1N54 A;  3ABK E;  2MHK A;  4YND A;  3ZUV B;  4BTA A;  2WXF A;  2OOE A;  1UG3 A;  4UI9 K;  4YDE A;  2R2L A;  4AJW A;  3CHR A;  4BER A;  4PS7 A;  2DYS E;  3CHO A;  3RKV A;  2YIN A;  1SA4 A;  5CHE E;  2I1J A;  5BPP A;  2GRO B;  3NOC D;  3NB2 A;  4CDR A;  5LOZ A;  3T9K A;  4NIK A;  5J90 A;  2WXR A;  4BET A;  3NOG D;  3DSV A;  2F8Y A;  5FIO A;  4HFG A;  3S7D A;  4JVS A;  2Y69 E;  1Z5S C;  3HVE B;  4GTM A;  5AYW D;  3UUX A;  2P9N G;  4GZ6 A;  1D8E A;  4GA0 A;  4Z68 A;  3RRN B;  3PH0 C;  3WG7 E;  4ILG A;  2WXN A;  1G3N B;  1HF8 A;  2L9B A;  5A6C A;  4J8F A;  3CST A;  1TEZ A;  1K1B A;  4I6J A;  2EIM E;  4GCN A;  3FTV A;  1E7V A;  1L5J A;  3PRZ A;  3QC1 A;  5DIZ A;  3S7F A;  1HZ4 A;  4GTS A;  3Q5M A;  1A17 A;  2X38 A;  3EHR A;  2P9L G;  5CRU A;  3ASG A;  3FHE A;  1BI7 B;  3LVQ E;  3OXL A;  4KZC A;  1ZB1 A;  3D3M A;  3PUJ A;  5T3R A;  2A5E A;  3NZS A;  3C3R A;  3V2X A;  4HVB A;  4GTP A;  5AN8 A;  3B13 A;  3FFL A;  5JMN D;  4UQZ A;  5ENP D;  2PNN A;  1IHG A;  4FHJ A;  2VSY A;  4K0R A;  3CVP A;  4PDX A;  4QFV A;  2GGF A;  4P29 A;  4KVO A;  3RIB A;  2IO3 C;  3UM3 A;  3UPV A;  3CVW A;  2P9I G;  1N0Q A;  3UM2 A;  3VLD A;  4G1T A;  3ESK A;  2LNI A;  2YHE A;  3E4B A;  2CHX A;  1O1T A;  4GCO A;  4AXH A;  2HE0 A;  3R9M A;  4DUI A;  3P1U A;  4F6R D;  4LER A;  4D10 C;  2IFU A;  3DPD A;  1UOH A;  4L23 A;  5CBN A;  4WNF A;  3DSS A;  3LS8 A;  4O1P A;  2F8X K;  4Q94 A;  4URK A;  4C0E A;  1TYQ G;  3B7S A;  1MYO A;  3FUM A;  1YMP A;  1SVX A;  2IEJ A;  3ZHE B;  1O1S A;  2CHW A;  3EHM A;  3SI5 A;  4L7T A;  3FDH A;  4ABN A;  1GW6 A;  2WQ6 A;  2WXG A;  1KT0 A;  4V3I A;  5B1A E;  3VLE A;  2KM4 A;  4N39 A;  3DSU A;  3SHF A;  3Q79 A;  1UN8 A;  2J09 A;  2C0M A;  4DLO A;  3GZS A;  2WQ7 A;  1YYH A;  5AJL A;  3EIJ A;  1QZ2 A;  1MX2 A;  2X6F A;  4OVV A;  4IN3 B;  4XKB A;  2P9K G;  3EU5 A;  2YHC A;  2YQ8 A;  1HFA A;  1LF8 A;  4FAD A;  3MKQ A;  2NSZ A;  1AWC B;  1Y8M A;  2ZXW E;  1SZ9 A;  3C5R A;  5C1D A;  3UIP C;  1E7U A;  2WXL A;  2XEH A;  4MRU A;  2R05 A;  3G2V A;  4AY5 A;  3BU8 A;  5ARF A;  5FIN A;  1K3Z D;  1E8W A;  3VLF A;  3PZD A;  3CVN A;  3TWR A;  4MBG A;  2ZIR A;  3PRE A;  3CKB A;  1VDY A;  3PZ4 A;  3CVU A;  2Y4U A;  2X6J A;  3UI2 A;  2IJG X;  4JEU A;  4YVQ C;  3MZL B;  3B7B A;  3JXI A;  2VYI A;  2DBA A;  3HXC A;  2AXZ A;  2UWJ G;  2VGX B;  3APC A;  4ACK A;  1FT2 A;  5KJK A;  3CVQ A;  4FJZ A;  3GZ1 A;  4HLL A;  5ENT D;  4U8H A;  2AXU A;  2B6C A;  5CMY A;  2CFU A;  3UM0 A;  4CCA A;  3RSE G;  4UWH A;  4AM9 A;  2ZIS A;  2WMN A;  1N0R A;  4JZY A;  4ANX A;  5KJL A;  4N3B A;  2DCP A;  4CT4 A;  1MZC A;  2ZU6 B;  2DZN A;  3SQV A;  3J5P A;  3LYA A;  3NZU A;  4UQY A;  3Q9U C;  5BXO A;  2GRQ B;  3W9G A;  4GB9 A;  2XHE A;  3G2W A;  5FZS A;  1JPL A;  3Q15 A;  3JUI A;  4K5C A;  3IV0 A;  4NRH B;  5H7P A;  3PZ1 A;  5FT9 A;  3TGO A;  1H2U A;  4N5C A;  3ZW3 A;  4UI9 J;  2X6H A;  3FUN A;  4ACL A;  3Q7F A;  4FP7 A;  1WAO 1;  4TUM A;  5LCW J;  3UKR G;  1BU9 A;  3L22 A;  3S7B A;  1DVP A;  2PM6 A;  3CGH A;  3CKC A;  5EKQ D;  3ULY A;  5AJD A;  1ELK A;  4HOQ A;  5FQ7 A;  4WWN A;  5LP0 A;  1FVF A;  4OYS A;  5ITZ F;  2H6G A;  4H7X A;  5FQ6 A;  1X5B A;  3CVY A;  5BW8 C;  3T8M A;  4M3O A;  2KZT B;  4HXI A;  4WAF A;  1LD7 A;  3Q47 B;  2Y4T A;  2GRL A;  2L0T B;  4U95 D;  1HU3 A;  2NXP A;  1Z3X A;  4G23 A;  4TXQ A;  1N4P A;  4XZ4 A;  5EX3 A;  2DWZ A;  4J8D A;  4YDO A;  2BUG A;  5D0O D;  4UUC A;  2WPV A;  2AJA A;  4IRU A;  1IQR A;  4CGW A;  2VGX A;  3Q75 A;  2WB2 A;  4JHK A;  5LX8 A;  4N3C A;  1HG5 A;  4YDY A;  4MKT A;  2FO1 E;  3O4Z A;  5KNG A;  4ZFH A;  4A55 A;  2M63 A;  3ZGQ A;  1UJK A;  2LUH A;  1PAQ A;  4YVO A;  3IBE A;  3PNL B;  5BT1 A;  3AG4 E;  1K1A A;  1MX4 A;  2WXH A;  3FH8 A;  5T4Y A;  3ZEF A;  1NZN A;  1N4Q A;  3GYZ A;  2BF0 X;  1JCR A;  2V8S E;  4GPK A;  2UY1 A;  1QQE A;  4JHJ A;  3F6Q A;  1ZBP A;  4TXR A;  3QK0 A;  4U07 A;  2ETC A;  4C48 B;  3ASO E;  3MYV A;  3FY4 A;  4DRX E;  3E33 A;  2WXI A;  1IXV A;  1ELW A;  4KXK B;  4G24 A;  1QYM A;  4G2V A;  4U8V D;  3UMV A;  3AU5 A;  4KMO A;  4APO A;  2OEV A;  3CK7 A;  4GAA A;  4HRL A;  3I4R B;  1D9S A;  3CLJ A;  2WXO A;  3CHQ A;  3FH5 A;  3CQG B;  3ASF A;  5CBO A;  4L2L A;  5M72 A;  4RSY A;  2F0Y A;  1FPP A;  2KZT A;  2DYR E;  2I2O A;  3C3Q A;  2VQ2 A;  4RG9 A;  3FU5 A;  3TAX A;  3CHP A;  3TXM A;  2OV8 A;  3SGH A;  2IOL A;  2XCC A;  1KZO A;  2VTB A;  1ZU2 A;  4HOT A;  3FU6 A;  4RQI A;  4WUY A;  2H6I A;  5G05 C;  1TN8 A;  2J49 A;  4BES A;  3LKU A;  2XGS A;  1AP7 A;  4A1S A;  4BY6 A;  3WXX A;  2I1K A;  4DX5 D;  2R02 A;  4WWO A;  5CRV A;  1N4S A;  3C98 A;  2GRP B;  4HRN A;  1DNP A;  2XRZ A;  2AXV A;  3RO3 A;  3TWQ A;  4I2W A;  1OCO E;  4JD2 G;  2OEW A;  2KBX A;  4GTT A;  1TN7 A;  2PL2 A;  3E37 A;  3PE3 A;  4HRM B;  4TV3 A;  4CZ2 D;  4EEC A;  3ZU7 B;  3UM1 A;  4FHK A;  4U04 A;  4K5A B;  4KBQ A;  1JUQ A;  3P2B A;  4B8A A;  3ZN3 A;  4IYP A;  1WY6 A;  4X8Q A;  2KCV A;  4BTB A;  4F3V A;  3EIQ C;  3QAR A;  3ESL A;  3D9M A;  3VTY A;  4AY6 A;  3LY8 A;  3PVL A;  4BT9 A;  4TUU A;  4O60 A;  2XQ0 A;  4TRQ A;  3S2A A;  1S63 A;  2Q7F A;  4ME2 A;  3W9F A;  4DX1 A;  3SBT B;  4ILH B;  2B0O E;  3PNT B;  4XX5 A;  5EIL A;  5IY5 E;  2FO7 A;  2QYJ A;  4E6H A;  1TJF A;  5G04 J;  3KEA A;  4BX8 A;  5JHA A;  2C2L A;  1TJC A;  3MA5 A;  2NYJ A;  2VSO E;  5FQ4 A;  1H2T C;  5KJM A;  5B3S E;  4U0S A;  1NL4 A;  3FTX A;  3I5P A;  1IHB A;  3ASH A;  5FJY A;  3PDN A;  3MEK A;  3V31 A;  2DIW A;  5FWQ A;  4N2S A;  3T8K A;  1U2V G;  4K03 A;  1HO8 A;  2DVW A;  2XEE A;  4GA1 A;  3DSW A;  4B89 A;  3CSF A;  2MOW A;  5CCL A;  3FU3 A;  4FJY A;  4I9E A;  4G8L A;  5J08 A;  3AG1 E;  3RAU A;  3FEY A;  3G2T A;  1DCQ A;  4UI9 C;  3TG5 A;  3IXE A;  4DJA A;  4DPR A;  4AOF A;  3HVE A;  2FEZ A;  4U63 A;  4ILI A;  2QC9 A;  5E75 A;  4DX2 A;  3QKY A;  4CDN A;  3AG3 E;  4J0U A;  1OY3 D;  5JJ6 A;  1OWL A;  4PUC A;  2AW6 A;  1K8K G;  3MV3 B;  4UWK A;  5D2M C;  4EZJ A;  3BG0 B;  1UN9 A;  1YCS B;  4MS6 A;  4GU5 A;  2XZT G;  3FH7 A;  4LCT A;  3L08 A;  5BUZ A;  4Y6C A;  3CEQ A;  1OWN A;  3BUA A;  4EZK A;  2VGE A;  3L16 A;  2BKG A;  3LEW A;  2IQC A;  3QWW A;  1U3C A;  5FTP A;  4DK5 A;  2CG2 A;  3EUV A;  4GMJ A;  3CV0 A;  4B8C B;  4ANU A;  3ZFW A;  5CEC B;  2R03 A;  1KT1 A;  3FUF A;  4LEU A;  3AS8 A;  4FC8 A;  5T8I A;  3FEX A;  3ML8 A;  2WVI A;  4XIF A;  1PY1 A;  3Q4A B;  3OAW A;  3LDZ A;  1HXI A;  1H6O A;  3L54 A;  4LG6 A;  2VSN A;  3FUH A;  3FUI A;  3U4T A;  4A1G A;  1SZA A;  3SZ7 A;  1SA5 A;  4F1S A;  1O1R A;  5ARG A;  3FTZ A;  1Y6I A;  5ENQ D;  2XEN A;  4GZ5 A;  2OCC E;  3RU0 A;  1MQS A;  2FI7 A;  4GPM A;  5AQB A;  2HM8 A;  3NBN B;  4OAU C;  2F37 A;  1H2V C;  3CVL A;  4RG6 A;  3JUE A;  4JA7 A;  2R5S A;  3APF A;  4AV7 A;  4DLQ A;  4UQX A;  5FZR A;  3UQ3 A;  3AJI A;  4HQD A;  5BXU A;  1MX6 A;  3HRA A;  3ZHE A;  1LTX A;  4F1P A;  5ENO D;  2L6J A;  4A3T A;  4BSX A;  3VTX A;  4XI9 A;  2GRM A;  5G55 A;  1TNY A;  4HI9 A;  4GTV A;  3S7J A;  1INZ A;  1KZP A;  3LCA A;  3UT4 A;  3TWW A;  2HR2 A;  2HO1 A;  4BFR A;  3PEV B;  1OWO A;  3QNK A;  4I1O B;  2V5F A;  2LXM A;  3U66 A;  4HNA D;  4WNG A;  2J4B A;  4E85 A;  4FU3 A;  2A5U A;  1E8X A;  3B95 A;  2P2C P;  4I2Z A;  1H0A A;  3RK6 A;  3D9K A;  1DC2 A;  4M7C A;  2WM9 A;  5KBA A;  4KT6 B;  2EIN E;  5EDS A;  3C72 A;  1UW4 B;  3B7R L;  3KSL A;  1S0P A;  4J7W A;  3KAE A;  2P58 C;  2KC7 A;  3QJZ A;  5E76 A;  3NF1 A;  5AEN A;  2ZGD A;  4I9C A;  3OXF A;  1V55 E;  3MCX A;  5BV1 A;  1ELR A;  1E8Z A;  3L6A A;  4OVU A;  3MKR A; 
#chains in the Genus database with same CATH homology
 1OY3 D;  2DZN A;  1TR4 A;  3V2X A;  4OAU C;  2FO1 E;  5HS0 A;  2F37 A;  2BKK B;  4J8Y A;  5KNG A;  4ZFH A;  1WDY A;  3ZKJ A;  3J5P A;  4YDW A;  5HKP A;  3W9F A;  3D9H A;  3JUE A;  4BER A;  5AN8 A;  1YYH A;  4DX1 A;  4K5B A;  3Q9U C;  5BXO A;  1MJ0 A;  3W9G A;  5JMN D;  5ENP D;  2PNN A;  3AAA C;  4BES A;  1MX2 A;  2B0O E;  3AJI A;  4DX6 D;  4HQD A;  1BI8 B;  3LJN A;  5BXU A;  5EIL A;  1IKN D;  2V4H C;  4K5C A;  1AP7 A;  1YCS B;  1K1A A;  2XZT G;  1MX4 A;  3TWU A;  3Q9N C;  2QYJ A;  1MX6 A;  3UTM A;  3HRA A;  3NOC D;  3V30 A;  1OT8 A;  3V79 K;  4LSZ E;  5KNH D;  3T9K A;  4DX5 D;  3TWS A;  4F1P A;  4NIK A;  1AWC B;  5ENO D;  3TWT A;  3KEA A;  4A63 B;  3V2O A;  2VGE A;  4BET A;  4QFV A;  4LNU D;  3C5R A;  2BKG A;  4HI8 A;  3NOG D;  3JXJ A;  4TUM A;  4HRN A;  1BU9 A;  2XEH A;  5KWD A;  2F8Y A;  4JB8 P;  3F6Q A;  2NYJ A;  5AAR A;  5FIO A;  5FIN A;  1K3Z D;  4CYM D;  4HI9 A;  5AQ7 A;  2JAB A;  5EYP F;  1N0Q A;  2ETC A;  3TWQ A;  4C48 B;  1IHB A;  4ATZ D;  3DEO A;  3TWR A;  5AAO A;  2J8S D;  4O1O A;  3TWW A;  2RFA A;  3TWV A;  4Z68 A;  1N11 A;  4DRX E;  5CEC B;  4OAV B;  2KBX A;  5D66 A;  1IXV A;  3V31 A;  4U96 D;  3ZNG A;  4QQI A;  1QYM A;  2HE0 A;  2L6B A;  2ETA A;  5ENR D;  1G3N B;  1A5E A;  2DZO A;  4HRM B;  3T8K A;  5ITZ F;  4U8V D;  3DEP A;  4CZ2 D;  2DVW A;  2XEE A;  3UI2 A;  4DUI A;  3UXG A;  4F6R D;  4HNA D;  4G8K A;  5AQA A;  1K1B A;  4HRL A;  3SO8 A;  4HB5 A;  5CER B;  5JA4 D;  1UOH A;  3ZU7 B;  3HG0 D;  5AQ9 A;  4GMR A;  2ZGG A;  5CBN A;  3B7B A;  3JXI A;  2MYO A;  4G8L A;  1D9S A;  4K5A B;  1NFI E;  4O1P A;  4LG6 A;  5CEA A;  4U95 D;  4BSZ B;  2RFM A;  2F8X K;  3EU9 A;  2ETB A;  3B95 A;  5CBO A;  2V5Q C;  5ENS D;  5EN5 D;  4DX7 D;  2P2C P;  1MYO A;  4HBD A;  1YMP A;  1DCQ A;  1SVX A;  3TWX A;  1DC2 A;  1WG0 A;  5KBA A;  4RLY A;  3EHQ A;  4HLL A;  4U8Y D;  5ENT D;  1BLX B;  3EHR A;  1S70 B;  3IXE A;  1SW6 A;  2DWZ A;  2Y0B G;  5ENQ D;  4UUC A;  2XEN A;  4BEP A;  5EIB E;  4J7W A;  1BI7 B;  2AJA A;  2XZD G;  2QC9 A;  2ZGD A;  2Y1L E;  4B93 B;  4DX2 A;  4ZHB A;  2KXP C;  4O60 A;  3ZUV B;  5CED B;  4GPM A;  5AQB A;  3NBN B;  4YDY A;  1BD8 A;  2A5E A;  5EYL A;  5HRY A;  1N0R A;  3J5Q B;  4N5Q A;  5EID A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...