4DXAA

Co-crystal structure of rap1 in complex with krit1
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
168
structure length
168
Chain Sequence
SMREYKLVVLGSVGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Small G Protein Effector Interaction of Ras-related Protein 1 (Rap1) and Adaptor Protein Krev Interaction Trapped 1 (KRIT1).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Ras-related protein Rap-1b
total genus 55
structure length 168
sequence length 168
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2012-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dxaA00
4F4IA 5F3WB 2WWXA 2AK3A 1RJ9A 1JQLB 2ZR9A 4JLDA 3P1JA 2X1VA 2JLRA 1BMFD 3IBYA 1N0UA 1OH5A 5E3HA 1OW3B 1KI9A 5HPYB 2I3BA 2IYZA 5C4MA 1CU1A 2Q6TA 4LV5B 4KITB 2YC2C 2ZJAA 2CLDX 1QVAA 4B74A 1U0JA 4NDZA 4LJ7A 3CB4A 3LXRA 2E9SA 2GKSA 2GRJA 2JDID 1R4AA 3RANA 4WZBE 3BB3A 4R2IA 4OI0A 2OESA 2G6BA 1GDDA 2ZJ8A 4OKSA 2C8VA 4X8HA 5DYIA 2JDIA 3NDBB 3E2IA 1P9NA 3ZZTA 1C1YA 4Q4JB 4KLNA 3OEHD 1GNPA 1OV4A 1R8SA 3EWSA 4CIDA 4GZMA 4HLUC 1A5TA 1E0KA 2MMCA 4RJLA 3DMNA 2YOHA 2B92A 1HEIA 4IDPA 1G5RA 3VR3A 2CHGA 2QN6A 4M0LA 2YV5A 2G77B 4IVPA 4OI1A 3KKQA 3T1TA 3SS8A 4XSHA 3FMPB 1RRPA 1L4UA 2NTYC 1R8QA 3UMSA 5FR2A 4ERNA 2FPLA 1SULA 1KY3A 2GJSA 2YJTD 3ZH9B 5B64A 5LD2C 2IUSA 4DIDA 4L9WA 3EIEA 5IF9A 2R65A 1NSTA 4EPVA 3B85A 1IHUA 2VLIA 3VNUA 2KBEA 3LLUA 3MD0A 1G21E 2WM9B 5KUTA 1CR2A 4MGZR 3B9QA 3EIQA 1E9SA 3LW7A 3TR0A 1E2DA 2O8CB 2ORWA 1XTIA 4B47A 4I4LA 2WHXA 2J0UB 1OT3A 3K0FB 3ZS9A 4OQFA 1G7TA 3QEOA 4ESHA 3PXGA 2IK8A 5JEEA 5KDDA 1NKSA 2CVHA 1YRBA 1NJGA 4BFZA 3B82A 1TUEA 2O8CA 2ZI9A 3RLFA 3TLXA 2OSBA 3SOPA 2WPDD 3LVRE 1SVSA 4NE2A 4L5BA 4WA7A 4E03A 1GILA 1P6XA 1VG0B 5E4FA 5BN3A 2ZRMA 1TQDA 3TGPA 1Z0FA 2OCYC 1KO7A 2VHTA 3GMTA 4HSEA 1KMQA 4HEJA 4AG5A 5KTYA 2CE7A 4QL3A 4QOSA 1L4YA 3TSWA 3GLGB 1KK1A 3NC0C 4PO9A 5CLQA 2ODBA 2RH5A 1YZGA 1NLFA 2Q3HA 4C7OB 4JL8A 2OFWA 4A8JB 4KODA 4CRWB 3J81k 1OIWA 4Z1MA 4OHYA 2G88A 2L0XA 4IEEA 2OFOA 3QIAA 4X8OA 4B44A 1AS3A 2RGDA 4V0KA 1XTSA 3R7WA 1T8UA 2ZSDA 3TBKA 1FP6A 1YJ5A 1UBCA 4C0KA 1W0JA 3KTAA 4V0OA 4X8LA 5G3ZA 3GPLA 2CK3A 1ZP6A 4GT1A 1S4QA 4F38A 2BJWA 2ZUCA 2VSXA 5DE3A 1G8YA 3SJAA 5FR1A 4PHTA 4DCTA 4DCUA 3RYTC 4LJ9A 4Q02A 1N5KA 2HF8A 4LPKA 4TYNA 5H8WA 1II0A 1GWNA 1P62B 1DAKA 3Q7QA 2XITA 3TAHA 2B7CA 1A2BA 3OEED 1GM5A 3HP1A 2IW3A 3IPXA 3QOFA 4F4CA 4S2EA 4A0HA 2OFXA 5AUQA 1S3SA 2JGNA 4Q1CA 4Q9LA 3VR1A 1MO6A 2H7VA 1FP7A 2QI9C 4II7A 2GVZC 1IBRA 1NKTA 1NJFA 2G83A 4TMZA 4LGMA 1O87A 3REGA 1CRPA 1ZUHA 1HTWA 3ICEA 3QPWA 2FA9A 3UMFA 4L4UA 1PV4A 1E9CA 1YZQA 3VR4A 2CJWB 3QQ5A 1B23P 1OIVA 4QJ5A 1F3OA 2O8FA 4EPXA 4Q66C 5FL3A 1GRRA 3UATA 4U7DA 2RGGA 2QUZA 4QRHA 3A4LA 1XEFA 3A58B 2HXSA 1QHSA 2AR7A 2WWGA 3DZDA 2OAP1 3K09A 2P2LA 3Q3JB 1AA9A 4QNMA 1EWQA 3K0AB 2JEOA 2HV8A 1U94A 4FN5A 2IT1A 1FFHA 1CJKC 1VECA 4HLQB 4CGZA 2SHKA 2ZRBA 1QHHB 2QMOA 1EFTA 1KI6A 2WJYA 1G16A 4PO8A 1CR4A 2X2EA 5F2EA 5IRCD 2G1KA 4M9ZA 4TTQA 4TMKA 1HQYE 2ZSEA 5EE0A 3PEWA 3PUWA 1FUUA 1L7VC 3TE6A 5J4YA 3DVLA 1M74A 2MMGA 2R6CA 2WJGA 3WNDA 1BKDR 5LD2B 1ANKA 2A9KA 3K8YA 4JSYA 5G40A 1FTNA 3QEJA 1NP6A 2V6JA 1IM2A 4B2PA 2DB3A 1E2FA 4L16A 3A4MA 4NBSA 1FQJA 4DVGA 2VEDA 2IS2A 1N6IA 4JL6A 5DISB 1KO4A 4L15A 2B8TA 2VIIA 2IXGA 2EU8A 1UKVY 2NGRA 4R2HA 4EQ6A 2QQEA 4DJTA 3M4YA 1KAGA 3K9GA 2ZQ5A 1JR3E 1G7SA 1Z63A 5FUYA 2QTFA 4NYIR 3N70A 3TW4A 5FPHA 2C9YA 3T06B 1JPNA 1Z0AA 2ECKA 1P5ZB 5JSZB 1OXUA 3BFKA 5JJLA 1I2MA 5CJ2A 1NMXA 5L3QA 4TYWA 2GK7A 4HB2A 2H92A 1ZINA 4PSKA 2IS4A 1KDTA 2ZSFA 1U0HC 3MSXA 5EXXA 1UEIA 4Q48A 5M04A 1E9AA 2KI5A 1RW4A 1TQ2A 4G3XA 1LV7A 2ZAOA 1E1RA 1GIAA 2FEMA 5L3RA 3PEVA 5DYGA 3RS5A 2IL1A 5C2JB 2ZSBA 3AVYA 1NLZA 1R10A 2VSFA 3SDZA 5EP4A 4UJ3A 4ZPXA 2GJAA 1ZM4A 1Z29A 3RC3A 5FBQB 4L8GA 1G18A 2O0JA 1RIFA 2PEYA 4WXRA 5DI3B 4B6EA 3ADBA 3MAAC 2GEVA 1Y63A 1ZIPA 3UK6A 5EXPA 3WP1B 4DWJA 1UKEA 4TT3D 4V0NA 4BPBA 4JLVA 4A0GA 4ZDWA 2FZ4A 4HAUA 3CRMA 3TKLA 2PZFA 4ZO4A 1G41A 1YZNA 1S8FA 4MRSA 4D80A 1E2HA 1T8TA 1US8B 4TL9A 2CE2X 1CJVC 5P21A 3FMFA 2RHMA 3UIEA 3FB4A 3IIKA 3DOFA 3FHTA 4LY6A 4UNSA 1G3QA 3ECCA 1GRQA 4E5UA 5AUNB 2ZRAA 3CH4B 1VIYA 2GBLC 3I62A 1YHNA 4JLOA 2LWIA 1T3LA 4B33A 1MRNA 1OFIA 3CLVA 3H84A 4V0ME 5FUVA 4BASA 4YXWA 4N1AA 1TQ6A 2BCJQ 2BOVA 4HI0E 5KDOA 4KU4A 4TYPA 1FNNA 4CEJA 2GJ8A 1N5LA 3NBYC 4RD1A 1KO1A 1S1CA 1WF3A 4C30A 3RSOA 2WKRA 2A5FA 3R7WB 4JZKA 1XDBA 4YC7A 3NH9A 2XZLA 4YXWD 1XTJA 4C0BA 1LTQA 2VPPA 5AJXA 1ZW6A 2D4HA 1P75A 1XWIA 2J1LA 2FN4A 1SVMA 4JJKA 3M0EA 2GWHA 4A8JA 1KIMA 2AX4A 4WZ6A 1KJWA 2R8RA 1S9HA 4Q47A 2V7QD 1XBTA 2ZJZA 2CJWA 3SFZA 1ZNZA 2ANCA 2WKQA 4Q4JA 1F2TA 2OEPA 4G5QA 1I4DD 4AKIA 1QHXA 1II9A 4LJ6A 4QBFA 4PTLA 3I72A 3AF4A 4JKIA 4PQYA 3THWA 4TZ0A 3R8FA 1R2QA 2FSHA 1LW7A 2ONKA 4GZLA 2GAOA 2JAQA 4LPSA 2IWHA 1RRCA 5DSZA 3EZFA 4NPHA 5TVKA 1CJMA 2OO7A 3OFNA 3IIMA 1C9KA 1A1VA 4O2RA 1NMZA 2Z4RA 2JLVA 4RKFA 3GLHA 3I8SA 4DUGA 5KHOC 5JS7A 2FFQA 1JALA 3K0EA 3S1AA 4D2IA 1R5NA 4GMDA 4PZLA 2GZDA 2C5LA 4B3CA 4G1UC 4JVNA 2GETA 1P9WA 4BLPA 4EKDA 4TMWA 2GCOA 2OV2A 1E2PA 3K0FA 4RY2A 1W4CA 2Q0HA 4WVFA 2RGCA 3K70B 3B1WA 2ASEA 3I1FA 3HDTA 1IN5A 3CIOA 5JEDA 4NONA 1NBMD 4QHYA 1CP2A 4MQBA 5JWRA 1KO5A 1G3UA 1M7BA 4W5HA 4PX9A 5AUPB 2YNMA 3CO5A 4ZIRA 2HJVA 3I5YA 3THWB 3ZLJA 5F9FA 3ZD6A 2RGNA 4FMDB 3UWOA 1DEKA 4B48A 2AK2A 4F91B 2D7DA 2J3EA 1IN7A 2FGKA 2XEXA 4DCNA 2EWWA 1R0ZA 2XAUA 3Q5DA 2EW1A 3GJ5A 4MYHA 3D8BA 2IYSA 1QHNA 3CNLA 2AWOA 4LJ5A 2IYYA 5TV2A 3NHAA 2AXNA 1UFQA 2CVFA 5KO2A 2OCAA 5L8VA 2RGXA 1K5DA 3AP2A 4M22A 1CR0A 3W9YA 1QDEA 4Z54A 4DLRA 3B9PA 4BFUA 1Z2CA 3SC3A 4MKIA 3A1TA 3ZZ0A 4V03A 1XZQA 2O8DB 1E1QA 2ZRDA 1DO0A 5E7JA 1W36B 1GOTA 3QKSB 4JBXA 1D2NA 1G20E 4RD6A 5HZHA 3U7HB 2XB2A 3U6KA 3O8RA 1P9RA 1C4OA 4LI0A 5KOYA 4HAYA 3U3OA 2QBYA 2YKGA 4DB4A 5FOTA 3T1VA 1SXJC 4AK9A 5FUXA 1E2EA 1US8A 4D6PA 3K70C 1AS0A 2R44A 5FL7A 2PBRA 3ZDQA 4BECA 2REBA 1K8RA 1ZM2A 3L0OA 5FFMA 3BAFA 4JS0A 4URYR 3K0AA 1EG7A 5C4GB 3SJZA 2NO9A 2QP9X 4UQOA 2ZEJA 1KK3A 1E2IA 1E2JA 3U7GA 721PA 1VHLA 4ILEA 3EPJA 4M1KA 4XVRA 2ORIA 1TEVA 3RC8A 1EGAA 4DLSA 5EP1A 4TTRA 4KJZA 3Q5EA 2QGZA 1FMLA 4BEJA 4M53A 1NN1A 2CNWA 4EPRA 4O0MA 2QAJA 2XGJA 3I5XA 3VU9B 1NVXQ 1XPOA 4EFMA 1OFUX 1SVWA 4CEJB 1GTVA 3FKSA 4KFSA 3RS0A 4FD2A 2V1UA 1VYUA 4TSFD 4C7OA 1GKIA 3BD9A 3KDSE 3KUCA 1P2SA 1UBFA 1P60A 4R7ZA 3VX4A 2ZXUA 4ESVA 2VA8A 1E79D 5H70A 3WY9A 1MABA 4RSGA 1N6OA 3PEUA 2YC4C 1KTVA 2PLFA 3HWSA 4TSFA 1Z0DA 5LB2A 4RZXA 4ARZB 3I3SR 1Q22A 2BVNA 4FMCF 5CLLA 2V4ZA 2ZJYA 3FYHA 4OHVA 4F93B 4URXR 1U9IC 1JPJA 4U5XA 2BMDA 4UNQA 5F98A 2H16A 3BH7A 3ZVNA 3FFAA 4S35A 4B3DA 4A0FA 3GLFB 1DADA 2WV9A 1E9EA 3O8BA 3SYKA 4B3BA 2VRWA 4B3FX 1TX4B 4K46A 4AKHA 1QHGA 1KOFA 3DKVA 1OXTA 4FXPA 4KCGA 3CBQA 4PHFA 4UKDA 1CEEA 4IXNA 4ZCIA 2ONJA 1U0LA 2ZETA 3PJRA 2OLJA 4OHZA 1VYTA 3B13B 1ZD8A 5CIWA 1IJEA 4AYTA 4KI0A 1K6MA 3NBXX 2DFLA 4PPGA 1FNMA 1H8HD 1KK0A 2AD1A 2OXRA 2QAGC 5G3YA 2ZS8A 4PZZA 4ZI3A 1NN5A 2WZQA 3P4XA 2I1VB 4US0R 1AS2A 2HCBA 1WBBA 3QXSA 3IPYA 3KB1A 4M1SA 2AL7A 1H8HA 2FSFA 2VH5R 4OHXA 1R0WA 2QBYB 3EC2A 4JLBA 4LHWA 1PVOA 1FQKA 1FX0B 2DPXA 4Q4LA 1IY0A 2ZYWX 4AC9A 4AD8A 1OPXA 2WJVA 5C18A 2ZS9A 621PA 2XXAA 3L43A 2J0VA 2XTMA 5KSYA 4I1VA 1V5WA 3QPVA 4Q1BA 5GVRA 5FPTA 1HQCA 5FTNA 2WICA 3ZIAD 3EPHA 1Q1QA 4QXAA 2ZE6A 2P65A 4D4JA 4IFBA 2JCSA 2YOFA 2A5YB 5AJZA 4HYYA 1RKBA 3BC1A 2J87A 2J45A 1S0UA 2ZI7A 3IQWA 4QBIA 5EZ5A 1X8JA 2WJJA 4I1OA 4M1YA 1X1RA 1MH1A 1NG9A 4IEIA 1KMHA 1NL3A 1N6RA 4NYMQ 2WTUA 3C14C 3MJHA 5HCNA 2WAYA 3U3MA 3PITA 1KZGB 4LC1A 3QF7A 1GAJA 2GCNA 1M2OB 1AKYA 1G8FA 1M7GA 2JJ1D 2NOAA 1E2NA 3FWYA 2J59A 3SU8A 1J7KA 3QKRB 1U2RA 1GG2A 3W8RA 1Z0JA 2IYTA 5TARA 3GLIB 5B30A 3KQLA 3L8YA 5FOUA 4YMUA 3B1ZA 3TUIC 1NVVR 1AM4D 3NKVA 3R20A 2C04A 2QGNA 2FU5C 2XNSA 3ZQJA 4TMVA 1XCGB 4KLZA 1Q1BA 2W58A 3Q7PA 5KPDA 2KJQA 1OKKD 2JLYA 4MRRA 4F92B 2XSZA 4B32A 2BWJA 3EW9A 3L8ZA 3X1WA 1OH7A 4KYUA 3QVUA 3S1AB 1CKEA 4LYJA 1XFAA 3TJZA 3CX7A 5CITA 2VSOA 2AHOA 1YR7A 5CK4A 1J8MF 3FMIA 1DBSA 2ZE8A 1VCNA 1XRJA 1E1RD 1CULC 1G4UR 1GL6A 4Q4AA 2JLSA 2W2VA 3KJHA 2ZTSA 5D3QA 5DH9A 3CRVA 2OBNA 2JJ2D 2ATVA 1XEXA 3TQCA 4A6PA 4BUJA 4IVRA 4P4SA 4BZQA 2GJ9A 4FIDA 3SI7A 2W6JD 3RRMA 3NC1C 1FMJA 3BS4A 4QM6A 1R0XA 2R6AA 3SZRA 3K0SA 1Q3TA 3QBVA 5H1YA 2EFDB 1Q44A 1BOFA 3A8TA 3PQCA 3ZS8A 1EESA 2FH5B 1GNQA 4OQMA 3SNHA 1P73A 3V4FA 2WWFA 1KYIA 4P32A 2J46A 4RCZA 4YMWA 2D2FA 1E9RA 1ZAKA 2A2ZA 3FE2A 4OK5A 4BE7B 1NN3A 2NMVA 1E3MA 1HA3A 1CRQA 3PENA 4PSVA 3QKTA 1DTSA 2R6GA 4HATA 4LJ4A 4TLDA 5JWOA 1JNYA 1G6HA 3FDIA 1KY2A 4HDOB 4NCNA 4RZ2A 3W3ZB 4UJ5A 1XD2B 3CNNA 2C2HA 4MUAA 1LB1B 1LNZA 2CBZA 3B2EA 1SKQA 4TLCA 2ERYA 1ZCBA 1Z22A 4F7WA 1AJEA 2B6HA 2XB4A 3RS2A 5KNCA 4NCIA 2FMXA 3U2QA 3VQTA 5JLJA 4Q1FA 4DBLC 1KI1A 3UKDA 5FTKA 4KAXA 2BHRA 3AF3A 3I8XA 2OBLA 4KFTA 1P3JA 3D3QA 3U44A 5J40A 2W2XA 2C03A 2X19A 2B8WA 4MYTA 4EJSB 4M2LA 3WHLA 2QPAA 1DVRA 3RRNA 1U99A 3ZQ6A 1TMKA 3ADCA 4PAMA 1Q1EA 3AUYA 1WE2A 2ORVA 2Q9BA 2F3RA 3AGQA 4KFRA 4JVSB 4HDQB 2NPIA 2WJIA 1J70A 2WSSA 1FZQA 3GEIA 3VU9A 3X1YA 4PAOA 3NTUA 4D25A 3THYA 1XJ0A 2CXXA 3M6AA 2DY1A 4A6XA 4D4LA 2FPMA 3QF4B 4Q03A 5L3SA 2XNDD 3KJGA 1YKSA 3QJYA 1DAHA 1UKYA 1JECA 2V3CC 1F48A 1G3RA 1Z83A 1Z47A 3MMPA 3EC1A 4LBVA 4IOJA 4GP6A 1YZUA 1YZTA 3CF0A 3L2OB 2C99A 2O8EB 3WYFA 2PLRA 3AF2A 1DPFA 2ZRFA 2GXQA 5KDLA 3UXMA 4Q01A 1XJQA 2WOJA 1W5TA 4PC6A 3F8TA 4POAA 3QENA 1YE8A 1R0YA 2GXUA 4Q7KA 5BYJA 2JIZD 5KU1A 2D7CA 1XF9A 1ZCAA 1ZM3A 5FBLB 4DUGD 4EFNA 2V1XA 1KI6B 1W0KA 1XXHB 3CX8A 1JBKA 2IYLD 4PHGA 4IVQA 2REXB 3RRZA 3U61B 3TVTA 2DBYA 3E1SA 3SFVA 1KI4A 2BBSA 2GK6A 5E95A 2BC9A 3OEHA 4A2QA 1NG1A 4NCJA 3IDQA 2J9RA 1J2JA 1NY5A 4FW9A 4TYYA 2QNRA 1FW6A 2QMUA 4CZ2A 1NMYA 1YR8A 3GLHE 4EFLA 1WXQA 3AP1A 3Q72A 4HB3A 5EE1A 2WIBA 1JEDA 2VF7A 2PJZA 1H65A 4KVGA 3G82C 4JLMA 1E2MA 1XTQA 1SVOA 4D0LB 3DOEA 3GLGE 1A2KC 1ETUA 5JRJA 4LV8B 1G8GA 1X86B 2P5SA 2R6FA 4XTRA 3LRPA 4LHYA 2KBFA 3BFXA 3P26A 2G3YA 1QG4A 2N42A 2ZYTX 3L0SA 3NXSA 3P27A 4FMBB 2GF9A 1G7CA 4WOPA 4DT1B 3EA0A 4P4UA 3TQFA 3CZQA 2LKCA 2VHCA 3GLFA 1EFRD 3NWJA 3U6BA 1E32A 4A2WA 1DE0A 2WSMA 3SYNA 3QUSA 3K09C 1M34E 4PQFA 1GVNB 1MV5A 4GL2A 3W5JA 4BFTA 1XEWY 3OAAA 2P0EA 2ZVQX 3W8NA 3EXAA 4M21A 1G1MA 1VPLA 3DM9B 2QAGB 2BBTA 1OFTA 1XMSA 4LWZA 1KZ7B 2LKDA 1S96A 4PQRA 3SN6A 5JWHA 3OAAD 3B1XA 2MSDB 4DEYA 2ZS7A 3QXXA 2CEAA 4KHZA 5DHFA 2WKPA 1ZD1A 3D31A 2JLUA 2GILA 2ANBA 2YWFA 2WIAA 1W1WA 2JLQA 4FMDF 1BYIA 4JVMA 1CF4A 3GFPA 3RDPA 1LS1A 3BWDD 2CHQA 1EK0A 3B60A 4LHZA 5CM8B 2OHFA 3DO6A 4WXPA 3WRXC 2P6NA 2NO1A 5JMTA 3BE4A 3SR0A 2D74A 3TSZA 5HR5A 4M9SA 2PX3A 2WBLC 1MO4A 3CH5A 4B75A 4KBGA 1E69A 3AVQA 3F0TA 2CNWD 1YR6A 2DYKA 1RRGA 1Z3IX 4EJSA 1ZUNB 2Y8EA 1PLLA 3CRQA 4ABYA 4BZPA 4I81A 2VHJA 3LA6A 4W9MC 1E96A 1TUIA 2HJGA 3VNVA 2ZI4A 1VG1A 2HLDA 5CYPA 1X8LA 1ONBA 1E0AA 4MUBA 4UXJA 1YZKA 2XJ9A 4A36A 1Z08A 2FF7A 3GJ3A 3LQQA 1E79A 5K8UA 221PA 1Q21A 5CDFE 1GZSA 2EFEB 3K9LA 5DN6D 3ADDA 1UDWA 4TMTA 4C2TA 2ZI3A 3L0PA 3GJ0A 3THOA 2QSYA 4C0LA 1JJVA 2PL3A 1YVDA 2FFHA 2GAAA 4A2PA 3PEYA 4KFUA 4Q1EA 3LW8A 3LV8A 3RVBA 2NQ2C 3VR2A 3RS4A 4DSNA 4HAVA 2D2EA 1UDXA 1AZSC 4DHEA 1S9DA 4HB4A 3ND9A 2O8EA 4Q7LA 1U98A 2HXYA 5CIQA 5EZ6B 1IN6A 5J47A 4Q7JB 3VFDA 4B6FA 1Z6AA 4JYBA 1RVDA 2N46A 2O8BB 5JI3E 3WYGA 1GKYA 1W47A 1E99A 3ZZUA 2PEZA 3T61A 2EFCB 1L8QA 1PLJA 3X2SA 3RRYA 4QGFA 3AKYA 3F5FA 1X8KA 1N6PA 2A30A 4PC2A 2EQBA 4LJAA 4R98A 1D2MA 3KXIA 3DDCA 3T34A 4US1R 4ZDJA 4PC7A 1FTSA 5LPNA 4R71A 4RZUA 4BRWA 1TNDA 1YRAA 1W2GA 2O0KA 5HTKA 1HUQA 4TTPA 2CDNA 3PUVA 2G1JA 4JT2A 5EUMA 3GEHA 1IAQA 4GPTA 4Q9HA 1OB5A 5JS8A 1ZM9A 2GDJA 2IYVA 3H86A 5BWMA 3NBZC 3X1XA 5KNDA 4AKGA 1XTKA 2FG5A 1LF5A 3FHCB 5DHAA 3PVSA 4QFMA 2C98A 4RD2A 3TH5A 2QU8A 1W0JD 4LX0A 3AUXA 2EYUA 4C0HA 1F5NA 4M9XA 2TMKA 4HUTA 4P3YA 4EIWA 4OK3A 3QNUA 4XH9B 1SKYE 4QGGA 3V4RA 3KXLA 2YVUA 2D3WA 2J7KA 3K9HA 4GMXA 1J90A 4KVAA 5BQ5A 4OQNA 3DEFA 3HU1A 2FEOA 3WNCA 1W36C 3BK7A 2BEJA 4RFSB 3GP8A 1WP9A 3KL4A 4PR0A 5CK5A 1AKEA 4M9QA 4HDCA 1II8B 2QT0A 1SXJD 4DIEA 1G5TA 2X77A 1T4GA 3ONWA 3WYAA 3UPUA 3IO3A 4RCYA 1G291 3KXKA 1KNQA 5TMPA 4UNPA 1Q1ZA 4C2UA 1IXRC 5HE9A 4Q1DA 4YDSA 4K8OA 3TIFA 3LNCA 1KSJA 3ZGXA 1Q20A 4CF7A 2VP9A 1N0VC 5B2ZA 1SGWA 3GFOA 3KKMA 1OHHD 3THXB 1SXJB 1WDTA 2IBMA 4LHXA 2QE7A 3IEVA 5J4HA 2V54A 1HT1E 1OIXA 4N0DA 1F2UA 1SXJE 4QGHA 2F9LA 2BJVA 2ZU0C 3PR1A 2NO7A 2FFBA 3ZVMA 1OHHA 3NEJA 2AKYA 1TU4A 4CVNA 2OG2A 4AG6A 3HPRA 2RAPA 2WWHA 3TUJC 4IDQA 4URWR 2IYUA 2BEKA 1T3SA 5JSZA 2PMKA 3U3KA 2QPTA 3RABA 3GLHB 2JLXA 3B5JA 4LOAA 3Q9LA 2ODWA 3N2EA 2J0SA 1HY3A 2VTKA 4Q7MB 3VTKA 421PA 4W5JA 5FH9A 2QROA 1CTQA 5B57C 2F1RA 5GVSA 2O8FB 3KX2A 521PA 4ACAA 1T3HA 4JYCA 4MDEA 2DFTA 2IXEA 3T12A 1TF2A 4BFYA 4DT1A 3NHBA 3GEEA 5EXTA 2DR3A 3OIUA 3R9XA 2VP2A 1WB9A 3X1DA 1TF7A 2DHRA 2IEZA 2CCKA 2H57A 4XD7A 5A0FA 2JLZA 3LAWA 4PHHA 4TL8A 2A3RA 4NKRA 4UNNA 2NPFA 4P4SB 5GADl 2YWGA 2OT3B 4MRNA 3BOSA 4LSGA 4AYWA 3BORA 1S1MA 1A4RA 4QG7A 3O8DA 3AVUA 2ZRIA 3OE7A 3IUYA 4DLZA 2WVJA 2IF0A 1EFHA 2PX0A 4HUQB 2Z0MA 5SZKB 4TZ6A 1L2TA 2BKEA 2ZRPA 3BJIC 2RCNA 2CLCX 4MDFA 3QG1A 5SZIA 2F43B 4F4JA 3GD7A 4HZIA 4KO8A 4WW0A 4IOLA 1TPZA 4P31A 1RE0A 1Z8FA 4V0LA 3O47A 4Q21A 4W7SA 4DLWA 2O52A 2IHYA 1J8YF 3D7MA 3QVVA 2ZJ5A 1N6NA 4DSUA 3LH5A 4US2R 1E4VA 2QM7A 4DKXA 4OQXA 1Q0UA 4FI3C 1ZYUA 1V43A 5EJEA 3SJBA 3TK1A 2GXAA 3U4QB 3MWYW 3AM1A 1AZTA 2FGJA 1YZLA 2VP6A 1X6VA 2V7QA 1GNRA 2UZ3A 4Z8YA 3LD9A 1Z6XA 2IEYA 3FTQA 1N6LA 3MFYA 1XB2A 2O0HA 4Y0AA 4DB2A 3A37A 4IOMA 4AURA 2WWWA 3BH0A 4KYIB 4NU0A 3HYTA 1CS4C 3C16C 4FCTA 1MOZA 1TL7C 3IHLA 2D06A 4ON9A 2DFKB 3LDAA 1QG2A 2EYQA 1NLYA 3EA5A 2AFHE 3FVQA 5DI3A 4BLSA 1E98A 2F1IA 5FBVB 4BWYA 1ZU5A 3H0KA 3RS3A 5TDHA 1BO6A 2FWRA 3W6OA 2G9NA 2GHIA 2WMOB 4IXMA 1W48A 2R6DA 1G17A 1X1SA 4A1FA 2D62A 4PPQA 1UKZA 4A0RA 4Q19A 5FTJA 4ASUD 4OL0A 1G7RA 4YMTA 4TLEA 5DIFA 2GESA 2ATXA 2OXCA 4GBMA 4JLAA 4K81B 3IO5A 3IQXA 4NYMR 1NN0A 3KKOA 1DS6A 4NP6A 4URUR 2W0SA 1XEWX 2XOKD 4KXFB 1XD8A 2FSGA 1R7RA 5ELXA 1EFCA 4DLUA 1KJYA 4G01B 3CUEF 3AGPA 3IEUA 4DLTA 4IHQA 1FUKA 4DEXA 2QAGA 2QRZA 1FX0A 2QTHA 3RAPR 3U3RA 1GFIA 1UPTA 2Q9CA 3EG5A 1M1YE 3BXZA 5GJCA 2B7BA 5H68A 2ZM5A 2F1HA 5C46F 3RNLA 1WRBA 3QBTA 4U00A 3WMGA 5JFGA 3KB2A 2PZEA 3REFA 1E0SA 4OBEA 2BBOA 2H8KA 1ZNXA 3QF4A 4BQSA 3MWLA 5BN5A 2QA5A 2OBMA 2CL7X 3P4YA 3WMEA 4CT5A 3I61A 1E0JA 4DC9A 1R5BA 4NYJR 1OXXK 4YDHB 2OM2A 4CDGA 2IS6A 4JLJA 1W2HA 2ZR0A 2WPDA 5K8LA 1JXOA 1E1QD 3LVQE 5AWFC 4GOXA 1ZMXA 2OE2A 1G8PA 3GLFE 3UMRA 3VMFA 3G0HA 4O25A 4B71A 3AB3A 4MRVA 2KB0A 1XMJA 2F55A 2OAQ1 4PC1A 3KQHA 2XZPA 1IN4A 2E87A 2NZ8A 2XXAB 2YZ2A 1PUIA 1A82A 1KI2A 2GEUA 4M1TA 2QRNA 4RFVA 4C0SA 3GQBA 4GDFA 4JLPA 4DDTA 3PUXA 4M8NE 1KJZA 3GJ6A 5FPYA 4HB0A 3VX3A 4LUCA 3HR7A 1N5IA 1E9BA 1RJ9B 1UEJA 5FBRB 2FDCA 1D5CA 1GITA 2HCJB 5FI1B 3KFVA 1NBME 2VP4A 1IY1A 2DWOA 2H18A 1S3GA 5LBIA 1GKUB 2VHUA 1QHIA 2CK3D 1FPMA 3EX7C 1T6NA 3IILA 3QSYA 1JXMA 3CR8A 4QM7A 5EXSA 1II8A 1MO5A 5JRZA 1N2CE 4GOKA 3QI2A 5AJYA 4D4KA 1PZNA 1XP8A 4AI6A 1W4AA 1RZ3A 5GJBA 4FCVA 2Z5FA 3FKSD 2IXFA 2C9CA 2JASA 4HLCA 4BEBA 2E1RA 3OEEA 4LBYA 3QY0A 3KQNA 2Q3FA 4MGYR 4Q00A 3TVDA 3C8UA 1BS1A 3U4QA 1I2DA 2ZAMA 4P4TA 3MUFA 1WCV1 2O8BA 3VR6A 1JEEA 3NIBA 4HLDA 1DAFA 2ZANA 4G0NA 4Z51A 3KKNA 2CLSA 4EPTA 4D4MA 1ESNA 1NVUQ 2ZU6A 3A36A 3MG9A 3QKSA 4JBYA 4MKGA 1KSHA 2KE5A 4RKEA 3UWKA 3WBKA 3FHOA 1VYVA 2Z6VA 5BXQC 3HU3A 3TUZC 2FE4A 4KV9A 2IS1A 1UBGA 2REOA 4DCVA 1HH4A 1KDPA 3UG7A 3WHKA 5A4JA 2VO1A 2IYQA 3W6PA 4MYCA 1ZD9A 2QEQA 3SBEA 1Z6GA 1N3BA 4CEHB 5TB5A 3WXMA 2BIFA 1GP2A 4CEIA 3A6PC 5JECA 5KNBA 5KSZA 1DG1G 3KJIA 4D82A 4LV6A 1VHTA 2ZYUX 3AEZA 1SKYB 2QORA 2XTZA 1M7HA 1MT0A 3OZXA 1KI7A 4Q9KA 3AKEA 1NI3A 2CHVA 3WP0A 2ZUBA 2HUPA 3ICQB 5IDVA 2ZUDA 3HJNA 5EE3A 2HEIA 4LYFA 2FZLA 2NO0A 4RD3A 4JLKA 4RVCA 3DHWC 4Z1MD 1VCOA 3JVUA 4LHVA 4W5WA 4B73A 2ZRJA 5G41A 5AR1A 1E4YA 2GA8A 2QT1A 4G5SA 3EAQA 3T1QA 2BM1A 1QRAA 4DLYA 2FSIA 3I32A 2P6UA 4TLAA 1IXSB 2GCOB 4PZYA 1DAMA 2ZE5A 2ZR7A 1KI3A 3EARA 3K0CC 3ZIAA 3RSLA 3MCAA 3C41J 2HT6A 3ZVRA 2YWEA 5IHPA 4CT4B 4QKQA 1UM8A 1QHYA 3QKUA 4B2LA 1MR3F 3ADKA 2ZI6A 1SHZA 2O8DA 4OJQA 3RWMB 4DDVA 4XWKA 1K5GA 5JI2E 5DGXA 1EXMA 4Y0VA 4HAXA 2VQSA 1N6KA 2A78A 3KTAB 4G5RA 3VAAA 3E70C 1OH8A 1U90A 4ZKEA 3BB1A 1Z07A 4LBWA 1DOAA 3M1IA 3IGFA 3OHMA 1S2MA 4MKHA 4D81A 1OFHA 5J5CA 5SZJA 5FI0B 3NG1A 1SQ5A 4NCHA 2JJ1A 3VKHA 2AXPA 1OJLA 5CM9C 4HAZA 3T5GA 1EWRA 4J0QA 1E2LA 3DKPA 1OYYA 2YYZA 3THYB 1LS6A 4JKYA 4A4DA 1OE0A 5J4LA 1OSNA 2IHBA 4HZUB 3MGCA 1DELA 2CL0X 3K1JA 1AQYA 3AH8A 2V55B 4QBGB 3CWQA 3O8CA 3CPHA 1UF9A 4TL7A 1PLKA 1WBDA 2XSZD 1HYQA 5FUWA 1YU9A 1IXZA 1W44A 4B3GA 1ZJ6A 3DMDA 3FKQA 2PCLA 3A1WA 2Z83A 2OLKA 2FV8A 2QE7D 2IUUA 3SBDA 3U60B 2ODEA 4DRZA 3CRRA 4LYAA 5SZHB 1Q57A 1VMAA 3JZAA 1OXVA 2RB4A 2BM0A 1F6BA 1ZC4A 2UZIR 4NCKA 1GRNA 4O2LA 1T0HB 4IDNA 2NZJA 3TR5A 3K70D 3L82B 3T5DA 2Q3MA 1ESMA 1M8PA 4ZKDA 2R9VA 4QJ4A 3GLIE 2F43A 4E22A 3AP3A 4MH0R 4DSOA 2GF0A 3K53A 5EP3A 5HE8A 5A5GA 2AFIE 2F3TA 2IF2A 4TQ9A 1P7CA 3PV0A 3QPUA 3VHXA 2OUKA 4GI7A 4C0AC 1NVVQ 1CBUA 2YWHA 1AN0A 2GZHA 5LDDC 4XOIA 3NDPA 3SJCA 2BMJA 4LBZA 4JIMA 4PO1A 4BGDA 4JBWA 4B2IA 5HKKA 1P2VA 3QKRA 1LVGA 4H1UA 4I1SA 4RD4A 2ZVPX 1JR6A 4A8JC 1D9ZA 1DO2A 1KMHB 4IRUB 4MGKR 1G6OA 5JCZA 1JR3D 2BCGY 4LJ8A 1XEXB 3CWZA 1VCIA 1XCPA 1XMVA 3UG6A 2ZE7A 1FOEB 2YOGA 5ANRB 1G3IA 3CR7A 1LY1A 1W36D 3OE7D 3PFIA 4OHWA 5AUOB 3BRWD 3ASYA 2RKOA 1HURA 3U44B 2ZRGA 1H8ED 2VYFA 1JAHA 2QPOA 3VKWA 3SQWA 1W4RA 5FOXA 2GBLA 1WMSA 2FOLA 3LBHA 2AKAB 1I4TD 3B78A 5FOVA 1ELOA 2W6ID 4JVLA 4V02A 2QL6A 1SVKA 1VG9B 3ASZA 1IY2A 3PIRA 3ZJYA 2C9OA 1ZNWA 2NG1A 4DLVA 4NMMA 4URZR 1TTTA 1CIPA 2R62A 2B21A 4G5OA 5FPSA 3LLMA 3BIFA 3DZ8A 3FPAA 5AJVB 1IJFA 4RZ3A 4KSCA 3TMKA 5JJIA 4JSTA 5CB8A 5J4VA 4BFSA 4TMXA 2ZPTX 3U7EB 2ZRLA 3QG5A 3OFND 1SZPA 3E5HA 2V8OA 3OIYA 3UANA 4PC3A 2ZITA 2GZAA 1F2TB 1HV8A 3HR8A 4IKEA 1XTRA 2IUTA 1KDRA 2JJ2A 4N0EA 1N6HA 3W3AA 4QHTA 5EE9A 2W6JA 8OHMA 1W49A 4TT3A 4NYIQ 1E9DA 2OCPA 4M4SA 4P0TA 3JZMA 1E9FA 1XJCA 3GJ7A 4M1MA 4WIAA 2K5UA 3IBGA 2GCPA 5AJWA 1LFDB 3BH6A 4BLRA 1CR1A 2OCBA 1QVRA 3Q85A 4Q4HA 2IA5A 3B1VA 1NBMA 4LJYA 1BH2A 3HU2A 4ASUA 1XPUA 3VKGA 4WAUA 4OJKA 1P2TA 2GXSA 2CL6X 3A1UA 3IHWA 4IDOA 2J41A 3V00A 3C5HA 1Z28A 3F3YA 4TLBA 5KSPA 2QM8A 4IFEA 1MABB 2XOKA 4YMVA 4NH0A 3BB4A 5DI9A 4B34A 1PUJA 3NEYA 3NVAA 2IYXA 2FPKA 3AVPA 4WZAE 3QE0A 5EP2A 4BLOA 4TQAA 4BLQA 1A7JA 1WA5A 1NNEA 1KGDA 4B3XA 1I4LD 3ND8A 2ODNA 4YMSA 2BBWA 4FWTA 121PA 1T5IA 1ZUIA 2AD5A 1KKLA 2MSCB 1RFLA 1SHKA 2ZJ2A 2KSQA 4MKFA 5E7MA 1Z6YA 2G0NA 4ZCLA 3OIVA 1GUAA 1P72A 2PT7A 1U8AA 4AY2A 1Y3AA 1P2UA 3TNFA 5GJWC 3CF6R 2IC5A 2WWIA 2ZREA 4P33A 5UKDA 1U81A 5DNYB 2Q9AA 3LQRA 4DCSA 4NTZA 2HF9A 1D6JA 2GEDA 1CJUC 3TW8B 2V9PA 1KSGA 2HT1A 1IONA 2QMHA 3EIHA 4GFDA 5AK0A 3EZ6A 4OYHA 5FL7D 3A4NA 4Q1AA 5J4KA 1ZC3A 2FX3A 3N5CA 4M1OA 3AVWA 3AQ4A 4EPYA 4JJZA 4YLGA 2QG6A 3AF0A 3RHFA 3QXHA 3RS7A 2UKDA 3AV0B 4LYHA 1GSIA 4MITA 4I99A 4AIIA 1NF3A 1ZIOA 5EQTA 1RYFA 2CCJA 1T91A 2QZ4A 4CW7A 4D0GA 2EFHB 3ETLA 2BDTA 4E09A 3GJXC 1J99A 4A15A 2DFNA 4CYMA 1AIPA 3KQUA 3LWNA 1W7AA 1VKJA 1Z06A 4TL6A 1BYUA 1W0KD 2WJHA 4PXAA 1TADA 3IKJA 3GJ8A 2ERXA 1RYHA 5HCIA 2AWNA 4IDHA 3I4LA 3CM0A 2F1JA 1KSFX 3H4MA 2C95A 5D3MA 1VIAA 1XNJA 2PH1A 2RMKA 4XWAA 4ZCMA 5KYKA 2J7PA 4ZI2A 2FNAA 2ZSAA 4URVR 2ZI5A 4ZDKA 821PA 1ZU4A 1KI8A 2HLDD 2I4IA 1DG3A 2WMNB 1TEXA 4UXIA 4ACBA 6Q21A 1MKYA 1R6BX 3NBFA 2QTVB 2YHSA 4XVUA 4Q5IA 3HPQA 3AKDA 3R9WA 3LXXA 3B6EA 1U8YA 1XXHE 3OIWA 2H1LA 2RGNC 3EZ7A 4XIGS 5DN6A 1Z0KA 2J7PD 2ZRKA 1RPZA 1OLOA 4BFXA 4TWZA 3BFVA 3CPEA 1DAIA 5DLQC 4JL5A 3U5ZB 4XSGA 1XMIA 1G8HA 2QY9A 3D6TB 3KZ1E 4IW3B 1AQUA 4XJXA 1SVLA 3C15C 1B0UA 4QBHA 3AVVA 1P61B 1OB2A 2PJRA 1U8ZA 1NY6A 2Z4SA 3GJ4A 4NL4H 3TRFA 1EFRA 5JHHB 3MWKA 5JCPA 1T9HA 3LX8A 3Q8XB 5DO9A 1OXSC 3ZYCA 4M1WA 3PUYA 1VDZA 4NHOA 2UVQA 4UXHA 2YINC 4DZZA 1QHHA 4B76A 2VL7A 3SYLA 4JMPA 1DAEA 3WBJA 1HE1C 3MWJA 3U3JA 4EJSC 5HZKA 1ODFA 4BLTA 4C0JA 4FINA 4IOKA 1G4AE 1EFUA 4OI4A 5LB4A 1UAAA 3KQKA 1QF9A 1P4SA 5B58C 2XJ4A 5FTLA 3PCRB 4ZIRB 4AYXA 4AWXA 3A1SA 3EZ2A 3IIJA 4DLXA 4YQFA 1CLUA 1TQ4A 3A1VA 3RWOA 2P6RA 2LCFA 2RHDA 4NZYA 1Z0IA 3SHFA 4BZXA 4D26A 2JATA 1D2EA 1IOZA 4LDJA 4QJ3A 4PPNA 4FCWA 2IYWA 4FWIB 2HYIC 4EPWA 1SVIA 4N3NA 1AK2A 4PPFA 2DWQA 4XWOA 3EPKA 3R9IA 2BV3A 1QBKC 2VP0A 2W0MA 4EUNA 1O3YA 1GL7A 1ZM7A 1KNXA 4EAQA 1IN8A 3FFBA 1W4BA 1W5SA 2FJUA 1E2KA 1CJTC 1G5PA 4TN1A 1XCMA 1VTKA 2VBCA 3GCGA 2QSZA 1KO8A 4RD0A 3AKCA 2QP3A 2XZOA 3I73A 3DPUA 1EX7A 1U9IA 3H2YA 5FPKA 1UADA 2NO6A 4ZDIA 4C3ZA 3SQXA 1XD9A 5GJVC 1TU3A 1KK2A 1HE8B 1NVWQ 1SXJA 1W46A 1OH6A 5EUQB 3X1ZA 4GRAA 3LY5A 5C1BA 3LBNA 3DM5A 3I92A 1NIJA 4BRUA 2WWYA 3CPJB 3MJRA 3W6NA 2BKUA 1YR9A 1R5OA 3ZD7A 1OF1A 1M6NA 4DXAA 4GOJA 4Q9JA 5CDFA 5JHGB 4TYQA 4U02A 4EQ6B 2JLWA 3FMOB 1PJRA 4C0QC 4XVQA 3ZVLA 1E6CA 2NIPA 2IX3A 1ZNYA 3AVXA 4X8MA 4RFSA 2CMKA 5EE5B 4A82A 3NH6A 4Z8XA 2W00A 4AKEA 3H1TA 1JJ7A 5F9HA 2VF8A 4I1UA 2N1BA 1VCMA 2J5XA 1NSFA 4H9GA 2CCGA 4CEIB 3AVTA 4UNRA 1XZPA 2F7SA 2C96A 4A92A 2WOOA 1TAGA 2A7QA 4KSBA 1ZBDA 5BW8A 4QC2A 3K9NA 1F60A 2GJKA 3LFUA 2J0QA 2XX3A 2RGEA 2PMDA 3KFXA 3AF1A 3THXA 3CKLA 2C77A 3CW2A 3EZ9A 4DSTA 4E07A 3OF5A 3W90A 1HT2E 1KAOA 1NIPA 1IQPA 4QNRA 4OK6A 2OILA 3C4JA 2RGAA 3LBIA 3T1OA 5IT5A 5FOSA 1OYWA 1X3SA 3EASA 4B43A 4HUQA 1DARA 3QXCA 1RRFA 4HLUA 4MGIR 2W2TA 2XTNA 5CB6A 2P5TB 2PZGA 1ZVQA 4Q9IA 2H17A 2JJ8A 1Q3HA 4XD7D 3WMFA 2ZYVX 3WNBA 4ZV4A 3P20A 1Q12A 3U7FB 3MRSA 1MO3A 4GNKA 4DDWA 4FMCB 1EX6A 2C78A 5HKKD 2P67A 3GLGA 1XPRA 1RC8A 1YQTA 1JR3A 3W34A 5L3SB 2Z43A 3CF2A 3GFTA 3SHWA 2R2AA 4GSYA 1DAGA 1E2GA 2VP5A 2F6RA 1G9XA 2IYRA 2F9MA 4LZZA 1CXZA 4KBFA 2RGBA 2G0TA 1N0WA 3JVVA 1VG8A 3QXJA 4MYUA 2QENA 1T5LA 2BMFA 2GTPA 2ZJOA 4PANA 4LCBA 2DCUA 1H8EA 4WBSA 4OI2A 1D8TA 2QP4A 1OKKA 3BBPA 4G5GA 2ZROA 1N5JA 5IK2A 2EVWX 3LX5A 4ARZA 3R8CA 2A5DA 1JB1A 1GL9B 1ZRHA 2EFGA 5CJPA 3BERA 2GVDC 3T35A 3FOZA 2BMEA 2W6IA 3LO5A 2ZJBA 4OQLA 4PSAA 2H5EA 2XNDA 1F2UB 5BN4A 4JLNA 5IK2D 5E7IA 5KSOA 4LK2A 3V9PA 2QMEA 1Z6TA 2X2FA 1D9XA 1KKMA 3VR5A 2W83A 3CONA 2WAXA 4PAQA 2KWIA 1KDOA 2A5GA 3HYRA 3KKPA 2FFAA 3PG5A 2OZEA 4QGAA 4EDHA 1XD2A 4O3MA 4MA4A 5FOWA 4HZUA 3EWAA 3CX6A 4TQUS 3B1YA 1KHTA 5JZVA 3W5IA 1QZXA 4C4PA 5D3MB 2PT5A 1E2QA 1FL9A 4H1VA 2P3SA 5JJKA 4LRWA 2GNOA 3SEAA 2O5VA 3MLEA 2JIZA 3L0IB 1XX6A 3KJEA 4CEHA 5KPJA 4HAWA 4BFWA 4D0NA 1AGPA 2ZIAA 3N2IA 4V0MA 3EPLA 2V6IA 4Q4AB 4A9AA 1JI0A 2EWVA 2AN9A 3C5CA 4Q18A 4R9UC 4IJMA 1XXHA 1G19A 4LC0A 3OESA 4L9SA 4GP7A 3P32A 2I1QA 1UBEA 3BGWA 2A5JA 2DWPA 4QHSA 3T15A 5G53C 1MRSA 3WRYC 5K8TA 5CYOA 2VHQA 4JT4A 3TSOA 2HYDA 3DL0A 1NRJB 3B8HA 1N25A 4Q4HB 1G3MA 3TAUA 3FGNA 4MRPA 4DDUA 2JA1A 3B7GA 3PUZA 1BIFA 1AGRA 2X8AA 5TXGA 1JQJC 2IWRA 5L3QB 1G64A 3KUDA 2ZRCA 4NYJQ 2MSEB 1JAIA 4ITRC 3VHLB 2J0UA 3CZPA 4PFSA 4YONB 1COWD 3G5UA 2ZRHA 3CNOA 3K0CA 4B35A 5FTMA 4XTCS 1LF0A 5JBQA 3SE0A 2PCJA 1Z5ZA 4BFVA 5TY0A 1Z2AA 5L3VA 2WSSD 1XU4A 3AVOA 1COWA 1BMFA 2Q21A 3CRW1 4C9BA 2QQ0A 5BYKA 3GLIA 1TF5A 3C7KA 1WQ1R 1UJ2A 2HDNB 2ZRNA 5FBWB 1E94E 1T0JB 5K8IA
chains in the Genus database with same CATH superfamily
4Z2AA 2CZQA 4F4IA 2WWXA 3G7NA 1RJ9A 1JQLB 1YZHA 4NAVA 4XDGA 4BCDA 2RGWA 2X76A 1JE1A 2JLRA 2WZCA 1LI4A 3M6XA 2HMWA 3S27A 2JFZA 3JWHA 1NNSA 2WA2A 2EZ9A 1R6DA 5EJ7A 4ZOAA 4HJXA 1BEZA 2WNSA 4K9LA 2VWHA 3AIKA 3IUSA 3ZDZB 2WNIA 1RYZA 4G0MA 2AQ8A 1WCXA 2C2ZA 2RHLA 2CLDX 1OV6A 2YC2C 3TKYA 3DW3X 2BKXA 3NJ8A 4I55F 5CNMA 4U8GA 5K51A 2JDID 1R4AA 3WGOA 1XQ9A 4OI0A 2B5VA 1A7KA 2G6BA 1A27A 1Y6QA 2XKAA 4FYHA 2CYAA 1W75A 4JASB 4OHFA 2BN4A 3G0CA 1AO0A 1J42A 3LIIA 5LLSA 4RIHA 1T2CA 4Y98A 1E3DA 1F2DA 2C8VA 1RZUA 1S5PA 3NKLA 4IH9A 4YAKA 2I4RA 3ZZTA 1GAEO 2Z98A 1EXNA 2VAVA 4KLNA 1Z6ZA 4UDOA 1H4VB 2FWNA 2IP4A 1GNPA 1OV4A 1JH8A 1QFSA 5D6OA 4GZMA 4FS8A 4YTEA 1KDVA 1N1GA 1ZIDA 4G0UA 2GN8A 2X0DA 2MMCA 4RJLA 3DMNA 3AUSA 5GV7A 4GX2A 2PMEA 4EJMA 1HEIA 6PFKA 4ER3A 4BY9E 3CSUA 1G5RA 1PEKE 3DLPX 4Y2VA 1L4NA 1E4EA 2QN6A 4I4TB 4IVPA 3PRJA 3DEYX 3KKQA 1PGJA 2PGXA 4JVOA 3SS8A 2WFMA 4CMIB 1CNFA 1RRPA 3M70A 4ERNA 4MUIA 5J58A 4RFLA 4ZVLA 3E05A 4L6AA 5K1ZA 3ZH9B 2G04A 5LFAA 2PZAA 4F9EA 2UVPB 1U7XA 1UP7A 3EIEA 4S2UA 3UK1A 4EPVA 1A4XA 5CB4A 5CXSA 1KMCA 2MWMA 3QA3E 3X3HA 2QRJA 5EY5B 3H4VA 2V74B 1E9SA 1EDOA 2OKCA 2PT9A 4ND5A 3BJZA 4GBGA 3TR0A 2NM0A 1K7SN 1QG0A 3L4BC 1KYWA 4HO1X 4OQDA 2M6KA 1KJIA 3I83A 4OD0A 3UCEA 3URKA 4OQFA 4F1KA 4O4IB 4ESHA 3ER8A 5AVYA 2CVHA 1YRBA 4BOYA 4D8YA 2ZI9A 4YJHA 1CUEA 2OSBA 3CMMA 3SOPA 2P1DA 4G25A 2GLTA 4MA0A 1W2WB 5I3ZA 3LVRE 4E03A 3TB6A 1VG0B 3KDPA 4QAQA 1ISRA 3DBVO 5ARDA 2UYOA 4E7OA 1Z0FA 4RADA 1X1TA 5JXWA 5AKYA 1KZ9A 1IAVA 2FEAA 3WGGA 3EGXA 2CE7A 4QL3A 1HLGA 3R8XA 2EEPA 4R0VA 5BR8B 3GLGB 5DW3A 1GQOA 1CLEA 2PIAA 2C3PA 5KEIA 4XGQA 3P2YA 1YQDA 2Z57A 4CI9A 2Q3HA 1U7ZA 2XLBA 2OFWA 3DCYA 3A3KA 4WY5A 4A8JB 5JAUA 3PFHA 4PBTA 2JANA 4EGSA 4PVDA 2PX5A 1BEEA 4BMNA 3UNXA 4W5RA 4P4LA 4B44A 5IBPA 5BORA 3TBKA 1YK1A 4OFWA 1A97A 1Y42X 2N75A 3FIUA 4C0KA 2BJHA 1SCQA 3T9BA 1C7QA 3C7DB 2GX6A 2H52A 5G3ZA 3GPLA 1EXWA 1FE8A 3T3EA 2AJBA 4BYMA 1P2GA 4Q15A 3S55A 3KV3O 3FY4A 5EKTA 1BKSB 3J7AC 4EG1A 2VSXA 5EJ8A 2DG2A 3C6KA 4LZJA 4G0VA 2Q5FA 4PHTA 2VJMB 4ERXA 1MB4A 1GU7A 2A1UB 3G9ZA 5CW2A 4RIGA 1AHHA 1SBQA 2HHLA 4F3KA 1BCRB 4LPKA 3AJAA 1GWNA 2GCEA 4WUTA 1DAKA 3E3AA 1ECPA 3FF4A 1GY8A 2Z9DA 3WDLA 1GM5A 2I67A 5DX8A 2D6FA 2J8ZA 2WF7A 3HP1A 3ZGVA 5JDIC 2WEKA 1OR8A 3BCUA 3VPDA 4S2EA 3QELB 5AUQA 3ZKWB 2PA3A 4Q9LA 3FRHA 4I8DA 1MO6A 1ZOSA 1C4KA 1FP7A 2JF0A 3JZIA 2QRMA 4R8RA 3AY7A 1IMOA 4ZHSA 5CBKA 3PNSA 4JNKA 2GVZC 1AMNA 4KPEC 2FMTA 2G83A 3UKJA 4YCNA 3GBVA 1M8GA 2XZTA 3ESBA 3FSGA 3ZJTA 4KQXA 3HMQA 3REGA 2HMYB 2ZIZA 1CRPA 1HTWA 3ICEA 1WXDA 3P9QA 1PV4A 1HDRA 3D4OA 1YZQA 2RGYA 4FBLA 4IIYA 3PNOA 4K5QA 7REQA 4MQEB 5DLPA 1WCYA 1WAMA 4EWLA 4EPXA 1YHZA 4QPDA 1GRRA 2JFGA 4Y2SA 1MOQA 4NLLA 1MA0A 2HXSA 1QHSA 2AR7A 4XWYA 3K09A 2OAP1 3OZ7A 3RBXA 3RUHA 4AJ2A 1PK8A 4ITVA 4YDRA 1AA9A 3T7AA 2K7FA 1QYDA 3LUPA 1EVZA 1Z0SA 2GASA 2ZQYA 4MJXA 4WZAB 3K0AB 4Q6WA 4A03A 2QJTA 1EWQA 4FN5A 1EP3B 4EOGA 1FYFA 3INGA 4A8PA 2IT1A 1VECA 3MCZA 1I33A 4OU5A 2Q6KA 2ZRBA 3OOHA 5EIBC 3QWHA 2QD1A 4MLZA 3WTBA 2ZSKA 1EFTA 1NVBA 1E1LA 1Y98A 3DT6A 1MA3A 3KRTA 1BMQA 4MUHA 1B14A 5A04A 3JQ7B 3R6DA 3EGEA 3GFQA 3R6WA 3A2LA 3M6WA 3NI2A 2R00A 3GZNA 4G23A 3VC3A 2B34A 4IGAA 4RULA 4TMKA 5EE0A 5LQNA 1UBOS 2EW8A 2VXBA 3OQIA 3PUWA 4J75A 4UDNA 3ZHSA 4E70A 5GZ1A 3OX2A 4YCAA 5K3FA 5JNLA 3CVXA 3Q98A 2II6A 5F52A 3U7QB 2YRWA 4L8WB 4D9NA 5J4YA 5LKAA 3GN2A 3ZU2A 2MMGA 1JWLA 4AJNA 5CG1A 4JBNA 2AC2A 3B53X 1L5OA 1IBCA 1JAZA 1ZMRA 1O96B 1ANKA 4WGGA 4UZSA 5FXMA 4NV1A 1FYEA 1N7JA 1NP6A 1V11B 3QVSA 3AY0A 1GT6A 4NBSA 3D8UA 1TO6A 2WKSA 3V4ZA 1GYPA 1UXOA 2VEDA 1ZUNA 4M0UA 2P2GA 4MVXA 5HK8A 2ESRA 2VIIA 4UDYX 4QXMA 3GYGA 1NJ1A 4J2HA 2AJ8A 2DPHA 2NGRA 1HNXB 5D51S 2O54A 3V34A 2XD4A 4AY5A 2HOQA 2NW6A 3BCSA 3F78A 3AYXB 4UPDA 4WBNA 2VHZA 3M4YA 4WT7A 1U8UA 3CPSA 1TCUA 2ZQ5A 1JR3E 1WV1A 3PKIA 2QTFA 4KN8A 3ENZA 1OAAA 1G21B 1PG2A 3KOMA 3N70A 3P9PA 4NYIR 4OXRA 3SZ3A 3WLSA 2C9YA 3T06B 1Z0AA 5JZSA 1K7YA 5C5EA 1DEXA 2AT1A 4O59O 5DLEA 5JJLA 1YB5A 2ZBPA 1B2RA 1QTNA 1PG5A 4KIGA 4ND7A 1NMXA 2VOJA 3WKEA 4C5CA 4H3VA 2FWPA 5K9ZA 3WLRA 4TYWA 3DVAB 6CHYA 3PSAA 3GLSA 1V5IA 1U2SA 3L7MA 3H6GA 1RR6A 4NOLA 4IIVA 3TOSA 5IW8A 2BF7A 5EXXA 2Z04A 1UEIA 1CZHA 4JYMA 1CWUA 2PRJA 1I4WA 2KI5A 4G9GA 3TTYA 2QRLA 3CXRA 4R51A 3FDJA 1Y89A 3O31A 4M7OA 3SLKA 3L07A 3IALA 3EQ9A 1GIAA 4I6JA 4V39A 3KJXA 4HYQA 4RHUA 4WK4B 3F7NA 2RFLA 3HBJA 4M98A 5C2JB 2P7HA 2GT1A 2ZSBA 2WB2A 4PYJA 4I2NA 3LECA 2R4TA 2VLBA 2XECA 4LWOA 4R5MA 4WDRA 3U19A 3VZCA 3V42A 2I66A 3PDWA 4YAUA 3K31A 4B31A 2I4MA 2UUOA 6REQB 3WLIA 4LEIA 1LD3A 2O0JA 1QGYA 1RIFA 4MMXB 1QG6A 3EZNA 4WXRA 4G65A 5KQPA 3GEDA 3IESA 2IP1A 3NRBA 4MJLA 5EXPA 1NQWA 3UK6A 1UKEA 2H59A 2BTOA 2C2MA 3EGIA 3IE2A 3R6TA 3RI3A 1QQ5A 4JLVA 4D99A 4C89A 4ZI7B 1G42A 1DBWA 1J2TA 2H7XA 4EF5A 1F7UA 4HAUA 4UCFA 3TKLA 2P35A 4DQDA 4DGQA 1P18A 3AIOA 1J0DA 3HXOA 4JQCA 2C2GA 4MRSA 3ZDBA 2WINI 3CT4A 3OM0A 1T8TA 4O2AA 2AF4C 2I7DA 3SE7A 4YRTA 4CXMA 1I2BA 1N2SA 4YV2A 1K5HA 3UW3A 2VYND 4EHNA 1I3CA 4GI3A 4PCAA 5AHOA 2BL4A 2RHJA 3O2JA 5FA6A 4F5WA 1XLWA 5BXYA 3L6EA 5FHQA 1GPUA 3FPJA 4EKIA 3DMTA 3DOFA 2VK1A 3OTGA 4NBTA 5JASA 2O07A 1GRQA 4Q16A 4BYGA 4E5UA 2FLWA 1DHRA 1VIYA 3M3HA 1EFAA 5IULC 2LWIA 1W36C 1NC3A 1OFIA 3KC2A 1GZ4A 4YXWA 4IR7A 4KO1S 1T9KA 2BCJQ 3UMGA 4CLRB 5JD3A 5CBPB 2DBQA 2X7XA 1CJBA 4RPHA 2H65A 3NBYC 4RD1A 1YTLA 2QSJA 2XNJA 5BSWA 1IM5A 2P4EA 2C97A 3EPRA 4AP6A 3LO8A 2AZTA 2WKRA 5IARA 4YC7A 4YI3A 2XZLA 3QVTA 4YXWD 2G4CA 2HXGA 5AJXA 1DDGA 2CXPA 4ALNA 4BKQA 3BEDA 2PYDA 3JW8A 1SVMA 2GJ4A 3M0EA 2GWHA 3G17A 1LDBA 4OU4A 2NYRA 5LZ4A 4WZ6A 3EGVA 1SKMA 3T3PB 2NQTA 2R8RA 2YZGA 3Q6MA 1V3VA 2V7QD 4HXGA 2ZJZA 5IJAA 5C8DA 1A8PA 1KEVA 2MSLA 1GXSB 3SFZA 3IAS1 2WYVA 1U7UA 2WKQA 3ZDDA 1F2TA 4RPKA 1PDOA 1QHXA 1NUTA 3O75A 3ZXUB 4QBFA 4PTLA 1YS9A 2WAOA 3HNPA 2VWGA 2OFPA 4JKIA 1QGOA 2QTWB 3CEJA 4WASA 3A2MA 1C81A 2PMBA 4EY4A 1B1CA 1RYNA 5AVOA 1JIIA 4YECA 4MCIA 2GBGA 5TVKA 3EMVA 5ESRA 4PU0A 3K05A 4GNRA 2OENG 3BFJA 3D6VA 3OF3A 4O2RA 3VDXA 5G2OA 1YR2A 2Z4RA 4DRXA 1KVQA 2LCIA 1PZMA 1O94C 2QVZX 3COPA 3GLHA 5KHOC 5LQAA 1CUHA 1NDHA 1K7EB 4B7CA 4A10A 2IXAA 2GZDA 5A3QA 2C5LA 4WOCA 1DHTA 3DOHA 2X58A 4OHUA 3H5NA 4EKDA 3UN1A 1BFUA 3GRFA 3KWLA 5CXQA 2YJZA 4ZTBA 4AO7A 4EY5A 3ZUGA 1E2PA 4KGDA 1NBIA 2NSLA 4GVPA 3IT3A 1G1AA 1A98A 3B1WA 4X92A 5I47A 4DR4B 1NTRA 1T4CB 2CN1A 3HDTA 5H4HA 3USZA 1PNQA 2HADA 4DCMA 1B76A 4QHYA 3W1WA 3MIIA 4FDUA 4HEA6 1KO5A 4ALKA 4YCBA 4W5HA 4C4YA 2F62A 1KVSA 1SJ9A 2ZB8A 4MVJF 4PX9A 4CM6A 5EZYB 2YNMA 3CO5A 4P5EA 2Q4RA 3UGQA 3THWB 4EEXA 5J23A 3G2HA 2DGDA 4BX2A 3ZD6A 2NMVA 3KCNA 2AK2A 3NRJA 1C0IA 4I3GA 4QTZA 4WCVA 5EESA 5BNWA 3GJ5A 5LMNB 1ZD4A 4DV2B 3D8BA 2W6MA 2GEBA 1CX9B 1XWFA 2GN1A 4BNTA 2W4MA 1FK8A 2NACA 3ZE2B 5CFQA 1HSZA 2UYCA 2PTHA 3RYHA 5JQGA 3A0RB 3HCDA 3K6JA 5DEOA 4CLOB 4D3SA 3C74A 4OX9B 4ODIA 3KD2A 2WIJA 2VT7A 5CT5A 2MINA 2AMYA 1KFEB 3VPHA 1ZVVA 2H7CA 3CLRD 2IGBA 5DULA 4TTVA 4F4FA 2TECE 4S05A 2XMGA 1MAVA 1DKLA 3AP2A 3QHQA 4M22A 4DA9A 4WGFA 4BMPB 1IHPA 2JIRA 4CCYB 2G9RA 4DLRA 4Z54A 3BHJA 4OSEA 2COKA 4MKIA 5AVSA 1AZLA 1LWOA 1G2OA 4MW2A 2O8DB 3W9BA 2A88A 1UMBA 5E7JA 3L7DA 1GOTA 1YS2X 2O57A 3CFYA 3PF8A 2K7ZA 1D2NA 1G20E 3VPBA 5HZHA 3WKAA 3WIBA 4HEHA 1WO8A 3U7HB 3O8RA 2DZDA 2AN3A 4OKNA 1C4OA 1WZNA 2Q5LA 5EHQA 1GPKA 1ZJYA 2P5UA 2QJOA 4D5GA 2VQ3A 2J5KA 5IVDA 5IDWA 4PEVA 1JG4A 3JQDA 3W8DA 4X1KA 1P1CA 5IBQA 1UJ5A 4YASA 3WK4A 1QHEA 1RLIA 1W5AA 1Z18A 2XQJA 4JU8A 2IXDA 2Q07A 4L28A 1UOEA 4MCAA 4QVKA 4TXLA 2WHRA 5FOTA 4AK9A 1N3LA 1D4AA 1E2EA 5C1OA 1WCIA 2IZ5A 1QFYA 1L7EA 1YOVB 4C7XA 4Y1FA 4WACA 5EA2A 4R6XA 3RTAA 1JEQB 1BHO1 1ZM2A 2NNWB 3RAEC 2A4KA 3K0AA 3IFSA 1KFKB 5DM0A 2NO9A 2Q7DA 1THMA 3MTDA 4RF4A 4UQOA 2VDLB 3RKRA 1E2IA 1E2JA 2WJZB 3X2FA 4ILEA 4JUBA 1Y6GA 3EPJA 3VU3A 1CUZA 3UUFA 1MVNA 2VAPA 5HHTA 3ZOZA 1XMOB 4N5NA 4KJZA 2JBWA 2XKJE 1FMLA 2R5WA 3BJRA 2YCBA 1YS4A 2VDVE 1NN1A 2Q2NA 5FTWA 1FDWA 4EPRA 3IAHA 3TCXB 3A10A 4YEDA 1NVXQ 2XRZA 3DQPA 2JGFA 9ATCA 2OD9A 3FKSA 4L1KA 1CQXA 3HUDA 2V1UA 3Q2KA 2XIJA 3BD9A 3W2TA 3ZZ1A 2HJRA 3B48A 2GARA 1RWWA 1YQGA 3VX4A 2CHUA 3UHFA 3C85A 2A14A 2FPXA 2VA8A 3LZ6A 4K9PA 2GSWA 5H70A 2A6PA 4YRLA 4CI0B 3RFXA 2JAHA 3PEUA 2YC4C 3ZKAA 2A94A 5LB2A 4TSFA 4DMCA 2GKGA 2B0JA 1TVEA 3ODPA 2RBKA 2ZJYA 3PEFA 2OO3A 3FFXA 1JPJA 2V5UA 2BMDA 3P9YA 1QYCA 1IE3A 1VLJA 2WM3A 3BH7A 4MXDA 3QBEA 4P82A 1RAHA 2ZIGA 3FFAA 3ITDA 4TV9F 5DYNA 5EFOA 4MV9A 3NDIA 3PQ5A 2DPLA 4DMUB 4B3BA 5D7NA 2YJ3A 3HCNA 4B3FX 4K46A 3GRKA 4AZVA 1K66A 3OHPA 1LZLA 2X9QA 5EPOA 3E2PA 3ZK9A 3KAJA 4B09A 2H1OA 2HL6A 2WFLA 2AW3A 1PL0A 1UFOA 4FB5A 3JAMA 1XVLA 4IX1A 4M0EA 1L8OA 3KKKA 5FNZA 2UUPA 4R8SA 3PJRA 1TO1E 2OLJA 2WUFA 3BF7A 4OO3A 1ZD8A 1IJEA 3DE7X 3KYCA 1U0FA 3JZDA 1W52X 3NBXX 2JIMA 1ECFA 2DFLA 5DASA 1LLFA 2QJRA 2AG6A 2FX2A 3I09A 3ICCA 3JYLA 1NN5A 2WZQA 1CUIA 2JJQA 1O95A 1XK6A 2QGFA 3KETA 1ZCZA 2A3NA 1AS2A 1LLQA 1NT2A 1WW8A 1UPXA 1LWNA 2GPTA 2X5NA 3EA4A 3K0HA 4PQGA 3RBVA 1U0BB 3KB1A 1CUSA 4M1SA 3L7NA 2ZBQA 1ABEA 4TZTA 4UAUA 1JJFA 4IJ6A 3AJDA 1FFXA 5IJZA 2H2AA 4GD3Q 4OHXA 5EYPB 1RBYA 1FDRA 1M1YB 2RJ3A 4TTAA 3EC2A 1QZ3A 3D7RA 1TIBA 3P9IA 3KUUA 2HC9A 3KOZA 4MPPA 1FX0B 3LL4A 1VBMA 1JR4A 1WUIS 4D0RA 4AD8A 3LRTA 4RVNA 1C9NA 2WJVA 3CF4A 3ZWAA 621PA 3L46A 3UMBA 2YWXA 1PKXA 4B6OA 5EIFA 4O8CA 1RU3A 4DCOA 1PG0A 3INYA 3HR4A 4Q1BA 2XUDA 2P9ZA 1UOQA 3KM0A 5A2QA 1SIOA 1LDYA 2P62A 2W6NA 3CNQS 4MWCA 4NBNA 1SUEA 5KYXB 5H9WA 3HLTA 3GVCA 4XQ0A 1EG2A 1RKBA 2YY7A 8AT1A 2ZI7A 4LG1A 2HU8A 4QBIA 2QUKA 3IV6A 2FYTA 3VHQA 4BX0A 4DHWA 4EYOA 1O4VA 1O0CA 2OR3A 1SH7A 1J9GA 4I9GA 4YRNA 5DGDA 3GO4A 3N87A 4IEIA 2O59A 2BFNA 2XD9A 4NYMQ 2WTUA 4DMKA 3MJHA 2IELA 5EWLB 3DOOA 2EKQA 4NZOA 3K94A 3PITA 3U3MA 3ZUPA 1QIDA 5JAZA 5MN5A 4AY6A 2Z6QA 2GCNA 2QTMA 4GPBA 1QK4A 3FWYA 3SU8A 1J7KA 3QKRB 3W8RA 1Z0JA 3GLIB 3T0FA 1ZGGA 5FOUA 2LZ0A 4EVQA 1RM3A 1KYQA 3QUAA 1N1MA 1EP1B 2QGNA 3RIEA 1SC3A 2XNSA 4N7RA 4CKCB 5LQSA 3F7OA 4D97A 1E1NA 1CG6A 1Q1BA 1CZKA 1U28C 3RR2A 4AXXA 1CE8B 1PNOA 1M6VB 1OKKD 3SQOA 3E03A 4J9VA 4J0JA 1BGWA 4IUDS 4XIJA 3D3WA 3FKJA 4UBKA 3GJQA 4WE3A 3TNYA 4B32A 3NHUA 5I9IA 1B6GA 3L8ZA 3EW7A 4DM3A 3PL5A 1EFPA 4MV8A 1AKQA 1ODJA 3D0OA 2PNJA 4BB5A 2XOXA 4JJAA 3VVMA 1O4WA 3WNZA 5A0VA 1XFAA 2QRVA 4TRNA 2I8AA 1R4ZA 3CX7A 3EVBA 3KYDA 3PNBA 4DC1A 2VSOA 2E48A 3R5JA 4DJEC 4HNTA 2PGNA 5JAPA 5KYYB 4ZXPA 1H4TA 1ZJZA 1RCTE 3JQ6A 4MINA 1XRJA 5HQJA 5BY2A 2C2OA 2Y0EA 5D1NA 2OCXA 1P8AA 4RY9A 4Q4AA 2W2VA 3I37X 1EDBA 5TJHA 3CRVA 4RH3A 4EEKA 2ATVA 1IUPA 3RFVA 3KSRA 5LA6B 1O94A 2R4UA 1MC4A 2GJ9A 1RWXA 3BTSA 1MT3A 1FMJA 3JTMA 5J3JA 3D8NA 4CG2A 5K6AA 1R0XA 1M1NA 2R6AA 3K0SA 3F3KA 2Q9UA 3A8TA 3GRCA 4EHHA 2BLLA 3TSAA 1I5EA 2XA1A 1IWOA 4BNWA 3WL8A 1AHIA 1JHZA 3F3SA 1JRLA 1ODCA 4P3NA 3HHPA 2W2PA 2H1HA 2WF6A 3CW9A 3DO8A 2I87A 3FWHA 3R23A 4RCZA 2GLUA 1M72A 5GM1A 1Q1GA 2ZGVA 3PENA 4N03A 4PLGA 1ZMBA 4PSVA 3PQDA 4RGQA 3U3XA 3GA0A 3HDQA 1JV2B 5JWOA 4A1OA 1JILA 3PRYA 4BKRA 1HR0B 1P6QA 3ZI0A 2COUA 3QRWA 3R41A 1QFMA 2I4TA 2B37A 2W98A 2PX4A 1XD2B 4QYMA 2O7NA 1U8EA 3M6LA 2C2HA 2DAPA 1LB1B 3OTWA 1M6EX 3B2EA 1KXJA 1SKQA 2A4MA 5ADVA 1Z22A 4F7WA 5C8YF 1P81A 1GTRA 1AJEA 3RS2A 1OA0A 2QVBA 1BCSB 5GMOA 2R5FA 1A1SA 1DIGA 2R68A 4G5YA 2I9KA 3ECSA 4Z4EA 1RP7A 4JHLA 4H16A 4Q1FA 1KI1A 4DBLC 9MHTA 4CBVA 2G25A 4V1CB 1R8YA 3B6MA 2D0PB 3S1LA 3ZXYA 1A9SA 3HZZA 5KNCD 2WJPA 5KWJA 1R16A 1ISFA 5J40A 5EIHA 4EFDA 1VP9A 3ZHYA 1XHEA 2W2XA 2C03A 2X19A 3C8DA 3OT5A 3ZXSA 4NZZA 4KUHA 4L6CA 4MYTA 4M2LA 3O91A 5DWDA 4WN9A 3N0XA 4G5XA 1PD0A 1DVRA 2XT9A 1U99A 1TMKA 1T4DA 3MNFA 1Q1EA 5B37A 1Y7LA 1WE2A 1XUOA 1PWHA 3DDHA 2F3RA 1FDTA 4P80A 2O9JA 5HDBB 4HDQB 4L2IA 3NTXA 2ISCA 3GEIA 4BP8A 1J70A 3MINB 3FVVA 4EGCB 4RA6B 1XJ0A 3IT1A 4WK2B 2DY1A 5ESDA 4OH1A 1VHJA 4RE5A 1DAHA 2VDRB 1VMEA 1ZVKA 1UKYA 1JECA 1PX0A 4IH1A 3F1KA 3SEFA 1DKQA 1CQPA 3ZIUA 1P3Y1 1EQUA 3N0VA 1VI6A 4BNVA 4FVTA 4WA8A 2O3SA 3EZGA 3RAFC 3WYFA 3TTWA 1ZK3A 1P7PA 2HK6A 2PGDA 2GXQA 3AUFA 4X45A 3UXMA 3ETCA 1XJQA 5IM4A 1J4AA 3SGLA 1CDZA 1CUYA 1RYEA 1PWEA 3OHSX 1C5KA 5DBHX 3WK6A 2XCUA 4PNPA 1W25A 1FVOA 2JBHA 4P7BA 2BM8A 1OWNA 1DFGA 4I7EA 4Q7KA 4ZGBA 3P9SA 3UGJA 3ROMA 4KO3S 5GP1A 2HO4A 4HDNB 3I9NA 3KU4A 4QULA 5GOTA 4RTLA 1NUQA 1ISGA 3IA2A 1KI6B 3ZWXA 4YV7A 1HX7A 4DPLA 2AJDA 3ZX5A 5JZOA 1JBKA 1TO2E 4LVCA 4NAHA 4NOJA 5EL0A 3DLIA 1U2QA 1LSSA 2B98A 1EJ6A 4YV1A 1ZX1A 1E58A 1Y3BE 4H1TA 1H2ZA 3IDQA 3MUNA 4ES6A 2J9RA 5J59A 2O6LA 1NY5A 1ULUA 5AI8A 2DKOA 2DX7A 2EKLA 2QNRA 2QMUA 3E4DA 3E9YA 1NQUA 5H81A 3OIDA 1YR8A 3GLHE 1Z0ZA 3CZAA 4FE4A 4NEGA 3W2EA 2XQKA 3OCJA 3VA7A 2YUIA 4DY6A 3QVGB 4KVGA 2CJPA 5BUCA 5KTRA 1DQYA 1ZIYA 1C29B 1DIRA 5CT4A 1XTQA 1SVOA 4D0LB 3DOEA 3HB5X 3GLGE 5K2OA 1C3OA 1T35A 2XT6A 1PU2A 2IHZA 5FNVF 5EJIA 2I2XB 3L7LA 4XTRA 1FBNA 3O03A 1NASA 1P2BA 3BGSA 2G3YA 1QG4A 2EAUA 2JIBA 2WJWA 2ZYTX 3E8MA 3KZOA 4K86A 4KAAA 4ZU3A 4KPFC 4DQUA 4ZK2A 2BY4A 3BRQA 4P4UA 3E7WA 5DVZA 4CM4B 4RS4A 3NWJA 1R6UA 1E32A 1WCIB 5H3LA 5B3JC 2F59A 3QKIA 1U2GA 1UOPA 4CV3A 2AI2A 1WB4A 1GGMA 1XFDA 2IOFA 4LQLA 4PQFA 3IEMA 2I91A 1C9DB 1MV5A 3IH5A 4Z9BA 5HIIA 2IJGX 3A9RA 4MWTA 3EEOA 1VPLA 2VOEA 3GGOA 5F5LA 3TR6A 1DJNA 4LWZA 2O2SA 1KZ7B 1KVRA 1S96A 4R5HA 3MS2A 1TYBE 5HKLA 5TMDA 3OUZA 3Q88A 4D46A 1E8DA 2EWMA 4JEUA 3WK8A 3B1XA 3AEUA 4FCCA 4IQ0A 3IS3A 4AM8A 2WKPA 1ZD1A 1G4HA 3PGKA 3DFIA 3ABSB 4J0IA 3ZTWA 3INRA 2OMKA 2WIAA 2FUCA 4HNHA 4R84A 2HFKA 4R1TA 1UKCA 1OI2A 3EMDA 3Q7RA 2R6HA 3A11A 1QV6A 1XO1A 3Q3HA 1ZEMA 4ZARA 3SSAA 1GYRA 5L3ZA 3CZ9A 3KCQA 1XJWA 3EEBA 2FSPA 1NV8A 1EK0A 3NIFB 4DR3B 4AAYA 5CM8B 3H1PA 3ELWA 3M1AA 4N6NA 3SIPA 1N75A 3WAGA 5JMTA 2FK7A 1F8XA 2J67A 2P3LA 3KZCA 1JA1A 2OD2A 4D9EA 3BWMA 2X0FA 1O54A 1KJ8A 3SR0A 3TSZA 4QYXA 4U9HS 1K4MA 2B1QA 3A1FA 3HKBB 3ZWMA 2WBLC 4LXTA 2VJAA 1XTVA 1XQVA 4YJ3B 5I7WA 3CH5A 1X19A 3KQOA 3BD8A 3AVQA 3LY9A 5CVJA 2CNWD 4BQPA 1U0NA 1YR6A 3GPDG 2BT4A 5TQ0A 3FPSA 3F6BX 2Y8EA 4HVAA 3COVA 1ZVMA 1KR2A 5COAA 4W9MC 1EZZA 1E96A 4L73A 2HJGA 3VR0A 3VNVA 2ZI4A 3PP8A 5JU6A 5REQA 4ABTA 3DB1A 1J5EB 4MUBA 5ALRA 1YZKA 2EERA 4GIBA 4LDNA 5DNAA 5IFLA 4J90A 4WKCA 3GJZA 1E2UA 4OGKA 1E79A 3GLUA 2XB6A 3VC2A 3RO7A 2FEPA 4DA8A 2GD2A 1R6TA 2WYOA 5TPZA 4ZZIA 1J24A 3ADDA 4E2WA 2ZI3A 5EC8A 4E31A 4PLWA 3NHSA 2B4KA 3PHJA 2EV9A 2FG6C 2FFHA 2PL3A 2PQ2A 3A1NA 3FWZA 3G2QA 3F4LA 4GUDA 2QX8A 3FMGA 5KWSA 4PO3X 1PX2A 4LXQA 1FUEA 4CIXA 4DSNA 1C3VA 1JT9A 3L6BA 3OH8A 5AK3A 5IKEA 4C0WA 1S9DA 4F11A 3ND9A 1T2EA 3S1SA 4DADA 4U6NA 2H31A 1U1EA 3VOBA 1NW7A 1Z6AA 3TMYA 1C8BA 4RSHA 1OTXA 1ADYA 1T2DA 4N9QA 1X9GA 1R6XA 3WYGA 1W47A 1E99A 4B7AA 3IXQA 5LN1A 3TW0A 2J07A 2PEZA 2AV6A 3OKPA 5E4JA 1BKYA 2EFCB 3LKVA 1CE8A 3ER9A 4CTOA 3RRYA 3AKYA 2AOUA 4KB5A 4PC2A 1FTWA 4JCCA 2AX3A 3FH0A 5LLTA 4HVLA 3T34A 1LRJA 2JAPA 3BXGA 3SXUB 4RENA 2CHFA 1ZLYA 4UNIA 3WTCA 1E7WA 2AQHA 5IC6A 3UMCA 3W5CA 4PPYA 2IZ0A 4BP3A 5ADHA 2WTNA 3DQQA 1YRAA 3W1VA 4ND8A 2O0KA 3RC2A 1U0OC 1BAPA 2DU8A 3R6LA 1PT5A 4RVUA 1GGFA 1K9VF 4GU5A 5EUMA 3RSFA 3U9SA 1SU6A 3ANMA 5BSUA 5JS8A 2AEEA 1FP2A 1GZ6A 4YGXB 5KNDA 2H08A 4KX5A 2C98A 1OZAA 1LUAA 4ZEXA 2NVUB 2QU8A 3PYLA 4E7PA 2BR4A 3SZOA 4LX0A 5KJ1A 3AUXA 1VC2A 1K3UB 1YC5A 2TMKA 4HUTA 4P3YA 1JPUA 3KR2A 4C4ZA 4ZOEA 2J3KA 1HNWB 3QVLA 3V1LA 1SKYE 1EB9A 4PFQA 5DK4A 1OZFA 3ED5A 3WICA 3X1JA 4BBAA 2OWEA 3V1KA 4G2NA 4DLNA 2YVUA 5JSKA 1S8NA 1YQXA 1Z7BA 4AJHA 1EK2A 1EK1A 2P9BA 3RG2A 4ZO7A 4DPKA 3K9HA 3E8XA 5ARCA 1J90A 1PL8A 2FEOA 1G20B 3BK7A 2FUG1 2BEJA 3QX8A 4LRXA 4J3NA 1WP9A 3RYCB 4G0OA 2NUTA 1JEOA 2QTNA 5U4QA 4N8SA 4WFIA 4DBVO 2FR8A 4AL4A 3D3EA 1A4UA 1G5TA 3DS8A 3ZX4A 3LF1A 4P4NA 1O8CA 4W8HA 5EWLA 4RCYA 5KAMA 4G8JA 3RF7A 3MYYA 3H1EA 2X3YA 4K28A 3D2AA 4BMDA 1F17A 3TRIA 5KNBH 1XZIA 3C8HA 4JJ6A 1ZK2A 4NU5A 4HGYA 4C6SA 4YDSA 5IMSA 4RWZA 3HWX1 1Q20A 1QH1B 2XUKA 3IP9A 4GDMA 2XBUA 5B2ZA 2G5CA 3AR8A 1I1OA 1RCUA 4C76A 2H2WA 2O1WA 1OHHD 3NVKI 1SXJB 3OKCA 1INLA 4LHXA 3BZUA 4IP0A 4U1RA 3IEVA 1LTKA 4BV3A 5KVAA 1UK7A 4E3ZA 4F5ZA 4MS4A 4N18A 1OIXA 1UZAA 2PWBA 4KMOA 1TYAE 2O3JA 1SXJE 1R5JA 3HFRA 2ZU0C 5BN4B 3V9AA 2R8OA 3PC8A 3B1JA 4P5DA 1OHHA 1XR3A 2P9TA 2AKYA 3SEZA 1U6IA 4XGNA 4CR6A 4D8VA 2OG2A 3HPRA 4XI9A 1A9PA 4WESA 3CB2A 2IU0A 3OE4A 1FVXA 1L5FA 3T9EA 3GEMA 2X1MA 1VZ2A 2B1GA 2BEKA 4IMIB 4XX0A 4YFVA 3R74A 3V8EA 2GM4A 2MTBA 2PMKA 2GEFA 2R4QA 2QPTA 4G5FA 5A3SA 2R1TB 4LOAA 3N2EA 3L1HA 1HY3A 1SQ0A 2V4MA 2JNWA 4W5JA 2H4HA 5FH9A 2OOSA 3HJGA 1DOZA 1UOOA 2I2CA 4LXIA 3BGDA 3JD1A 5A3RA 2OB2A 3AL3A 3FPKA 1GUBA 1VL6A 3WDSA 2Z2YA 1RM4A 3IMKA 2VI5A 2EF0A 3L1IA 3ZW7A 1TF2A 4Q93A 1HT3A 5EMNA 2WU0A 3ZGZA 3V4OA 1KAEA 3PCXA 2IEZA 4JBHA 5GGXA 1XQYA 1I5RA 1VJ0A 3DTYA 4XD7A 3HCFA 2BFBB 2E82A 3O8NA 3PFCA 4HPXB 4UNNA 2NPFA 2VYNA 4P4SB 5GADl 2YWGA 1O6CA 2OT3B 3LPNA 4MRNA 3CLTC 3V1UA 3QX9A 4JI5B 3BORA 3PKZA 4JR1A 1A4RA 2C5SA 1NQTA 3G49A 4NJOA 3OE7A 3C6MA 4NZNA 2WVJA 2IRWA 3T7KA 1GRCA 1GZUA 4X00A 5SZKB 2G80A 4CHGA 2OAGA 1U4NA 3L1VA 5SZIA 4UOQA 1NVTA 3GD7A 3KTDA 4HZIA 3KB8A 4CKZA 4IOLA 5BVHB 2PUWA 1H85A 3ISTA 1YV9A 2OZKA 1X1DA 4EAAA 3LL7A 3VOSA 1GQ2A 3QYJA 1H3NA 2XMQA 2CNDA 2O52A 1VGQA 3COWA 3X0DA 4MLDA 1V48A 5JDCC 1GHTA 2PUDA 4PXSA 5P8WA 1NNI1 4DSUA 5HTOA 4US2R 5I48A 1J97A 1DPGA 1DBVO 2QM7A 3Q3CA 5IAKA 2OC4A 1U80A 4FI3C 3JS5A 4EY6A 3DLHA 3SJBA 4DG5A 4UUMA 3ZE9A 3MWYW 3U4QB 3K1YA 5CH5A 1YZLA 2LE0A 1BS9A 4P08A 5DYTA 1L0BA 5EVCA 1V1RB 3JTEA 4FYIA 1LZKA 1UC8A 3NPMA 1GNRA 2B69A 2FRXA 3GNSA 2UZ3A 3COZA 5JSFA 2AF3C 5KMGA 2WHQA 5KREA 2J9FB 2BKLA 4HX2A 1N6LA 3ZE6A 4DB2A 3A37A 4AURA 3L41A 2QMQA 3BH0A 2YY5A 4NU0A 3RROA 2J9FA 3LCUA 3E8SA 4W4TA 3R5SA 4ZMBA 2QLJA 5H59A 1TQ8A 4N3AA 4QUGA 1TL7C 4LNUA 5FLYA 4ON9A 2DFKB 4BL5A 3LDAA 3MJSA 5AKEA 1NLYA 4B46A 1BJRE 1WABA 3F97A 7AT1A 3RC9A 2QVGA 4BLSA 2JGDB 5A4IS 4I1RA 3WIVA 4UHJA 2BGIA 2ZG6A 4EW1A 2BGGA 2XWQA 3ABOB 4FU0A 5CCXA 3R5HA 4F2DA 5J63A 2AMFA 4FE3A 2EZTA 2IBSA 2J3IA 2QV0A 4LHEA 4NCBA 4OHKA 1X7YB 4K6HA 1R8XA 2E2WA 1UBMS 1AUXA 2D62A 4PPQA 1USVA 4I08A