4DXAA

Co-crystal structure of rap1 in complex with krit1
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
168
structure length
168
Chain Sequence
SMREYKLVVLGSVGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Small G Protein Effector Interaction of Ras-related Protein 1 (Rap1) and Adaptor Protein Krev Interaction Trapped 1 (KRIT1).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Ras-related protein Rap-1b
total genus 55
structure length 168
sequence length 168
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2012-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dxaA00
1KI1A 3LH5A 2OFXA 1KI9A 4JBWA 521PA 3SYNA 4OI4A 4CT5A 4CVNA 3QSYA 2XEXA 4PC1A 1XJCA 4A2WA 2QNRA 3T06B 3J81k 4G3XA 1AKYA 2VLIA 4CEHB 1OXTA 2JLSA 5B2ZA 3QPVA 4V0LA 3K1JA 4Q4HB 3K0FA 1G5RA 4DCUA 2O8DB 5CJPA 4YDHB 2PZGA 1L4YA 1GKIA 4O2LA 4DB2A 3VU9A 3L0SA 3D3QA 3ZVLA 3M1IA 4MKIA 1W7AA 5JRJA 4FMDB 4WA7A 4BWYA 3QG1A 4QNRA 2UZ3A 5EP4A 1KJZA 2YC4C 4IVPA 3AVXA 1FUUA 2ZRCA 3WNDA 4AY2A 1YZTA 3WXMA 5EE9A 3L0OA 2Q3FA 2EW1A 1U8ZA 4LHYA 5CDFA 5KPDA 1Z08A 2BM1A 3LX8A 5HKKD 1JEDA 1KK3A 1OPXA 2RH5A 4XIGS 1Z28A 2ECKA 3C14C 3TH5A 5DSZA 4V02A 1OFUX 1CJVC 1RRPA 4F4IA 1AJEA 1FP7A 4GDFA 1XXHE 1E2MA 2O8FA 2CEAA 3LW7A 1NIPA 2IC5A 2QTHA 5AWFC 5FOTA 1FMJA 3CKLA 3I32A 3QKRA 3I62A 1TUEA 2EFCB 4C4PA 2BEJA 4UJ3A 1R0ZA 4M1TA 2BC9A 3OZXA 3I61A 2ZI4A 1GL9B 4DSNA 4E09A 1CTQA 2J0UB 3EARA 3FPAA 4LPKA 3ZS9A 4NTZA 1DAKA 1MOZA 1MO3A 5L3VA 3B85A 1EFUA 2GZAA 5G40A 4EPRA 1SKYB 1Z22A 2A3RA 2XGJA 3M0EA 4PQRA 1Z0AA 4JZKA 1I4LD 1R2QA 3SYKA 3KQKA 1E2QA 1F2UA 3QKTA 4HZUA 4FN5A 4GSYA 3SQXA 2NO6A 3ADKA 4Z1MD 2IUSA 1QBKC 4BLOA 3I92A 2D06A 4DCSA 1W49A 1QHNA 3A36A 4BPBA 4AKGA 1AZSC 2VP9A 4AWXA 1XEWX 1O87A 3R8CA 2YWFA 2C78A 1NSFA 4FCWA 1Y63A 1E2PA 5JCZA 5HR5A 1KK1A 2WJJA 1P9RA 4LJAA 4OL0A 1IJEA 1Q1EA 2JJ2A 3C4JA 1TL7C 1NKSA 4C0AC 3KJGA 4V0KA 4LJ8A 1JQJC 5JWOA 1HYQA 1U94A 4OQFA 3SU8A 5KNDA 4A6XA 3KQLA 1X1SA 1KI2A 4B75A 4M1MA 3UWOA 2CVHA 4A0HA 4Q5IA 4M21A 5DE3A 2OEPA 2QE7D 2YWGA 2J5XA 2G6BA 4DBLC 4BFWA 4YXWD 1ZP6A 1AS0A 3CM0A 2IHYA 2ERXA 1E4VA 2BJWA 4A0FA 3GLGE 5BWMA 8OHMA 3THXA 5J4VA 1E9EA 4ZIRA 2UKDA 1VPLA 5AJVB 3QKRB 3PENA 2IYSA 2ZROA 3B5JA 2IK8A 2QM7A 4PSVA 3LXRA 3KB2A 4LC0A 4GI7A 4MDFA 2UVQA 2FE4A 4LCBA 4Q02A 2QN6A 2ASEA 2FFQA 2QM8A 3R8FA 2X19A 1W0JA 1TX4B 2WMOB 4JBYA 3NH6A 5FL7D 3PUVA 3SJZA 2Y8EA 4QJ5A 5IK2D 4YQFA 4QOSA 4B43A 2GEDA 2HCBA 1I4DD 4TQ9A 1QHYA 4CF7A 2F55A 1HT1E 4NP6A 4RCYA 4NYIR 3U6KA 2R6DA 3QKSB 3U4QB 3HP1A 1WMSA 3OIYA 4NYMR 4KITB 4M0LA 3A4MA 3UANA 3B78A 1U0JA 1N5LA 3KUCA 3SFZA 1F5NA 1MV5A 1XJ0A 1MKYA 1NJFA 1M7GA 1R4AA 1AQYA 3TQFA 1J8YF 1U0LA 2P3SA 1KKMA 2Q21A 4PHFA 4QBGB 3BIFA 4DB4A 1XCGB 1OIXA 2GILA 3PEWA 1FOEB 2VSXA 4A1FA 2JDIA 2C98A 1R0XA 1A4RA 2FG5A 2KB0A 1XRJA 2IS1A 2XJ4A 1KDPA 2H1LA 4TMTA 1OE0A 4OI0A 1DG3A 2Q9BA 4CT4B 2D2FA 4US2R 4P33A 4JKYA 3K0AB 2X2EA 3VMFA 1SVLA 1OSNA 4K81B 4TYPA 3VX3A 2C5LA 4DIEA 2RB4A 1VECA 1FFHA 4TMKA 3ICEA 2AKAB 5DNYB 1VCIA 3VFDA 3RYTC 1AZTA 4D4LA 3NC1C 1N6PA 4XD7A 1G8PA 5DI3B 3WMEA 3CF2A 3KFVA 4BUJA 4XOIA 1LVGA 1ESMA 3P27A 4DSOA 1RC8A 3DKPA 4AYTA 1XD8A 1KO8A 4B2PA 3TMKA 1YR7A 4S35A 1QG2A 4FIDA 4EPWA 3HU1A 2ZYUX 1K6MA 4M1YA 2Z0MA 2ZSAA 4ACAA 4WW0A 3TSOA 2F3TA 3TVTA 4NYJQ 4B6EA 2ORVA 3PUYA 4C0QC 1BYUA 2VEDA 4DRZA 1UEJA 4BGDA 1COWD 2OFWA 2OBNA 3H4MA 4G01B 2IWHA 3QF7A 5FBRB 2VF8A 2WJYA 2REXB 1A2BA 4ARZB 1NMXA 3K0CA 1G7SA 3U3MA 1XMVA 3DOEA 1XCMA 2EFDB 4RY2A 4YONB 4DLYA 2ZRMA 3I72A 1IQPA 4EUNA 1R10A 5ELXA 4KYIB 4ESHA 3LA6A 1NNEA 1CKEA 2O8DA 2WIAA 2ZANA 4KLNA 4F4CA 1JR6A 2Z4RA 4PZLA 4BFVA 2VP4A 4CEHA 1CR4A 4MYTA 1Z6TA 3CX7A 4A8JB 2AR7A 1CU1A 5KHOC 2CHVA 2W2XA 4ZO4A 2IYVA 1Q22A 4FINA 5IDVA 2OCPA 1G7TA 3QF4A 3FFBA 2GJAA 4Z54A 3OEHA 4GPTA 3NH9A 3RVBA 5BN3A 4JLBA 4DLVA 2D7DA 5KNBA 1A1VA 2VP6A 1U9IC 1MO4A 4IW3B 3U3RA 1UBCA 3I5YA 2A78A 3NEYA 1G6OA 2P5SA 2FH5B 621PA 1NL3A 2HLDA 4XD7D 1OXUA 2ZRLA 1F2UB 2IYXA 3C5HA 4HZUB 2GXQA 5IF9A 3MG9A 5GJCA 3PEVA 1R8QA 1RRGA 1X3SA 1HUQA 2ZSEA 2DFLA 3IQXA 4UXHA 1S3SA 3NBZC 4ZDWA 3WP0A 3N2IA 3ZH9B 2WBLC 1XJQA 2XB2A 2QMOA 1YRAA 4WOPA 2OBLA 3H2YA 2GA8A 2N1BA 4JLKA 4PPNA 4PTLA 4Q1BA 1Z63A 1N5IA 1GAJA 2FFBA 3QKUA 3DKVA 4MRPA 2AFIE 2G88A 4TT3A 3Q7PA 5JEEA 1VHLA 4EPXA 4RD1A 1E2JA 1G41A 1G5PA 2AK3A 5SZHB 1E3MA 4M2LA 1ZC3A 1ZIPA 1S9DA 5K8UA 1BS1A 1CXZA 4HDQB 4UXIA 1UBGA 4D0LB 2NPIA 5CDFE 5KU1A 4PO8A 4QM6A 4JT2A 1T5IA 4LC1A 4PZZA 5J4HA 4PFSA 5G3ZA 2H16A 5LB4A 3CX6A 1IXSB 1BIFA 2PJRA 4AKHA 4D2IA 2UZIR 4OQMA 4HEJA 4I1SA 1P9NA 2NZJA 2FFHA 3U7EB 1DOAA 4R71A 2DCUA 3CONA 1W4AA 1R5NA 2A5DA 1SXJE 5H1YA 1A2KC 1L2TA 3PITA 3PUXA 3HPQA 5EJEA 2DFTA 1ZCBA 2O0JA 4LI0A 1GDDA 1DE0A 1Q44A 4CRWB 1YZKA 3GMTA 2JLWA 2XTNA 4OHVA 1JBKA 3KKOA 2CL6X 2DFKB 2JIZA 1PV4A 2QORA 2FPKA 5E95A 2ZRBA 1GNRA 4G1UC 1U8YA 1P2UA 1E2DA 4IJMA 1T3HA 3BFXA 4NPHA 4TTQA 4E07A 3QUSA 3CNLA 1NRJB 4Q47A 5CIWA 1E0KA 4KV9A 1DAMA 2V4ZA 4W5HA 5FPYA 2JLXA 2ZJBA 3NG1A 1S3GA 4ZV4A 5LD2C 2EU8A 2ODBA 5E7IA 3B13B 2IXFA 3PUZA 3T1VA 2PZEA 4JJZA 3DZ8A 4C3ZA 4LK2A 4IDQA 2R65A 1P60A 2Q3MA 4F93B 1W36B 2CK3D 4DKXA 1AGRA 2ZS7A 2Z43A 4TL7A 1D2MA 3VR3A 3CR8A 1PUJA 3X2SA 1GNQA 3U7HB 3SN6A 1P2SA 4DSTA 2B8WA 3RANA 4URXR 1HH4A 2W0MA 3GP8A 2ZRPA 2IF0A 1XPRA 4EQ6A 2F9LA 3AP1A 3U7FB 3BB4A 4B3CA 3LQQA 5DN6D 4KU4A 1Q21A 4HAWA 3OE7A 3BH7A 3F5FA 4FMCF 2Z5FA 2EVWX 3LVQE 1E1QA 2B7BA 4HB0A 2LKCA 1DAEA 2QQEA 4M1WA 721PA 1FTSA 3A37A 3IO3A 4EJSB 2HUPA 4QGAA 4TYNA 3KTAA 4Q4JA 1Z6AA 1XB2A 4US1R 2J45A 4N3NA 4OK3A 4ZDKA 4A0RA 4BEJA 1OXVA 3U6BA 5F2EA 2NO7A 2OXCA 2CNWA 5GJVC 2ZAOA 4IDHA 4C2TA 1OXXK 3WYFA 2JIZD 1GWNA 1M2OB 4W5WA 2H18A 2I1VB 1ESNA 2F43A 1E2GA 3AVVA 3OAAA 4EPYA 3D7MA 2RGEA 2GHIA 4LYHA 2B92A 4GZMA 3FHCB 4EFMA 3CZPA 2J0QA 1CR0A 3V4RA 4KSCA 1ZVQA 4MRNA 3ZD7A 5FOSA 4E03A 4ZIRB 3U3KA 5JEDA 3MLEA 4LV8B 1XZQA 4Q1DA 2PLRA 2MSEB 2ZRNA 2H92A 1W46A 1HTWA 1MO6A 2J7PA 3SI7A 1W36D 1Q1QA 3GJ3A 4JL5A 2F1HA 1DAFA 1J99A 2FSGA 3T1TA 1NBMA 3THYA 2XSZA 1XX6A 1XPOA 4MUBA 3UMFA 4HAVA 4DVGA 5BN5A 2R62A 2ZQ5A 3GQBA 2AL7A 2NZ8A 2OCBA 4GBMA 1II9A 3KKQA 5BN4A 2WPDD 2A5JA 4M1KA 2G1JA 2ZPTX 5HE9A 4EIWA 1HURA 1R5OA 2AKYA 2G3YA 4BECA 1VCOA 4B35A 5KO2A 1I2MA 1GTVA 1IJFA 2OILA 2C96A 2W0SA 1ZU4A 4FMCB 1X8KA 2QUZA 3RC8A 4JBXA 4BZPA 3KTAB 2ZVQX 1G3RA 3OFNA 2TMKA 3TAHA 2AXNA 2HJGA 5JFGA 3B1VA 5FUVA 1NF3A 4LBYA 4JLNA 1SKYE 2GF9A 3C7KA 3KKMA 3IBYA 1E2EA 1KZ7B 1VDZA 1ZW6A 2OG2A 1N6LA 2VO1A 5SZIA 4QGGA 3RRNA 5JI2E 4ASUD 1DPFA 1XTIA 2ZAMA 4Q9JA 4BEBA 4JYBA 1ZINA 1E9DA 1N5JA 2CE2X 2V1XA 3AKDA 5TVKA 1JAHA 5A4JA 2GCNA 1VCNA 2P65A 1KHTA 2WSSA 2QBYA 1VG9B 2EWVA 2VYFA 3KQHA 1UDWA 1W5TA 2E87A 2IYLD 2JLYA 3IIKA 5TB5A 1E2IA 1KSJA 1XNJA 3QE0A 4R9UC 4D26A 4AYWA 2IYTA 2IF2A 5AK0A 2NG1A 4TWZA 4MGKR 2ZJ5A 3NDBB 3L43A 3OEED 3TW8B 3EW9A 3K70C 1Q57A 1D2NA 2YHSA 4RSGA 4JT4A 5KPJA 2DYKA 3GJ0A 4FCVA 4WZ6A 1DEKA 2ZI3A 4JLOA 1K8RA 1N2CE 5CJ2A 2D74A 4GZLA 1F48A 1G6HA 2YZ2A 5CLQA 1OH8A 3QOFA 4NBSA 1W2GA 2BHRA 1JI0A 1VYUA 2AWOA 4M1OA 3ICQB 2IUTA 2QAGB 3TJZA 2ZTSA 1CIPA 2XAUA 3RDPA 3VX4A 3IHWA 4WZAE 1GOTA 3CWZA 4KFUA 4IEIA 4ZDIA 1KNXA 3TIFA 3VKWA 2B6HA 3IPXA 2GWHA 4V0ME 3K0CC 4KAXA 5GVRA 4NYJR 2ONKA 3RS7A 3U3OA 4TMZA 1MRNA 4Q01A 4QRHA 3TNFA 3TRFA 1V43A 2J7KA 3BE4A 3B8HA 3WHKA 4AC9A 1MR3F 4CIDA 3LX5A 2GK6A 1EFRD 3C15C 1RE0A 2B21A 3P26A 1XD2B 2A5FA 2A2ZA 2IHBA 3DO6A 4ASUA 1CR2A 1P72A 2ZR7A 2WKRA 1RRFA 4YC7A 4DIDA 1R8SA 1U9IA 4NCNA 3K70D 1NVXQ 2CDNA 1N0WA 2D7CA 1V5WA 3REGA 3VR1A 4DSUA 4BFZA 3AUXA 4Q1CA 4KFSA 1F6BA 1XF9A 3MWJA 3THXB 2GBLA 1YR8A 4W9MC 5EXXA 1OW3B 3FB4A 1UJ2A 2R44A 1HA3A 3HR7A 1XCPA 1G4AE 3WNBA 3EIEA 4L4UA 3IGFA 5FOWA 3AF4A 4UNQA 4KFRA 4ZI3A 4KODA 2WJHA 1QHHB 5CYPA 2ATVA 3NVAA 3X1DA 4IHQA 1E94E 1AGPA 2I3BA 4AG5A 4ABYA 3A1VA 2OCYC 4XTCS 1HQCA 1T8UA 1OH6A 4AKEA 5AUPB 3U44B 2XNSA 1OIWA 4MKGA 1WQ1R 3QBVA 3R9IA 3BFVA 1EGAA 3BWDD 3EPHA 2FOLA 4FD2A 2FSIA 5FBWB 1Z2AA 5EUMA 5C46F 2CCJA 1H65A 2V55B 2WWXA 4X8MA 3W6PA 1E79A 2WWGA 2VP2A 3CR7A 5IHPA 4C0BA 3IILA 4A8JC 1NN3A 1PZNA 3DM9B 3W3ZB 2IYZA 3WHLA 2AWNA 3B1XA 3UK6A 1GIAA 2MMGA 2WWHA 1H8HD 2KE5A 3Q72A 4DT1A 2VH5R 2GBLC 4D6PA 3AB3A 4Z1MA 2J0SA 4URZR 4P4TA 4E5UA 4V0OA 3EWAA 4M4SA 3UG7A 1IN7A 4LWZA 4I81A 1TQ4A 5JECA 2PT5A 1US8A 3LY5A 3ZIAD 3AVYA 3RSOA 1CJTC 1ZM2A 1Z6GA 4WIAA 1YZUA 2R9VA 5EE0A 2W83A 2ZRDA 1D5CA 4UQOA 2IYWA 1KDRA 2ZI7A 5FTLA 1KSFX 2WJGA 4IOLA 2ZR0A 4YLGA 5L3RA 3VR6A 3P20A 4ERNA 1RRCA 4PR0A 3TUZC 4LOAA 1KI6B 4NCHA 5DI3A 1YHNA 1E32A 1D6JA 2F1RA 2WJIA 2C9OA 1LTQA 2BMDA 2EYUA 5KSPA 3UIEA 2F3RA 3DEFA 4BRWA 5LBIA 2IYUA 3FTQA 4NCIA 2BKUA 1S4QA 4HLQB 2QMHA 1SHKA 4GFDA 5E7JA 1CR1A 4PQYA 1TAGA 3IIMA 2O8EB 2QA5A 2QGNA 1W1WA 3RWOA 2IUUA 1WRBA 1Z0KA 2J0VA 3FHOA 3W5IA 4LY6A 3GLIA 421PA 3U7GA 5JRZA 2Z6VA 4MYCA 2YOGA 4YMUA 5G41A 4AYXA 4QC2A 4XVRA 4AD8A 2AX4A 4TYWA 4DEXA 1PLKA 1R0YA 1P9WA 1MRSA 4DLZA 2ZE8A 2ANCA 1VIYA 1H8HA 4CEJB 4AKIA 1NY5A 2RGDA 3H86A 4PHTA 4A82A 3GLIE 2CMKA 2VP5A 4DLTA 1KJYA 3L82B 4M9SA 1U98A 1WA5A 2GAOA 3E1SA 3EZ9A 2WHXA 2GNOA 3MWYW 2Q9AA 4PXAA 2J59A 2XOKA 5FPKA 2P0EA 4JVLA 3UKDA 1PLJA 4DEYA 3W9YA 3AF0A 3W6OA 3BAFA 3RSLA 4RD6A 1TADA 2V3CC 1YE8A 4P4SA 4JVMA 3W3AA 5LD2B 3SBDA 1JECA 1E4YA 3RABA 1E2KA 2ZRJA 5CYOA 1W36C 2ZR9A 2WSMA 3AQ4A 2YV5A 4Q4HA 3T1QA 2ZREA 3DL0A 4JLJA 3ZD6A 2C99A 3RRZA 1E1RD 3K70B 1N0VC 1G8HA 2HXSA 2PT7A 2DWPA 3FMFA 3GEHA 2YOFA 3ASYA 1AS3A 1QRAA 2J1LA 2JJ1D 5F9FA 2QE7A 1N6RA 3HR8A 4B73A 2N46A 4YXWA 1OHHD 2QRNA 2QPAA 1II8A 2JLZA 5AJXA 3ZVMA 4BZXA 2ZJYA 1D9XA 1E0SA 3HU2A 5EZ5A 1SXJA 1EWQA 4Q4AB 3X1XA 1IBRA 4RZXA 4KBGA 3QENA 1TTTA 2IS2A 1MABA 5JJKA 2A7QA 5JBQA 1HQYE 1S1MA 2CCGA 5JI3E 5JSZA 4OI2A 2QTVB 4LV5B 1JALA 1SQ5A 1T5LA 2IEZA 3EXAA 4FMBB 4HB3A 1QHGA 2FGJA 2BDTA 1WF3A 2FEOA 2P6NA 2QP3A 4RD0A 1XTRA 2RHMA 2IS6A 3BRWD 4PHGA 4L5BA 4AURA 3AF1A 5EXSA 2QT0A 4PZYA 1Z3IX 4TQAA 4UNPA 2ODEA 2YC2C 3SHFA 3GLFB 5BYKA 2BBSA 1FQJA 4HSEA 1CP2A 1T6NA 3ASZA 3O47A 5FI1B 4KCGA 1E9SA 1LB1B 1SKQA 2OHFA 1XEFA 2N42A 1GM5A 1R7RA 4NH0A 1NIJA 2G0NA 1Z07A 3FKSA 3ND9A 1P2VA 4HATA 3GLGB 1GSIA 4G0NA 1F2TA 5CK5A 4IDOA 5JS8A 3IKJA 3WNCA 1II8B 2BWJA 1DO2A 4DXAA 1UBFA 3UPUA 3BB3A 3KL4A 4XWOA 1WB9A 1DELA 1X8JA 1KOFA 3HYTA 2IXEA 2NOAA 4MDEA 3KJHA 4LHZA 1FX0A 4ZCLA 1CRPA 4V0NA 1E0AA 1JPNA 1OHHA 1CRQA 1KDOA 1LF0A 2ZRHA 3CB4A 2O8BB 2GETA 1DS6A 2LWIA 4PHHA 2REOA 1YU9A 2ERYA 1LY1A 4LZZA 1SXJD 2XNDA 2KWIA 4Q66C 3WMGA 4DLSA 1TU3A 3PEYA 2WKPA 2GTPA 3PJRA 3Q85A 4OHWA 1VIAA 1D8TA 2ZRFA 2YOHA 3A58B 1YRBA 1Z47A 4HLCA 1DADA 1IXZA 1TMKA 5K8LA 2G1KA 4P32A 2BCJQ 4TMXA 1KMQA 1Z0JA 5HKKA 3VNVA 4JLMA 2PLFA 1TEVA 3FWYA 1L4UA 1RIFA 2REBA 3OF5A 2FPLA 1ZU5A 1HE1C 3P32A 1XEXA 3TSZA 3V4FA 1QHSA 2Z4SA 2IYYA 4LRWA 4Z8XA 4TMWA 3LWNA 2FMXA 3PQCA 3GLHB 2H57A 3B82A 4QHSA 1TU4A 2FZLA 2O5VA 3K9LA 2QL6A 2W2TA 3EZFA 3NC0C 3SOPA 1T4GA 1EX6A 2CBZA 4NKRA 2HF9A 4RZ2A 3LXXA 5P21A 5TV2A 4URVR 1BYIA 3FKSD 5BYJA 5AUOB 5BXQC 4CYMA 5HZHA 5JS7A 5KNCA 1S96A 2O8EA 1Y3AA 4GMXA 3ZZ0A 4ESVA 4GRAA 1ZCAA 1QZXA 1VCMA 2ODWA 2CVFA 1XMJA 3KB1A 4LJ4A 5FBLB 1ZM4A 3KX2A 3UWKA 3KFXA 3A1UA 2QI9C 4R98A 4ZCMA 2XJ9A 2GXAA 1CJMA 2FF7A 2P6RA 4LHWA 2KJQA 1ZNWA 3GD7A 4ZKEA 3T34A 3TK1A 1M6NA 2X8AA 5BQ5A 3U5ZB 2OT3B 2DBYA 2ZVPX 3BD9A 1SVOA 3CRMA 3QJYA 4FWTA 4TL9A 1ZAKA 2WOJA 1Q1ZA 3MRSA 4IXMA 5DISB 4URWR 3QEJA 2GCOB 1ELOA 4TYYA 2BBWA 1MABB 1BOFA 1GZSA 4XVQA 4C7OA 1KKLA 1OYYA 3MSXA 1XBTA 1PLLA 2YVUA 2YWEA 4Q7JB 4O0MA 4RZUA 4BASA 3QXJA 4LBWA 1G291 1GG2A 4UNRA 1WBBA 1LS1A 2GKSA 3GEIA 3FMPB 2JAQA 3D6TB 4QNMA 4MRRA 3X1WA 1IOZA 1AM4D 2PEZA 4HLUA 4B3FX 6Q21A 5L8VA 3UATA 4Q4LA 4IVQA 1F60A 1GITA 1TNDA 3W90A 2ZUCA 1W44A 4ZDJA 2WOOA 4JIMA 4LJ6A 2FN4A 1II0A 4EAQA 2BOVA 4JLDA 1Z0DA 1A7JA 1VKJA 2QP9X 1NLYA 2D62A 1CULC 1Q20A 4NYIQ 4XWKA 3RRYA 1G3UA 2ZE5A 2O8FB 1XTQA 3OESA 1GKUB 3I4LA 1P6XA 3AUYA 1QF9A 2NO1A 2E1RA 2R2AA 1KGDA 4Q1AA 3DOFA 3CIOA 3BGWA 2AFHE 1E2NA 3RC3A 3AF3A 2PMDA 2P2LA 2GJKA 3Q5EA 4BRUA 4NDZA 2OAQ1 5KUTA 2ZSBA 3PXGA 2NQ2C 2I4IA 4BLQA 4JYCA 1AK2A 3UG6A 2A9KA 2YNMA 3JZMA 2VP0A 4NMMA 2OLJA 2RGXA 4QXAA 4OHYA 2ZI5A 2H17A 1D2EA 3MMPA 1UAAA 1E9CA 1HEIA 1NVWQ 2ZE6A 4H1VA 1BH2A 3T5GA 3CPHA 1XTKA 1YQTA 1ZM7A 2KBFA 3B9PA 3GFTA 2NPFA 2QAJA 4NHOA 3TVDA 4DLWA 5B57C 1LFDB 2PH1A 2GEUA 2X1VA 3EG5A 4XSHA 4N0EA 1ZNZA 5JZVA 1S9HA 4N0DA 2J3EA 2AK2A 5KDLA 1G8FA 4CZ2A 3O8CA 3VHLB 4RFSA 2GAAA 3A1WA 1Z29A 2WZQA 3AGQA 4WAUA 4UKDA 4BE7B 4GNKA 4G5QA 2J7PD 3EWSA 2JDID 1OH7A 3K0SA 4DCNA 2H5EA 2WMNB 4QBFA 4TSFA 1Q3TA 1KY3A 4OI1A 5D3MB 2ZJZA 1X86B 2NIPA 1T3SA 3ZJYA 4C0KA 1FW6A 3O8RA 1UKEA 4II7A 3B1ZA 5IRCD 1W0KD 2CLCX 4P0TA 1VG0B 3QKSA 3U4QA 2ODNA 1GKYA 1G7CA 1TQ2A 3EC1A 3H1TA 4U02A 5FFMA 2JCSA 3U2QA 4OQXA 2ZUBA 3KXKA 4K46A 4L8GA 1IN8A 5E4FA 2GJ9A 3GLFA 2QRZA 2X2FA 2FFAA 4M9ZA 4MGIR 2RGNC 3OFND 1FUKA 2JJ8A 2OUKA 4I4LA 4M1SA 4RVCA 3EA0A 1K5GA 3MFYA 4PAOA 5EE1A 2VPPA 1NLZA 2W58A 1CEEA 1LV7A 3A1TA 1T0JB 2V6JA 4C0HA 3TAUA 1VTKA 1W4CA 4JKIA 2CNWD 2EFEB 1OKKD 4TLBA 1T8TA 1F2TB 3KZ1E 2RGGA 2WAYA 5AJYA 2DHRA 5FL3A 3QI2A 3VTKA 5CLLA 3OAAD 1DAGA 4F7WA 3EAQA 1P4SA 3H0KA 2QBYB 3AVUA 2V7QD 1KIMA 1M8PA 1KZGB 1TPZA 3CLVA 1E9RA 2C95A 1OYWA 2QEQA 2OXRA 3LO5A 1I4TD 5DLQC 4HUQA 3VKHA 4J0QA 1G7RA 1E0JA 3B1YA 1KSGA 3SYLA 4EPVA 5JHGB 4RZ3A 5F98A 3AF2A 5FUYA 3N2EA 4MRSA 5JWHA 4ILEA 4TSFD 5GVSA 3QG5A 121PA 2H8KA 5HE8A 4HAUA 3TR5A 1YZNA 4HAZA 1IY2A 2QQ0A 1N6HA 2HCJB 4DLUA 1G17A 1SGWA 3DM5A 2VBCA 1WDTA 2DWQA 2OSBA 5JSZB 1XTSA 4MRVA 5FTMA 2C9CA 3BOSA 4A0GA 1CLUA 3BH6A 5J47A 2B8TA 1P3JA 3OEHD 5C1BA 2KSQA 3LRPA 3MCAA 3WYAA 5EE5B 4HYYA 2GEVA 2ZRKA 1P7CA 2ZU0C 1NP6A 4L16A 2BMEA 1HE8B 3RS0A 2F6RA 4G5OA 1OLOA 2AN9A 2HF8A 4U7DA 3R9XA 4TYQA 1OV4A 4U5XA 3EC2A 2PCJA 3NTUA 1S0UA 3RLFA 2NO0A 3B1WA 4HAYA 3I3SR 3AEZA 1E96A 1NG1A 3LBHA 3BERA 2CJWB 4A8JA 1J90A 3KKNA 1OB5A 1Z8FA 3SS8A 3BK7A 2WTUA 3ZGXA 1N3BA 3NBFA 3AVWA 1QDEA 2Q6TA 2L0XA 4OJKA 3CPJB 3L0PA 2VQSA 4Y0VA 4D4JA 4GP6A 1XP8A 2OO7A 3EZ6A 4MKFA 2P67A 4FCTA 2C77A 4DJTA 3KQUA 4BFXA 2VF7A 4CW7A 4W7SA 1C1YA 1UDXA 4IRUB 4A9AA 3T5DA 1ZBDA 4QKQA 4XJXA 4TZ0A 3KJEA 5CM9C 4FWIB 2C03A 4C9BA 2W2VA 3BC1A 1NKTA 2ORWA 3NXSA 3CW2A 4KSBA 4AIIA 3R7WA 2C04A 3B9QA 3GLHE 5EXPA 5FPHA 4EJSA 3UMRA 4PPFA 1GNPA 4NONA 2MSCB 2VSFA 4Y0AA 2IW3A 4OHZA 3VR2A 3NHAA 3Q5DA 3IQWA 2WWWA 3U3JA 1KO7A 2XX3A 5FPTA 1IONA 2SHKA 2YWHA 3MJHA 1NN0A 2ZSFA 3CX8A 4LJ7A 1KMHA 5EZ6B 4BLPA 5HZKA 1XPUA 4MH0R 3HJNA 3AVPA 1DVRA 3TUJC 3FGNA 2PX3A 4E22A 3WY9A 1Q1BA 4D80A 5JCPA 5K8IA 4HZIA 2O8BA 3X1YA 2FNAA 2ZYTX 1U99A 3RRMA 4C0SA 2FSHA 4DUGA 1H8EA 2XXAA 2CJWA 2ZS8A 4LHVA 1FX0B 2ZRGA 4DT1B 2GXUA 5JHHB 4PSAA 1JR3A 1Z0FA 3K9NA 1XMIA 2BIFA 3LD9A 3OIUA 4RKFA 4URUR 1EFRA 3QXSA 4XSGA 1ZNYA 1NVUQ 4KXFB 4EDHA 1T91A 4US0R 3Q8XB 5J4LA 3CF6R 2IWRA 3C16C 4V03A 2BMJA 1UKVY 4PPGA 4TTPA 2ZU6A 1G21E 1M34E 1NBME 4B2LA 1DG1G 4QGFA 1KK2A 3EA5A 1NG9A 5TMPA 4A15A 4UJ5A 2GZHA 3RAPR 4F38A 2JLUA 2O0HA 1NN5A 2NGRA 4OQLA 3AVQA 1AKEA 4LJYA 4TLAA 3ZYCA 1KMHB 4EJSC 2J41A 5FOVA 4QG7A 2VSOA 1G5TA 1ZM3A 5DN6A 4I1VA 1YJ5A 1CS4C 1N5KA 1T0HB 4KBFA 4KI0A 3BBPA 4PAQA 3TR0A 3AH8A 3SNHA 1X6VA 3EZ7A 5F9HA 4JVSB 2FGKA 2W00A 4LPSA 2JLVA 2BCGY 3K9HA 3AM1A 1JXMA 5B58C 2CL7X 5KDOA 4B34A 1NVVR 5KSZA 5LB2A 3SDZA 4KLZA 4LJ9A 3AP3A 1EG7A 1FZQA 2WJVA 1QHXA 4MGYR 1E9FA 2PZFA 2QPTA 1R6BX 4JLPA 5C4GB 4NCKA 1YZQA 4WBSA 1FQKA 1G3QA 4IFBA 1KNQA 4Q48A 4RFVA 4G5RA 1BMFA 2WIBA 4M9XA 3BXZA 2IBMA 1H8ED 1KO1A 3QNUA 4IOMA 5CITA 1RPZA 2WICA 4NE2A 2QY9A 5JWRA 1EXMA 1X8LA 3ZDQA 1W0JD 3VAAA 1W48A 5F3WB 1ODFA 2YJTD 5E7MA 4B3GA 1FNNA 3TW4A 1ZIOA 1SULA 2OESA 3AVOA 1SVMA 3ECCA 2BVNA 3LNCA 1XD9A 4BFTA 1E6CA 3SJBA 3IO5A 5DGXA 4S2EA 1T9HA 3SHWA 4D0NA 4DHEA 1S2MA 3UMSA 4Q7KA 1R5BA 1ZRHA 3VHXA 2ZSDA 5DYIA 5J4YA 1RKBA 3ADBA 4KHZA 1WXQA 5TARA 5H70A 1TF5A 4OQNA 3AKYA 4QHTA 1IN5A 3K09A 2QSZA 2QSYA 4B2IA 3EZ2A 4JJKA 2ZUDA 5EP2A 5SZKB 4LBVA 3K9GA 1B0UA 1HT2E 4TL8A 3EASA 5B30A 3GPLA 4P3YA 1JJ7A 3B2EA 3U61B 2ZETA 4C0LA 4B74A 2WWYA 3PV0A 1XTJA 2BMFA 4PC2A 3BFKA 2ZEJA 5AUNB 4RFSB 1XDBA 2IEYA 2QPOA 2V6IA 1I2DA 2W6IA 4F92B 2WWIA 2HDNB 3C5CA 3BB1A 2XTMA 2LCFA 5AR1A 4B76A 1SVWA 4Z8YA 3GLGA 5L3QB 5M04A 1NMYA 3EPLA 3GLIB 2XB4A 1ZNXA 2DY1A 2GVDC 2W6JD 4WXPA 1KAGA 1P61B 4L9SA 1JEEA 2EWWA 4JL8A 2BBTA 3W8NA 2ATXA 5HPYB 2WSSD 4TTRA 1GP2A 3LLMA 1VMAA 2F1IA 2FA9A 3P4XA 5FH9A 2VRWA 3I1FA 4A2PA 1IM2A 2J9RA 4DLXA 3I5XA 4LBZA 5KOYA 1GUAA 3PR1A 1TF2A 1O3YA 1N6IA 3I8SA 4K8OA 4M53A 3CRQA 1SZPA 2AHOA 3W8RA 4NL4H 4GOXA 4BLRA 2OAP1 2GZDA 3IPYA 4KJZA 5FOUA 4Q7MB 1N6KA 4A4DA 1GL7A 4Q4AA 3KUDA 1GRNA 1SXJB 2OBMA 1KTVA 4D4MA 1EFTA 4DLRA 821PA 3T35A 1U81A 3A6PC 2Q0HA 1X1RA 3CZQA 3M4YA 3CBQA 1DTSA 2WAXA 3QEOA 3P1JA 2LKDA 3R20A 4B47A 5L3QA 5DH9A 1ETUA 3ZQ6A 4QJ4A 4ZCIA 1E1RA 4D81A 3S1AA 3WRYC 3HDTA 2PEYA 1YZLA 4WXRA 3ADDA 3IBGA 1FTNA 3NKVA 3A1SA 1IXRC 2JJ1A 2IYQA 1GRRA 1OFTA 1W47A 4UNNA 1GVNB 1CF4A 4Q1FA 2FZ4A 1W5SA 2D2EA 2QTFA 1YR9A 1E2LA 2QAGC 4RCZA 2VHCA 4JSTA 1UEIA 1Z06A 1SVKA 5C18A 2ZJOA 1P5ZB 3QIAA 3A4LA 4H9GA 4A36A 3QVVA 5IT5A 1OXSC 2IL1A 2FX3A 2E9SA 4A6PA 5H68A 2DWOA 3CNOA 4F4JA 2IYRA 1FNMA 3U44A 1HY3A 3EPKA 2BV3A 2HT6A 2NMVA 5A0FA 5K8TA 4Q9HA 4GL2A 4LGMA 3F8TA 4H1UA 5J4KA 1LNZA 1DO0A 4C2UA 2G9NA 3DMNA 4CEJA 1OH5A 1AS2A 4JMPA 1SVSA 1M7BA 1SHZA 4YDSA 3PIRA 3LVRE 4ZKDA 1UBEA 3HYRA 3H84A 1K5DA 1YVDA 4TLDA 5AJZA 2VHUA 3GJ5A 1NVVQ 1G19A 1T3LA 3GFPA 2RGNA 2VIIA 3BH0A 3GLHA 4HDOB 2RKOA 3RWMB 3SR0A 4W5JA 3KXIA 5FI0B 3WBKA 4GP7A 221PA 2F43B 3AKCA 5KTYA 4D0GA 3K09C 1Z5ZA 1E79D 2ZIAA 1G3IA 3DPUA 3JVVA 3P4YA 1XD2A 1CJUC 5CK4A 1N6NA 4OBEA 2CXXA 3ZLJA 5FUWA 4EPTA 2PBRA 4F91B 4OKSA 3S1AB 1JB1A 2HYIC 1OFIA 3WMFA 1NY6A 3V9PA 2VHQA 2EFGA 3RS2A 4YMTA 4LYJA 5FL7A 1KI3A 5IK2A 5JJLA 1XU4A 1GRQA 3TGPA 2XNDD 1Q12A 2DB3A 5G53C 4EQ6B 1Z6XA 3MWKA 5JMTA 3ZQJA 1A5TA 3QPUA 4X8LA 4TN1A 2IS4A 4X8OA 4Q9IA 3WBJA 1NJGA 1Z6YA 5CB6A 2H7VA 2P6UA 1A82A 3SFVA 2GVZC 2R6AA 4IDNA 2CL0X 4XTRA 4Q9LA 5DHAA 3B60A 2FU5C 1QHIA 4P4UA 4RD2A 2AD5A 3RS3A 2JJ2D 5A5GA 5C2JB 5C4MA 4YMVA 2EFHB 4EFLA 3R7WB 3RS5A 4EFNA 1UADA 2ANBA 2ZITA 3AGPA 4CEIA 4DCTA 1XEWY 4C0JA 3QBTA 3SE0A 4HB4A 4KFTA 4ITRC 1Q3HA 1N25A 1PJRA 1OT3A 1RVDA 4LYAA 3TSWA 2O8CB 2XZLA 1R0WA 2ZJ8A 4XWAA 2AXPA 3IDQA 5KSYA 3MAAC 2OV2A 3W6NA 4B3DA 2PMKA 1P62B 1VYTA 2QGZA 1JQLB 2ZM5A 4O3MA 2QG6A 3FKQA 1KJWA 2FWRA 1PUIA 4PC7A 2CHQA 4QHYA 3TKLA 3TLXA 1ZYUA 1M7HA 2PL3A 1G9XA 1BKDR 4LYFA 2DFNA 1J7KA 5HTKA 4Q9KA 1W4BA 3GLFE 1E2FA 1IAQA 2OM2A 4JL6A 3K8YA 2QZ4A 3WP1B 3AV0B 1Q0UA 4RKEA 4ACBA 2ZS9A 2CLSA 4FW9A 4PO1A 2WWFA 1TF7A 3JZAA 4MQBA 3ZZTA 1P73A 5GJWC 3V00A 1ZJ6A 3LFUA 3VR4A 2FJUA 5EE3A 1D9ZA 1ONBA 4KYUA 5JJIA 2C9YA 1COWA 3VQTA 1KO4A 5FR1A 4R2IA 4UXJA 4MUAA 4Q21A 3QXXA 1U90A 3CRRA 2QROA 3WRXC 3ONWA 4AI6A 3IUYA 5TDHA 4LX0A 4GT1A 1ZMXA 1AN0A 3EX7C 3O8BA 3CF0A 1FPMA 5DYGA 1ZD9A 3K0FB 1AIPA 1G20E 2ZYWX 3GJXC 3LBIA 4BQSA 4Q7LA 5KDDA 3SC3A 4N1AA 5HCNA 3T61A 4AG6A 3C41J 1QVRA 4HUQB 1OJLA 3SBEA 4QM7A 4DCVA 1JNYA 3X1ZA 4HUTA 4GOJA 4TL6A 2RGAA 3FYHA 5D3QA 3THOA 4DZZA 1C9KA 3E70C 2AD1A 1MH1A 5CB8A 2IX3A 3GJ8A 3REFA 2A30A 3BS4A 2NTYC 4DDVA 4XVUA 2PJZA 4OJQA 4O25A 3VR5A 1SVIA 3LAWA 5EUQB 5HCIA 3W5JA 4IOJA 5GADl 1VHTA 2FSFA 3AVTA 1KAOA 3SJCA 1JAIA 1N0UA 1F3OA 3QF4B 2HLDD 3ZZUA 5EP1A 4DWJA 1HV8A 1C4OA 1G1MA 4IVRA 1TUIA 4MKHA 4JLAA 5AJWA 4RJLA 3SEAA 4ON9A 1YKSA 3KJIA 2QENA 3L8ZA 3ZS8A 3SQWA 1XZPA 1RJ9A 2PCLA 2V54A 3L0IB 4XH9B 4BZQA 3THWA 5FOXA 4TZ6A 1WE2A 2WKQA 1J70A 2V8OA 3G0HA 3NBXX 3CUEF 1OF1A 4TT3D 3N5CA 2WM9B 4NU0A 4PSKA 2BBOA 1E9BA 4MGZR 2ZYVX 3G82C 3NEJA 1Z2CA 2WV9A 2CLDX 4ARZA 2J0UA 3MWLA 3PEUA 5KYKA 1KO5A 2ZRAA 2G83A 4IKEA 2OE2A 3GJ4A 2ZXUA 2OLKA 4L9WA 3KQNA 2RCNA 3K0AA 4LUCA 4BLTA 3VU9B 2ZI9A 2GESA 4OHXA 1S8FA 2BJVA 2ZI6A 3A8TA 4QGHA 4CEIB 1N6OA 3FFAA 4BLSA 1B23P 2ZJ2A 3ETLA 2GDJA 2YYZA 2F7SA 1XFAA 4C30A 3ADCA 2XXAB 1CBUA 4R2HA 4A92A 4DDTA 3RS4A 2RHDA 1G8GA 3O8DA 1W0KA 2O0KA 1LF5A 4MYHA 4HB2A 1E99A 4U00A 3LW8A 3FMOB 3QXHA 3T12A 4ZPXA 4OYHA 1G18A 2C8VA 5LDDC 4HLDA 3IEVA 4RD4A 5G3YA 1LS6A 3N70A 1J2JA 2OZEA 3FE2A 4B33A 3CPEA 2D4HA 1XXHB 4UNSA 2R8RA 3T15A 2CHGA 2D3WA 1J8MF 4KVGA 3QQ5A 5B64A 4NZYA 3IHLA 3E5HA 3FDIA 3VKGA 2GJSA 1UPTA 1Z0IA 5FPSA 2IT1A 3HU3A 2GCPA 2RGBA 4JSYA 2ZJAA 2GJ8A 2NO9A 5BW8A 2CK3A 4HAXA 2BKEA 5CIQA 1IN6A 3L2OB 4BFUA 5L3SB 4PAMA 1JXOA 3OHMA 1WCV1 4G5GA 1EFHA 4YMWA 1ZUNB 3BJIC 2F9MA 3FMIA 1KYIA 4GMDA 1UKZA 1JJVA 2F1JA 2EYQA 5FTNA 2JASA 4QBHA 1ZUHA 1NMZA 2VL7A 3CRVA 1G16A 1GL6A 2KBEA 1LW7A 2PX0A 4GOKA 3CH5A 2QU8A 2CCKA 1QHHA 3LLUA 1RYFA 4LHXA 2R6GA 4WVFA 1E1QD 2GRJA 2QMUA 5DO9A 2XZOA 1U8AA 2GK7A 4L15A 3CRW1 3PUWA 4I1UA 1E2HA 2V1UA 5J40A 4CGZA 3PFIA 4IXNA 3TE6A 1W4RA 4NCJA 1RJ9B 3A4NA 2JGNA 3GCGA 3K53A 1BO6A 3THWB 1OFHA 1KSHA 1U2RA 1OIVA 5TXGA 1QG4A 1KK0A 3LV8A 2VA8A 5EQTA 3TUIC 4QJ3A 3ZVNA 5TY0A 1XMSA 3FOZA 3M6AA 4MITA 4B3XA 1ZUIA 2O52A 5FUXA 3LDAA 5DIFA 2V9PA 4V0MA 3E2IA 2C2HA 1U0HC 4DUGD 3GEEA 3Q3JB 2EQBA 4M22A 3LQRA 4QFMA 2HT1A 1XWIA 3B7GA 1P75A 1AA9A 2QP4A 3GFOA 4B32A 1JR3D 1KI4A 2FPMA 3Q7QA 2X77A 3GJ6A 5FBQB 1G8YA 2ONJA 5EP3A 4URYR 4B6FA 3F0TA 2JA1A 2K5UA 2XITA 3F3YA 1G3MA 4TLEA 3HWSA 1RW4A 1RYHA 2DR3A 1NBMD 3EPJA 1KI8A 1RZ3A 4HI0E 3IIJA 3ZVRA 3GJ7A 4DC9A 1EFCA 2G0TA 1SXJC 4TLCA 5FTJA 2BEKA 1VG1A 1JPJA 3ZIAA 4Q00A 2QAGA 4EKDA 3FHTA 1WBDA 4B44A 4IEEA 2WPDA 4FXPA 1KI7A 2JLRA 2RAPA 2QT1A 3KKPA 4P4SB 3SJAA 3QVUA 3DDCA 2JATA 4TQUS 4FI3C 4QBIA 2G77B 1KY2A 4Q1EA 1G4UR 2JLQA 3OE7D 1YR6A 4JS0A 2ZE7A 1W2HA 4KVAA 4Q03A 4LJ5A 4NYMQ 3CH4B 3IEUA 4TMVA 3SZRA 4KO8A 5H8WA 4IOKA 4BFSA 3I73A 4RD3A 4QL3A 1TQ6A 1UM8A 3TQCA 4CDGA 1GFIA 3RHFA 5FR2A 3ND8A 3Q9LA 3CWQA 2OFOA 2BM0A 2MSDB 1ZD1A 3T1OA 1YZGA 1RFLA 2B7CA 4B71A 2OCAA 2VHTA 4IDPA 5FTKA 3W34A 1IN4A 3EIHA 3RNLA 4LSGA 4LDJA 4I99A 2HXYA 2Q3HA 3NDPA 4X8HA 5SZJA 3U60B 3L8YA 2HEIA 1BMFD 4Q19A 1G64A 3JVUA 1M1YE 1NSTA 1ZM9A 1WP9A 2DPXA 5D3MA 5L3SA 1ZD8A 2A5GA 2ORIA 4PANA 5EXTA 3TBKA 2KI5A 3FVQA 4M8NE 1JR3E 1XEXB 1EK0A 3D31A 1IY1A 1P2TA 3NBYC 4O2RA 4Z51A 5CM8B 3OEEA 2Q9CA 3KDSE 3MD0A 5AUQA 2O8CA 3NWJA 1TEXA 4POAA 2IXGA 1KI6A 4M9QA 1E69A 2P5TB 2RGCA 1GILA 1IHUA 2VHJA 2XZPA 2Z83A 4OK5A 5ANRB 4D4KA 1UF9A 2XSZD 2R6FA 4IFEA 3QXCA 4WZBE 2J87A 2YINC 2XOKD 1MT0A 3K0EA 5DHFA 4DDUA 4LV6A 4P31A 1NN1A 3VNUA 1XXHA 1EWRA 4PX9A 4OK6A 2FDCA 3G5UA 2J46A 2R6CA 2A5YB 1OB2A 1Z83A 1UKYA 3MGCA 1M74A 2CE7A 2I1QA 2IA5A 4G5SA 4HLUC 4PC3A 4JVNA 4R7ZA 1KDTA 3THYB 3UXMA 1US8B 4PO9A 3PVSA 1CJKC 1MO5A 1ZC4A 2HJVA 5GJBA 5E3HA 4HDCA 3C8UA 2HYDA 4DDWA 1EESA 3DMDA 1EX7A 2FV8A 2W6ID 3MJRA 3BORA 4D82A 2JEOA 2GF0A 2MMCA 1E9AA 1FP6A 3MUFA 3OIWA 3QPWA 2WVJA 2RMKA 2W6JA 1OKKA 2HV8A 4PC6A 1NI3A 4B3BA 4A2QA 4ZI2A 1DAIA 4YMSA 3NHBA 4FMDF 1IY0A 2V7QA 4Q18A 1NLFA 3I8XA 2XTZA 4Q4JB 5DI9A 3PG5A 4BFYA 2VTKA 5LPNA 3DZDA 4MYUA 2GXSA 2ZRIA 1PVOA 1QVAA 3R9WA 3D8BA 1E98A 3EIQA 4I1OA 3HPRA 3KXLA 1FL9A 3QY0A 4PPQA 4C7OB 1FMLA 3WYGA 3PCRB 1DARA 1L7VC 3CO5A 3NIBA 2FEMA 2GCOA 4PQFA 1DAHA 4JLVA 1DBSA 1VYVA 3B6EA 5JLJA 1AQUA 5J5CA 4AK9A 2QMEA 1VG8A 4B48A 3OIVA 2YKGA 1L8QA 1ANKA 4D25A 3DHWC 3CNNA 3LBNA 3DVLA 5FBVB 1UFQA 1S1CA 5KSOA 3AKEA 4MA4A 3AP2A 5UKDA 1TQDA
chains in the Genus database with same CATH superfamily
2BI4A 1G0OA 1KI1A 4URHA 3BMNB 4CL3A 3QYJA 3VR5H 1YCGA 1KI9A 1U2ZA 2D8AA 2DPHA 2GEFA 2XWBF 4OI4A 4WY8A 3IT0A 1XRMA 4QBTA 4ZVPA 4CT5A 3I01M 2XEXA 4PC1A 3DLBA 2QNRA 3T06B 3J81k 4G3XA 1HYGA 1AXEA 1W5FA 1OXTA 2JLSA 5B2ZA 4ETIA 5CB0A 1P77A 3K1JA 4Q4HB 2C7GA 1FVHA 1Y1TA 1YUBA 1U7WA 5INTA 1APBA 4MKRA 4WNAB 4R9RA 5T57A 1WU8A 2CLMB 3LQ4A 3FNGA 4O2LA 3L0SA 2VNKA 3C3PA 4UEKA 2GM5A 4YJ2B 5FWXA 4MKIA 5KWEA 2KS6A 1AO0A 1WU7A 4WA7A 3QG1A 4TMFA 5HM6A 5JSQA 1IBLB 4Z86A 1SQSA 4G86A 1R27A 3KQTA 2YC4C 2TMDA 1DWPA 2IIBA 3AVXA 2I6SA 4L9RA 3RV3A 2FLKA 3WNDA 3W7VA 5I3CA 4AY2A 1NUUA 4RKWA 1YZTA 4M0DA 2A94A 5JE8A 2IEGA 3FYUA 5JH7B 2ZYHA 3FUWA 3M5WA 3OE4A 1IZ8A 5KPDA 1FU4A 2IUYA 3VOAA 4TTSA 4C5AA 4NJEA 4ZVQA 4E0BA 2GN6A 4IQGA 5DSZA 3WTBA 1JV2B 1RRPA 4F4IA 4BP8A 4JEIA 1G1AA 3P9NA 5AO9A 3RWBA 2XRYA 3KHTA 1I36A 2M6RA 1PR3A 3T4EA 5CFPA 1E2MA 1BJTA 3UAOA 1PKXA 5FOTA 1FMJA 5A06A 3I32A 4FQ5A 4QFBA 2DPLA 1ZGJA 4IIJB 2I4MA 5TJHA 1NQOA 2EFCB 4ZT4A 3ZNNA 4DLAA 3W2TA 1L4GA 3JYPA 5B6PA 3G5TA 3H83A 2ZI4A 2RBGA 4E09A 5DHQA 4RZQA 4BB0A 2AMJA 3CZ5A 3CURA 2C5GA 1RCFA 4UVIA 3DNPA 1D07A 3B85A 1EFUA 1IUOA 4TKUA 1NRIA 4PQEA 3FWZA 1EXVA 2I0FA 3VPFA 2L2QA 4OEHA 2YZGA 4WOBA 1WUJS 4BAGA 1UBRS 5IF9A 3H2BA 1R2QA 2Q1UA 4Z4GA 3Q8KA 3KQKA 3LBYA 1GXSB 4HRYA 3ZCRA 1F2UA 3QKTA 5L7WA 4UBMA 1DRUA 4GSYA 1YRWA 3SQXA 2OL4A 4LYYA 4BTLA 2VH2A 1T2FA 2FR8A 1JG6A 1AC5A 1M67A 2WTNA 3HUUA 3SS7X 1NVDA 2R4UA 3WADA 1QBKC 3CKYA 3I92A 3IAEA 4H6WA 2D06A 4DCSA 5JQGB 1SBIA 1C30B 4BPBA 4AKGA 3WQBA 2VP9A 3K2QA 3QVXA 1XEWX 3K96A 4BQIA 1O87A 2EKPA 2YWFA 3R8CA 3V1YA 2YCBA 1NSFA 3EE6A 5H59A 1KK1A 4B4OA 1SVNA 3JCZA 1ODKA 2L42A 4D3FA 4LJAA 4OL0A 1UQRA 1IJEA 2Q5HA 3C4JA 4C0AC 1S8AA 1GCGA 1Z7GA 2GTHA 4V0KA 3RK1A 2H48A 1JQJC 2P27A 2W2OA 2WMYA 5DLPA 2F3PA 2R8YA 1LJ8A 3A3NA 3RSHA 1N2CB 3SHTA 3VPHA 3JQQA 4TRJA 3SU8A 4QICA 13PKA 1QGED 1KI2A 3N76A 1P5RA 2CXUA 1XVIA 4OLAA 4F3RA 5EQFA 5LYJA 4YWHA 3FR8A 2OEPA 2YWGA 2IPOA 3GCDA 4RAQA 1ES9A 3H6GA 3KYIB 3RR2A 5FV4A 1ONSA 1Z4IA 5DTQA 2QI9F 4FYPA 1ZK4A 3K3PA 1PHPA 2WU3A 2GYUA 1WXXA 2C9MA 2FN7A 4WOCA 4YBZA 3VH1A 8OHMA 3I5MA 3K9FC 1JQKA 1Z8DA 1P3Y1 2Z8YA 4H18A 3PENA 2IYSA 2ZROA 3BSFA 2IK8A 5D85A 3W9BA 4PBSA 2O59A 3VC7A 5K7SA 2DETA 3LXRA 1YBVA 1XLTA 3E1KA 4GI7A 1H5QA 1A9TA 1HYEA 1ORDA 4LCBA 3CUKA 1RHQA 3ABSB 2Q8NA 1YVUA 1JLSA 3LCRA 3M4XA 3TOXA 2QM8A 3H6KA 2X86A 3RRJA 3IJ5A 3TRDA 2R7AA 3O8QB 2I7XA 1MZVA 2PBFA 3NH6A 3ZDYB 3DTTA 5FL7D 4F12A 4QJ5A 3BD6A 3C8ZA 3OD5A 3RFXA 3VV2A 4AZSA 4TZTA 4FUTA 5LZ9A 3NTOA 4AY3A 1A8SA 1EM8A 1U7XA 3BWVA 3FRHA 3HK2A 4CF7A 5A04A 3KOYA 4LRXA 4OGGA 1LK0A 3E2MA 2R6DA 4KQXA 4LN1A 3HP1A 1L4NA 1UPXA 3U4QB 2OM6A 2PMCA 3AUJB 1O08A 1E62A 3OIYA 4L1KA 1YSCA 4R69A 3ZHBA 3ZR4B 2Y1GA 3A4MA 3OZVA 4UUPA 1CQJB 2NUBA 1JN0A 1I6LA 3HB5X 2PUCA 1DUSA 1DU4A 1MKYA 1SWVA 1R4AA 3Q41A 3ROEA 1PL7A 1WDLA 3LC0A 4DB4A 2XGOA 2R7NA 5F33A 3Q3CA 1PNTA 3PDIB 1GGHA 2JK0A 4LSWA 3HUEA 4PICA 3RG8A 1WPRA 3T94A 1C8KA 1DI0A 2VLBA 2P79A 2VSXA 4GWLA 4HBZA 3TW0A 2V45A 5DNVA 2XYRA 2ICAA 3HR4A 3LOQA 2XJ4A 5A03A 1LDYA 5JVDF 3FZNA 2C7PA 4AS1A 5K3BA 5G4KB 1RXSA 4Z99A 4M3NA 1FXWF 4BVJA 1WVGA 3GRKA 4US2R 1VJGA 4RSHA 3SM9A 4DAOA 3PXAA 1YAHA 3IH5A 1XRLA 4BNXA 2FPUA 4K81B 4HHEA 3UCEA 5A2QA 3ZHVA 5E8RA 4QT0A 2ZBDA 4S1TA 2RB4A 3KYCB 1D0SA 4N01A 1FFHA 3ICEA 4WKPA 5BNIA 1SEPA 2NSJA 3H99A 3OETA 4GQIA 4K2AA 4Y1RA 3IUNA 1HDXA 4NMXB 3RYTC 4W8GA 1AZTA 1ZCFA 3RAGA 4AJIA 5E6SB 1ZQ9A 5K09A 1G8PA 2H5IA 1XTZA 4I6GA 4L9AA 5B36A 5DULA 4DA6A 1CE8B 1ESMA 1FS6A 1YTUA 1JAZA 1N3LA 2PUAA 1QZZA 3V8RA 3S8YA 4Q16A 1L5GB 4B2PA 3DO8A 4QU8A 1GRVA 3TMKA 1YR7A 3CXRA 3G7NA 4M1YA 1NVFA 4JC5A 1T0PA 3IAS1 2Z0MA 3OIDA 3BRWA 4F6RA 4ACAA 2PX2A 3PFBA 3AP2A 2NUPA 1SUEA 1RWMA 2ECQA 5ARCA 1CYDA 3WGGA 3IB6A 3DUFA 4C0QC 1BYUA 2B37A 2VEDA 3FWNA 4FYKA 4DRZA 4E6PA 4FIZA 1UEJA 2H4JA 4BGDA 1LQTA 2IWHA 1YR2A 3QF7A 1TCBA 2IIPA 1RTKA 2VF8A 3BMCB 5IJ9A 5KTSA 4ARZB 3K0CA 2I87A 3IUJA 1HZJA 3PD7A 4KE9A 1CRLA 1DT3A 1YRYE 3HO1A 1EA7A 1PT9A 3U3MA 5DCYA 3DOEA 2HA2A 2QTCA 4YONB 4EVSA 2HBRA 1IQPA 4Y2UA 2IOFA 1G21B 4Q6BA 3T5PA 1R10A 2SNIE 2AZXA 4FN4A 3UT5B 3LA6A 1H2ZA 3C0KA 4CR7A 1NI4B 4QXPA 3LVBA 3PXBA 1MF7A 4FS3A 2DQKA 4CEHA 4MYTA 4ZAFA 1Z6TA 2ZUVA 6REQA 1YOVB 3HBAA 3HJTA 1XAGA 3EVNA 3N3AC 2O7SA 4HL6A 4UUBA 4X60A 3MT9A 5KHOC 1CFJA 4E21A 2CB9A 4RIFA 5H02A 4ZZ2A 3O3OB 4D9FA 5I9BA 4REMA 2GJAA 2NADA 3A31A 4XCQA 5GONA 4B4UA 4Z54A 2O4CA 2AG1A 5KTOA 1E5QA 3RVBA 2AF4C 4D0SA 4DLVA 5EHXA 2D7DA 4ID3A 1X1QA 1F1JA 1TDJA 4HDKA 1PRYA 2DCMA 2FH5B 4HDKB 3UB3A 3R2JA 4XD7D 2Q50A 3TTYA 2WT9A 1F2UB 2QL7A 3N87A 3X1JA 3PEVA 1R8QA 2R5NA 3PHBE 3ZKWA 3O84A 3WP0A 3IQXA 1J0BA 1YMVA 3WFZA 3ZIUA 4IS3A 2IHNA 2WBLC 1XJQA 1ZG3A 1UMBB 4GYKA 3E05A 2PUVA 2GA8A 2N1BA 2OGSA 1M8FA 3H2YA 4ZVTA 1JFFB 4WA8A 2DR0A 4F6LA 4MRPA 2NAPA 2G88A 4R2JA 4TT3A 1C3LA 1XK7A 4EPXA 2GMWA 4QRDA 3O8OA 1G5PA 2AK3A 3SKVA 4K0KB 4M2LA 3IT2A 1YONA 1ZOLA 1WMAA 3DE0X 1ZIPA 1ZC3A 1QIEA 2RAFA 1B42A 2X6RA 3WO1A 4GWKA 2JKVA 4BV2A 2QRKA 2EEPA 3DBLA 4QEKA 1KY5A 1LLCA 1TYDE 2FN3A 3A6GA 3K5IA 5G0SA 3WMRA 3WL4A 2PUJA 2I2XB 2YQ4A 3BTOA 1T5IA 3WMWA 3P2KA 4PZZA 5AXBA 3FYCA 1BAPA 3CTPA 4E7OA 1X7XA 5J58A 3EGWA 2JZCA 1IXSB 1F12A 1NJ8A 2PJRA 2ZSJA 1NP7A 2REQA 4KMSA 1PJ3A 2BH9A 2QX7A 2ZIXA 4I50A 5C31A 4ZI7B 4Y2RA 2R5FA 4DKJA 1W4AA 2A5DA 2Y68A 2JFBA 4JBIA 4CWAA 2X3YA 5C5DA 4BPRA 4HAOA 1LA2A 1MXFA 3PUXA 5DXJA 4YJDA 4BJ1A 2DFTA 3KYBA 1ZCBA 2QQ5A 4UU0A 1VPTA 5EZYA 2EC5A 4ND8A 3WIEA 1JYSA 1EJ0A 1RJDA 4LQCA 2CD7A 3GMTA 3OLCX 2JLWA 5EA2A 3HFRA 4ZV9A 3KKOA 2CL6X 4G4JA 5CX1A 3S8EA 4OUKX 1EBBA 1T2AA 2QORA 4FKBA 4MMYB 1AKMA 4RA6A 2FPGB 1T24A 4P22A 1UBUS 4P9NA 1CUAA 3AT1A 5E95A 1P2UA 3G2HA 3H4VA 1E2DA 2B36A 4DM4A 1T3HA 4BNIA 1ORTA 4TTQA 3TDNA 4V1CA 3D4NA 2FZ5A 2GYYA 2OVBA 4CLHA 4E07A 4BVEA 3CNLA 4LJKA 5JXIA 4H17A 3NCHA 1YS1X 1CY0A 1HLDA 2OCGA 5CFRA 5ED4A 1USWA 2HSDA 1PT7A 1DAMA 2V4ZA 5CT5A 1V5FA 1EBUA 3NG1A 2H51A 3DZCA 3EGOA 1DRJA 4JLWA 2PJDA 3DAPA 4HEQA 3N59A 1F0PA 2IXFA 4N39A 4JJZA 4IIFA 2V7TA 3DZ8A 4X63A 3ZD8A 4COOA 2O3SA 2CK3D 3KKZA 3OCCA 4DKXA 3NHWA 4OH7A 2LBPA 1D2MA 3VR3A 3LJKA 1PUJA 3AEUB 1GNQA 4TGLA 1RXIA 3CUUA 1EFDN 2ZBVA 3E7DA 4JX8A 1P2SA 3WAGA 5K51A 2NAFA 3RANA 4URXR 1KMNA 2ZRPA 3LDHA 2AV6A 3RB8A 2EKQA 1U7ZA 4HNSA 1T29A 5AVUA 3BB4A 2QLLA 4QYTA 4B3CA 5LQCA 1WCIB 4ZT2A 4BTVA 3AWDA 1Q21A 3M6XA 2IHUA 2XCUA 4KU4A 3OE7A 3T1NA 4F93B 4BX8A 4FMCF 1A0OA 1B4DA 1E1QA 3ZDEA 1UIRA 4G9BA 3QX3A 2IYFA 1NW4A 3EXG2 2F64A 2RGRA 3NHYA 1T1SA 3BL6A 4EJSB 3D5TA 2PG3A 4X5OA 3NTLA 5AOAA 5F3DA 2OG1A 2O8NA 5CM2Z 5KYYA 1P5HA 2OKCA 4BEJA 2BEUA 3CNQS 5DASA 1D7AA 1KZ9A 3G13A 3G7SA 4HQLA 3ZDRA 4CN8A 5GJVC 1K0UA 3N2NA 3OSUA 4NLLA 3CKMA 3H11A 3EUEA 2YFKA 2QRLA 2JFQA 1OBHA 3O03A 3OUZA 1H2WA 4CLRB 2BYTA 1ESNA 1E2GA 1O03A 4LGCA 3SF0A 1H1LB 3KLMX 2YHIA 1ACJA 4MP6A 2W5UA 2BFDA 3Q7EA 4LYHA 2DG2A 3FHCB 1YQWA 1UFKA 2RHBA 3CINA 3CZPA 3F7NA 1CR0A 4EG4A 3UCFA 3R5FA 4KSCA 5FOSA 3U48A 4ZIRB 2V5UA 4MQ6A 5JEDA 2EJVA 4MV6A 5DP1A 2P6MA 2G9QA 3N8DA 3ER8A 2PLRA 3QK7A 2V8BA 2AA3A 2ZRNA 1IQUA 4D9IA 1KORA 1BXRA 3RBAA 1ZD2P 4G2TA 3SI7A 1Q1QA 5D3KA 5DNDA 3OQIA 3QTLA 2ARKA 4MX8A 4C4XA 4EW3A 2XSZA 1XSEA 3AW9A 1XX6A 4J6EA 1UL1X 1V39A 2E3JA 2UYQA 3EF1A 4L6AA 2AUMA 1H6BA 1FDSA 3A2MA 2R62A 4PYIA 4E2ZA 2AL7A 3GVPA 1E1DA 1SZJG 1VLQA 3FI9A 4GBMA 4LDZA 4JEUA 2AW3A 3M34A 3UF0A 5HVNA 5F73A 3ZY6A 2A9JA 2GJ4A 2G3YA 1RHRA 4B35A 4IUYA 1GTVA 4WEOA 2AE1A 5EHZA 5DVZA 2DUNA 1I2CA 2JGEA 5A7FA 1T1GA 4O63O 1OC4A 2X0RA 3WKAA 1ZVVA 4YWJA 2VATA 1SD5A 1IBSA 1TM4E 3E9EA 3BT7A 3NMUF 3RC8A 4E4YA 1V3UA 1O6ZA 1W94A 5AIBA 3OFNA 2TMKA 3TAHA 1NV9A 1IVNA 3OP4A 4M46A 3U62A 5JFGA 1QQAA 3I64A 4O2AB 1NF3A 5B4UA 4MR7B 2HMYB 1Y37A 1GDTA 2J08A 1SKYE 1CVIA 3C7KA 1K8YB 4X3OA 3IBYA 2DVMA 1E2EA 1VDZA 2JFPA 4XPIB 5JARA 2GZ3A 4LAFA 3SXUB 4MO2A 5JI2E 2G7MC 2AFIA 4JR1A 4G84A 5GOTA 1DPFA 2XYQA 5FNVA 4JYBA 1E9DA 1YFLA 3EUFA 3HZZA 4QODA 3AM4A 4M9CA 1ENPA 2P35A 2YBEA 1KHTA 1X1TA 2VYFA 3KQHA 3ZWBA 1W5TA 2IYLD 3PF8A 3LLSA 1QIJA 3DTNA 3AR9A 4O4LA 2GEKA 5TB5A 3TTTA 1CEQA 1A7AA 4UUQA 1DRWA 2IYTA 2IF2A 3KB6A 3JVDA 1FFDA 4UUAA 2FMUA 3GJYA 2WD8A 3KT3A 3P0IA 5LLSA 5CEEA 5KJ6A 2OCLA 5FD8A 3NDBB 1SUCA 4PW0A 2J09A 5IT4A 5ICEA 4JT4A 5DGHA 5ADHA 1A9YA 3SKXA 4DJ5X 4FCVA 1LU9A 3R0QA 9LDTA 1T15A 1VSQA 4JLOA 4EBFA 1Q50A 2I66A 4TM7A 4JGBA 2VZ0A 3OJ0A 2WY2D 1NXVA 3U16A 2HY7A 3QOFA 1NUTA 1A9RA 3ADOA 4KR7A 2AG5A 2FQXA 3LLVA 1MG5A 1MOSA 3TNYA 5AVRA 3TJZA 3NFRA 3LUPA 1T6XA 4GBJA 1AKTA 4JJIA 3NBUA 1CIPA 3RDPA 3VX4A 2CYAA 4N0MA 2R0QC 3H1BA 3CWZA 4ZYTA 5CH8A 1KDZA 1FLDA 1SELA 1R0SA 2P78A 2XI4A 4IEIA 3TO5A 1XC7A 4C88A 5HYVA 2DEUA 1YK1A 4G67A 3IPXA 2WLSA 4X7RA 4V0ME 2A57A 4KAXA 1PIWA 4GM1A 1Y6QA 2JI7A 5JS2A 2PZBA 4QRHA 4TMZA 3TNFA 2IY8A 4MS1A 1UH5A 3WHKA 3RGWS 1MR3F 5KNBH 2RFLA 5JVDB 5TE9A 1I33A 3C15C 1RE0A 2WB2A 1PZMA 3OT4A 1J09A 3GGOA 2R7LA 3D4LA 1R4NA 4YRGA 3JQPA 4N3AA 2WKRA 3F7TA 1NBAA 2B82A 4DIDA 4CR8A 3LVFO 2NXNA 4ENRA 1UFOA 2CDNA 2D7CA 1V5WA 3FRJA 2I6XA 2HRBA 1ZSYA 2HR1A 1A27A 5DXAA 3PKJA 5CCXA 4E5DA 4QPZA 1YR8A 1P0PA 4W9MC 5EXXA 2VDPB 3FB4A 1TO1E 3LGAA 4TSRA 2CJFA 1BA2A 3QA9A 3HR7A 1EE2A 1JJBA 5DPMA 5IC6A 3Q8WA 5F23A 3KJQA 1YA6A 1K92A 1QAMA 3IGFA 2FCRA 2J9GA 3E53A 5FOWA 1MA3A 4B84A 4KFRA 1LPPA 4ZI3A 3LKVA 1JB9A 1IQRA 2HA5A 1EVIA 1GRCA 1XVUA 3COJA 5AW9A 4WLFA 2X0NA 5CYPA 2QUAA 4CKYA 2SKDA 5CB4F 4FBMA 2I3BA 4IIVA 3Q0EA 4HDNA 4UBJA 3DDOA 2AN4A 2QYSA 2XUDA 3IUQA 1Y7TA 5AUPB 3Q8LA 2XDAA 2FVYA 2XGSA 4MUXA 1C3XA 3DOUA 3GQVA 3BFVA 1EGAA 4HVTA 3IP5A 2NACA 2FOLA 4FD2A 3C3JA 2FSIA 2C7BA 3WGZA 3EPHA 1DC7A 3U3XA 1Z2AA 1NM5A 3IE2A 2X6TA 3DAFA 4DQUA 1SCKA 4NG4A 1I3LA 1M1NA 5I4IA 1CUSA 1C0PA 2V55B 3UJCA 1J9EA 2ZB7A 4ZC1A 1NW7A 2WWGA 3GOQA 4XB6B 2Y9MB 4NQZA 5IHPA 4KHPB 2I91A 5KEIA 5ICCA 3W3ZB 2PS3A 1E1NA 2QWXA 1L7NA 2OA0A 1WF6A 4FOLA 4ALLA 1QIKA 1K2WA 1T5DX 5AXDA 5ALNA 5IG2A 3IEXA 3INTA 1QGUA 3G8CA 2AW5A 4C5CA 5KVVA 1H8HD 1YQGA 2LRHA 3Q72A 3RYFA 1JSXA 1L5QA 1PG5A 2FUNB 3AB3A 2PS9A 3LPCA 4F8JA 1K98A 4YIHA 4V0OA 2ZTHA 4WE3A 3USZA 2RARA 5IVHA 3C97A 3DL2A 4I81A 4MW4A 5JECA 3GFVA 2XQFA 2AB0A 1KVSA 4PINA 1US8A 3ZHTA 2RHGB 3KU1A 4F46A 1KY4A 5AM5A 5TX7A 3W5UA 2R9VA 1DWQA 3BZBA 4PRZA 2FYTA 4H15A 1D5CA 3BL8A 2H4ZA 1EGMB 2LV8A 4EENA 4OBWA 3KJNA 4WKGA 2XVZA 3ACBA 2RBEA 5KNDD 1F0NA 1EVJA 4ERNA 5IHXA 3I9NA 3R77A 3TUZC 4ND7A 1OA1A 1MNAA 3UQZA 2SKEA 3IHKA 1KI6B 3DZBA 4LOAA 4HH0A 5CVCA 2BKXA 3Q3VA 3PI7A 5DI3A 1CV2A 3VU9A 1UJ5A 1H6CA 2F3RA 5HIJA 5A3JA 1EX9A 4BJ3A 3CVOA 4EMTA 3FTQA 5I4KA 4NCIA 2AJTA 4R54A 3NBQA 5SYMA 4CLOB 4EB6A 5I4BA 1S4QA 4HLQB 5DOZA 3MGBA 4WK6A 4LFAB 2R4QA 5DU2A 4ND1A 1RPNA 1YH3A 3GW8A 5L7TA 1K7YA 1WRBA 2G1UA 4QUAA 3AM3A 4NBRA 4QXQA 1M6WA 4U7GA 2JANA 2YMLA 5LP1A 1KEUA 4LY6A 4LI3X 4B82A 2X8WA 3TEFA 2YOGA 3PU6A 3DBIA 3PDHA 1YVPA 3GYGA 3EN0A 3UK7A 2AFRA 3DYIA 1OZGA 4WLEA 3ABIA 4YAFA 3RVNA 4YRTA 3GLRA 2XXJA 2O2CA 3ZWPA 5KVAA 3EQZA 4DEXA 5FBHA 4CCYB 4EK9A 3DKIA 1Z18A 4ZHQB 1Y1RA 3QEKA 1SCJA 5AK6A 2GLTA 2ZIWB 2P9ZA 3D81A 4OY3A 4RZSA 5DM0A 1T9AA 1C7QA 2Q62A 1FDIA 2ZE8A 3U80A 3VVLA 4CEJB 3GNLA 5K0JA 4AKIA 1NY5A 2RGDA 3SF8B 4PHTA 3LGXA 2CMKA 1NQTA 3UAWA 1JVBA 1KJYA 3FTNA 3TI7A 3OQMA 1YTLA 1IQ0A 3GI1A 4GVLA 4D9HA 2IH4A 5AKZA 3MWYW 4MV1A 4PXAA 2WK1A 2BFEB 2J59A 4C4AA 4ZXPA 3T3OA 1Z7BA 4GMFA 2Q7DA 2F90A 3DDHA 5FPKA 1PLJA 4KBYA 2LIPA 2HC9A 4O8ZA 3W6OA 2QYOA 2DLCX 3RO7A 1TADA 1YE8A 4Q3CA 5EWJB 3D6UA 1KWKA 3SZUA 5LD2B 3SC4A 4I4IA 3RABA 2OWDA 5SYNA 2XGGA 3VGJA 3AQ4A 1EE1A 1UP4A 3BM5A 2FRDC 2XWPA 2C99A 5ARDA 3RRZA 3VYRB 3MRTA 1GT91 4C05A 1G8HA 4ZAGA 1I30A 2RE8A 4NARA 4BMVA 4GVPA 5TMEA 1ZGZA 1YJBA 2Y76A 3R3WA 4C4ZA 5J2TA 4Z49A 4EG0A 2QE7A 1N6RA 3A05A 2A1IA 3HR8A 1SG6A 2N46A 2F4NA 3TJMA 3E9YA 2BH2A 1QO9A 4OHOA 2PZ8A 1BGXT 4MLZA 2IHJA 4NZZA 2H4YA 2JLZA 1P9LA 3IAM1 4BZXA 5DF1A 2ZJYA 3FFXA 2GS9A 1GCUA 2ZUSA 3DE4X 4WJZA 1V1RA 4ZTZB 1EWQA 2QD5A 3O31A 2PKQP 4Q4AB 2C0QA 3MQ4A 4KJXA 1NDHA 5C34B 2WAAA 3HC7A 1P8JA 3OPQA 2A7QA 4MJ3A 2YW2A 3H1PA 2NYRA 2DH6A 4CLEA 1MC1A 5EN4A 1EDEA 2R00A 4L50A 2CNOA 4YP6A 2QTVB 1JALA 1RU3A 1SQ5A 3PJEA 4HBGA 4Y0NA 4KR2A 4W5NA 3ZHSA 5AVKA 1KAQA 1KA9H 3ZC3A 4DLBA 2FEOA 1WF3A 4RD0A 2RHMA 4BQFA 5FUYA 5BN1A 2IS6A 3BRWD 2HHHB 4PTYA 1YQUA 3FETA 3ML1A 5CNJA 3KLNA 4AURA 2QT0A 1BE0A 3D0OA 3GGJA 4KZKA 6AT1A 1L5VA 3SHFA 3V7UA 3GLFB 4WTOA 2BBSA 1FQJA 4HSEA 4PLCA 1PS8A 3ASZA 3HSKA 4H7PA 5HEKA 2XCLA 2B2NA 2ZJ1A 2AI3A 1LB1B 5IZCC 2OHFA 5FX2A 5CEJA 3EH2A 1NIJA 2CNKA 4JQZA 1TTPB 4EYEA 1AY0A 1J24A 4PZDA 1Z0UA 1Z07A 4NEHB 1P2VA 5M3BA 3W5SA 3GLGB 1GSIA 4GRDA 1HMPA 1JHDA 5CK5A 4YROA 3PJGA 3L9XA 3WNCA 3RVSA 2CLOB 4DM3A 1G8MA 2NOAA 3KRTA 3O0TA 3E0XA 1WP4A 4IY1A 3SZLA 5IM4F 1XRQA 2I55A 4QTUB 4V0NA 4M37A 1JT9A 3L7OA 1W25A 2CF5A 1CJSA 1T0IA 3S2IA 5ITZA 5LDHA 1OHHA 1K6EA 4LA4A 1U7DA 4UFNA 5G4LA 4KQFA 2ZB2A 2VYVD 1TT7A 1BCRB 5IAAA 3JD2A 2R8BA 2FZCA 5B3KA 4HGQA 5ICFA 3ELWA 1AQJA 1LY1A 4GX1A 3CLHA 3ET4A 4U7HA 1UBNA 2KWIA 2AFHA 4MXDA 2TECE 3MS7A 3SBXA 3MA0A 3RFFA 1X7ZB 2XOXA 5CBPA 3BL5A 3A1CA 1J6UA 2V98A 2OGWA 1Y42X 1PBTA 3HDHA 3K31A 1IXZA 3GVCA 3DMRA 3GRCA 1VA5A 4YCDA 4MWBA 3B20A 5KNCH 2G1KA 4O2AF 2C5AA 2Z8YM 1U3VA 2ZWAA 2IV2X 3CJTA 3ZGLA 2R751 4NCBA 4TMXA 1KMQA 2EBWA 4GYJA 3I58A 1RM5A 2NPOA 4WQMA 4EB3A 1ETHA 1ZD4A 4AKSA 1AKVA 2W8BB 1L4UA 1RIFA 2REBA 3OF5A 1SC3A 3I2GA 1HE1C 1KOGA 2YXLA 1XEXA 2HJWA 5IT9A 4JCOA 2PD3A 3AR6A 4QVKA 4FLEA 2RC5A 2VF5X 3T7JA 2PX5A 2FMXA 3LWNA 3A9UA 3PQCA 2JHCA 5D6OA 5TQ0B 1TI7A 4ANFA 1KEZA 2Q2OA 3HMQA 1CIVA 2O5VA 2VNSA 2K2WA 2W2TA 3A4YA 3IP7A 3K9LA 4QLAA 4UMVA 5B6IA 1T35A 1EX6A 2QTZA 5P21A 5D8DA 4KUHA 4JK3A 4CIBA 4CYMA 5JS7A 2Q3LA 2O8EA 4UDXX 2J67A 5B37A 3EFBA 4AULA 1HEUA 2Q29A 1ZCAA 1VCMA 2OC9A 2ODWA 3KPJA 4RYDA 1Z4NA 4MVJF 2YJ6A 3PQEA 3VZSA 1AHPA 1N57A 2YV3A 1AK9A 3KFXA 3SBOA 4ZCMA 2XJ9A 2FF7A 2P6RA 1EP9A 1PG0A 1Z5NA 2HRQA 3BHNA 1OX5A 5SY4A 3FPLA 1KGSA 1Y7LA 4O4HB 2GYWA 5BQ5A 1NR5A 3Q88A 4Z2AA 4TVBA 5C8YA 2OT3B 1NJ1A 5KJ1A 1QUEA 2DBYA 2ZVPX 4FWTA 1PQUA 3RUIA 2QXUA 1JIVA 1Q1ZA 3GJQA 4IXMA 4PM4A 5DISB 2EJTA 4WBNB 2OHOA 4GSKA 1MC4A 3FZQA 1TO2E 3P2EA 5A05A 2WYVA 5DYNA 1RPJA 4ALMA 2OD9A 1QF6A 3HGTA 4M1EA 1KWGA 1K7CA 1OYYA 1SUPA 3ZDZB 3EZNA 3ZGZA 1DRVA 3MSXA 5FQNA 4Z0HO 3FWHA 4G9EA 1XBTA 4Q7EA 2JFWA 3HJRA 1HDRA 2YVUA 2YWEA 5ALMA 4CV1A 3AHHA 4L3OA 1T9BA 3STHA 5IU6A 4O0MA 4Q05A 4BASA 3WLJA 3EXIA 4UNRA 2AZMA 1LS1A 2P90A 3DZJA 1QANA 1NQ5A 1BN7A 5LQAA 1VJDA 2YXEA 2MINB 5L8VA 6Q21A 1U7TA 1B26A 5A6SB 5CDYA 1TNDA 1H2XA 4QDXA 3SIWA 2H6EA 2PWYA 2VBFA 4XRRA 5I45A 4WFIA 1O94A 1JVSA 4JIMA 1K27A 1QGYA 2AZ4A 2BRUC 4LJ6A 4EAQA 5ELMA 3ZDDA 1O6GA 1Z0DA 1TOAA 2WEKA 2PNJA 2QP9X 3RVDA 5A1JA 5KREA 3S3TA 4XWKA 3SR4A 3VOSA 4UOEA 4C06A 4PCVA 1SUWA 1QF9A 4PBTA 1KGDA 1DEAA 3D6NB 5ENVA 5BSRA 4WN9B 1ISSA 2PMDA 3AF3A 1UPUA 1Z2PX 3UK1A 1KEVA 4BRUA 2JCBA 4NDZA 3UWPA 1ZH4A 5BRJA 2BKAA 5KUTA 2NQ2C 3AG5A 3E9RA 4BLQA 1V71A 1PR6A 1MB0A 2YNMA 4PLTA 3C1AA 3KVYA 4NMMA 1I13A 2OLJA 1JR2A 3FCAA 3S1LA 1TM3E 1CDZA 1EQ2A 1D2EA 4KO4S 2O0MA 3DF7A 3OUTA 1TQHA 4NIMA 3WLFA 2O20A 3KEFA 4JVOA 1DCTA 3A6PC 1BH2A 1RXVA 5I47A 3RTGA 2B69A 3BEDA 1EFVA 3V55A 4XB1A 5B57C 4DLWA 5D5PA 2GEUA 3EG5A 3QVOA 4N0EA 3T4XA 4QTYA 5A71A 1LGYA 1WDWB 2J3EA 5IBCA 5KDLA 5BPHA 1OWPA 2FF5A 4GXQA 1R66A 2H4XA 3QFTA 4J0IA 4KL8S 4RFSA 5F5XA 4G0ZA 1VKRA 3JV7A 4WAUA 2GRUA 4G5QA 4F86A 4GL4A 2PMBA 4N5HX 3TSAA 2PLWA 1T2DA 3CN9A 4DCNA 2WMNB 1C3OB 4QDOA 1Q3TA 1Z82A 4OI1A 4HRAA 3OTWA 2ZJZA 3TRIA 2C7VA 1T3SA 3N8IA 2UZ1A 3ZJYA 4C0KA 1ZHOA 2W6OA 3STXA 5AIAA 2YMPA 3NUGA 3TFWA 5IRCD 1HDYA 2CLCX 1IZZA 3DAHA 3HVHA 3EMKA 5BNFA 1G6KA 1VL5A 2BR5A 1N92A 2JNWA 3QKSA 2B35A 2FPSA 5F4BA 2FMKA 1Q3KA 4LE0A 1GKYA 1CIJA 1G7CA 2P6PA 3H5RA 4P38A 2JGDB 3OTHA 4Y9UA 3ZU2A 1C3JA 5EPOA 3U2QA 5CLJA 4F9FA 1IN8A 3DDSA 3I12A 5TQVA 2FFAA 2VXBA 1J22A 4WNYA 1FUKA 2A0FA 3Q0IA 4MHOA 4UEQA 2FB9A 4JLUA 1R0BA 1SHJA 1T36A 5I7UA 3IE1A 1C29B 4IWNA 1NDQA 1PS9A 2G9VA 3HVIA 1NLZA 1NOJA 1ISPA 1Q77A 3F6BX 1A96A 3LHKA 4KWHA 3T0GA 1O5TA 5LIRA 4RF2A 1XNRB 1T0JB 1C5KA 1NNSA 2QVYX 3NKFA 3GLKA 4MUIA 4BMCA 5AM2A 2HU7A 1CLEA 1J7JA 2ZTUA 3QLEA 4CIWA 5JCOA 2MDTA 1QB7A 2BFNA 2WTAA 1HORA 4RJJA 5CLLA 5DTJA 1DAGA 1Q6YA 2NT4A 3EVFA 7ABPA 2WU1A 2E82A 2VDWB 3Q7IA 1YQ9A 1SUFA 4CHGA 3H0KA 3AVUA 1DC8A 2V7QD 1UR5A 4REOA 1KZGB 2HRRA 4F2HA 2C95A 3EDCA 4QUGA 4CG1A 1RQPA 4I5GA 1WULS 4NI5A 4YA6A 2QEQA 3ROKA 5BOVA 3RVMA 3SC2A 4HWPA 4NZPA 5DLQC 5EC8A 2AFIB 2X9VA 3AHDA 1RMTA 2R66A 3HH8A 4D7AA 2JFOA 2OR3A 3D5EA 3GVIA 3B3FA 4QDZA 4RZ3A 3UBMA 5F98A 4A73A 1PL8A 5JYCA 3ZJUA 5KTMA 1CD5A 1LQUA 2X6QA 2QD3A 4KQGA 3WVNA 5KINB 3W5BA 5A6VA 1JLMA 3L07A 5HE8A 1QM5A 4HAUA 3S4YA 1YZNA 3TR5A 3VTAA 3NXKA 1G17A 2HLPA 3NOQA 1XTSA 2XUFA 2B4RO 4P3OA 5FTMA 3QEAZ 2C7QA 3AIMA 5E2IA 4RZIA 1SRQA 4OXXA 3TZBA 3ROTA 1YI1A 4MUFA 1SR8A 1OQAA 2GZ1A 3OEHD 1GZ4A 3LRPA 3MCAA 3KJXA 2GEVA 3FOWA 2V9CA 1YVRA 3FDFA 5DV9A 1NP6A 2BMEA 3LPDA 2DFPA 1OLOA 4TV9A 3R9XA 4TYQA 1N2IA 4J75A 4EHJA 1OV4A 1LI4A 4X93A 4EHKA 3NTUA 4KKVA 2W7TA 3B1WA 4JC4A 1R50A 4MW6A 3I3SR 1GQFA 3LZCA 4E2WA 1D2HA 1NG1A 5KC9A 2CJWB 4NATA 4XZ3A 1T1JA 2AE2A 4I2VA 1B3BA 2YWXA 5F1OA 1OYOA 2B2CA 3BK7A 7REQB 2C9ZA 2ID9A 4X9XA 2WTUA 1IPHA 1T9CA 2Y1XA 5EJFA 3UT5A 2EIXA 3R0JA 1QDEA 3I0ZA 3W0LB 1WZ2A 2L0XA 3DEYX 5IN4A 1CUGA 3FYUC 4OJKA 4KVZA 4EHFA 5BURA 3L0PA 1E5VA 2VQSA 4G1VA 4KG7A 4D4JA 4UCWA 3H9EO 3KVNA 4PSDA 1XP8A 2RHJA 3QLJA 3K4HA 2JAOA 5TF4A 2QUIA 3FLAA 2BMWA 3M2PA 3DCYA 2C77A 4FC6A 1E6WA 4LWOA 5GPBA 4DJTA 2PSHA 1IOVA 1L7BA 4DNOA 4YUZA 1LVUA 1VI5A 4JFRA 4RU1A 4B9AA 2C9BA 2P4HX 5D5HA 4ZREA 1TLFA 4D3YA 4FWIB 5CVTA 3HLYA 3B9BA 3BC1A 1NKTA 1KKUA 4NJOA 4MICA 2XKBA 4UW9A 3T7SA 1U2PA 1Y3DE 3B9QA 4EJSA 4QU0A 4H60A 3WNVA 4CMGA 4MS4A 3KC2A 2AEEA 4NONA 1EB9A 5BT9A 4F9EA 1N2OA 2GO1A 4JV5B 4YCLA 4OJTA 4E5YA 3IDSA 4P8RA 2I2WA 4C2BA 1DQRA 2XMGA 1KMHA 3DMTC 3TSCA 2ABWA 1DVRA 4BJ6A 5DMXA 1N77A 1PR4A 1QCDA 4IRXA 4FGUA 4HR7A 4IDDA 1WV0A 4IL5A 3U17A 3DDNA 5JCPA 3X1YA