4DXAA

Co-crystal structure of rap1 in complex with krit1
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
168
structure length
168
Chain Sequence
SMREYKLVVLGSVGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Small G Protein Effector Interaction of Ras-related Protein 1 (Rap1) and Adaptor Protein Krev Interaction Trapped 1 (KRIT1).
pubmed doi rcsb
molecule keywords Ras-related protein Rap-1b
molecule tags Protein binding
source organism Homo sapiens
total genus 55
structure length 168
sequence length 168
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2012-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dxaA00
4YQFA 2WOOA 4ARZB 4UNRA 4ZCMA 1CULC 1NVXQ 1OHHA 5HKKD 1PUIA 2ZJYA 3TIFA 1AGRA 3N2IA 5LDDC 4C0LA 1N5JA 4Q4LA 1OFTA 2FN4A 4WZAE 5DYIA 1KK2A 2CVFA 5JHHB 1K6MA 4GFDA 3ZZTA 5KNDA 1RRPA 1AZSC 2BBWA 4I1SA 1CTQA 1UDXA 4LBVA 4LHVA 1KOFA 4GZLA 3WNBA 1G7SA 3THOA 5DH9A 2REBA 4DXAA 2JLRA 2P65A 3PENA 1TNDA 1RRGA 1DAEA 2D2FA 1B0UA 2GZDA 5L8VA 3WYAA 4LV6A 1TUIA 4Q7MB 2A78A 2Z4SA 1XPOA 1XDBA 3H0KA 4A2WA 1MO5A 3FMPB 3V00A 2R6FA 2XOKA 2R6CA 5D3MB 2J0UA 3WRYC 3V4RA 2ZJZA 2CVHA 2EU8A 3GFPA 2FPMA 3PEYA 3RHFA 4AURA 2QG6A 1SVOA 4QJ5A 3AKYA 1DG3A 1DPFA 5CIQA 3BWDD 2AN9A 1HQCA 4TMXA 3RS4A 2CHQA 4XD7A 4MGIR 3I8XA 4RFSB 4UXIA 5EXSA 1ZNYA 1FNMA 3VR1A 3QF4B 4BECA 1OW3B 2ZREA 5KTYA 4DT1A 3CKLA 1JPNA 1VG9B 3KX2A 5FI0B 1KJWA 3LQQA 1F5NA 5DHAA 3SQXA 1ZNXA 2W6JD 5JECA 3PVSA 4A2PA 3KQKA 2HEIA 1BOFA 2XX3A 1GG2A 4IDQA 1NMXA 2P0EA 2ZI7A 4LHZA 4A4DA 4QOSA 5G3YA 3B85A 3RRNA 4GMXA 1KY3A 1UBCA 2GVDC 2FEMA 5FPYA 4Z51A 5CJPA 3TNFA 1KO1A 1ZAKA 2CDNA 1S4QA 4S35A 1W44A 4D26A 1ZC3A 3B6EA 1UF9A 5B57C 4YDHB 1ZUNB 3BGWA 3DO6A 1ZC4A 2QGNA 4KYIB 2RHDA 4BLSA 2JIZD 2P67A 5LBIA 1NN0A 2CL0X 4MGZR 3WYGA 5GJBA 3QG5A 3EIHA 3RVBA 2F1JA 3K0AA 1D8TA 1W0KD 3AVWA 1Z0DA 4Z8YA 2HYDA 3SN6A 2GCOA 4XVUA 1RVDA 3THYA 2BHRA 3GFTA 4LV8B 1R0XA 4RD1A 5CYPA 5JJLA 2PT5A 2IYRA 4DLTA 1YR8A 2D7DA 5BXQC 2JDIA 3FFBA 1GIAA 1W46A 2VLIA 1WCV1 3NIBA 1D5CA 4DB4A 4A36A 4C4PA 3CRQA 1N6RA 3PIRA 5ELXA 1TU3A 4BLOA 5JSZB 4GNKA 2BM0A 1D2EA 3KJIA 4TMTA 4CT5A 5JS7A 2W0MA 5KPDA 3NBXX 4S2EA 3E1SA 2J7KA 1R5OA 4B3CA 1AKEA 1G7RA 3B78A 5FPKA 2CK3A 1P72A 2Z6VA 3EASA 1TF5A 3LX5A 4Q21A 1FQKA 2RB4A 4NHOA 2JLVA 2FDCA 3EARA 2GILA 1Z06A 4PXAA 3WMGA 5EE9A 5L3QA 1E9AA 2FJUA 2XZLA 1Q3TA 3P26A 1G17A 4N0EA 3AB3A 4PC3A 1NP6A 3FKSD 4V0LA 1X8LA 2EVWX 2F1HA 3VMFA 2AWOA 3D8BA 1CJVC 1T9HA 5KSOA 4DLSA 1FPMA 4TYPA 4QKQA 4M4SA 3FTQA 4OK6A 1MRNA 3AF4A 1OH8A 4ZIRB 1Y63A 3ZZUA 4TTQA 3I73A 3EG5A 4WZBE 3X1ZA 2J7PD 2BMEA 2D06A 2WWHA 3K1JA 3KKNA 4DDVA 2IC5A 3MJRA 4JSYA 4LI0A 2HV8A 1OF1A 2OXCA 1OIWA 1P6XA 2WWFA 3OFND 3W3AA 4JJKA 2GF0A 1XPUA 3U3JA 3CX6A 3KKMA 5FOXA 2W0SA 3CWZA 1DARA 2GXUA 2GK7A 4UXJA 2QZ4A 3PQCA 1AQYA 3S1AB 3SQWA 2F9MA 2AFIE 2V3CC 1X1SA 221PA 2OAQ1 4EFLA 4M1WA 4A1FA 3U6KA 1VG8A 1DADA 3H86A 1XB2A 4RD4A 3QPVA 2E9SA 4ZCIA 3THXA 2VPPA 3C14C 3E5HA 3GCGA 4IDNA 4BRWA 1VCMA 1W36D 3AUYA 5C1BA 3SBEA 2CLDX 1P9WA 5ANRB 1PLLA 1F6BA 2QA5A 2YOFA 5JHGB 3QKSA 3GPLA 3CW2A 2XAUA 3IILA 4PC6A 3ZD6A 3U61B 2IYTA 4Q1FA 4FCWA 3O8DA 5CIWA 4KITB 1AKYA 1Z07A 4F7WA 3N2EA 3DZDA 1QHHB 2YKGA 1KK3A 2ZVPX 4XH9B 3QKTA 3SFZA 1HT1E 1S9DA 2DWQA 3I5YA 3ZYCA 4BLRA 3ND9A 3GLIE 1ZRHA 4CT4B 4H1VA 2EFHB 3CLVA 4TL6A 3H84A 4D0GA 1XJCA 1U94A 2GWHA 2WAXA 4LYHA 4YMTA 1Z0AA 721PA 1NKTA 4NTZA 3QENA 4JZKA 4QM6A 1AGPA 3CM0A 3CNOA 1VDZA 2LKDA 3BC1A 1NLZA 2C9OA 4X8MA 2FF7A 1E2GA 1GP2A 2J59A 2VH5R 2QU8A 3A37A 3IQXA 4XWOA 4OKSA 4MGYR 4TMVA 1EFRA 1G4AE 3EC2A 4A0HA 4EFMA 4XIGS 4D2IA 4DDWA 2FFBA 5CM9C 1F3OA 2C8VA 3OAAD 5IDVA 3EC1A 3SJBA 5FOSA 1EFCA 2FV8A 3K0CC 5EUQB 3VX3A 3GLIA 3GLHE 4HDOB 2DPXA 2QTFA 2ZEJA 3FMOB 3L0IB 1XEXB 2IWRA 4LHXA 3WHKA 2JA1A 1HT2E 2PX3A 4YMVA 1NBME 2AX4A 2OCAA 4WW0A 3KUDA 3K70C 4MKGA 2RGDA 1YKSA 1M34E 5AJWA 1JQJC 4LCBA 2ZETA 2ZQ5A 4B35A 2VYFA 5HR5A 3DL0A 4HAXA 3CO5A 1KAOA 3LXRA 4Q02A 5SZJA 3RS3A 4TYNA 1GKYA 1XD8A 1YZNA 1CJKC 1S8FA 3KKOA 4NL4H 2O8FA 2QM8A 5FUWA 4DCTA 1UFQA 3UG7A 2ERYA 3GLHA 1ZD8A 1X86B 2IYSA 3AF1A 2J1LA 4AD8A 3TQFA 3GJ6A 4C0HA 4GMDA 4AY2A 4IXNA 3UWOA 2W2TA 3VNVA 4NCIA 1N0WA 3PUZA 1GVNB 1ZUHA 1CRPA 3ZVNA 1NY6A 1GL6A 4CEJA 2KBEA 1Q22A 1L2TA 2IYWA 4WOPA 1XZPA 2GEUA 4OQMA 3EPHA 4NCKA 2F9LA 1U2RA 1JR6A 4JKIA 4YMSA 4FMCF 1E9SA 1VCOA 4CEHB 4NH0A 3C8UA 1S3GA 1UJ2A 2P2LA 2XJ4A 1NIPA 3KQNA 1XTQA 2WWIA 4MKFA 1KI9A 1P9NA 3KZ1E 3LQRA 1J99A 3KDSE 1P2SA 4EPRA 2HLDA 4TLEA 4I81A 4ACBA 4KJZA 4BZXA 2OBNA 4GSYA 3RABA 2QENA 3A4LA 5H68A 4QJ4A 5JEDA 3C15C 3RC3A 4R71A 2HYIC 1UM8A 1K5GA 3A1SA 2TMKA 4LC1A 1ZVQA 4MA4A 2R9VA 4RFVA 1SGWA 2H8KA 4P4SB 4O3MA 1EFHA 1U8ZA 2SHKA 3SC3A 1MOZA 3DDCA 4WXPA 2CL6X 4RCZA 3RLFA 3T15A 4F91B 3TH5A 3SYLA 3RS0A 2ZANA 4QJ3A 2NPFA 2RGAA 4Q9KA 3QKRA 2BEJA 4LJ4A 1E0JA 4JLPA 1XEWY 1N5LA 2MMGA 1Z6AA 2A5DA 2FSHA 1R6BX 4OQXA 3ADDA 4ZO4A 1DEKA 5IK2D 1DAKA 4A8JB 4BFYA 2ZE7A 4LJ7A 3OF5A 2XB4A 1XTSA 4M21A 4HLCA 1KO4A 4BLPA 3HU3A 4L4UA 1P5ZB 1E2HA 3BERA 3FDIA 3K09C 4QGFA 3Q7QA 3KKQA 4TSFD 2VQSA 3AKDA 3B1XA 3PUWA 4FW9A 4URYR 3UMRA 2H17A 1IXRC 2QPOA 4NCHA 2ZXUA 1OB2A 2W00A 2FWRA 4L5BA 1SULA 3O8CA 1KMHB 2V6JA 3EZFA 1N6OA 4IKEA 1JEDA 4IRUB 1DG1G 1ESNA 2NMVA 3AP1A 1MT0A 3LD9A 3T1TA 1P2TA 1VIYA 4IEEA 2O8DB 2KE5A 5JBQA 4Z54A 4PHTA 5DYGA 2ZRLA 5KSPA 2YC4C 3NC0C 8OHMA 1AA9A 1LS6A 1TADA 3MUFA 1GM5A 1E9CA 3C5HA 1IHUA 4JVLA 4POAA 4M8NE 1KKLA 3N70A 1BYUA 3KL4A 4PQYA 3D6TB 1G3QA 1F2TA 4HSEA 5P21A 1W48A 1U81A 1EXMA 4JLAA 5EJEA 1G8GA 1XD2A 1SXJA 1ZU4A 5DSZA 2OV2A 3OIWA 4R9UC 2PLFA 1ZM3A 1SQ5A 1NG1A 2BBOA 4PZZA 2QQEA 5AUQA 4PZLA 2KB0A 4W5JA 2W6IA 2G1KA 4DUGA 4RD6A 3X1XA 4BGDA 1W7AA 3OIYA 1W2GA 3VKHA 2Q9AA 4Z1MA 4N3NA 2MSDB 3TK1A 1S1CA 4R7ZA 3BB4A 2GHIA 2RGNC 5LB4A 4MRRA 1XXHB 5BYJA 4JJZA 4URWR 5TDHA 2H7VA 3T35A 2ECKA 2ZR0A 1S1MA 3WBKA 1FTSA 2WMNB 3UIEA 2RMKA 4BWYA 1QF9A 1LS1A 2RGEA 3BH0A 2VA8A 3HR8A 3TAUA 2NG1A 2ZI5A 4JLNA 4AYWA 3IIJA 3LLMA 4CRWB 4JVNA 3NH6A 5CJ2A 5FTNA 4AKIA 3TRFA 3ADKA 3V4FA 5BQ5A 3CBQA 2ZS8A 4EPXA 4GDFA 4C0QC 1RPZA 2RGGA 4GP7A 3K0EA 4TMWA 2HT1A 2F1IA 1QVAA 2WWXA 4BFXA 5EXPA 2YHSA 3R20A 1CJUC 3DKPA 4EPTA 1TQ4A 3RRYA 4PPGA 2ZSBA 3A36A 4QNRA 4DB2A 3SNHA 5FI1B 5KYKA 4GL2A 4TQUS 3QIAA 1XEWX 1E1QA 5EXTA 4DSUA 3FOZA 4B2LA 1UAAA 1BMFD 1A2KC 2FPKA 3CPHA 4LBWA 3L8YA 1VYUA 2X8AA 1XP8A 4HAYA 2P3SA 4OJKA 3K9HA 1W4BA 1XMJA 2HCBA 4A15A 2O8EA 1C4OA 1HH4A 3AM1A 3ASZA 2OILA 2XNDD 5EE1A 2CE7A 1OXSC 1JEEA 1NVVR 1FZQA 4DDUA 4G01B 3IBYA 2QT0A 3BFXA 1E2KA 2EFGA 2I1QA 2ZTSA 1XJQA 1Z2CA 1WP9A 3B1YA 2PLRA 5FL7A 1T0HB 1XRJA 1ZM9A 1R7RA 1GZSA 1SZPA 4CZ2A 4W5WA 3AEZA 3O47A 4BFZA 1VECA 4M1OA 1E32A 3NDPA 4K81B 3GEIA 3ZVRA 4X8OA 4GZMA 2XJ9A 4F4JA 2CNWA 4W9MC 1Z5ZA 4P4UA 4TQ9A 1W5TA 2CJWA 1EGAA 3FPAA 2J0UB 3W6OA 2D2EA 3I1FA 1OXUA 5EE5B 5EUMA 1XMIA 4NBSA 3GLGE 4CDGA 1Z0FA 2WJGA 3FWYA 5FBVB 3QXJA 5CDFE 3Q85A 1A7JA 4WAUA 2VF7A 1YZLA 3AQ4A 3CB4A 2ZM5A 4DT1B 3EZ6A 1ETUA 1VHLA 3U7EB 3ZS9A 3A1TA 4JSTA 1JAHA 3DHWC 1LV7A 3IDQA 1WF3A 1Q57A 3L0PA 2AK2A 4G5GA 1DAMA 2PH1A 4IOMA 4KXFB 1H8EA 5FBRB 1D6JA 4UNNA 1XMSA 4QHTA 2BVNA 2GJ9A 1MV5A 3OEHD 3RRMA 2ORIA 1XCGB 2R65A 1E79A 3J81k 3KUCA 1E2QA 2VP9A 1Z6YA 1LFDB 4CYMA 3GLGA 4EJSB 3AVTA 3CR8A 5CDFA 4FD2A 1ZIPA 1UEIA 3EAQA 2V4ZA 5LD2C 2IYLD 1UBFA 3K0AB 2PBRA 3T1OA 3WY9A 2R44A 2GCOB 3THYB 2VP2A 3WMEA 1OKKA 4JMPA 4R2IA 4BFTA 4TLBA 5H8WA 1LW7A 1ZINA 4PSVA 1VIAA 4OQNA 1A1VA 2QTHA 1QHSA 3K0CA 2GCPA 2ZRNA 4TMKA 5L3SB 1ZD9A 2XGJA 4L9WA 4V0KA 4RD3A 1QHIA 4PX9A 4TZ6A 4AKHA 3B1WA 2ASEA 1KI6A 2IL1A 1FFHA 4XTRA 3TSWA 1EK0A 3L43A 4KSCA 4DSOA 4U00A 4I1VA 2BV3A 1UKVY 1GRNA 2C98A 4M9ZA 2QT1A 1U8YA 3FYHA 5A5GA 5KO2A 3RS2A 2C96A 1KSGA 4PZYA 5L3QB 2D74A 3AV0B 3W6NA 4K8OA 4B33A 2WKQA 2WJHA 5FL3A 2P6UA 3BB3A 1G5RA 1W0JD 1NMYA 5CYOA 5AJZA 2H18A 1TAGA 5DN6D 2A5JA 1XU4A 3SJCA 1E1RD 2YINC 5K8TA 2X19A 4DSTA 5GADl 4QGGA 5KOYA 4FI3C 4YONB 2JLUA 3REGA 2GVZC 4WBSA 2ZI3A 1IJFA 4MKHA 2EFEB 5E7MA 2VRWA 2W6JA 3KB1A 1HYQA 4PFSA 1H65A 4LRWA 2BWJA 2OE2A 1E0AA 4A82A 1C1YA 1XWIA 1WXQA 3NHAA 2DB3A 4KSBA 3QUSA 1QHGA 1XBTA 1EFUA 3WNDA 3CONA 4MRVA 2REOA 2JLWA 2CMKA 2R62A 4QC2A 4PANA 3GP8A 1W49A 1XCMA 2GETA 1Q12A 3ZVMA 2V6IA 2QQ0A 5DE3A 2O8CA 1RZ3A 3PEVA 4TMZA 3TGPA 1M7GA 4NDZA 2VP4A 2O5VA 4M2LA 4M9QA 1D9XA 2JJ8A 1ZM7A 4P4TA 2CCKA 1OYWA 4ACAA 4M9SA 1MABA 1TQ6A 3B1VA 3BK7A 3IQWA 3TJZA 4C0BA 5GVSA 5DHFA 3AGPA 4H9GA 3U2QA 1R0ZA 5JRJA 3KJHA 4DRZA 4LPKA 2BIFA 5TMPA 3KFXA 3OHMA 1BH2A 5DI3A 1RC8A 3QKSB 2VF8A 2VHJA 3E2IA 121PA 2O0KA 2XTNA 4G5SA 2EYQA 3CF0A 5KNBA 4DLWA 1Z6TA 2JLXA 4TYQA 4V02A 2JJ2D 2LKCA 3BBPA 1G8PA 2KWIA 4FIDA 3GEEA 3FVQA 2RGXA 4YLGA 1J7KA 2QM7A 3U6BA 1G6OA 2OBMA 1M7HA 4BEJA 1YE8A 1NVVQ 3KTAA 2Q0HA 3CWQA 3PEWA 2ZVQX 4PPNA 3K09A 2J0QA 2OBLA 1UPTA 4FXPA 3H2YA 3CH4B 5DNYB 1CLUA 3B5JA 2ZRJA 5UKDA 4FINA 2JJ1D 4OK5A 2WM9B 4D4KA 1NVWQ 2QAJA 3U3MA 3P1JA 4QNMA 3HYTA 1DAIA 5K8IA 4PHFA 1QHNA 5KNCA 1E2FA 1CU1A 1G9XA 2OSBA 3QG1A 1FQJA 1COWA 3WP0A 2G1JA 3UK6A 3KXLA 3CRVA 1YR9A 2QRNA 3JVVA 2GNOA 4JLDA 5CM8B 5C2JB 1UKZA 3UXMA 5D3QA 4ZDJA 1E2JA 4F4CA 2X2EA 1MO4A 4GPTA 3LAWA 1GAJA 5HCNA 1KTVA 2FSIA 5EP2A 2WPDD 1JNYA 1Z22A 3CH5A 1G4UR 3X1WA 2DCUA 4KLNA 4ITRC 5C4GB 1GOTA 1Q21A 2FG5A 3BH7A 2OCYC 4DLYA 4PO9A 3K8YA 2GXAA 4DLXA 4YXWA 3AVXA 2NPIA 1E2PA 2IF2A 1C9KA 2RGNA 2FNAA 5F98A 2IXEA 4UXHA 2O8FB 2XOKD 5E7IA 1ZBDA 2OLKA 4GOXA 4BZPA 1CP2A 1G64A 621PA 3GLHB 3VTKA 1V43A 3THWA 3MAAC 4UNPA 3ZQ6A 1NN5A 3NC1C 3VR5A 2NZJA 4PC1A 2A30A 2YOHA 1GKUB 2LCFA 2QPTA 4P33A 2F55A 4M1KA 4XD7D 3CNNA 4L8GA 4E03A 2DFLA 1RRFA 4A0RA 1QVRA 4US0R 3REFA 3AVVA 1TUEA 1KIMA 4CEJB 2RHMA 4U02A 2ODEA 4DEYA 1Z8FA 2JATA 1W4AA 5JLJA 4PAQA 2BMDA 1I2DA 2GZAA 1IN7A 2J9RA 4KHZA 5HTKA 1WRBA 4F92B 3JVUA 4C0SA 4FMDF 2ATVA 5JCPA 1SVSA 3F3YA 2WICA 5J40A 5KDLA 1HURA 4RZXA 4Y0VA 4OQFA 1KZ7B 1OIXA 2YV5A 1II8A 2V7QD 2IX3A 3U5ZB 4IOKA 4C3ZA 4AC9A 1A2BA 5BW8A 1YZKA 3W3ZB 3R8FA 1OT3A 3I62A 3LVRE 3I72A 1UADA 3DEFA 4JT4A 1KZGB 2FA9A 4JLOA 3MGCA 1T4GA 5L3RA 5CITA 4IVRA 3K0FA 1XTKA 3KJGA 1D2NA 1TTTA 2ANCA 3R9WA 5K8UA 4MRSA 1OLOA 4IDHA 4OQLA 3PFIA 3EW9A 1P75A 4L9SA 4Q1AA 4TL8A 4JBYA 2PCLA 3QKRB 2OFOA 4B3XA 1NN3A 4MYTA 3BOSA 2P6RA 1TMKA 2Z4RA 4G3XA 2Q6TA 4XWKA 3WP1B 521PA 5JJIA 2R2AA 2AR7A 4M1TA 2GDJA 3AGQA 1E9FA 2I1VB 3U3RA 3NH9A 2ZYTX 3P20A 4B48A 4B76A 3PJRA 1OJLA 2PMKA 1SKYE 5M04A 1X8KA 2C5LA 4Q47A 3SYNA 4TLDA 4Q1CA 2WWYA 2IYQA 2IYUA 1T3SA 2YYZA 2A5YB 3CX7A 5FTKA 4CVNA 5J4VA 3QE0A 3EPLA 3DZ8A 4Q4AA 2C03A 2DFKB 3KQHA 1FOEB 3A4MA 5FPSA 2MSCB 2C78A 5D3MA 4EDHA 3ZVLA 3I32A 4E09A 3EPJA 4Z8XA 3BE4A 2BMJA 3DKVA 1VYVA 3U7FB 1QRAA 1G7TA 2LWIA 2RH5A 4B32A 1G5TA 3N5CA 1Z0JA 3U3OA 3D31A 1T8UA 2QPAA 3L2OB 3QF4A 4JL5A 4Q4JB 1T8TA 4BE7B 2AXPA 3L0OA 4D0NA 2J46A 4NU0A 5G3ZA 1F2TB 2EFCB 3IO3A 1XD2B 1SXJB 3VNUA 4L15A 1VHTA 4MKIA 4H1UA 2ZUCA 1BO6A 2DWOA 3KKPA 4GOJA 5AR1A 3R9XA 4JT2A 1T91A 5KHOC 1XZQA 2AFHE 3HPRA 2B8TA 1P2UA 1EWRA 3MLEA 2XSZA 2PZGA 4Q00A 4NYMR 2V1UA 2C9CA 4XJXA 1N6HA 4LJAA 1M8PA 1JAIA 3AP3A 1XTRA 1G20E 1KK1A 1J70A 3AP2A 4R98A 3W34A 1KO8A 2OUKA 1L4YA 1A82A 3B1ZA 4M1YA 1M74A 3U4QA 5FOTA 4AIIA 2ZRFA 2IK8A 3AVOA 2VHQA 3T12A 2XZOA 3WXMA 5JCZA 3MCAA 3UMSA 1Z83A 3EXAA 4Q19A 3RANA 2QBYA 4ILEA 3LBHA 1RYFA 4JYCA 1NBMA 1AZTA 4G1UC 1G3MA 4QBFA 2ZAOA 3CF6R 2V9PA 4B74A 3TW4A 2QEQA 3Q5EA 1S96A 4UJ5A 4NONA 1ZU5A 4HZIA 4ON9A 1ZUIA 5IK2A 1ZYUA 4NMMA 4V0ME 5IRCD 5TB5A 2XB2A 1AJEA 3ADCA 2B21A 2WZQA 3W8NA 4DEXA 1N5IA 3BH6A 1CIPA 2IXFA 4US2R 4O0MA 1DS6A 1Z47A 3ADBA 4Q9IA 1GTVA 1SHZA 4B47A 2FFQA 3JZMA 4OJQA 5GJWC 3FHOA 4LJYA 4M53A 1SVKA 2ZE6A 4TSFA 2F3RA 4TT3D 3F8TA 4WXRA 5TVKA 1E69A 4LOAA 4GT1A 1KDOA 4KVGA 4NYIR 1VG1A 4ZV4A 2ERXA 2GESA 3QEOA 2IYYA 4EKDA 1EFRD 1U0LA 2QTVB 2GKSA 2O8EB 2FE4A 2FX3A 4IVQA 3OE7A 3UANA 3OEED 2GTPA 3KQUA 3VKWA 4V0MA 1Q3HA 3T5GA 4TLAA 2QN6A 5FOWA 1HE1C 2ZRBA 3I3SR 4A0GA 3KQLA 2FMXA 3P32A 1SHKA 1I2MA 1U99A 4IW3B 4HAZA 4DC9A 1AIPA 5JWOA 1KI1A 2FFHA 4Q7LA 3ZDQA 4HDCA 4HEJA 1J90A 5G40A 1KGDA 2BCJQ 3IEVA 4MITA 4F38A 4C2UA 4EIWA 3LBIA 1L8QA 1HA3A 3FGNA 2OG2A 1R0WA 2QE7A 3I4LA 3A1VA 4CGZA 5J4LA 3UWKA 5H1YA 1KDPA 3LVQE 3IKJA 4RD0A 5HE8A 5EE3A 2G83A 3RC8A 1U0JA 2QSYA 4C30A 2ZJ2A 2CJWB 5TV2A 3TR0A 1UEJA 2PJZA 1G41A 4NYJR 1OSNA 2PX0A 4JL8A 4OBEA 2GRJA 2JLQA 5G41A 2K5UA 3MRSA 5KDDA 1BIFA 4Q1EA 4XVQA 1G3IA 3IPXA 1E9DA 1XF9A 1WBDA 4MH0R 1N3BA 4PHGA 4M0LA 4X8HA 2NTYC 1KSFX 1RW4A 3RRZA 1KNQA 2WVJA 3CUEF 1CRQA 3LFUA 2ZYVX 3L8ZA 2ZR7A 1OYYA 4HLUC 3ZIAD 2ZR9A 2ZU0C 3RSOA 3F0TA 1QHHA 2Z83A 4PSKA 2IUTA 1FMJA 4PTLA 1Q44A 2NOAA 5BWMA 2ZI4A 3AVYA 1XFAA 3T1QA 1NN1A 3AF2A 1OE0A 4Q4HA 4B75A 4MDEA 1SKQA 1QDEA 3DPUA 4YDSA 4P32A 4TYWA 2JLYA 2HLDD 3RS5A 2J0SA 4BFWA 2ZRMA 4QBHA 4PR0A 1JI0A 2QL6A 2C95A 5FUXA 4QM7A 4EJSC 4DBLC 4FN5A 1U90A 1UDWA 2ZRKA 3LNCA 3LX8A 2JLZA 4EUNA 4MQBA 4GI7A 3F5FA 1I4DD 5FOUA 4QHSA 3GMTA 4BEBA 1KKMA 1E99A 1E4YA 2ORVA 2H5EA 1W5SA 4GP6A 4QHYA 4EFNA 5CK5A 3VR2A 1BMFA 1ONBA 2IEZA 2ZRDA 4HAUA 2VBCA 2YVUA 5BN5A 1A4RA 2QAGB 4Q01A 1G5PA 2GZHA 2RKOA 1GKIA 1GFIA 3NBYC 4RKEA 5DO9A 1FMLA 3UATA 3K70B 1JXMA 1KI6B 3QEJA 2Z43A 2NGRA 3RS7A 2KBFA 1W36C 4DLRA 4HI0E 2OAP1 5EE0A 3TAHA 2Y8EA 1J2JA 1CR0A 1E2LA 3PG5A 5DISB 3A1UA 3VHLB 3QBVA 4PAOA 2IWHA 1G18A 2G9NA 3VR6A 2XITA 4Q03A 2RGCA 3PUYA 3GJXC 4JLBA 1Q1EA 1ZW6A 5EP1A 2CHVA 5FTMA 3GLFB 3NEYA 1QHXA 2H16A 3FMFA 2VP6A 4NYMQ 3QSYA 4FMDB 4B6FA 1F2UA 4D80A 1KK0A 3EA0A 1Q20A 4IOLA 3VKGA 1FW6A 1GUAA 3TUZC 1VKJA 3PUXA 2DBYA 3A8TA 2DR3A 2VSOA 1NJGA 1R2QA 4LC0A 5AJXA 2JCSA 2ONKA 4PPQA 5J5CA 2ZS9A 4DWJA 1YZTA 1VYTA 1KI4A 2IHYA 1YVDA 2J41A 4Q9HA 5F9HA 5KU1A 1CR4A 1J8YF 1H8HA 1ZM2A 3MWJA 2WJYA 4DLZA 5HZKA 1SXJD 5IT5A 1TF7A 5KUTA 3AH8A 1N0VC 3G0HA 2AKYA 3GJ7A 3LRPA 4PQRA 2PEZA 4LGMA 5TY0A 3T1VA 1EWQA 4LSGA 5CK4A 3DM5A 2C99A 4LHYA 3OEHA 2VHUA 2W6ID 2H1LA 3KXKA 4DUGD 3G5UA 2MSEB 3DOEA 4RSGA 1W4CA 3KFVA 3SHWA 1R4AA 4Z1MD 2IW3A 3WHLA 3VU9A 2O8CB 2H57A 4MGKR 2NO6A 3GJ5A 1ZMXA 2ZUDA 4A9AA 1PLJA 1YHNA 1MABB 2J87A 1E3MA 4IJMA 2D3WA 3M0EA 1KJYA 5CB6A 2AKAB 2UZ3A 4RZ3A 2VL7A 4P4SA 4HLQB 2A7QA 4B6EA 1HY3A 2VSFA 3LW7A 1S0UA 4NYIQ 5DI3B 2GJAA 1BS1A 3R7WA 1RE0A 2F3TA 4YC7A 4AWXA 3VQTA 5CB8A 2ZI6A 4G5QA 3W5IA 4LHWA 1T5LA 1IONA 2J0VA 1TL7C 4OK3A 2ZITA 3D3QA 2ZJAA 1GSIA 1BYIA 2WKPA 5C18A 4RD2A 3W6PA 3KTAB 3PITA 3RWMB 5JZVA 5J4HA 1JECA 2DFNA 2ODBA 5JI2E 3WYFA 1OFHA 2EWVA 4C0JA 5C46F 4HDQB 2GJSA 1US8A 4C7OA 5EZ5A 3P4YA 1NSTA 1JR3D 2ZYUX 4M1SA 3NKVA 5H70A 3X1YA 2GEDA 4UNQA 3B9PA 3CPEA 2F43A 2ORWA 3QVUA 1X6VA 4Q5IA 1TQDA 2EYUA 2HCJB 2D62A 4BUJA 4U7DA 4P0TA 5AUPB 2IS4A 4D0LB 1S9HA 1M7BA 3AVPA 2O0JA 4ERNA 2YWHA 3TR5A 2C04A 3PUVA 2FFAA 5DN6A 3EZ7A 2IS6A 1T6NA 3NG1A 4NYJQ 1KDTA 4IEIA 2REXB 4E07A 2O8DA 4B3FX 3MMPA 1E1RA 1NJFA 2ZU6A 2G88A 5E4FA 3GJ0A 2IYZA 4D6PA 1XXHE 2CLCX 2PEYA 4IDPA 1W1WA 2ZRGA 1OXVA 3FHTA 1T3LA 4FWIB 3EZ2A 1IY2A 1R5BA 2X2FA 4PC2A 5FL7D 4YMUA 2YOGA 1OB5A 3SZRA 1E0SA 2WSSA 5SZIA 1LNZA 4MRNA 3FMIA 3BIFA 5JS8A 1OFUX 4QBIA 1K5DA 3B2EA 5HKKA 1PV4A 4TQAA 1EESA 3IHLA 1KJZA 1I4LD 4C0AC 4PC7A 4KBGA 1IQPA 2EFDB 2X77A 1YQTA 4AYXA 3ICEA 3IUYA 3THWB 1CEEA 1D2MA 3KB2A 1YRAA 6Q21A 1DAHA 1W2HA 1VTKA 1CS4C 2ATXA 2G3YA 4TYYA 2A9KA 1XXHA 4D82A 2G0TA 2O0HA 1Q1ZA 2P5SA 2HF8A 4II7A 2XTZA 3CZPA 4J0QA 1G291 3L82B 3HP1A 3T5DA 3HDTA 3C16C 4B43A 3HU2A 3EWAA 4QFMA 2A3RA 2UKDA 4B3DA 1LVGA 1D9ZA 1G21E 3C4JA 2IA5A 2QY9A 4JBWA 1NG9A 2NO7A 2QORA 3A1WA 1H8ED 2YC2C 3IEUA 4OYHA 3ZD7A 3ZLJA 1Z6XA 3Q8XB 1KSHA 1MRSA 1VG0B 5E95A 1E79D 1OXTA 1HTWA 5FBWB 1RJ9A 3GQBA 1G3UA 3QQ5A 4PO1A 3TLXA 1M6NA 2GA8A 3IO5A 1DELA 1UBGA 3DVLA 4HB3A 4BLTA 1OXXK 2KI5A 5E7JA 1WBBA 1DO2A 1II8B 5IF9A 3LA6A 1FX0A 1IY0A 4EQ6A 1ODFA 1O3YA 4AI6A 5AWFC 2NO9A 3TVTA 1IJEA 2QRZA 4JLKA 3W9YA 2EWWA 4MYHA 2JJ1A 2OCBA 2ZYWX 5B64A 2ZE8A 4BQSA 1E98A 2YNMA 4HUTA 4ZDWA 3GFOA 3VR3A 1DBSA 2WIAA 4BFSA 5E3HA 4CEIA 1KHTA 4I1UA 3K0FB 4ZCLA 5KSYA 3K9LA 4HYYA 3PV0A 1VPLA 4HZUA 1N6IA 1XNJA 2JIZA 1QHYA 2QMUA 1CF4A 3DOFA 5AK0A 3THXB 3QBTA 4NE2A 1XTIA 1OH6A 1JJVA 1W0KA 5AJYA 5J47A 2O52A 2VIIA 2WWGA 4URXR 1N6KA 1UKYA 3K70D 3NTUA 4ZI3A 2NZ8A 3BRWD 3SHFA 2WAYA 2XNSA 2O8BA 3Q7PA 1L7VC 1IOZA 1G16A 1FTNA 2WPDA 3DM9B 4R2HA 2BBSA 3WNCA 3U44A 1IN4A 2B7BA 1S2MA 1GWNA 5BYKA 3SBDA 2BMFA 4GBMA 2FEOA 3R9IA 1KO7A 5FTLA 1P7CA 3X1DA 1TX4B 3EPKA 4X8LA 1E9EA 4Q4AB 1G1MA 2ZI9A 1Q0UA 2QROA 3K9GA 5DLQC 3VFDA 2WTUA 4ASUD 3ZJYA 4JLVA 2EW1A 2GF9A 4IHQA 1JALA 4XSHA 1E2EA 4B71A 4LPSA 4QXAA 4OI0A 3AVUA 4O2LA 3MWLA 4XWAA 4QBGB 2W58A 1AS2A 1JXOA 3CRMA 5J4KA 5HPYB 3JZAA 5A0FA 4A0FA 3W8RA 1G3RA 3QXXA 3UKDA 2HUPA 4FWTA 4KLZA 1SKYB 2GXSA 3FKSA 1ZCAA 4HLUA 1G8YA 4IFEA 3AUXA 1B23P 2F6RA 1G8HA 4CIDA 4LDJA 5FUYA 3GLIB 3DMNA 4V03A 1IXSB 1WA5A 4JLJA 2J3EA 1OHHD 1R0YA 1SXJC 3QI2A 2J7PA 4RVCA 4RZ2A 3SDZA 1PZNA 3AKCA 4OHWA 2OZEA 5JWRA 2OCPA 5LD2B 4MYCA 3AKEA 1F60A 4QGAA 4EJSA 3ONWA 2WMOB 3MG9A 3OFNA 1ZM4A 2ZRAA 2V7QA 3VAAA 1XPRA 1F48A 2YWGA 4I4LA 4U5XA 1O87A 3I61A 4HAWA 4M22A 2I4IA 1TEXA 2GAOA 3U4QB 1NMZA 4LY6A 1NRJB 5B58C 1K8RA 5DIFA 4HUQA 3SEAA 3UMFA 3O8BA 3SI7A 4C0KA 1Z29A 4RKFA 4TZ0A 1W4RA 2AD5A 5FTJA 3SS8A 1G8FA 4DJTA 1ZJ6A 4KFTA 2GK6A 1II0A 4DHEA 4JS0A 2QBYB 2GBLC 3ZGXA 1KI7A 3TBKA 3CIOA 5L3SA 1ZNZA 4ZDKA 1MH1A 3QPUA 1HQYE 1GNPA 2A5GA 5CLQA 1RFLA 2FPLA 2OM2A 1G19A 1DAGA 1NKSA 3CRRA 4JVSB 3H1TA 2ZE5A 3E70C 3G82C 4HB0A 5C4MA 2NIPA 2JASA 1YJ5A 3ZZ0A 1VCIA 2OO7A 2ZAMA 4DCVA 1OH7A 1GNQA 2AD1A 2VHCA 2CLSA 2IYXA 2BKEA 4KYUA 4TTRA 1P2VA 2Q21A 4DCSA 1X8JA 1VCNA 1NLYA 3Q9LA 4UJ3A 1QBKC 4KFSA 4LZZA 2PZFA 1E2IA 1MKYA 1COWD 3IHWA 3Q72A 2VP0A 2JLSA 3IIKA 1U9IC 3MSXA 1KI2A 4DLVA 2C77A 3QXCA 2PMDA 2W2VA 2QSZA 2KJQA 4LK2A 5K8LA 2XXAA 3AF3A 1XD9A 2JDID 3PEUA 1XJ0A 3U3KA 1T0JB 1P73A 3RNLA 2WSMA 4EPWA 2QMOA 4D4MA 3OAAA 3RWOA 1OIVA 3ECCA 3SYKA 4B3BA 4B2PA 3LV8A 2P6NA 3SU8A 4ARZA 4BASA 2UZIR 1Z63A 3I92A 3X2SA 2BJVA 4YXWD 5BN4A 2VHTA 4JYBA 2HXSA 2RCNA 1KY2A 1YR6A 4IOJA 2F7SA 4EAQA 2CK3D 1CR1A 2AK3A 4PQFA 1N2CE 4A8JC 1OPXA 3IGFA 4W7SA 1TEVA 5FBQB 2IXGA 4A6PA 1HUQA 1GITA 4KO8A 4TN1A 1EX7A 1CBUA 2GJKA 1PJRA 3HWSA 4EPYA 5F3WB 2DWPA 3BXZA 3LY5A 2VEDA 1Z3IX 3CZQA 4LWZA 2QGZA 3LW8A 4KCGA 5FPHA 1KMQA 1RRCA 1Z28A 2ANBA 2HXYA 2PCJA 5KSZA 1OV4A 4E22A 3T34A 4AG5A 2E1RA 4RFSA 1P9RA 3BFKA 2AL7A 2R6GA 5JI3E 4TL9A 3R8CA 4Q4HB 2D4HA 2GXQA 3HU1A 1YZUA 4W5HA 4WIAA 2ODWA 3T06B 2N1BA 3ETLA 3BD9A 1L4UA 2V55B 4OI4A 2GCNA 1YR7A 3WRXC 4IVPA 2V8OA 2ZSFA 4ESVA 2H92A 2JGNA 4JKYA 4M1MA 4TT3A 5HZHA 2BM1A 4AYTA 3PCRB 2GJ8A 3C5CA 3O8RA 1YZGA 4OHXA 3LLUA 1OFIA 4UNSA 1KI8A 1E4VA 2B92A 5F2EA 3C7KA 4LJ8A 5F9FA 5GJVC 5AJVB 3ND8A 2JAQA 2WBLC 4O25A 2BEKA 4N0DA 3OEEA 1SVIA 4I1OA 3NBFA 1T5IA 3QY0A 2FZ4A 5FUVA 1KAGA 2QAGC 2ZIAA 1R8QA 2R6AA 1SVLA 1GDDA 4PO8A 5TARA 2GAAA 2G6BA 3B13B 1TQ2A 1XMVA 1EFTA 3LBNA 1S3SA 2ZS7A 4HATA 3NVAA 4D25A 2OXRA 3BJIC 2I3BA 4URZR 2AXNA 1NY5A 4OHZA 5L3VA 4JLMA 421PA 2DYKA 5JSZA 2OFWA 2CBZA 3KJEA 5EP4A 4AG6A 1KNXA 5GJCA 4Y0AA 2BOVA 2FU5C 2CEAA 1IAQA 1IM2A 1E94E 2IUSA 2IHBA 3NXSA 2CCJA 1GL7A 5J4YA 3V9PA 4US1R 4DVGA 1J8MF 1F2UB 3I8SA 3LXXA 2BC9A 1E0KA 4TTPA 2WOJA 1AM4D 2ZUBA 3SR0A 3AF0A 4LYJA 1II9A 3ASYA 4KI0A 1V5WA 1JJ7A 1TF2A 2HDNB 2ZSAA 3D7MA 3EIEA 2YZ2A 2IF0A 1RKBA 4Q18A 2QP3A 4P3YA 2HF9A 2Q3HA 2VTKA 1E2MA 4FCTA 4LYFA 5B2ZA 1DE0A 2B8WA 3QOFA 2BDTA 4ESHA 4IDOA 2PT7A 2PZEA 3C41J 4ZIRA 1P3JA 3B8HA 3BB1A 3HPQA 2B6HA 4JL6A 4RZUA 3ZIAA 4CW7A 3M6AA 4DCUA 2GEVA 3CX8A 1E9BA 3WBJA 2UVQA 5B30A 4NP6A 2XSZD 3GJ3A 2HT6A 2ZRIA 4WZ6A 3SE0A 2RGBA 1IN5A 3IBGA 3VU9B 4TL7A 4D4LA 1ELOA 3FKQA 4MYUA 3TE6A 1KO5A 2BBTA 1PUJA 4LJ5A 3VHXA 1DVRA 3OIUA 1JPJA 1XX6A 3P27A 3S1AA 4N1AA 3TVDA 3GEHA 4Q48A 1GL9B 1NI3A 2OT3B 4DLUA 4Q1BA 2IBMA 1P4SA 3TUIC 3IPYA 3BFVA 3B7GA 3OIVA 3R7WB 4M9XA 3GJ4A 3M4YA 1NBMD 1WQ1R 2ZSEA 4L16A 4QRHA 2P5TB 3HJNA 1DTSA 1LTQA 4XOIA 1Z6GA 3TQCA 4GOKA 3QVVA 4GRAA 5A4JA 2YWEA 4Q1DA 1NLFA 4DKXA 5SZKB 4Q9LA 1AS0A 4A92A 3LO5A 4JBXA 3L0SA 3RDPA 1EG7A 1N6NA 1US8B 1N6PA 3OZXA 4C7OB 3DMDA 2XTMA 3K0SA 5FBLB 4NPHA 1FP6A 1SXJE 2F43B 2ZRPA 5JRZA 2E87A 4D4JA 4AK9A 5JJKA 2VP5A 3GLGB 3M1IA 1Z0IA 2RAPA 3EZ9A 2XZPA 4TLCA 3RSLA 2NQ2C 4UKDA 2XEXA 4OHYA 2BCGY 3OE7D 3QXSA 4EPVA 1FUKA 1FUUA 5KPJA 2J5XA 3LH5A 5SZHB 1HV8A 1NSFA 1R10A 2BJWA 2N42A 2Q3FA 1PLKA 1A5TA 1LB1B 1G6HA 4Q4JA 5EQTA 3CF2A 2C2HA 3MJHA 3A4NA 3K9NA 1ANKA 3EA5A 2QMHA 4URVR 2Q9CA 3QNUA 1GNRA 4ZKEA 4G5OA 4KBFA 2FGJA 2XNDA 1JBKA 1XEFA 1M2OB 2YWFA 2QE7D 2F1RA 1XEXA 2DHRA 4B2IA 5DGXA 1LF0A 3NWJA 4PPFA 1KI3A 2QNRA 4FMBB 4KFRA 4HLDA 4LJ9A 2HJVA 4LX0A 1KYIA 1NL3A 4NZYA 2W2XA 3U60B 1GILA 2ZROA 3IIMA 2ZJBA 2IS2A 1W47A 3CRW1 2G77B 5JFGA 3CNLA 1CKEA 3FHCB 2ZJ5A 3CR7A 2GBLA 2J45A 821PA 3MWKA 4HB4A 4LBZA 2FGKA 1JR3E 3TKLA 1RYHA 2BKUA 4C9BA 1AN0A 2QMEA 3A6PC 1IN8A 1ZCBA 4QG7A 1OH5A 2AWNA 2IS1A 3BORA 1X1RA 1N6LA 2C9YA 1WE2A 4LYAA 3EX7C 3OESA 4C2TA 1P62B 3NBZC 4ZDIA 2R6DA 3TSOA 5JEEA 4WA7A 2NO0A 3Q3JB 2L0XA 1Z08A 3MD0A 3U7HB 3KXIA 4PAMA 2FZLA 5GVRA 1RJ9B 1WB9A 4NKRA 3H4MA 3FB4A 1GRRA 3U7GA 1T3HA 1FX0B 4UQOA 2CE2X 4EQ6B 1AS3A 4RY2A 4DIEA 1YRBA 2D7CA 1NVUQ 2WHXA 4DDTA 1Y3AA 1JR3A 4CEHA 4KU4A 4G5RA 2EQBA 1IXZA 4NCNA 1QG4A 1ZNWA 4MUAA 4LJ6A 5EXXA 2OFXA 1MR3F 2FH5B 1E9RA 3K53A 4CEIB 3CPJB 1Q1BA 1KSJA 1U9IA 1NF3A 1WMSA 4HZUB 5KDOA 5CLLA 1QZXA 4I99A 1IBRA 4KAXA 4F4IA 3GD7A 1DAFA 1VMAA 4QGHA 3Q5DA 4V0NA 2ZSDA 3W90A 1U8AA 4LUCA 4PHHA 1XCPA 1WDTA 3AVQA 4Q7KA 3RYTC 1N0UA 2O8BB 4BPBA 4NCJA 4RCYA 3U44B 1YU9A 5AUNB 1IN6A 2QI9C 4G0NA 2Z5FA 5JMTA 1CXZA 4PSAA 3TMKA 1HE8B 5G53C 2CXXA 2VO1A 2OEPA 2WIBA 5FPTA 2PL3A 1BKDR 3A58B 1MO3A 1FP7A 4XTCS 5FR1A 4A8JA 3SJZA 1E2DA 2N46A 1CJTC 4JIMA 2A2ZA 1GRQA 1Q1QA 1XTJA 3BS4A 4OL0A 2ZRCA 4DIDA 2A5FA 2QUZA 4Q9JA 3TUJC 4AKGA 5HE9A 2NO1A 1TPZA 2JEOA 2V1XA 1E96A 2WJJA 1EX6A 4Q66C 4QL3A 5DI9A 1E1QD 4B3GA 1KMHA 2R8RA 3B60A 4AKEA 2AHOA 3UG6A 1W0JA 3TW8B 2CL7X 2FSFA 1H8HD 2OHFA 3QPWA 4BLQA 3HYRA 2CHGA 2OLJA 4MUBA 1KDRA 1HEIA 1M1YE 1YZQA 2DFTA 2Q9BA 5FH9A 1QG2A 1ZD1A 2HJGA 2IUUA 3VR4A 3SOPA 4ABYA 1Z0KA 1FNNA 5LPNA 4MDFA 3NEJA 3T61A 3P4XA 4OHVA 1UKEA 2WKRA 3TSZA 1CJMA 1P61B 2WJVA 1UBEA 2Z0MA 1E6CA 4DCNA 2PJRA 2B7CA 4KV9A 4KFUA 3SFVA 2WV9A 3LDAA 3ZQJA 4O2RA 4IFBA 4XSGA 4BZQA 4V0OA 1MO6A 4KVAA 4XVRA 2IEYA 4HB2A 4HAVA 1G7CA 4LV5B 2DY1A 4ZKDA 3MWYW 5JWHA 3NDBB 3ICQB 2CNWD 4HUQB 2X1VA 2ONJA 4RJLA 3ZH9B 4TWZA 5EZ6B 2IT1A 4DSNA 2ZJ8A 4URUR 2MMCA 3BAFA 2QAGA 2QP9X 4OI2A 2VSXA 5HCIA 1I4TD 3MFYA 3I5XA 3GLFE 5BN3A 1ESMA 4BFUA 4MRPA 1LY1A 4YMWA 4Q7JB 1JQLB 1W36B 2ODNA 1PVOA 4E5UA 2G0NA 3EIQA 3WMFA 4ZPXA 1ZIOA 4F93B 3NHBA 5IHPA 3HR7A 3SJAA 1DOAA 4FCVA 1CR2A 2FOLA 1U0HC 3PXGA 1ZP6A 4BFVA 3RAPR 2ZJOA 2WJIA 3QXHA 2JJ2A 4IXMA 5TXGA 3LWNA 1SVWA 2Q3MA 2ZRHA 3FE2A 3FFAA 1NNEA 1X3SA 1FL9A 1Z2AA 3GJ8A 4B34A 1E2NA 5EP3A 4ZI2A 2CCGA 3QKUA 4WVFA 5FOVA 3B9QA 3ZS8A 2IYVA 4BRUA 2W83A 4CF7A 2ZPTX 1AK2A 4FMCB 5FFMA 4B73A 3GLFA 2WWWA 4ASUA 4P31A 5AUOB 1R5NA 4K46A 3VX4A 1AQUA 5FR2A 1DO0A 1LF5A 4JVMA 2OESA 3QF7A 1N25A 2QP4A 1RIFA 4LBYA 1IY1A 1OKKD 4D81A 1TU4A 4A2QA 4A6XA 3B82A 4DZZA 4OI1A 2FSGA 2KSQA 2XXAB 1N5KA 4KODA 2V54A 1NIJA 3EWSA 1JB1A 3W5JA 4B44A 1U98A 3UPUA 3QJYA 2YJTD 2WSSD 3PR1A 1SVMA 1P60A 1R8SA 5LB2A
chains in the Genus database with same CATH superfamily
3KM0A 5KMGA 2CMHA 2DKOA 3OQNA 4URFA 5HKKD 1CULC 1DCTA 1DAPA 4HLNA 1PUIA 1ZVKA 3TIVA 3I2GA 2Q3LA 2FN4A 3L1VA 4HDSB 4AKSA 4OHPA 5ADHA 5KINB 3FVVA 4WFIA 3KOWA 1EFAA 3B5EA 4MMZB 4E1VA 1MAVA 1SFRA 4DRXA 3FZGA 1TYAE 2PSHA 1FJGB 2XUIA 2NT4A 2V6GA 5KNCH 1XDDA 1EB8A 1CTQA 4DA6A 1EE1A 2CLKB 3AJRA 3STVA 3G7SA 1X1CA 2D2IA 1CY0A 1V37A 3DMTA 1TNDA 1RRGA 3JAKB 1CQIA 2D2FA 2D1QA 2P90A 1B0UA 2YRXA 4HBGA 4AUEA 4JOCA 3QWHA 4XPZA 4Q7MB 2ZT7A 4UHFA 3Q6IA 1RR6A 5KOHB 3EFOB 3JQ7B 3FMPB 3V00A 3VGPA 1KIAA 4QRDA 4A2WA 2XIJA 3IBCA 2QKYA 1LKZA 1PWXA 4FC7A 3RHFA 3RRJA 3ZTYA 5HF8A 1ADYA 2QJTA 1MJFA 1M1ZA 3DCYA 3IUJA 4K86A 4U7HA 3WC4A 1V41E 4BLUA 4MQFA 3CA8A 5DM70 4MGIR 3QU7A 4RK7A 1HOTA 4KN8A 5EY5B 3VR1A 3ZGZA 4NU8X 1QE3A 1VG9B 3SQXA 2CJPA 3JARA 1ZNXA 2W6JD 3K5IA 3KQKA 5F7OA 5K3BA 1F8FA 1NMXA 1SZCA 3LPDA 4BBAA 2G9UA 1P1IA 2DQYA 3MS2A 3VPCA 2CL5A 1UBCA 1SZJG 1PWZA 1ZHOA 3DH0A 3ABRB 2QUIA 5DU2A 4QQFA 3RBAA 3RFUA 3A7EA 3IPAA 2CLLB 1YDFA 5JCJD 1S4QA 4EW2A 2ZTUA 1BXKA 1C0LA 2EHDA 3B6EA 4D26A 2EEPA 4FGLA 2YIJA 2VDWA 1GPLA 4EG7A 4KXXA 2YMPA 3UN1A 2QGNA 3ZXIA 5DF1A 1SBZA 1YMQA 2PZMA 2YXLA 3PWKA 4KYIB 4U3JB 2HLNA 1WW2A 3JQFA 4DCPA 1UFKA 1NVEA 4TMYA 3ICVA 4Z8YA 3NATA 4GBJA 5TQ0B 4DR1B 3GLSA 4S0XA 3ROTA 3SN6A 2HZBA 3U4AA 4D43A 2Z98A 3KAPA 1CJSA 2BHRA 3LCJA 1DWQA 2XB6A 1TVKB 4QDOA 4E1BA 3Q6NA 3A9SA 3DBHA 1PKXA 4RSHA 1T2VA 3RYFA 3CZRA 1P7PA 4NS1A 2IYRA 4KBYA 1UFVA 1NRXA 2JDIA 2YVQA 5BWBA 4UREA 1WCV1 1TJNA 4H7EA 4A1OA 2H5IA 5CDGA 5LBUA 5G0UA 4A36A 4E4YA 2X5XA 5ELXA 3DE7X 3VISA 2QXTA 1URPA 2YWDA 4WK0B 1U9YA 4QYSA 4BMNA 4BLOA 2JFYA 1TD1A 3KVNA 4G1FA 4EYGA 5JSZB 1O58A 3GFRA 2A92A 3DFZA 3COYA 3S27A 3VMMA 4CT5A 4P3OA 1E20A 1GGNA 1ILEA 2W0MA 1NBEA 3HL4A 3NBXX 3ENZA 1T9ZA 3K9WA 4B3CA 4KPEC 3B78A 1RLTA 3KKEA 3CZMA 3H9BA 2PXXA 2HLHA 4KQ6A 1KL7A 2V9CA 5AOAA 5LU9A 3LX5A 4F6CA 2RB4A 1EE2A 4EA8A 2FDCA 1SQGA 1W93A 3O8QB 4FGWA 3DP9A 3FAZA 2YCBA 5EE9A 4B31A 5E1DA 3C48A 4KQ9A 2FJUA 4L08A 2XZLA 4PNEA 2QUAA 1FNBA 3C7TA 5TRTA 5G1OA 1IEQA 2X13A 4M6WB 4PN7A 1ZOSA 4V0LA 2F1HA 1J2RA 3TI9A 4HYTA 3VMFA 2PMEA 2G71A 3M81A 5JS6A 2FXIA 1FDVA 2HSWA 3GP5A 5FADA 4HNTA 1X2EA 5TPZD 3WYCA 3LGXA 5CA1F 1OH8A 4FYKA 2LIPA 5D1HA 2YWRA 1J5PA 4TTQA 5ARCA 1YI8A 4WZBE 2NXEA 4QAJA 5LLSA 2BMEA 2D06A 2WWHA 3KZKA 1ZESA 3KKNA 4HFRA 2AG5A 4HNRA 1VI2A 2CKDA 3RV4A 4ND7A 3ZHRA 3KCNA 4LI0A 2HV8A 3PC2A 3TZCA 3OFJA 5JVDA 4TRJA 2Z3WA 2NQ8A 3W3AA 5EC8A 2X6QA 3H11B 5HDBB 1XPUA 1WX1A 1QFXA 4OQQA 3CX6A 4BB6A 4UASA 1YRLA 2W0SA 1K89A 3RYHA 2GXUA 3TSCA 4EB3A 4G8DA 3M7IA 3QY9A 4JELA 5CUQA 4G0XA 4WZZA 3LT2A 2JGEA 1U7WA 4XRRA 1AQYA 4Y9UA 3S1AB 1T8YA 3LOUA 4YUWA 3SVTA 5LXTF 2QVYX 2AFIE 3VU3A 5CH8A 221PA 4YRAA 4NESA 1Q91A 4M1WA 5HJ2A 4EFLA 2R4QA 3DKIA 5T4EA 4EHJA 4HH3C 1ESEA 1XB2A 3HNOA 2UVPB 4Q3NA 4BE9A 1Q11A 2IDJA 5AJUA 2XE6A 1MO2A 1JV2B 1LI7A 1QGED 5B3LA 3KZXA 4UHJA 1GA6A 4MW2A 1F9AA 2XRMA 1LZLA 3UHOA 1XU7A 1UKAA 2CWDA 5DIZA 5AVUA 2X4IA 1GPBA 2W2NA 1U6JA 4UUPA 2DR2A 3NWPA 4RORA 3SBEA 2CLDX 1P9WA 3D4IA 3PPWA 1F6BA 2YOFA 3PHIA 4R6WA 4INJA 2E37A 2WM8A 3UAZA 3U61B 1QUEA 1E1YA 1NDUA 5E3JA 1P29A 1FY2A 3O8DA 4NFLA 4R1PA 4ZVVA 1Z07A 4YJ2F 1WMFA 2E4WA 3SFZA 1KAEA 4HMPA 2DWQA 2RHJA 2P9QA 2J33A 3HCPA 4I3GA 4WN9B 3FCYA 1HDXA 3GLIE 3SD7A 1U3GA 4YWJA 4JIGA 1F8XA 1ST2A 4L0CA 2GWHA 2WAXA 1Z0AA 4B84A 2HRBA 1ZHHA 2XXJA 3QBEA 4NTZA 3QENA 4QM6A 5F2OA 4JH0A 1OPRA 3MJTA 4J2HA 1R74A 3JYOA 3BC1A 5F4BA 1Z35A 2H31A 2C9OA 4G8BA 4I5FA 4JQYA 4X8MA 5EINA 3NI2A 4YGYA 4W9NA 4DF3A 2J59A 2VH5R 4P5EA 4DV7B 1NUHA 5IVPA 4FFMA 3G5TA 3GVHA 3A37A 4BNGA 3IQXA 4XWOA 4LTNA 1YS6A 2XEDA 1M5UA 2Q49A 3PKIA 3EC2A 2FPGA 3UENA 4EFMA 4XIGS 2GM4A 2WM3A 4DDWA 2QVGA 3EEOA 2Z95A 1MAUA 4H7PA 5TQVA 4F9EA 1L5NA 2IU4A 4XIYA 4DXDA 3FTEA 3K0CC 3VX3A 4KMMA 5LLDA 1IUPA 2FSPA 3GLHE 3I4CA 3JWGA 3TCKA 5IFLA 3CVVA 1TLLA 2PAFA 1V3UA 4KWCA 2B4YA 2M2IA 5EZYA 5KC9A 3S55A 2AX4A 3TYXA 2QWXA 1YL6A 1RCFA 3TQRA 4MKGA 3LO8A 1YKSA 2P9BA 4IG9A 1HBJA 3NV7A 4LCBA 1GFWA 3OPQA 3Q7RA 4DLLA 2ZETA 1QLJA 3IDFA 4B81A 4F2GA 2VYFA 3NONA 2PVCA 3QX7A 1ACMA 1N75A 4X1OA 4Q02A 4QG3A 2B8JA 3DLTA 1R6TA 4KE7A 4TYNA 3RKUA 1BWRA 1YZNA 4GXQA 3TPFA 4RJKA 1CQZA 5DLEA 2BT4A 1A9TA 2RD2A 2IFTA 1CF9A 1JHUA 4DCTA 5FUWA 4EMSA 1EFVB 2YL2A 1NT4A 1UFQA 4ARCA 2YJ4A 1LTKA 2BMWA 2ERYA 3BIOA 4AZ0A 4G56A 4S1WA 3IQDB 3NALA 3UJBA 5JD6A 1P2GA 5G0SA 4LVUA 5JQGA 4YV7A 5KJ1A 1U5BA 5I9BA 2Q1TA 4OLBA 4NRDA 3C85A 1GUBA 1H0KA 1ST3A 3E9NA 2I7CA 4IXNA 2M98A 3OM0A 3UWOA 2W2TA 4ME6A 1N7GA 1JDPA 2FF5A 3CX3A 4QE3A 2LZ0A 4C7XA 4Z6KA 1GVNB 1T15A 1UBSB 2JI7A 2XXBA 2Z1DA 1G6Q1 1PJQA 2B7LA 3ANXA 3TLMA 3ZE2B 2QLFA 3UK7A 1XZPA 4NCKA 4L5IA 2PUHA 3PFGA 3SYTA 2MIIA 1FU4A 5HCUA 3NEPX 2FEAA 5CDHA 1E9SA 4CEHB 1OVMA 4F84A 1MA0A 2GEBA 2H4ZA 4DSZA 3C8UA 2I76A 2P2LA 3OPMA 4XSVA 3TZKA 3OLCX 1XTQA 2WWIA 3D3EA 1OX4B 4JN6B 3PZRA 3KZ1E 4L5AA 4R8KA 4UHBA 2Q07A 5G4KA 1FTQA 2CD9A 1SQ0A 3KDSE 3UXYA 4E5VA 4AQYB 2ZCJA 4EPRA 1WOYA 3MOIA 4R1LA 3RCBA 2XMDA 3ZC3A 5BR1A 1DWPA 3T1YB 2KLBA 4FFVA 4U0KA 4AP9A 2O2DA 3CKYA 2QENA 1ENOA 3AI1A 3D5TA 3D8UA 3RC3A 4R71A 3I2JA 3BZWA 1C8VB 1UPFA 3OLWA 3U40A 3QE2A 4LC1A 2ONYA 4I3FA 5HMLA 4C4OA 4DA7A 1KZ4A 4TS4A 3DKKA 1SGWA 5CCEA 1EFHA 4MPPA 2PIAA 3AI2A 3KYJB 4L3VA 3DDCA 4NATA 1GCIA 1LPPA 2DE0X 4CMIB 4E5PA 1FXSA 1LDMA 3SYLA 3KSAC 5HIKA 1CYDA 1DJOA 3MTJA 1KQGA 2YCLA 3M8KA 3W7AA 2VQDA 2VWPA 5TMBA 1E0JA 3L1HA 1N5LA 3OVMA 4L6AA 2A5DA 5AW2A 5A4FS 4J0FA 4O5AA 1X7XA 3UOAB 1ZHFA 5T41A 1LWOA 4UVEA 4WNCA 3ZXXA 5IK2D 5BV0A 3V7FA 2GZ3A 1KO4A 2ONZA 3B3GA 4JLSA 5A0VA 3KALA 1E2HA 4H4CA 1K8YB 3GDHA 4M88A 2OP1A 5KCMA 1XRMA 2GN0A 1JAZA 3U3ZA 4AVYA 5IASA 3O1LA 5IJ0B 3WAJA 3KKQA 2QN9A 2VTBB 2I0FA 4TSFD 3AKDA 3PNBA 3PUWA 2LR0A 3GRRA 4URYR 5FLEX 4Z3OA 4NCHA 2ZXUA 2W00A 4UPVA 4L5BA 4PINA 3WRYA 2V6JA 4WUVA 4HOYA 1CEXA 3TX6A 2AOTB 3PKZA 5ADVA 1HYEA 2H07A 3HKEB 2F59A 1EJ2A 2GZMA 1JE0A 2GYVA 4IKEA 5K09A 3O7MA 4L27A 1ESNA 4QU9A 2K7FA 1IY9A 1USIA 3TTSA 3ZWKA 4ZCPA 5ICSA 1NQUA 5ER9A 2AZ4A 3O73A 3ESXA 4EEZA 4ZEVA 3NMUF 3FTFA 1JZTA 1LS6A 1XPJA 1TEHA 1L7PA 1OI2A 5LWQA 1IHUA 2QL5A 1KKLA 1KR5A 1P33A 2DBVO 4N49A 4GI3A 4DMMA 1Y8RA 3KL4A 3D6TB 3PGLA 1F2TA 4PQYA 1BAPA 1OBCA 1JDBC 1EXMA 1U81A 1W76A 2ORYA 4GPZA 1DBRA 1G8GA 4G89A 4I1YA 1SXJA 1NRIA 4MV4A 4EYEA 1DEAA 3VR6H 5AKYA 1ZU4A 5DSZA 1AF7A 2OV2A 3FCOA 3KTOA 3OIWA 3CVYA 2HPVA 5ALNA 5DX0A 2HMAA 3Q3CA 5BSWA 3N8IA 1G0NA 2QQEA 2YY5A 3TBHA 4ENWA 5JNSA 5G2OA 4YUYA 1U8TA 1ZVVA 2KB0A 4BGVA 3IP3A 2W6IA 1FFCA 2G1KA 1EQUA 3PX2A 3N1UA 1Z4OA 2QTBA 1HDOA 5IUNC 3T7RA 4HL6A 3VKHA 4JBLA 3B3FA 2PKCA 2QQ5A 1BQ4A 1E89A 2AC7A 1U28C 5LB4A 4UAGA 4FYIA 2ODPA 3OQIA 4KLAA 5BYJA 5TDHA 5ARBA 3HO1A 2H7VA 3F5DA 3VU0A 4AXXA 1AHIA 3WGIA 3T35A 1NP7A 1BJKA 1YS9A 3WR5A 4MI3A 1FTSA 1MAHA 4RMNA 2AYXA 4WY5A 5HSGA 1YUMA 2RMKA 2CV0A 1MJHA 2QW8A 4B4WA 3TTWA 1OBFO 1SU6A 3G0GA 2ZI5A 3HR8A 4EY4A 2YXPX 1CUJA 2FWMX 2L82A 1HT0A 3C3PA 4BVLA 4BC1A 1WSDA 1XDZA 2VC2B 2A35A 3TRFA 4JJ4A 4YEDA 3ADKA 3K16A 3V4FA 4YRJA 1ONOA 5BQ5A 3DAFA 1UDBA 1KH2A 4HADA 4EPXA 2IHUA 4RMJA 3I76A 1XL1A 3AG5A 4GP7A 4QULA 3I42A 3MFQA 1X7WA 2HT1A 1QVAA 1DIGA 3R20A 4PAGA 2W2KA 3QA3E 5CVTA 3DKPA 1SXPA 2CHEA 3BRSA 3A36A 2M1ZA 1RHUA 1U2TA 4QNRA 2VDPB 5CHEA 4DIKA 5FI1B 3HV2A 2PS9A 1PL8A 1U5CA 3QIAA 4PM4A 5MFPA 2CUTA 1SUCA 1EVKA 1EHCA 1X74A 3EXEA 1E1QA 3NAQA 1G21B 4NEQA 4OY3A 3RC9A 4B2LA 1FFWA 2Z3VA 3CPHA 1UUFA 4ER7A 3I53A 3L8YA 3D9QX 3JZFA 2YASA 1PNOA 4HAYA 3NT5A 1SCAA 3B2QA 1Y1QA 3AEYA 2HCBA 4A15A 1L6IA 1JLLB 1W29A 2P2DA 3OQBA 4JEHA 5BW4A 2XNDD 3HADA 2JGDB 5EE1A 3LKDA 2YS7A 3WOHA 1NDQA 1OXSC 2FQYA 4E46A 1FZQA 1CZOA 1P7WA 1WNFA 4DDUA 4G01B 4KQHA 4ZVNA 1KMCA 1U80A 3H5RA 4H18A 2Y1CA 2QT0A 1HDYA 2VZ8A 4FFNA 4INZA 2DZDA 3LUCA 1E2KA 3LSYA 4ZAWA 5FF9A 3SKXA 2ZTSA 1XJQA 4CL3A 3IVGA 1Y8AA 1WP9A 5IC5A 2A9PA 1T0HB 1QZUA 1NZDA 1WVIA 4IX9A 5D86A 1R7RA 3GO4A 1P1BA 1SZPA 4IHJF 3LCUA 4BV2A 2ZBPA 3QEMB 4Y2GA 3AEZA 2B1GA 3O47A 2OXFA 1MT3A 3GT3A 1H2EA 5LDHA 3ZLUA 2QE6A 5K0TA 1V9SA 3TLCA 1NNUA 2D5BA 3PFKA 4WCVA 4XASA 2PH3A 4NABA 1W5TA 2HA6A 2ZR8A 1KVUA 3WWPA 3FOCA 3UJ8A 4QGBA 4ID3A 4NBSA 3ELWA 3QNWA 5CA0B 3ZPXA 3EVFA 3FWYA 3ZDYB 5FBVB 4UMDA 5EJMA 1A7JA 1RPJA 2JBAB 4IZIA 5E4YA 1BDJA 1BE0A 2VT6A 2WF9A 1EB9A 5AMXA 3EZ6A 1ETUA 3AM5A 1WXWA 3FCXA 3RFCA 2Y71A 4ZOLF 5DLYA 3OZRA 1QX3A 4JSTA 4ZA2A 4RK0A 2BUAA 4JBIA 1F12A 3A9WA 2WWRA 5AI0A 4P08A 5EPOA 5B1IA 1JJAA 3IDQA 4MQ6A 4E7PA 5CXUA 4FXOA 1H9AA 4G5GA 2AK2A 2W8BB 2ZUWA 1FMCA 3H16A 5EAIA 3UJCA 4RTNA 1A95A 4LFBB 5FBRB 1E1CA 3U4IA 4UNNA 3ENKA 4QHTA 3IP8A 3OEHD 1M8KA 3I45A 4BNNA 1H4SA 1RP1A 1XCGB 4PX3A 3RD5A 1NSYA 3KUCA 1KVQA 2GB4A 3MUOA 1Z6YA 1GVHA 1HI9A 1LFDB 1TT5B 4IDBA 5HIMA 4GIBA 4CYMA 3GLGA 1V5EA 4N9WA 3IC5A 1HKHA 3CR8A 3FYCA 5CDFA 3SZGA 4AX4A 4BNZA 3AVTA 5L3ZA 1AV7A 2CF6A 4K6FA 2XE4A 4L4RA 3V6LA 5C31A 1MNQA 2OOSA 4QBKA 4MUXA 3ZE0B 5KU1A 2VAPA 3K0AB 1XKXA 4ZHQB 2PBRA 3T1OA 2PO5A 1D1QA 1NC1A 4OFWA 2ONCA 5IMBA 2Q3JA 1KYZA 3L1IA 2VP2A 2IV7A 3THYB 1N0IA 1OKKA 2G82A 4OCZA 4R2IA 4BFTA 4CMEC 5BSHA 4AMBA 5H8WA 1SC1A 1X1QA 1Z39A 2P9CA 1TJPB 2VBIA 3RVQA 4PSVA 4B46A 1VIAA 3OCWA 2BFCA 2AOXA 1G5HA 4TYMA 1E3JA 3UH1A 2FUG1 1NR1A 3FX2A 1ZD9A 5L3SB 1SWVA 3H75A 3IAAA 2VDKB 2XGJA 3B6MA 1MC5A 1HEYA 4L9WA 1TAHA 3HY6A 1BE6A 4N54A 3UA4A 4RD3A 4ENPA 4MVJF 1ABBA 3WLEA 3QFSA 1CVRA 3UY4A 3V80A 4ZZIA 1V8PA 3DOIA 5IEJA 4FU0A 4H1HA 3T7SA 1FFHA 1PVVA 2CY0A 5EGSA 3ETGA 1C29B 1GAQA 2FX2A 2J3IA 4DAEA 2BV3A 4EHKA 3ZIUA 4TLMB 1P8JA 4CLRB 5JH7B 5A5GA 3ZUGA 4WGFA 3TLAA 5HUJA 4MQ4A 1Q15A 5B3JA 4AN1A 3OUZA 4LQCA 1EUCB 5ECWA 4AXBA 5HK9A 3W6NA 1BD3A 4K8OA 4QDXA 3RYIA 1DXQA 1W6UA 3ESAA 3D0QA 2AMVA 3KSMA 2WJHA 3UUGA 1B8PA 4M99A 1PT7A 1W0JD 1DWOA 1NMYA 1EMDA 5CYOA 1QZ3A 3TLGB 4GMKA 1DIHA 3FPFA 2XVZA 1HE4A 4MHOA 5EYPA 3N2GA 5TJHA 3HLKA 2NNLD 1DMSA 1UZAA 3U80A 1DQYA 2YN0A 4H7JA 5JTUA 3TDNA 2X19A 1XWWA 1YS2X 5E1BA 4YONB 1DJLA 3REGA 1YONA 2EKPA 2GVZC 2X14A 4WBSA 3WZMA 1IJFA 5C7LO 4MKHA 1E66A 5J5AA 2D5IA 1V7QA 3TLKA 2YBDA 2H1VA 4EMUA 2JHAA 1UQTA 1H65A 1JFTA 5COBA 3FN4A 1Z4PX 4EA7A 4NMXB 3PS9A 4LF5B 4C0WA 1E0AA 2CGEA 6ABPA 3PEFA 1C1YA 1XWIA 3MT9A 4EVSA 2HK7A 1RWPA 4YAJA 1E6EA 3NHAA 2DB3A 3NJRA 2E3JA 2WUGA 4IG4A 3UBTA 1WHSB 3HJCA 2JEYA 2Q2QA 1ZCFA 2DPYA 2II6A 3H1PA 4IIJB 3CONA 4PGAA 1TCAA 2DJIA 5JMOA 2RE8A 1OLXA 4RJJA 5L4LA 4QC2A 1TCBA 1T4CA 2Q1YA 3AT1A 5C5CA 3ZVMA 2V6IA 5L7YA 4CF3A 4F9FA 1DC4A 3PEVA 4TMZA 1PR1A 2HWXA 3TGPA 2NYUA 2ZXEA 3KPYA 3OPVA 4CL0A 4EYQA 1SIUA 2CCKA 3ELYA 1H2WA 3VR0A 2OCXA 1MABA 3IQWA 3BK7A 1KGSA 4Q3AA 5GVSA 1BW9B 1JEJA 1NBAA 3D4LA 3ZWVA 3U2QA 1K8QA 4IUDS 3L7DA 1D7OA 3JRWA 4YFVA 1V7PC 2PN1A 5TMPA 3OHMA 1U0FA 3IESA 1RC8A 2VHJA 121PA 2O0KA 3BTVA 2JLXA 1A5ZA 2EYQA 2W6OA 3E23A 1Z6TA 2OCKA 3GRYA 3QVMA 4AZ3B 4CKEB 1GYPA 1JPUA 5BRAA 4FIDA 3GEEA 3FVQA 3R7LA 1LA2A 2RGXA 4CGYA 2DHQA 1GDTA 3R0XA 3HKBA 3RFVA 2NSLA 4FX5A 3U6BA 1K2VN 1Y6GA 3LP5A 3BWEA 3OCCA 5D5HA 5AI5A 2Z9DA 4HH1A 3MJCA 1NVVQ 1WF6A 2WD7A 2Y1GA 3VZCA 5HFNA 2ZVQX 3K09A 5EIBD 4G4GA 2J0QA 3OKCA 3PWZA 1EDOA 4M0KA 1YVUA 1P5JA 3B38A 4G24A 1BC5A 4I5IA 3B5JA 1DEHA 1MORA 2CDCA 3AB8A 3HFRA 1SUDA 1CX9B 3QFFA 1RD4A 4QUDA 3IAXA 2WQ7A 1DIAA 5FHRA 3EUEA 2B4RO 3QHAA 3VZDA 4D4KA 1GPAA 4EX6A 3A2LA 1YRQA 2HBQA 4TSKA 4QNMA 4P22A 2PSEA 1JRLA 3E58A 1QHNA 1XU9A 4PBTA 1I8TA 1E2FA 1I30A 5EIAA 5F5NA 5JZOA 3NTVA 1UWKA 3HZRA 1FQJA 1COWA 4DSAA 1FRFS 2G1JA 3VO1A 4UAUA 1T5SA 1DX6A 1H6AA 1YE3A 3CRVA 3O92A 4F2HA 2C0PA 2QRNA 1U9CA 2QVZX 2DM6A 1FSZA 1KQ3A 1LQ2A 3PL5A 4N48A 1L5HA 3UXMA 4DLPA 3E5RA 1Y7HA 2WU1A 4K6CA 4LG1A 2PSSA 1QIDA 2X2EA 1MO4A 3INYA 2NO4A 4GPTA 4N82A 2VZEA 2HMUA 2O06A 3JQEA 4QJIA 4XYGA 5CMLA 1A5SB 4KRXA 5FJJA 3G13A 2FXVA 2WPDD 3G49A 3Q9UA 1AUOA 2QN3A 2N9UA 4NFSA 4D3YA 1JNYA 3EQ2A 3HC7A 1JU9A 3EY4A 2YV3A 2VUUA 3JQQA 4R1NA 4QYWA 5EHZA 4HTAA 3L92A 4BGIA 3GLTA 4MCIA 5C4GB 1EDBA 2RH9B 3BH7A 1QM5A 3BMQB 3N8NA 3RIGA 4MR8B 2FR8A 4FSHA 3QELA 4Y6OA 3W2FA 5H4GA 4TV8A 2GXAA 2GHRA 1YBFA 2DPGA 2AMLA 5C81A 4MS1A 2UU9B 2NPIA 2OKGA 2B8NA 3TKYA 2RGNA 1JSRA 2IXEA 3N07A 2YYYA 3ILXA 1U7PA 2GN1A 4KXLA 4GOXA 4X63A 4YJGB 621PA 3PNVA 4BX3A 2WJZB 4HGYA 2QTTA 4R2MA 4UNPA 5K3FB 2GEKA 3VR5A 5JZBA 5LVAA 2YOHA 3FFWA 4CM9A 1HKUA 3N6XA 2HV9A 2LCFA 5KWEA 4M1KA 1NVFA 4ISBA 2Q62A 4L8GA 4E03A 1JLHA 1DCMA 1RRFA 2VXCA 1TK2A 4YV1A 2FZGA 1M2GA 3OJEA 1WUHS 3W6UA 4A0RA 1MTZA 4BBZA 4KPYA 2XMZA 1CV2A 4U7PB 3RG2A 2PS0A 1BA3A 3ONEA 4PG6A 3AVVA 3GIDA 3E8XA 4RJ2A 3ICPA 1GZDA 2WILA 1P0CA 3AIOA 2CVQA 2ODEA 4KMSA 3EZNA 4IIUA 3CVXA 1W4AA 5JLJA 4C76A 3E18A 1PGOA 1Y4AE 2O59A 2IZ7A 3TLYA 1PR9A 2GZAA 3WQHA 5D87A 1CS0B 1WU8A 3NUZA 2QR5A 4G0YA 1TYCA 2O7RA 1ODCA 2DKFA 2Z8ZA 3JVUA 1H1DA 3O0TA 3GZNA 4FMDF 1GU0A 3PC6A 1SVSA 5JO0A 1QR2A 2DSTA 2WICA 2EXXA 1YRYE 1TAQA 4LJKA 1TRKA 3GFFA 5EMNA 2QTLA 1JEAA 3UICA 2V7QD 1GT91 1OD6A 2IX3A 4EVRA 1XVTA 3Q7SA 4QUIA 5IVIA 4JI6B 3QMWA 2NT3A 1A2BA 2OHGA 5BW8A 1Y5IA 3W3ZB 1GTMA 4V0RA 1FDWA 3L8GA 4UZEA 1Y7PA 3GOQA 1QIEA 3I72A 3UW3A 2R4TA 3EF3A 2PGIA 2O3QA 2SKCA 3HCBA 1IZ9A 5DOVA 5TGZA 1TT7A 1TTHA 3OM1A 5TQ2A 1N1EA 1FMTA 1GU7A 1O95A 3O4IA 4FFSA 1D2NA 4Y2QA 2ANCA 1TTTA 5K8UA 4PCAA 5D6NA 4RA9A 3E15A 3KU1A 5D01A 4DM3A 4QVGA 1P75A 2DTEA 1NNSA 1ZFNA 2FMKA 2TSYB 4YCSA 2WFZA 3JRNA 3U7JA 1XAHA 4G0MA 1NN3A 2BGMA 3I2KA 4B17A 3DBIA 3GK3A 4RUKA 4BCBA 4CTMA 1KPHA 5GAJA 4OU4A 1YXMA 4XWKA 1KAQA 1W4ZA 4JC0A 2HF7A 2J3HA 2JARA 3OQOA 3SF8B 1V7ZA 2P77A 2ZYTX 4B48A 3D3NA 4GQIA 3U7QA 4B76A 5A5VA 3PJRA 1SKYE 5M04A 1ZEJA 2C5LA 3SYNA 4B5KA 4I4TA 4Q1CA 4DAOA 1PK8A 3WGJA 3I9LA 2IYUA 4MV7A 4WQMA 3WTCA 2W6QA 1C5KA 4PR3A 2A5YB 3JAKA 4L3OA 5FTKA 3SIXA 2NWQA 4HDKB 4MZDA 3DZ8A 1OXKB 1LGYA 3DR5A 3W4JA 5M7EA 2Y27A 3U62A 5BR4A 3NKLA 2WFAA 4HG2A 1SBHA 2GD1O 3A4MA 5FPSA 2M32A 3V2IA 1X14A 3KU4A 4DCOA 1VE5A 3LHSA 3X0DA 3CKMA 4I4IA 4PGHA 1DOHA 2KW5A 4Z8XA 3T1NA 4CKBB 3U7FB 3D6MA 3TFQA 1KH3A 2EEZA 3HVRA 1Y7IA 3RADC 2I3ZA 2Z8YM 1Y1LA 4M0CA 4NFYA 4Q4JB 2D00A 1E0DA 1FUEA 3EAFA 3QU9A 1W2WB 2OV4A 2ZWOA 2HIGA 5SYAA 4XQ9A 2BH2A 1C8BA 2AW5A 1BOOA 4TROA 4DV2B 3IO3A 1XD2B 3D54D 3O3NB 3GQVA 1HNWB 5B5SA 3QVGB 1QH9A 3OD1A 4RVDA 3ETCA 3JWIA 2H0AA 1T35A 1VHTA 3EIUA 2DWOA 3L4BA 3Q88A 1T91A 5EIOA 5K6AA 4CT0A 2APJA 3FPGA 4U7JA 3HPRA 2FHSA 2C7BA 3QE3A 1GQSA 2Q3EA 3RJ9A 1P2UA 1NBOA 3H2IA 2N0SA 3MLEA 1HDEA 4NYMR 3EVTA 4XJXA 1N6HA 3HDYA 5TEWA 3RVDA 1M8PA 1UT8A 2UXCB 3CZ5A 1UBKS 3ZBPA 2Q9UA 1DINA 3G0IA 4HNVA 5HRAA 2P1ZA 1YL7A 1QH0A 1L5KA 4BXOB 3TD9A 2OUKA 3B1ZA 1FDIA 1WUKS 4N3BA 4FNGA 4LF7B 1M74A 2BP7A 3PDHA 3IAM6 5KYXB 1AKMA 1ISSA 2X2OA 4RF3A 3TM5A 3HRHA 2IK8A 4ENVA 1E3IA 2JAWA 1FLNA 1SR8A 1TVKA 1UBUS 3PDIB 2VAVA 4IZ6A 4LCJA 5KI6A 2WU8A 3OFSA 3AJ8A 1J06A 3RGWS 1Z83A 3CGWA 5C0OE 3RANA 5F64A 4HTFA 4L2IB 3MA0A 2Q5HA 3EXHC 3DXZA 4QPNA 2NX2A 2R25B 1XZGA 3D5EA 1IOWA 3N6RA 4IDDA 4LXGA 2RKBA 3CLSD 2V9PA 3EISA 4Y2TA 1MD9A 2R7NA 1ZOLA 4B74A 1UBRS 4QGSA 1XRQA 3F49S 1AQIA 1B1AA 1F1JA 3Q5EA 4W8HA 4RXUA 1G20A 4HZIA 4TPKA 1E61A 1ZYUA 1SCKA 4NMMA 4V0ME 1KBOA 4KIGA 2B21A 4ALNA 4IR7A 4NZ9A 4DEXA 1NUSA 5THQA 4ZTUB 1HX7A 1CIPA 2YFKA 3PD7A 5LA6B 3KT8A 1WKBA 3JZMA 4OJQA 3FZEA 4M53A 4N0QA 1SVKA 2HMSA 2F3RA 5FWNA 3Q3VA 4IFIA 1EFPB 1IHDA 3S2SA 4O1IA 4UE6A 5DBFA 5T7BA 3ZD8A 5B7QA 4LOAA 4NYIR 4KVGA 4FUTA 3FUTA 2ERXA 4ZV4A 1XR3A 1JHXA 4PE5B 4GVLA 4EARA 4FS3A 2VPIA 3MWEA 5B37A 4RIHA 1CRZA 2IKSA 2PZJA 5CT8A 2QTVB 3WWEA 3OJCA 1W34A 4RPIA 2IUYA 2VA9A 2FX3A 3L5OA 4FQ5A 4EF4A 1U3CA 2GTPA 1PZEA 3G7NA 3KQUA 4ITUA 3S2UA 3NKFA 4U2EA 4YQYA 1SA0B 3MJEA 2JFZA 4MJ3A 3O91A 1YQGA 2ZRBA 4M37A 3EDMA 5EXDA 2WHRA 3I9JA 3NASA 3I3SR 4F2DA 1E7QA 3KQLA 3QXGA 1LC3A 4JEMA 1U99A 4I1PA 1QQ6A 2Q6LA 2W4IA 3FLMA 2X41A 4UEKA 3ONFA 4NH4A 2ZJFA 4Q7LA 1ES9A 3O8LA 5DM60 3RU7A 1KGDA 2QRHA 2BCJQ 2BTQB 1QP8A 1AHNA 5CNMA 1U31A 3QUQA 2W11A 4XLTA 4YRTA 1HA3A 2BRUA 2QK4A 1MVNA 4FLFA 4MRMA 4XGQA 1DRJA 4OYRA 5TC4A 3RQSA 5CVCA 2OKCA 5J4LA 4CGZA 1KP9A 3BHIA 3C5WP 1O6CA 3AR4A 2X1MA 3LVQE 5HE8A 3MYYA 4TS1A 3RC8A 3PLNA 3R7FA 4BDSA 4UNIA 2ESRA 2F3SA 3O38A 2AVNA 1UOQA 1XHFA 5F73A 3SAJA 4BP1A 2PJZA 1ID1A 4BYGA 3LECA 2WUFA 1G41A 2V7BA 2X8LA 4BP9A 1VBMA 2PX0A 5C51B 2HA5A 3K2IA 4OHRA 1FMFA 3DZFA 4KAAA 3BWYA 4AJEA 4KK3A 1U0OC 2WTXA 5CNIA 1N7HA 2I8LA 2JD0A 4MH0R 1N3BA 3C7AA 3H19A 4M0LA 1VCHA 4NR0A 3T5TA 2DQ4A 2GN4A 4NENB 4X8HA 3ES9A 4L0MA 3LFUA 2WMDA 3L8ZA 3AEQB 4H4DA 1ONNA 2ZR7A 3D81A 4XYMA 3L0BA 5FULA 1TCVA 2OB1A 1OYYA 2OGSA 4HLUC 3WGQA 4YH1A 4A7PA 3PNKA 2FPPB 1CWUA 3G7UA 1XZFA 2Z83A 1PK9A 1PQYA 2IUTA 2XKAA 3O5AA 5F2NA 5JDIC 2OFFA 4IIXA 5BWMA 3PD1A 2GBCA 1SBNE 4HNSA 3AC0A 3LWZA 4L72A 4B75A 1TLTA 2ZB3A 3V32A 4E4RA 4YDSA 3BEDA 4QOJA 2HLDD 3LPMA 3MT0A 1OFVA 3GARA 3M1LA 4FOTA 1ZGBA 4QBHA 2ID8A 3CISA 4PR0A 4YAFA 3OTGA 1R5JA 1RJWA 2FZCA 2C95A 1G8MA 2QL6A 3JYPA 5FUXA 1L8AA 3ZU5A 3JZDA 4J07A 4WV3A 5EHIA 3LNCA 5JC8A 4KKXB 1YKGA 2JLZA 4OJYA 4CQLB 3F3KA 1BXGB 3C3BA 3VTAA 4UDXX 3T54A 3F5FA 1I4DD 1KKMA 4D6YA 2BM8A 2H00A 4PCLA 2C20A 3RTBA 4EFNA 2VWHA 1BMFA 2IEZA 4HAUA 4QYMA 5JNRA 1JLKA 4MARA 3OZGA 5AHRA 4XUEA 3WYBA 1G5PA 5DNCA 1SBIA 4MW7A 2R5WA 5KSWB 3QWAA 1SAYA 2HGSA 1QIGA 2GO1A 1L3CA 2UZ1B 3NBYC 4HO1X 4BXOA 1LK0A 1BJTA 5BN3B 3IEPA 4N8SA 4JI7B 1XF1A 1GPWB 4KX3A 1FMLA 5ALDA 5EKSA 3SQOA 1R0CA 1QQ7A 2O1EA 1I5EA 1JXMA 1LSOA 1U7OA 3CLKA 2Z43A 1RCUA 2NGRA 3RS7A 4DNXA 1Q0ZA 2KBFA 3M4JA 4HI0E 3T0IA 4KPUB 3WWZA 3UMGA 2QLBA 2QL9A 1RZRA 1R00A 1J2JA 2AT1A 5E8RA 3QBVA 4BAZA 3B36A 3B5IA 3W1EA 3BULA 4CMKA 1MG5A 3KS9A 2YVKA 4UOZA 1XKQA 2C4UA 3WGNA 3ZDFA 4AJIA 5JRDS 3GJXC 4C4XA 2CHVA 2O3TA 3HVKA 3ZHZA 4QO7A 2G28A 1EFVA 4ZEWA 3BQ9A 4PYOA 3QSYA 3VJRA 3U37A 4JWTA 1OLUB 1POXA 3UNXA 3Q0IA 3TUZC 1VKJA 4BNTA 2EZ9A 3QX3A 2ODAA 3PUXA 3AI3A 3DEKA 4ZARA 4QFCA 3S1SA 2NSYA 1NJGA 4D3ZA 4CQJA 4M7PA 2JCSA 3D6FA 2ZS9A 4FFBB 4GQBA 4CXMA 2XBLA 3MHPA 1AOXA 3O3CA 4BJ5A 4X62B 1I4EB 2B94A 4GEGA 4Z9FA 4G0UA 2VEOA 1XCOA 3QSGA 1CR4A 1J8YF 2ZOSA 3ME5A 3O84A 3OTQA 5CB4A 4ZHSA 5HZKA 2OXTA 1TF7A 1U2GC 3FSEA 5EUCA 5JJCA 3L8MA 4F6LA