4DX6D

Transport of drugs by the multidrug transporter acrb involves an access and a deep binding pocket that are separated by a switch-loop
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
156
structure length
156
Chain Sequence
GSDLGKKLLEAARAGRDDEVRILMANGADVNAADVVGWTPLHLAAYWGHLEIVEVLLKNGADVNAYDTLGSTPLHLAAHFGHLEIVEVLLKNGADVNAKDDNGITPLHLAANRGHLEIVEVLLKYGADVNAQDKFGKTAFDISINNGNEDLAEILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acriflavine resistance protein B
publication title Transport of drugs by the multidrug transporter AcrB involves an access and a deep binding pocket that are separated by a switch-loop.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein, transport protein
total genus 46
structure length 156
sequence length 156
chains with identical sequence E
ec nomenclature
pdb deposition date 2012-02-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4dx6D00
2HE0A 1MX2A 4U8YD 4DX1A 4OAUC 1YMPA 3B95A 3ZKJA 5CBOA 3W9GA 1UOHA 2ETAA 5EILA 5EN5D 5EYPF 1K1AA 3NOCD 4JB8P 5CERB 1AWCB 4OAVB 3ZUVB 4CZ2D 2PNNA 5AARA 4K5BA 5HRYA 3UXGA 3EHQA 1TR4A 3TWWA 2F37A 4HI8A 1WDYA 2KBXA 2V5QC 5FIOA 5JA4D 3B7BA 4F1PA 4ATZD 4QFVA 4HB5A 4DUIA 2Y1LE 5EIDA 1WG0A 1NFIE 5CBNA 1YYHA 5FINA 2XENA 4ZHBA 4HI9A 4DRXE 2RFAA 3TWSA 3ZU7B 1YCSB 2Y0BG 4O1OA 3TWTA 2RFMA 3D9HA 4Z68A 4NIKA 5AQBA 3V2XA 1BI7B 4G8KA 1BI8B 5EYLA 3SO8A 5KWDA 1N0QA 4BETA 4TUMA 4J7WA 3C5RA 5KNHD 3TWUA 4DX2A 1AP7A 3V31A 5EIBE 5KBAA 2VGEA 1MX4A 2B0OE 2XZDG 3DEPA 4HRNA 5BXOA 4LNUD 4UUCA 5ENOD 1BU9A 4BSZB 3UI2A 1D9SA 1MX6A 4GMRA 3JUEA 3F6QA 5AQAA 1G3NB 1IHBA 2QYJA 1QYMA 2A5EA 5ENTD 4J8YA 1N0RA 3AAAC 4U96D 2BKGA 3J5PA 4BERA 5KNGA 2F8YA 2DWZA 1DC2A 5CEAA 2XZTG 4HNAD 5AN8A 5ITZF 4LG6A 2KXPC 3TWXA 2L6BA 2AJAA 4YDWA 4RLYA 3JXJA 3HG0D 3TWQA 2MYOA 3KEAA 5BXUA 4U8VD 2NYJA 4U95D 2ZGDA 2XEEA 3IXEA 4DX6D 4O1PA 3EU9A 4HBDA 5HS0A 5CECB 1BLXB 2DZNA 3V2OA 4LSZE 1K1BA 5AQ7A 4CYMD 1IXVA 2DVWA 5ENRD 1IKND 2QC9A 1SVXA 4G8LA 1BD8A 3UTMA 3EHRA 3TWVA 3NBNB 4A63B 2P2CP 4HRMB 4QQIA 2ETBA 2F8XK 3T9KA 1N11A 4HRLA 3J5QB 3JXIA 3T8KA 4ZFHA 2XEHA 1K3ZD 5JMND 4O60A 4F6RD 2FO1E 4B93B 1DCQA 1A5EA 4K5CA 3AJIA 3DEOA 5ENSD 4BEPA 5ENQD 5AQ9A 4YDYA 3Q9NC 3HRAA 5D66A 2DZOA 3V30A 5AAOA 4K5AB 4BESA 5ENPD 1S70B 5HKPA 2J8SD 4DX7D 3Q9UC 1OT8A 2BKKB 3V79K 2V4HC 3LJNA 1OY3D 4DX5D 3W9FA 3ZNGA 2ZGGA 4N5QA 5CEDB 4HQDA 2JABA 4C48B 1SW6A 4GPMA 1MJ0A 1MYOA 3NOGD 4HLLA 3TWRA 2ETCA
chains in the Genus database with same CATH superfamily
5E76A 1MX2A 1RW2A 4B0ZA 5BPPA 3QK0A 1TJFA 4PS7A 4CEMA 3FTXA 3PNLB 2PNNA 5FQ6A 3LVRE 2OVBA 4XKBA 1TNBA 3B7BA 3GW4A 2LSVA 5EIDA 5FQ8A 2VQ2A 3HVEA 2EIKE 4O1OA 4JHJA 3D9LA 1BPOA 3IHYA 4PH4B 4AXHA 2AXUA 3DBSA 3BU8A 5EKQD 1MX4A 3OXFA 4FP7A 3AS5A 3DWLG 3CSFA 2XCCA 5IY5E 2IO3C 5KNGA 3S7DA 2R59A 2ILRA 3CHSA 3PEVB 4MBGA 4RLYA 1IQRA 3KEAA 5FQ4A 4TV3A 3TL5A 4C9BB 4U95D 1TN8A 1BLXB 4U8HA 3RO3A 2BEDA 2LAIA 1N52A 3EHNA 4LNBA 4O60A 4GTQA 2P9LG 3MKQA 5ENSD 4BEPA 4CRWA 3B13A 3HRAA 2LNIA 4ANWA 3VTYA 1TJCA 2XRYA 2XPYA 1WAO1 5A23A 4Q94A 4BWRA 2JABA 5AIJA 1KT0A 3CV0A 3FDHA 2VTBB 4XI0A 3IKOB 4PDXA 1O1TA 2YQ8A 2C0MA 3E33A 5KCMA 4IULA 2WQ7A 1ELWA 3L08A 2XPIA 5AJLA 4I6JA 3PE3A 1WM5A 5T4YA 4XKCA 2JEKA 2WXLA 3ZPJA 3UM1A 3LY7A 3AS8A 4L1BA 4JW1A 4GTOA 5G55A 4BSZB 4U0ZA 3F6QA 1G3NB 2QYJA 5ARGA 1PC2A 5D0OD 1Z6TA 1MQSA 1U2VG 3VLDA 2IFUA 4YDWA 3IV0A 4U07A 4BTAA 3PDNA 4C0EA 3APCA 3ZXSA 3FUMA 1UJJA 2FBNA 3FULA 3ZHEA 2XEHA 2V5FA 3C3OA 3UM2A 3S7JA 4GTTA 1N4QA 4OVVA 3FP3A 3ZXPA 4GTPA 3HXCA 4N5QA 4JL0A 2P9SG 3NZSA 3UMVA 4GPMA 2Q7FA 1JCSA 5DBKA 1L5JA 3BQOA 4G11A 3FTVA 4WNEA 3B95A 3ZKJA 1TEZA 3NB2A 1UOHA 5EYPF 3NOCD 5FWQA 2X3MA 2NXPA 1WDYA 1OCRE 4UQXA 4EPZA 3QJZA 5D0QD 4ATZD 3O48A 3P2BA 2MRIA 4U04A 3FUEA 4ZHBA 4HLEA 5CCLA 2Y0BG 5LCWJ 4A55A 3VTXA 2OOEA 3QB2A 3QARA 3KSLA 3PZ1A 2XEVA 3DPYA 3L16A 4DI3A 4JC8A 4UUCA 4O6FA 1D9SA 1A5EA 4GMRA 1IHBA 3MGBA 4HNAD 4OVUA 2L6BA 3IXEA 1OUVA 3E34A 2XCBA 1IHGA 5BV1A 4HORA 4MLPA 1N11A 4GYYA 1UN9A 5JJ6A 3CIAA 3UKUG 5BNWA 4LERA 4E6HA 4WAFA 4K5AB 2J8SD 2J49A 4TXRA 3U66A 3UIOC 1JWGA 1V54E 5ANRA 4DX5D 4BT9A 2R17C 3EDTB 3CHRA 3PH0C 4EHMA 3L22A 1D8DA 3NOGD 4B94A 1NZNA 4BY6A 5B1BE 4ACKA 2WQ6A 2ZIRA 3FTUA 4DLOA 4OAVB 4R7LA 3C3RA 3EHQA 2KBXA 4QFVA 3UM3A 4NQ0A 3ENEA 3PS6A 1P5QA 3FUKA 4NURA 3FUJA 4BT8A 4GCNA 2V4LA 3ABKE 4N2SA 2PM7A 3JQ0A 3MEKA 1E7VA 4GZ3A 3UT4A 4LRZA 2J09A 3PNTB 3ISMC 3Q5MA 2XGOA 3KD7A 3BUAA 1NA0A 1Y8MA 1MX6A 4GAAA 4AV7A 5E75A 2Y3AA 4UQZA 4ANUA 3TWXA 1KZPA 2I1JA 4GA2A 4DPRA 4U8VD 1ZU2A 3LYAA 3Q15A 3ONLA 2KCLA 2VSNA 3FUNA 4F3VA 3EU5A 3CHMA 3FUFA 2F0YA 2YHEA 3CVNA 2DIWA 2WXIA 1FT2A 4ZFHA 4KZ0A 5M72A 3DXMG 4UWGA 3BEEA 4TXPA 3GZ2A 4GYOA 1Q2ZA 1S70B 4EBAG 2V0PA 3U9WA 2IQCA 4FJYA 3LJNA 1O1SA 2C0LA 1TN6A 4N3CA 5C2YA 4JD2G 3ZFWA 4JB8P 2IY0C 4HOTA 2P9KG 4K5BA 1EDUA 1HU3A 2NSZA 3E4BA 3RJVA 3FTYA 4FJZA 1NFIE 3U64A 4HI9A 1JUQA 5G05J 2VSXE 1ZB1A 4UWLA 3N71A 2GGFA 5FJYA 2HM8A 2WXHA 3SO8A 5JHAA 4KYOB 3RIBA 5KJMA 3PEUB 4ILIA 4FC8A 1H19A 2P9UG 3PZ4A 5LCWC 3CHPA 2WXKA 2A4ZA 5ENTD 3AAAC 3PVLA 3QDNA 3FY4A 3CVUA 5LOZA 4NRHB 5BXUA 3LVQE 3L13A 2CG2A 2QC9A 3ZRHA 1HG5A 3CVPA 1MZCA 4IYPA 5HQ8A 4ILHB 1V55E 2VSOE 3ASHA 3JXIA 5JMND 3CK7A 4M7CA 3SHFA 3FU0A 5AAOA 4BESA 3G2WA 2J4DA 2L6JA 3PZDA 2OVFA 5EX3A 2B6CA 4AVXA 3FFLA 4Y6CA 2WVIA 5CEDB 5FT9A 4A3TA 2X6IA 4PS8A 4C48B 3DXKG 1HG2A 4FLHA 5CBOA 5ENNA 2L0IA 1ELKA 3JYSA 2F37A 4AP2A 3S7FA 3AG4E 4UI9K 4WWPA 1U3CA 2FEZA 3TWTA 3MX3A 2XPZA 4XZ4A 2GRRB 2GW1A 3HXEA 1BI8B 3FU3A 2WQHA 1AP7A 4GA1A 3Q7FA 5BW8C 1TNZA 1XNFA 2Y4TA 4UWHA 4CDNA 4J8YA 1H2VC 4U96D 1RZ4A 3RAUA 4LUNU 1LTXA 2AJAA 3RO2A 4B8CB 5LP0A 4FU3A 4DX6D 2DZNA 3V2OA 1JCQA 2DVWA 1FVHA 1S63A 5FTPA 4CDRA 2WXGA 4I1MA 3HVEB 2DYSE 4G1TA 3X2QE 2CFZA 2FI7A 2WXOA 4D10C 1WY6A 4F6RD 3LCAA 4YNDA 5ARFA 4YDYA 1OCOE 1EYHA 2WXMA 4TUUA 4BSXA 2VYIA 1HF8A 4XIFA 3TJPA 3L6AA 4JA9A 4MS6A 1PAQA 3SFZA 2YHCA 4GZDA 3NQPA 2ETAA 2FO7A 1AWCB 3JCKC 3UINC 4HI8A 4EZLA 4ILGA 5JHBA 1S64A 4J0UA 4AM9A 4IRUA 2AXZA 2KCVA 5B3SE 4HXIA 3UUXA 3DRAA 2P58C 4ANVA 3TWSA 3C98A 2ZU6B 4YVOA 5BUZA 4P29A 1OWPA 3MKQB 5KNHD 4URKA 2A5UA 3FH7A 2WXFA 4YDOA 3VLEA 1VDYA 2KCKA 1E8WA 4U63A 2AVPA 1QYMA 2J08A 3FUDA 5LX8A 5CEAA 3KAEA 3NF1A 3LS8A 2NYJA 3RSEG 1DCEA 4I6EA 3CVWA 3UIPC 4ABNA 2L0TB 3NBNB 3LDZA 4HRMB 5DIZA 5B1AE 3ULEG 4G24A 4AIFA 3T8KA 1KPSB 2HR2A 4U0UA 4B93B 4I43A 2KZTA 3DSXA 1KZOA 3ASFA 4KVOA 3Q9UC 4N3BA 5FZQA 3FUIA 3JUIA 3W9FA 4YVQC 5C1DA 3OXLA 4LNGA 1MYOA 4L2LA 4GMJA 5J08A 2E2EA 2EINE 5EDSA 5AJDA 1QBQA 4KVMA 3EUVA 4AY5A 4B8AA 1H2TC 1NL4A 4GTVA 3SNXA 3B7UX 3G2UA 4C0MA 2X6JA 4KXKB 5CMYA 4KMOA 2H6IA 3U3WA 1E90A 1FPPA 3ZHEB 5CRUA 2EILE 3SF4A 1E8ZA 1N0QA 1TYQG 4BETA 2QFCA 2LXLA 1MHQA 5EIBE 3DEPA 1ZBPA 5CCMA 5AENA 2A5EA 3G2TA 1B89A 2UWJG 4PUCA 3FHEA 2XZTG 3R7QA 4LG6A 4H7XA 3CKBA 3D9NA 1ELRA 4O1PA 3ESLA 3JQ1A 1XGWA 3SBSA 2XGMA 3ULQA 1DCQA 1HFAA 3AJIA 3CQCB 4HFGA 3LPZA 3Q78A 4GYWA 3ABME 4DX7D 1NA3A 3TG4A 4E85A 4I17A 2EQXA 3V79K 4JPSA 1JPLA 3ASGA 4RQIA 2IEJA 3MYVA 4EBAA 3RRUA 2ETCA 4YDEA 3UT7A 2VSYA 4U8YD 3OAWA 5CMWA 2BF0X 2XRZA 5CERB 2JLBA 2R02A 4HOSA 2OCCE 2BTDA 3I5PA 3I3NA 3MV3B 3LY8A 4JEHA 2R05A 4GMLA 5FZSA 1YYHA 2XENA 2WXQA 3UM0A 2RFMA 4NIKA 1OWMA 3V2XA 4EZKA 2P9NG 3PRZA 4I1AA 1SQMA 5KWDA 3SGHA 3SI5A 4BX9A 2AWIA 3Q79A 2RG8A 2X6HA 4AEZC 3BG0B 3CVVA 4BERA 3ULYA 2F8YA 3FWVA 2PL2A 3CVYA 1E96B 2CG3A 3SFYA 2WM9A 2IOSA 3S2AA 4ACLA 5CECB 4XE0A 3QC1A 1IKND 1SVXA 2F8XK 2VGXA 3C72A 3U4TA 2C2LA 3UX4A 1N9AA 2LAHA 3QWPA 3QNKA 5A6CA 5HKPA 3PZ2A 1LF8A 3RU0A 4G2VA 2GRMA 4KT6B 2V4HC 3EIJA 3PZ3A 3URZA 2AXVA 3QWWA 3DSTA 2IU1A 2XQ0A 2UY1A 3WG7E 3D9JA 3CVXA 2EIME 1YMPA 2E0IA 3ASDA 5AARA 3R7RA 3Q49B 3MJWA 1HS6A 4CT4A 4F1PA 4F7AA 1UJKA 4HB5A 4G26A 3KS2A 5CBNA 5G04J 2EIJE 5KJNA 2X38A 1YCSB 3G2SA 1X81A 3AG2E 3ASOE 3RKVA 3MKRA 1BI7B 1INZA 3IBEA 4FLBA 4DX2A 1IQUA 1GW6A 2B0OE 2XZDG 2HYZA 1OWOA 5ENOD 4AOFA 5EX0A 2FF4A 4WWNA 5FQ7A 4A3VA 3FH5A 2DWZA 3TGOA 4XX5A 1NI1A 2P9PG 1QZ2A 2I9CA 4JVSA 3HG0D 3TWQA 4RG9A 2ZGDA 2OEVA 1HO8A 3UTMA 3EHRA 3ZVVA 4WNGA 3D9PA 4KZCA 2WB2A 2FO1E 4K5CA 2GROB 1SZ9A 4RSYA 3APFA 1EPUA 3ZIMA 2ONDA 4U7EB 2J07A 2ZXWE 2ZGGA 4FULA 4FHJA 3SQVA 4HLLA 3PUKA 1HH8A 2MHKA 3I4RB 4WNFA 1Z3XA 1K1AA 3ZUVB 1YA0A 2V5QC 4UQYA 4DUIA 4CGVA 4DRXE 3ZU7B 4CT0A 4JHKA 4GPKA 4G25A 4L7TA 4EQFA 4I6GA 2OEWA 4I9CA 3D9MA 3ML8A 2I1KA 1OCZE 4W9RA 1UN8A 1DVPA 2FULA 4DLQA 3AS4A 4B89A 1DC2A 3D9KA 2YINA 1H6OA 3FUHA 3EU9A 5HS0A 4GTSA 4J6IA 4LSZE 1TN7A 4J8DA 1N4RA 3NZUA 3L17A 3HDXA 4A63B 5CHEE 3AU5A 4GU5A 4LEUA 3CKCA 3MZLB 3DEOA 4OYSA 4N5CA 3V30A 3DSUA 3TG5A 3SBTB 4RG6A 2LXMA 2WXJA 3CGHA 2VGYA 1D8EA 4K0RA 1SA5A 2WMNA 3TWRA 4DX1A 3WXXA 2ZISA 4N3AA 5EN5D 3VLFA 4DK5A 3CK9A 3DPDA 1N95A 2WMOA 4APFA 4AY6A 1WG0A 5T3RA 3NAWA 1TNOA 2OV8A 4Q96A 1KT1A 3RRMB 1OWNA 4CCAA 5BV0A 4J7WA 3HXFA 5G04C 4NACA 5KBAA 2VGEA 1X5BA 2WXNA 2LSUA 3SD5A 3MV2B 1N0RA 5BT1A 4V3IA 2VTBA 5AN8A 4X8QA 2QZAA 4XI9A 1NP7A 2PM6A 2RD0A 1OCCE 3FTZA 3HXDA 5ENRD 5G05C 1BD8A 1PY1A 1S0PA 2IF4A 3PE4A 4HRLA 4J8FA 1N4SA 3RK6A 1FT1A 5JJ7A 2I6HA 1TNUA 3Q4AB 3CVLA 5FZRA 3IEGA 2H6FA 2XGSA 2BKKB 2GRLA 2CHXA 1MJ0A 3AG1E 1Y6IA 2HE0A 2GRQB 3S7BA 3Q47B 1IYGA 4L23A 2J4BA 4I9EA 4FHKA 5EILA 4CZ2D 4N39A 3TXNA 5HRYA 3ZYKA 3UXGA 3TWWA 1DNPA 5AYWD 1H0AA 2QY7A 3CVQA 3ESKA 1E7UA 5AQBA 3QWVA 4G8KA 3K9IA 4GB9A 2KZTB 4GZ6A 4TUMA 4A1GA 3SY2A 3TWUA 4L9PA 1K8KG 2DYRE 4JA7A 2H6GA 3I4GA 4I2ZA 3J5PA 4HOQA 4CDMA 2R5SA 2R03A 2IOLA 1Z5SC 2CHWA 2X6KA 4HBDA 4ANXA 3HYMB 1UW4B 1IXVA 4JHRA 3B7TA 4TXQA 3J5QB 2DCPA 5KJLA 5ENQD 4WUYA 5AQ9A 4EZJA 5ANLA 4UWFA 1QNFA 1OT8A 5HI7A 4F1SA 2NC9A 3ZYLA 4J8SA 2QYUA 3BG1B 1OWLA 4HQDA 3UQ3A 3T8MA 3EIQC 3CEQA 4APOA 4DI4A 4ATGA 3L9TA 3FTSA 3PREA 5KJKA 1SA4A 4FADA 4OAUC 3ABLE 2X6FA 3FEYA 3FH8A 3LEWA 3GYZA 1H6PA 1LD8A 2GRPB 2XHEA 4GZ5A 4AJWA 3EJNA 2LUHA 3B7RL 4FA6A 4Q69A 3T5VA 3HXBA 5EYLA 3Q7AA 3C5RA 3MCXA 4UI9J 3V31A 4DJAA 5BXOA 4G23A 3D3MA 4Y6WA 5AQAA 1OXJA 2BKGA 2Y69E 1EF1C 3CLJA 3ZW3A 2WXRA 1TNYA 5ITZF 3ZN3A 4CGWA 3JXJA 2VJ8A 1HE8A 2WPVA 4I1OB 3MA5A 3OXGA 3Q73A 1FVFA 5J90A 1K1BA 2H6HA 2R2LA 1JWFA 4H7YA 2IONA 4N2QA 2M63A 2ETBA 4ME2A 4HVBA 2DBAA 3L82A 3EHMA 2L9BA 3LY9A 1H2UA 3UPVA 4GA0A 1FCHA 3GZ1A 2DZOA 3CQGB 3ML9A 2WXPA 4RVBA 4J8EA 2YNQA 3R9AB 2Y4UA 3ZEFA 3CR3A 3OTNA 3W9GA 4UWKA 4BTBA 4WNDA 4U0SA 5D2MC 1TR4A 5FIOA 5JA4D 3DSSA 2BUGA 4EECA 2VGXB 3D9HA 4Z68A 4GTMA 4BX8A 5LFAA 4KBQA 4LCTA 2HO1A 3QAQA 2CHZA 2LO6A 1E8YA 2PQNA 4L2YA 1BU9A 3AG3E 5A7DB 3JUEA 4MKTA 3UT8A 5G2NA 4BFRA 4F53A 1JCRA 3O4ZA 2PZIA 4JXTA 2UY1B 2IO2C 3Q75A 1LD7A 3ZGQA 4WWOA 2KXPC 2J9QA 3B7SA 4A1SA 5H7PA 3LXUX 4HOUA 1U3DA 5AQ7A 4PS3A 4G8LA 4GCOA 3GZSA 2P2CP 4QQIA 3CSTA 3C3QA 4K03A 3T9KA 4JZYA 1N4PA 1QQEA 2MOWA 5D66A 2AW6A 2V8SE 5ENPD 3E32A 3FTWA 3PUJA 1E8XA 2I2OA 2XS1A 3E30A 3UKRG 3ZNGA 3CK8A 3D9OA 1SW6A 3DSVA 2IJGX 4TRQA 3UI2A 3LJ3A 3DSWA 5CRVA 3ZYMA 3KSQA 3R9MA 3L54A 4GTRA 4HS2A 1HX8A 2P9IG 1H6KA 3RRNB 3KEZA 2CFUA 2Y1LE 3TXMA 3HHMA 5FINA 2RFAA 1O1RA 2RKKA 3E37A 3HIZA 3LKUA 3CHQA 1KLXA 1HXIA 3FU5A 1A17A 1HZ4A 2KM4A 4HRNA 1Z3YA 3AU4A 4LNUD 4IN3B 3TAXA 3SZ7A 4UI9C 5T8IA 3QKYA 1O5MA 1N94A 3CHOA 2MYOA 2XS8A 2XEEA 3P1UA 1W3BA 4GZCA 4CYMD 3ONKA 2PQRA 3APDA 5JJTA 3FU6A 3TWVA 2KATA 3ZYQA 3D9IA 3G2VA 4M3OA 1K3ZD 2GRNB 3ASNE 4MRUA 3Q9NC 1SZAA 1N54A 3IHVA 1OY3D 4JEUA 4XEIG 4I2WA 3QOUA 1UG3A 3SFXA 3FEXA 3T5XA 2KC7A
chains in the Genus database with same CATH topology
2HE0A 1MX2A 4U8YD 4DX1A 4OAUC 1YMPA 3B95A 3ZKJA 5CBOA 3W9GA 1UOHA 2ETAA 5EILA 5EN5D 5EYPF 1K1AA 3NOCD 4JB8P 5CERB 1AWCB 4OAVB 3ZUVB 4CZ2D 2PNNA 5AARA 4K5BA 5HRYA 3UXGA 3EHQA 1TR4A 3TWWA 2F37A 4HI8A 1WDYA 2KBXA 2V5QC 5FIOA 5JA4D 3B7BA 4F1PA 4ATZD 4QFVA 4HB5A 4DUIA 2Y1LE 5EIDA 1WG0A 1NFIE 5CBNA 1YYHA 5FINA 2XENA 4ZHBA 4HI9A 4DRXE 2RFAA 3TWSA 3ZU7B 1YCSB 2Y0BG 4O1OA 3TWTA 2RFMA 3D9HA 4Z68A 4NIKA 5AQBA 3V2XA 1BI7B 4G8KA 1BI8B 5EYLA 3SO8A 5KWDA 1N0QA 4BETA 4TUMA 4J7WA 3C5RA 5KNHD 3TWUA 4DX2A 1AP7A 3V31A 5EIBE 5KBAA 2VGEA 1MX4A 2B0OE 2XZDG 3DEPA 4HRNA 5BXOA 4LNUD 4UUCA 5ENOD 1BU9A 4BSZB 3UI2A 1D9SA 1MX6A 4GMRA 3JUEA 3F6QA 5AQAA 1G3NB 1IHBA 2QYJA 1QYMA 2A5EA 5ENTD 4J8YA 1N0RA 3AAAC 4U96D 2BKGA 3J5PA 4BERA 5KNGA 2F8YA 2DWZA 1DC2A 5CEAA 2XZTG 4HNAD 5AN8A 5ITZF 4LG6A 2KXPC 3TWXA 2L6BA 2AJAA 4YDWA 4RLYA 3JXJA 3HG0D 3TWQA 2MYOA 3KEAA 5BXUA 4U8VD 2NYJA 4U95D 2ZGDA 2XEEA 3IXEA 4DX6D 4O1PA 3EU9A 4HBDA 5HS0A 5CECB 1BLXB 2DZNA 3V2OA 4LSZE 1K1BA 5AQ7A 4CYMD 1IXVA 2DVWA 5ENRD 1IKND 2QC9A 1SVXA 4G8LA 1BD8A 3UTMA 3EHRA 3TWVA 3NBNB 4A63B 2P2CP 4HRMB 4QQIA 2ETBA 2F8XK 3T9KA 1N11A 4HRLA 3J5QB 3JXIA 3T8KA 4ZFHA 2XEHA 1K3ZD 5JMND 4O60A 4F6RD 2FO1E 4B93B 1DCQA 1A5EA 4K5CA 3AJIA 3DEOA 5ENSD 4BEPA 5ENQD 5AQ9A 4YDYA 3Q9NC 3HRAA 5D66A 2DZOA 3V30A 5AAOA 4K5AB 4BESA 5ENPD 1S70B 5HKPA 2J8SD 4DX7D 3Q9UC 1OT8A 2BKKB 3V79K 2V4HC 3LJNA 1OY3D 4DX5D 3W9FA 3ZNGA 2ZGGA 4N5QA 5CEDB 4HQDA 2JABA 4C48B 1SW6A 4GPMA 1MJ0A 1MYOA 3NOGD 4HLLA 3TWRA 2ETCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HE0 A;  1MX2 A;  4U8Y D;  4DX1 A;  4OAU C;  1YMP A;  3B95 A;  3ZKJ A;  5CBO A;  3W9G A;  1UOH A;  2ETA A;  5EIL A;  5EN5 D;  5EYP F;  1K1A A;  3NOC D;  4JB8 P;  5CER B;  1AWC B;  4OAV B;  3ZUV B;  4CZ2 D;  2PNN A;  5AAR A;  4K5B A;  5HRY A;  3UXG A;  3EHQ A;  1TR4 A;  3TWW A;  2F37 A;  4HI8 A;  1WDY A;  2KBX A;  2V5Q C;  5FIO A;  5JA4 D;  3B7B A;  4F1P A;  4ATZ D;  4QFV A;  4HB5 A;  4DUI A;  2Y1L E;  5EID A;  1WG0 A;  1NFI E;  5CBN A;  1YYH A;  5FIN A;  2XEN A;  4ZHB A;  4HI9 A;  4DRX E;  2RFA A;  3TWS A;  3ZU7 B;  1YCS B;  2Y0B G;  4O1O A;  3TWT A;  2RFM A;  3D9H A;  4Z68 A;  4NIK A;  5AQB A;  3V2X A;  1BI7 B;  4G8K A;  1BI8 B;  5EYL A;  3SO8 A;  5KWD A;  1N0Q A;  4BET A;  4TUM A;  4J7W A;  3C5R A;  5KNH D;  3TWU A;  4DX2 A;  1AP7 A;  3V31 A;  5EIB E;  5KBA A;  2VGE A;  1MX4 A;  2B0O E;  2XZD G;  3DEP A;  4HRN A;  5BXO A;  4LNU D;  4UUC A;  5ENO D;  1BU9 A;  4BSZ B;  3UI2 A;  1D9S A;  1MX6 A;  4GMR A;  3JUE A;  3F6Q A;  5AQA A;  1G3N B;  1IHB A;  2QYJ A;  1QYM A;  2A5E A;  5ENT D;  4J8Y A;  1N0R A;  3AAA C;  4U96 D;  2BKG A;  3J5P A;  4BER A;  5KNG A;  2F8Y A;  2DWZ A;  1DC2 A;  5CEA A;  2XZT G;  4HNA D;  5AN8 A;  5ITZ F;  4LG6 A;  2KXP C;  3TWX A;  2L6B A;  2AJA A;  4YDW A;  4RLY A;  3JXJ A;  3HG0 D;  3TWQ A;  2MYO A;  3KEA A;  5BXU A;  4U8V D;  2NYJ A;  4U95 D;  2ZGD A;  2XEE A;  3IXE A;  4DX6 D;  4O1P A;  3EU9 A;  4HBD A;  5HS0 A;  5CEC B;  1BLX B;  2DZN A;  3V2O A;  4LSZ E;  1K1B A;  5AQ7 A;  4CYM D;  1IXV A;  2DVW A;  5ENR D;  1IKN D;  2QC9 A;  1SVX A;  4G8L A;  1BD8 A;  3UTM A;  3EHR A;  3TWV A;  3NBN B;  4A63 B;  2P2C P;  4HRM B;  4QQI A;  2ETB A;  2F8X K;  3T9K A;  1N11 A;  4HRL A;  3J5Q B;  3JXI A;  3T8K A;  4ZFH A;  2XEH A;  1K3Z D;  5JMN D;  4O60 A;  4F6R D;  2FO1 E;  4B93 B;  1DCQ A;  1A5E A;  4K5C A;  3AJI A;  3DEO A;  5ENS D;  4BEP A;  5ENQ D;  5AQ9 A;  4YDY A;  3Q9N C;  3HRA A;  5D66 A;  2DZO A;  3V30 A;  5AAO A;  4K5A B;  4BES A;  5ENP D;  1S70 B;  5HKP A;  2J8S D;  4DX7 D;  3Q9U C;  1OT8 A;  2BKK B;  3V79 K;  2V4H C;  3LJN A;  1OY3 D;  4DX5 D;  3W9F A;  3ZNG A;  2ZGG A;  4N5Q A;  5CED B;  4HQD A;  2JAB A;  4C48 B;  1SW6 A;  4GPM A;  1MJ0 A;  1MYO A;  3NOG D;  4HLL A;  3TWR A;  2ETC A; 
#chains in the Genus database with same CATH topology
 5E76 A;  1MX2 A;  1RW2 A;  4B0Z A;  5BPP A;  3QK0 A;  1TJF A;  4PS7 A;  4CEM A;  3FTX A;  3PNL B;  2PNN A;  5FQ6 A;  3LVR E;  2OVB A;  4XKB A;  1TNB A;  3B7B A;  3GW4 A;  2LSV A;  5EID A;  5FQ8 A;  2VQ2 A;  3HVE A;  2EIK E;  4O1O A;  4JHJ A;  3D9L A;  1BPO A;  3IHY A;  4PH4 B;  4AXH A;  2AXU A;  3DBS A;  3BU8 A;  5EKQ D;  1MX4 A;  3OXF A;  4FP7 A;  3AS5 A;  3DWL G;  3CSF A;  2XCC A;  5IY5 E;  2IO3 C;  5KNG A;  3S7D A;  2R59 A;  2ILR A;  3CHS A;  3PEV B;  4MBG A;  4RLY A;  1IQR A;  3KEA A;  5FQ4 A;  4TV3 A;  3TL5 A;  4C9B B;  4U95 D;  1TN8 A;  1BLX B;  4U8H A;  3RO3 A;  2BED A;  2LAI A;  1N52 A;  3EHN A;  4LNB A;  4O60 A;  4GTQ A;  2P9L G;  3MKQ A;  5ENS D;  4BEP A;  4CRW A;  3B13 A;  3HRA A;  2LNI A;  4ANW A;  3VTY A;  1TJC A;  2XRY A;  2XPY A;  1WAO 1;  5A23 A;  4Q94 A;  4BWR A;  2JAB A;  5AIJ A;  1KT0 A;  3CV0 A;  3FDH A;  2VTB B;  4XI0 A;  3IKO B;  4PDX A;  1O1T A;  2YQ8 A;  2C0M A;  3E33 A;  5KCM A;  4IUL A;  2WQ7 A;  1ELW A;  3L08 A;  2XPI A;  5AJL A;  4I6J A;  3PE3 A;  1WM5 A;  5T4Y A;  4XKC A;  2JEK A;  2WXL A;  3ZPJ A;  3UM1 A;  3LY7 A;  3AS8 A;  4L1B A;  4JW1 A;  4GTO A;  5G55 A;  4BSZ B;  4U0Z A;  3F6Q A;  1G3N B;  2QYJ A;  5ARG A;  1PC2 A;  5D0O D;  1Z6T A;  1MQS A;  1U2V G;  3VLD A;  2IFU A;  4YDW A;  3IV0 A;  4U07 A;  4BTA A;  3PDN A;  4C0E A;  3APC A;  3ZXS A;  3FUM A;  1UJJ A;  2FBN A;  3FUL A;  3ZHE A;  2XEH A;  2V5F A;  3C3O A;  3UM2 A;  3S7J A;  4GTT A;  1N4Q A;  4OVV A;  3FP3 A;  3ZXP A;  4GTP A;  3HXC A;  4N5Q A;  4JL0 A;  2P9S G;  3NZS A;  3UMV A;  4GPM A;  2Q7F A;  1JCS A;  5DBK A;  1L5J A;  3BQO A;  4G11 A;  3FTV A;  4WNE A;  3B95 A;  3ZKJ A;  1TEZ A;  3NB2 A;  1UOH A;  5EYP F;  3NOC D;  5FWQ A;  2X3M A;  2NXP A;  1WDY A;  1OCR E;  4UQX A;  4EPZ A;  3QJZ A;  5D0Q D;  4ATZ D;  3O48 A;  3P2B A;  2MRI A;  4U04 A;  3FUE A;  4ZHB A;  4HLE A;  5CCL A;  2Y0B G;  5LCW J;  4A55 A;  3VTX A;  2OOE A;  3QB2 A;  3QAR A;  3KSL A;  3PZ1 A;  2XEV A;  3DPY A;  3L16 A;  4DI3 A;  4JC8 A;  4UUC A;  4O6F A;  1D9S A;  1A5E A;  4GMR A;  1IHB A;  3MGB A;  4HNA D;  4OVU A;  2L6B A;  3IXE A;  1OUV A;  3E34 A;  2XCB A;  1IHG A;  5BV1 A;  4HOR A;  4MLP A;  1N11 A;  4GYY A;  1UN9 A;  5JJ6 A;  3CIA A;  3UKU G;  5BNW A;  4LER A;  4E6H A;  4WAF A;  4K5A B;  2J8S D;  2J49 A;  4TXR A;  3U66 A;  3UIO C;  1JWG A;  1V54 E;  5ANR A;  4DX5 D;  4BT9 A;  2R17 C;  3EDT B;  3CHR A;  3PH0 C;  4EHM A;  3L22 A;  1D8D A;  3NOG D;  4B94 A;  1NZN A;  4BY6 A;  5B1B E;  4ACK A;  2WQ6 A;  2ZIR A;  3FTU A;  4DLO A;  4OAV B;  4R7L A;  3C3R A;  3EHQ A;  2KBX A;  4QFV A;  3UM3 A;  4NQ0 A;  3ENE A;  3PS6 A;  1P5Q A;  3FUK A;  4NUR A;  3FUJ A;  4BT8 A;  4GCN A;  2V4L A;  3ABK E;  4N2S A;  2PM7 A;  3JQ0 A;  3MEK A;  1E7V A;  4GZ3 A;  3UT4 A;  4LRZ A;  2J09 A;  3PNT B;  3ISM C;  3Q5M A;  2XGO A;  3KD7 A;  3BUA A;  1NA0 A;  1Y8M A;  1MX6 A;  4GAA A;  4AV7 A;  5E75 A;  2Y3A A;  4UQZ A;  4ANU A;  3TWX A;  1KZP A;  2I1J A;  4GA2 A;  4DPR A;  4U8V D;  1ZU2 A;  3LYA A;  3Q15 A;  3ONL A;  2KCL A;  2VSN A;  3FUN A;  4F3V A;  3EU5 A;  3CHM A;  3FUF A;  2F0Y A;  2YHE A;  3CVN A;  2DIW A;  2WXI A;  1FT2 A;  4ZFH A;  4KZ0 A;  5M72 A;  3DXM G;  4UWG A;  3BEE A;  4TXP A;  3GZ2 A;  4GYO A;  1Q2Z A;  1S70 B;  4EBA G;  2V0P A;  3U9W A;  2IQC A;  4FJY A;  3LJN A;  1O1S A;  2C0L A;  1TN6 A;  4N3C A;  5C2Y A;  4JD2 G;  3ZFW A;  4JB8 P;  2IY0 C;  4HOT A;  2P9K G;  4K5B A;  1EDU A;  1HU3 A;  2NSZ A;  3E4B A;  3RJV A;  3FTY A;  4FJZ A;  1NFI E;  3U64 A;  4HI9 A;  1JUQ A;  5G05 J;  2VSX E;  1ZB1 A;  4UWL A;  3N71 A;  2GGF A;  5FJY A;  2HM8 A;  2WXH A;  3SO8 A;  5JHA A;  4KYO B;  3RIB A;  5KJM A;  3PEU B;  4ILI A;  4FC8 A;  1H19 A;  2P9U G;  3PZ4 A;  5LCW C;  3CHP A;  2WXK A;  2A4Z A;  5ENT D;  3AAA C;  3PVL A;  3QDN A;  3FY4 A;  3CVU A;  5LOZ A;  4NRH B;  5BXU A;  3LVQ E;  3L13 A;  2CG2 A;  2QC9 A;  3ZRH A;  1HG5 A;  3CVP A;  1MZC A;  4IYP A;  5HQ8 A;  4ILH B;  1V55 E;  2VSO E;  3ASH A;  3JXI A;  5JMN D;  3CK7 A;  4M7C A;  3SHF A;  3FU0 A;  5AAO A;  4BES A;  3G2W A;  2J4D A;  2L6J A;  3PZD A;  2OVF A;  5EX3 A;  2B6C A;  4AVX A;  3FFL A;  4Y6C A;  2WVI A;  5CED B;  5FT9 A;  4A3T A;  2X6I A;  4PS8 A;  4C48 B;  3DXK G;  1HG2 A;  4FLH A;  5CBO A;  5ENN A;  2L0I A;  1ELK A;  3JYS A;  2F37 A;  4AP2 A;  3S7F A;  3AG4 E;  4UI9 K;  4WWP A;  1U3C A;  2FEZ A;  3TWT A;  3MX3 A;  2XPZ A;  4XZ4 A;  2GRR B;  2GW1 A;  3HXE A;  1BI8 B;  3FU3 A;  2WQH A;  1AP7 A;  4GA1 A;  3Q7F A;  5BW8 C;  1TNZ A;  1XNF A;  2Y4T A;  4UWH A;  4CDN A;  4J8Y A;  1H2V C;  4U96 D;  1RZ4 A;  3RAU A;  4LUN U;  1LTX A;  2AJA A;  3RO2 A;  4B8C B;  5LP0 A;  4FU3 A;  4DX6 D;  2DZN A;  3V2O A;  1JCQ A;  2DVW A;  1FVH A;  1S63 A;  5FTP A;  4CDR A;  2WXG A;  4I1M A;  3HVE B;  2DYS E;  4G1T A;  3X2Q E;  2CFZ A;  2FI7 A;  2WXO A;  4D10 C;  1WY6 A;  4F6R D;  3LCA A;  4YND A;  5ARF A;  4YDY A;  1OCO E;  1EYH A;  2WXM A;  4TUU A;  4BSX A;  2VYI A;  1HF8 A;  4XIF A;  3TJP A;  3L6A A;  4JA9 A;  4MS6 A;  1PAQ A;  3SFZ A;  2YHC A;  4GZD A;  3NQP A;  2ETA A;  2FO7 A;  1AWC B;  3JCK C;  3UIN C;  4HI8 A;  4EZL A;  4ILG A;  5JHB A;  1S64 A;  4J0U A;  4AM9 A;  4IRU A;  2AXZ A;  2KCV A;  5B3S E;  4HXI A;  3UUX A;  3DRA A;  2P58 C;  4ANV A;  3TWS A;  3C98 A;  2ZU6 B;  4YVO A;  5BUZ A;  4P29 A;  1OWP A;  3MKQ B;  5KNH D;  4URK A;  2A5U A;  3FH7 A;  2WXF A;  4YDO A;  3VLE A;  1VDY A;  2KCK A;  1E8W A;  4U63 A;  2AVP A;  1QYM A;  2J08 A;  3FUD A;  5LX8 A;  5CEA A;  3KAE A;  3NF1 A;  3LS8 A;  2NYJ A;  3RSE G;  1DCE A;  4I6E A;  3CVW A;  3UIP C;  4ABN A;  2L0T B;  3NBN B;  3LDZ A;  4HRM B;  5DIZ A;  5B1A E;  3ULE G;  4G24 A;  4AIF A;  3T8K A;  1KPS B;  2HR2 A;  4U0U A;  4B93 B;  4I43 A;  2KZT A;  3DSX A;  1KZO A;  3ASF A;  4KVO A;  3Q9U C;  4N3B A;  5FZQ A;  3FUI A;  3JUI A;  3W9F A;  4YVQ C;  5C1D A;  3OXL A;  4LNG A;  1MYO A;  4L2L A;  4GMJ A;  5J08 A;  2E2E A;  2EIN E;  5EDS A;  5AJD A;  1QBQ A;  4KVM A;  3EUV A;  4AY5 A;  4B8A A;  1H2T C;  1NL4 A;  4GTV A;  3SNX A;  3B7U X;  3G2U A;  4C0M A;  2X6J A;  4KXK B;  5CMY A;  4KMO A;  2H6I A;  3U3W A;  1E90 A;  1FPP A;  3ZHE B;  5CRU A;  2EIL E;  3SF4 A;  1E8Z A;  1N0Q A;  1TYQ G;  4BET A;  2QFC A;  2LXL A;  1MHQ A;  5EIB E;  3DEP A;  1ZBP A;  5CCM A;  5AEN A;  2A5E A;  3G2T A;  1B89 A;  2UWJ G;  4PUC A;  3FHE A;  2XZT G;  3R7Q A;  4LG6 A;  4H7X A;  3CKB A;  3D9N A;  1ELR A;  4O1P A;  3ESL A;  3JQ1 A;  1XGW A;  3SBS A;  2XGM A;  3ULQ A;  1DCQ A;  1HFA A;  3AJI A;  3CQC B;  4HFG A;  3LPZ A;  3Q78 A;  4GYW A;  3ABM E;  4DX7 D;  1NA3 A;  3TG4 A;  4E85 A;  4I17 A;  2EQX A;  3V79 K;  4JPS A;  1JPL A;  3ASG A;  4RQI A;  2IEJ A;  3MYV A;  4EBA A;  3RRU A;  2ETC A;  4YDE A;  3UT7 A;  2VSY A;  4U8Y D;  3OAW A;  5CMW A;  2BF0 X;  2XRZ A;  5CER B;  2JLB A;  2R02 A;  4HOS A;  2OCC E;  2BTD A;  3I5P A;  3I3N A;  3MV3 B;  3LY8 A;  4JEH A;  2R05 A;  4GML A;  5FZS A;  1YYH A;  2XEN A;  2WXQ A;  3UM0 A;  2RFM A;  4NIK A;  1OWM A;  3V2X A;  4EZK A;  2P9N G;  3PRZ A;  4I1A A;  1SQM A;  5KWD A;  3SGH A;  3SI5 A;  4BX9 A;  2AWI A;  3Q79 A;  2RG8 A;  2X6H A;  4AEZ C;  3BG0 B;  3CVV A;  4BER A;  3ULY A;  2F8Y A;  3FWV A;  2PL2 A;  3CVY A;  1E96 B;  2CG3 A;  3SFY A;  2WM9 A;  2IOS A;  3S2A A;  4ACL A;  5CEC B;  4XE0 A;  3QC1 A;  1IKN D;  1SVX A;  2F8X K;  2VGX A;  3C72 A;  3U4T A;  2C2L A;  3UX4 A;  1N9A A;  2LAH A;  3QWP A;  3QNK A;  5A6C A;  5HKP A;  3PZ2 A;  1LF8 A;  3RU0 A;  4G2V A;  2GRM A;  4KT6 B;  2V4H C;  3EIJ A;  3PZ3 A;  3URZ A;  2AXV A;  3QWW A;  3DST A;  2IU1 A;  2XQ0 A;  2UY1 A;  3WG7 E;  3D9J A;  3CVX A;  2EIM E;  1YMP A;  2E0I A;  3ASD A;  5AAR A;  3R7R A;  3Q49 B;  3MJW A;  1HS6 A;  4CT4 A;  4F1P A;  4F7A A;  1UJK A;  4HB5 A;  4G26 A;  3KS2 A;  5CBN A;  5G04 J;  2EIJ E;  5KJN A;  2X38 A;  1YCS B;  3G2S A;  1X81 A;  3AG2 E;  3ASO E;  3RKV A;  3MKR A;  1BI7 B;  1INZ A;  3IBE A;  4FLB A;  4DX2 A;  1IQU A;  1GW6 A;  2B0O E;  2XZD G;  2HYZ A;  1OWO A;  5ENO D;  4AOF A;  5EX0 A;  2FF4 A;  4WWN A;  5FQ7 A;  4A3V A;  3FH5 A;  2DWZ A;  3TGO A;  4XX5 A;  1NI1 A;  2P9P G;  1QZ2 A;  2I9C A;  4JVS A;  3HG0 D;  3TWQ A;  4RG9 A;  2ZGD A;  2OEV A;  1HO8 A;  3UTM A;  3EHR A;  3ZVV A;  4WNG A;  3D9P A;  4KZC A;  2WB2 A;  2FO1 E;  4K5C A;  2GRO B;  1SZ9 A;  4RSY A;  3APF A;  1EPU A;  3ZIM A;  2OND A;  4U7E B;  2J07 A;  2ZXW E;  2ZGG A;  4FUL A;  4FHJ A;  3SQV A;  4HLL A;  3PUK A;  1HH8 A;  2MHK A;  3I4R B;  4WNF A;  1Z3X A;  1K1A A;  3ZUV B;  1YA0 A;  2V5Q C;  4UQY A;  4DUI A;  4CGV A;  4DRX E;  3ZU7 B;  4CT0 A;  4JHK A;  4GPK A;  4G25 A;  4L7T A;  4EQF A;  4I6G A;  2OEW A;  4I9C A;  3D9M A;  3ML8 A;  2I1K A;  1OCZ E;  4W9R A;  1UN8 A;  1DVP A;  2FUL A;  4DLQ A;  3AS4 A;  4B89 A;  1DC2 A;  3D9K A;  2YIN A;  1H6O A;  3FUH A;  3EU9 A;  5HS0 A;  4GTS A;  4J6I A;  4LSZ E;  1TN7 A;  4J8D A;  1N4R A;  3NZU A;  3L17 A;  3HDX A;  4A63 B;  5CHE E;  3AU5 A;  4GU5 A;  4LEU A;  3CKC A;  3MZL B;  3DEO A;  4OYS A;  4N5C A;  3V30 A;  3DSU A;  3TG5 A;  3SBT B;  4RG6 A;  2LXM A;  2WXJ A;  3CGH A;  2VGY A;  1D8E A;  4K0R A;  1SA5 A;  2WMN A;  3TWR A;  4DX1 A;  3WXX A;  2ZIS A;  4N3A A;  5EN5 D;  3VLF A;  4DK5 A;  3CK9 A;  3DPD A;  1N95 A;  2WMO A;  4APF A;  4AY6 A;  1WG0 A;  5T3R A;  3NAW A;  1TNO A;  2OV8 A;  4Q96 A;  1KT1 A;  3RRM B;  1OWN A;  4CCA A;  5BV0 A;  4J7W A;  3HXF A;  5G04 C;  4NAC A;  5KBA A;  2VGE A;  1X5B A;  2WXN A;  2LSU A;  3SD5 A;  3MV2 B;  1N0R A;  5BT1 A;  4V3I A;  2VTB A;  5AN8 A;  4X8Q A;  2QZA A;  4XI9 A;  1NP7 A;  2PM6 A;  2RD0 A;  1OCC E;  3FTZ A;  3HXD A;  5ENR D;  5G05 C;  1BD8 A;  1PY1 A;  1S0P A;  2IF4 A;  3PE4 A;  4HRL A;  4J8F A;  1N4S A;  3RK6 A;  1FT1 A;  5JJ7 A;  2I6H A;  1TNU A;  3Q4A B;  3CVL A;  5FZR A;  3IEG A;  2H6F A;  2XGS A;  2BKK B;  2GRL A;  2CHX A;  1MJ0 A;  3AG1 E;  1Y6I A;  2HE0 A;  2GRQ B;  3S7B A;  3Q47 B;  1IYG A;  4L23 A;  2J4B A;  4I9E A;  4FHK A;  5EIL A;  4CZ2 D;  4N39 A;  3TXN A;  5HRY A;  3ZYK A;  3UXG A;  3TWW A;  1DNP A;  5AYW D;  1H0A A;  2QY7 A;  3CVQ A;  3ESK A;  1E7U A;  5AQB A;  3QWV A;  4G8K A;  3K9I A;  4GB9 A;  2KZT B;  4GZ6 A;  4TUM A;  4A1G A;  3SY2 A;  3TWU A;  4L9P A;  1K8K G;  2DYR E;  4JA7 A;  2H6G A;  3I4G A;  4I2Z A;  3J5P A;  4HOQ A;  4CDM A;  2R5S A;  2R03 A;  2IOL A;  1Z5S C;  2CHW A;  2X6K A;  4HBD A;  4ANX A;  3HYM B;  1UW4 B;  1IXV A;  4JHR A;  3B7T A;  4TXQ A;  3J5Q B;  2DCP A;  5KJL A;  5ENQ D;  4WUY A;  5AQ9 A;  4EZJ A;  5ANL A;  4UWF A;  1QNF A;  1OT8 A;  5HI7 A;  4F1S A;  2NC9 A;  3ZYL A;  4J8S A;  2QYU A;  3BG1 B;  1OWL A;  4HQD A;  3UQ3 A;  3T8M A;  3EIQ C;  3CEQ A;  4APO A;  4DI4 A;  4ATG A;  3L9T A;  3FTS A;  3PRE A;  5KJK A;  1SA4 A;  4FAD A;  4OAU C;  3ABL E;  2X6F A;  3FEY A;  3FH8 A;  3LEW A;  3GYZ A;  1H6P A;  1LD8 A;  2GRP B;  2XHE A;  4GZ5 A;  4AJW A;  3EJN A;  2LUH A;  3B7R L;  4FA6 A;  4Q69 A;  3T5V A;  3HXB A;  5EYL A;  3Q7A A;  3C5R A;  3MCX A;  4UI9 J;  3V31 A;  4DJA A;  5BXO A;  4G23 A;  3D3M A;  4Y6W A;  5AQA A;  1OXJ A;  2BKG A;  2Y69 E;  1EF1 C;  3CLJ A;  3ZW3 A;  2WXR A;  1TNY A;  5ITZ F;  3ZN3 A;  4CGW A;  3JXJ A;  2VJ8 A;  1HE8 A;  2WPV A;  4I1O B;  3MA5 A;  3OXG A;  3Q73 A;  1FVF A;  5J90 A;  1K1B A;  2H6H A;  2R2L A;  1JWF A;  4H7Y A;  2ION A;  4N2Q A;  2M63 A;  2ETB A;  4ME2 A;  4HVB A;  2DBA A;  3L82 A;  3EHM A;  2L9B A;  3LY9 A;  1H2U A;  3UPV A;  4GA0 A;  1FCH A;  3GZ1 A;  2DZO A;  3CQG B;  3ML9 A;  2WXP A;  4RVB A;  4J8E A;  2YNQ A;  3R9A B;  2Y4U A;  3ZEF A;  3CR3 A;  3OTN A;  3W9G A;  4UWK A;  4BTB A;  4WND A;  4U0S A;  5D2M C;  1TR4 A;  5FIO A;  5JA4 D;  3DSS A;  2BUG A;  4EEC A;  2VGX B;  3D9H A;  4Z68 A;  4GTM A;  4BX8 A;  5LFA A;  4KBQ A;  4LCT A;  2HO1 A;  3QAQ A;  2CHZ A;  2LO6 A;  1E8Y A;  2PQN A;  4L2Y A;  1BU9 A;  3AG3 E;  5A7D B;  3JUE A;  4MKT A;  3UT8 A;  5G2N A;  4BFR A;  4F53 A;  1JCR A;  3O4Z A;  2PZI A;  4JXT A;  2UY1 B;  2IO2 C;  3Q75 A;  1LD7 A;  3ZGQ A;  4WWO A;  2KXP C;  2J9Q A;  3B7S A;  4A1S A;  5H7P A;  3LXU X;  4HOU A;  1U3D A;  5AQ7 A;  4PS3 A;  4G8L A;  4GCO A;  3GZS A;  2P2C P;  4QQI A;  3CST A;  3C3Q A;  4K03 A;  3T9K A;  4JZY A;  1N4P A;  1QQE A;  2MOW A;  5D66 A;  2AW6 A;  2V8S E;  5ENP D;  3E32 A;  3FTW A;  3PUJ A;  1E8X A;  2I2O A;  2XS1 A;  3E30 A;  3UKR G;  3ZNG A;  3CK8 A;  3D9O A;  1SW6 A;  3DSV A;  2IJG X;  4TRQ A;  3UI2 A;  3LJ3 A;  3DSW A;  5CRV A;  3ZYM A;  3KSQ A;  3R9M A;  3L54 A;  4GTR A;  4HS2 A;  1HX8 A;  2P9I G;  1H6K A;  3RRN B;  3KEZ A;  2CFU A;  2Y1L E;  3TXM A;  3HHM A;  5FIN A;  2RFA A;  1O1R A;  2RKK A;  3E37 A;  3HIZ A;  3LKU A;  3CHQ A;  1KLX A;  1HXI A;  3FU5 A;  1A17 A;  1HZ4 A;  2KM4 A;  4HRN A;  1Z3Y A;  3AU4 A;  4LNU D;  4IN3 B;  3TAX A;  3SZ7 A;  4UI9 C;  5T8I A;  3QKY A;  1O5M A;  1N94 A;  3CHO A;  2MYO A;  2XS8 A;  2XEE A;  3P1U A;  1W3B A;  4GZC A;  4CYM D;  3ONK A;  2PQR A;  3APD A;  5JJT A;  3FU6 A;  3TWV A;  2KAT A;  3ZYQ A;  3D9I A;  3G2V A;  4M3O A;  1K3Z D;  2GRN B;  3ASN E;  4MRU A;  3Q9N C;  1SZA A;  1N54 A;  3IHV A;  1OY3 D;  4JEU A;  4XEI G;  4I2W A;  3QOU A;  1UG3 A;  3SFX A;  3FEX A;  3T5X A;  2KC7 A; 
#chains in the Genus database with same CATH homology
 2HE0 A;  1MX2 A;  4U8Y D;  4DX1 A;  4OAU C;  1YMP A;  3B95 A;  3ZKJ A;  5CBO A;  3W9G A;  1UOH A;  2ETA A;  5EIL A;  5EN5 D;  5EYP F;  1K1A A;  3NOC D;  4JB8 P;  5CER B;  1AWC B;  4OAV B;  3ZUV B;  4CZ2 D;  2PNN A;  5AAR A;  4K5B A;  5HRY A;  3UXG A;  3EHQ A;  1TR4 A;  3TWW A;  2F37 A;  4HI8 A;  1WDY A;  2KBX A;  2V5Q C;  5FIO A;  5JA4 D;  3B7B A;  4F1P A;  4ATZ D;  4QFV A;  4HB5 A;  4DUI A;  2Y1L E;  5EID A;  1WG0 A;  1NFI E;  5CBN A;  1YYH A;  5FIN A;  2XEN A;  4ZHB A;  4HI9 A;  4DRX E;  2RFA A;  3TWS A;  3ZU7 B;  1YCS B;  2Y0B G;  4O1O A;  3TWT A;  2RFM A;  3D9H A;  4Z68 A;  4NIK A;  5AQB A;  3V2X A;  1BI7 B;  4G8K A;  1BI8 B;  5EYL A;  3SO8 A;  5KWD A;  1N0Q A;  4BET A;  4TUM A;  4J7W A;  3C5R A;  5KNH D;  3TWU A;  4DX2 A;  1AP7 A;  3V31 A;  5EIB E;  5KBA A;  2VGE A;  1MX4 A;  2B0O E;  2XZD G;  3DEP A;  4HRN A;  5BXO A;  4LNU D;  4UUC A;  5ENO D;  1BU9 A;  4BSZ B;  3UI2 A;  1D9S A;  1MX6 A;  4GMR A;  3JUE A;  3F6Q A;  5AQA A;  1G3N B;  1IHB A;  2QYJ A;  1QYM A;  2A5E A;  5ENT D;  4J8Y A;  1N0R A;  3AAA C;  4U96 D;  2BKG A;  3J5P A;  4BER A;  5KNG A;  2F8Y A;  2DWZ A;  1DC2 A;  5CEA A;  2XZT G;  4HNA D;  5AN8 A;  5ITZ F;  4LG6 A;  2KXP C;  3TWX A;  2L6B A;  2AJA A;  4YDW A;  4RLY A;  3JXJ A;  3HG0 D;  3TWQ A;  2MYO A;  3KEA A;  5BXU A;  4U8V D;  2NYJ A;  4U95 D;  2ZGD A;  2XEE A;  3IXE A;  4DX6 D;  4O1P A;  3EU9 A;  4HBD A;  5HS0 A;  5CEC B;  1BLX B;  2DZN A;  3V2O A;  4LSZ E;  1K1B A;  5AQ7 A;  4CYM D;  1IXV A;  2DVW A;  5ENR D;  1IKN D;  2QC9 A;  1SVX A;  4G8L A;  1BD8 A;  3UTM A;  3EHR A;  3TWV A;  3NBN B;  4A63 B;  2P2C P;  4HRM B;  4QQI A;  2ETB A;  2F8X K;  3T9K A;  1N11 A;  4HRL A;  3J5Q B;  3JXI A;  3T8K A;  4ZFH A;  2XEH A;  1K3Z D;  5JMN D;  4O60 A;  4F6R D;  2FO1 E;  4B93 B;  1DCQ A;  1A5E A;  4K5C A;  3AJI A;  3DEO A;  5ENS D;  4BEP A;  5ENQ D;  5AQ9 A;  4YDY A;  3Q9N C;  3HRA A;  5D66 A;  2DZO A;  3V30 A;  5AAO A;  4K5A B;  4BES A;  5ENP D;  1S70 B;  5HKP A;  2J8S D;  4DX7 D;  3Q9U C;  1OT8 A;  2BKK B;  3V79 K;  2V4H C;  3LJN A;  1OY3 D;  4DX5 D;  3W9F A;  3ZNG A;  2ZGG A;  4N5Q A;  5CED B;  4HQD A;  2JAB A;  4C48 B;  1SW6 A;  4GPM A;  1MJ0 A;  1MYO A;  3NOG D;  4HLL A;  3TWR A;  2ETC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...