4DXAA

Co-crystal structure of rap1 in complex with krit1
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
168
structure length
168
Chain Sequence
b'SMREYKLVVLGSVGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Rap-1b
publication title Structural Basis for Small G Protein Effector Interaction of Ras-related Protein 1 (Rap1) and Adaptor Protein Krev Interaction Trapped 1 (KRIT1).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 55
structure length 168
sequence length 168
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2012-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dxaA00
1XNJA 3TJZA 3RC3A 4G3XA 4QGHA 1QHYA 3FMPB 2ZRAA 2YOGA 3AUXA 2ECKA 4MGZR 3TRFA 2ZRGA 2W0SA 4ZO4A 2QN6A 1T3SA 5H1YA 4EFNA 3EWAA 3GLIB 1E94E 4IOJA 2O8CA 5FOTA 4D4LA 2QM8A 1DVRA 3KKMA 1OXUA 3B9QA 4TQUS 3HDTA 1Z28A 2H5EA 3AB3A 1GNQA 1X3SA 4XVUA 5LD2C 5C4GB 1VG0B 1QHGA 3GLHA 2IUTA 1COWD 1N5KA 2AHOA 1M8PA 4GOKA 3D8BA 1R2QA 2Q9AA 5BQ5A 1E9DA 2X2EA 4A0HA 1SVKA 4AYWA 1W47A 1Y63A 1UF9A 2C03A 4NYIQ 3THYA 3ZD7A 1P2TA 5EP2A 2ZYTX 2O5VA 3UATA 4DB2A 4TLEA 4BPBA 3ONWA 4W5WA 1E2JA 1TADA 2OE2A 5E7IA 3GLHB 3LFUA 4QGFA 4B47A 1DE0A 3NH9A 1RC8A 1Z08A 3AGQA 4JJKA 1ESNA 3AF2A 3DEFA 2ZR0A 4AG6A 2IW3A 2QBYA 5DHAA 2XX3A 3SHWA 4MQBA 4LI0A 3K9HA 1LS6A 1SGWA 4QHSA 2NO9A 1K5DA 3NDPA 3OHMA 1US8A 2ZS7A 2O8EA 2WZQA 3O8CA 4C0AC 3K9LA 1T5LA 1VG1A 2WPDA 5DIFA 3DL0A 4XVQA 1E9SA 4DWJA 1KO5A 1BIFA 1TPZA 2WJJA 4L8GA 5KSPA 1CEEA 4EDHA 1DAMA 3UKDA 3AF3A 1MH1A 2WJYA 3KQLA 1LS1A 2YNMA 3CF0A 5FPTA 3PEUA 1IXRC 3JZAA 1US8B 2G88A 2QI9C 2O8EB 2DCUA 2OT3B 2R8RA 1TEVA 2PMDA 2I1QA 2VL7A 1FTSA 3GMTA 2ZRKA 3FHTA 1JR3D 3VR1A 2V1UA 1M6NA 4AKGA 3EZ9A 2J3EA 1AGPA 5DH9A 2W2TA 2CL7X 3BIFA 2DY1A 3C41J 3BH0A 2O52A 2JLRA 4EPYA 4Q18A 4RD0A 3B8HA 4M1WA 1SXJC 2GEVA 3H1TA 3SI7A 4DKXA 5DI9A 2ODEA 2ZE6A 3RSOA 2H18A 1NJGA 5EE9A 2RCNA 3D7MA 1ELOA 1HV8A 1KSHA 2PX3A 4IOKA 4LZZA 3GFPA 3RS5A 4BLQA 4GI7A 1G1MA 4OHZA 1NMYA 4Q1EA 2N46A 3KB1A 2YJTD 3GEEA 4BUJA 3AGPA 2BBOA 4G01B 2ZJOA 1WBDA 4DRZA 3TMKA 4JVNA 1AK2A 1FP7A 2QTVB 2AD5A 1WRBA 1Z29A 3MWYW 1UKZA 1Q22A 3NBYC 1NVUQ 3QEOA 1IN6A 4DCUA 2ZRHA 2DWQA 1KHTA 4W5HA 3U7EB 3T35A 1D9ZA 3DZDA 1NL3A 4L9SA 4BFZA 1AS0A 4D0NA 3KJEA 4RD4A 4POAA 4WOPA 3CM0A 2BWJA 4IRUB 4Y0AA 3R9WA 1VYUA 5JRJA 2QROA 3H4MA 3QF7A 5DSZA 3FB4A 2HJGA 2XZLA 4UXHA 4Y0VA 3EW9A 4JJZA 1T5IA 4H1UA 3NXSA 4RSGA 5FR2A 4XH9B 3UMSA 3B7GA 2B92A 3CX8A 4HAXA 1NVXQ 2GZHA 4Q21A 3QENA 2E9SA 2GF9A 1CS4C 3WRXC 4XD7A 1MRSA 3B1YA 1G16A 2OFOA 1XEXA 5FPYA 2QZ4A 4C7OB 1T9HA 1M7HA 2IYSA 3RS2A 2IYLD 2ZJZA 3FMOB 1G18A 4AYXA 2ZANA 1X8KA 4I1VA 4WBSA 3U4QA 2HXYA 1EFUA 4KBFA 3L8ZA 3KKNA 3VHLB 5CIQA 2R65A 2BCGY 4Q4AA 4X8LA 2PZFA 3N2EA 5B57C 4DDVA 3BB1A 2AKAB 3K1JA 3LW8A 3ZIAA 4PTLA 1UKVY 2ONKA 1EX7A 2LKDA 3H84A 3SYNA 4Q7KA 3SJCA 4NCIA 3QOFA 1BO6A 3NHAA 4N0EA 3U4QB 4IDNA 1CIPA 4HYYA 3C7KA 1IJFA 1OV4A 4MRNA 3ZD6A 5CJ2A 4UNRA 4DSOA 1OH6A 2CJWA 1NN3A 4ESVA 2HUPA 4GOJA 3U3MA 4M1YA 2D62A 2JLUA 1FUUA 1JPJA 3K0AA 2Q21A 4TL9A 3QIAA 1P72A 2J46A 4LJ9A 4TT3D 1M2OB 3HJNA 1YKSA 4PC1A 3DDCA 1OHHA 1IQPA 3WNBA 3W8NA 3F8TA 4D25A 1VG8A 1AKYA 4PO1A 2IEZA 1ZC4A 4IVPA 3ZS9A 3CX6A 3HR7A 1ZCBA 1R10A 4IVQA 2DPXA 3AF0A 1W2HA 4RVCA 1JR6A 3QQ5A 1PLKA 1ZC3A 2XOKD 2CLSA 2CHVA 3IO5A 3LVRE 1G5TA 4DCVA 2JLZA 4XSHA 1Q21A 1XTRA 3K0AB 3MUFA 4HUTA 1U99A 1U94A 3MMPA 4DDWA 4EJSB 4JLAA 1G8FA 4BFVA 1ZVQA 2J0UB 5JBQA 3CRQA 3ETLA 4WXRA 1XJCA 2WAXA 5EXSA 3PJRA 1AKEA 3LXRA 2ZETA 4DBLC 5GVSA 1CTQA 1ZYUA 4PSKA 1D8TA 4A92A 2GILA 2Z4RA 1IHUA 3SBDA 2OLKA 1OKKD 2ZRMA 2ZRFA 4M9SA 1AS2A 5TY0A 4YMUA 5L3QA 1S1CA 4HB3A 3IILA 2GBLC 2QRNA 4EPTA 1E96A 3CO5A 3HPRA 5B58C 4M0LA 3GJXC 3CWQA 3AKEA 5CIWA 4C0JA 3DOEA 1LFDB 4RFSB 1SXJE 1XBTA 2EVWX 5EP1A 5FTJA 1WQ1R 2HDNB 4FD2A 5AJXA 4L15A 3WMFA 5KSYA 5M04A 2V7QD 4G5SA 3VR2A 5JMTA 3TQFA 2IYXA 1NVWQ 2A3RA 1Q0UA 3BXZA 4BLSA 4JBWA 4URZR 3F5FA 1E0SA 2ATVA 1WXQA 3CR7A 4HLCA 1R4AA 4YXWA 4DEXA 5DE3A 1JEDA 1SULA 3SJAA 4R2HA 3ADCA 3NBZC 1GDDA 2CK3D 3WYGA 2ZSDA 3PUXA 3QVUA 3IUYA 1TUIA 2UZIR 1G21E 4BFTA 2ZJ8A 4S2EA 4WVFA 3OIYA 2GESA 2QAGC 4ZIRA 5C46F 5J4KA 1H8EA 2WWWA 2FSFA 1NBMD 3FHCB 4CT5A 1ZBDA 3AH8A 2QT1A 1NVVR 2ZROA 5JHGB 3HU2A 1E9RA 4FCTA 4B6FA 5IF9A 3VKWA 8OHMA 2B6HA 1G4AE 3SJBA 4Q1AA 2R2AA 4DIEA 4X8OA 2OAP1 4B35A 2H1LA 4FWTA 1QHHB 2CHGA 2ZI3A 3CX7A 4MKHA 1E2QA 2EFEB 4HAWA 2PL3A 1W36B 2J41A 4NCJA 1CR0A 2BDTA 4AIIA 4PSVA 3L0OA 5GADl 2FPKA 3EA5A 1II8A 2CCKA 2RGEA 2FDCA 4DLWA 3M1IA 3GJ5A 2IF0A 1TU3A 3BE4A 1NLFA 4DT1A 3L82B 1ETUA 4L16A 4A0GA 2EWVA 2JDIA 2YINC 5SZIA 3RYTC 4B33A 3KQUA 4URUR 4B3CA 4TL8A 1E2GA 1MO3A 4F7WA 4MUAA 4P4SA 2G77B 4RZ3A 5A5GA 1ZD8A 3I62A 3C16C 2IXGA 1DAEA 4OK6A 3T15A 5DN6D 1AJEA 1G3IA 1KOFA 1P60A 1KSJA 4ZDIA 4OHYA 1WA5A 5B64A 5FOUA 1KJZA 3U61B 1HE1C 5GVRA 5FOVA 2QA5A 4QXAA 4XWAA 1Z07A 3K0CC 4B32A 1YE8A 1OXTA 2XNDD 1ZIOA 1TEXA 1GL7A 2F1IA 2UVQA 4QBIA 4F4CA 3T61A 1RRFA 3SZRA 3MJHA 4D80A 4Z1MA 4BRUA 2DWOA 5EE5B 2NPFA 1YJ5A 5CLLA 3IEVA 3CZPA 2NO1A 2C9CA 3LLUA 2HT1A 5EXTA 2V8OA 3NBXX 1G8GA 2O8FA 4IJMA 1L4UA 2ZM5A 3PXGA 3FDIA 3THXB 1X1SA 2JJ2A 2GEDA 1W4AA 3MAAC 1KSGA 4F38A 3CPEA 3PVSA 2FWRA 1GNPA 2C98A 5CK5A 1GVNB 3B82A 4YDHB 4M21A 1W5TA 2RGDA 5LPNA 5HCNA 5L3SB 3QUSA 3GJ6A 4JKYA 4OKSA 3V4FA 5C2JB 1IN8A 5KNDA 4E22A 4D4MA 4YMVA 2FE4A 4BZQA 3KL4A 3ZVLA 2BKUA 1XXHA 2CXXA 1GRNA 4KXFB 5KDLA 5CM8B 2PZEA 3TAUA 3BFXA 4BFYA 3THWA 3JZMA 1NY6A 4P31A 1E69A 4HSEA 3LVQE 3QKSA 5DISB 2HYDA 2OCAA 1JEEA 2PEZA 1YZUA 2GJ8A 2ZSEA 2BMEA 4GNKA 2KJQA 5JCPA 3P26A 2BKEA 4QNMA 3RRMA 3RVBA 1UKYA 1NG9A 2ZRPA 1JAIA 2ZAMA 2D06A 1LF5A 4IEEA 4AK9A 1FZQA 1G5PA 4ASUD 4FMDF 2NO7A 3B60A 1V43A 2ODNA 1NSTA 2ZRBA 4TTPA 4UXIA 2IYVA 4G5GA 4PO9A 4KU4A 1HT2E 4HZIA 5CK4A 2VP0A 4RD6A 1UAAA 3VR4A 3CNLA 5AUOB 1G19A 2FSGA 4LV5B 1X6VA 3O47A 3OIVA 4FMCF 4OQNA 3UANA 5HKKD 1VCMA 1Z6GA 1FTNA 2A7QA 3D3QA 4DDUA 2ZI7A 5JWHA 1G6OA 1GUAA 2WJHA 1NVVQ 4EFLA 1UFQA 2KBEA 2ZRDA 4RZUA 2NQ2C 1I2MA 1C1YA 2R6FA 1QBKC 1ZNYA 4URWR 4JSYA 1OIWA 3WHLA 2FEMA 1XCPA 2AL7A 5DHFA 4DLVA 2GCOB 1XEWY 4C9BA 4GDFA 4YDSA 1II9A 3B6EA 1XEWX 3I4LA 4CEHA 3QG5A 2ZI9A 2F6RA 5FH9A 1ESMA 2CVHA 2R6AA 4LX0A 2JJ1A 2P67A 3MLEA 4FMDB 1OYYA 1S3SA 3GLFB 4DLUA 2ZQ5A 2I4IA 2ORWA 5DLQC 2IF2A 3FKSD 2C96A 4D4KA 4DEYA 5JEDA 3SN6A 3KQKA 2HEIA 4RKEA 2GBLA 1AS3A 2DHRA 2FG5A 3PUWA 1TF2A 4MRVA 1N6RA 3NC1C 4FMCB 4X8HA 4PZZA 1D5CA 4Q1CA 4O25A 2FSHA 1ZM2A 1CJUC 4BFXA 1YZKA 4OQXA 1QHSA 3R9IA 3QXSA 4EPXA 1WBBA 4HZUA 1ZD1A 2OCPA 3ND8A 5AUQA 4P33A 4OJQA 2W6IA 4PQFA 2QY9A 4CRWB 4JBYA 2R6DA 2A2ZA 2QMEA 4II7A 1T8TA 2BEJA 3OAAD 3SC3A 1Q1EA 1NMXA 3UG6A 3R8CA 1BS1A 1W7AA 3TSZA 2H16A 1KY3A 4HZUB 4RD1A 1WCV1 3OEHA 3UPUA 4A82A 4DUGD 2J45A 2FU5C 2PBRA 4HLDA 4TLDA 2I1VB 1IN4A 2WWXA 4JBXA 3CWZA 4LK2A 5E7MA 1CJKC 3REGA 4C2TA 1FMLA 1XCGB 5AJWA 5H70A 521PA 1OFUX 3MGCA 4O2LA 2AK3A 3IPYA 4NU0A 1COWA 3KQNA 5C1BA 2QTFA 1CBUA 2WWGA 2O8DB 1KK1A 4M9QA 1Z2CA 1X8LA 2ANCA 2J7PD 3TAHA 2IYUA 2ZRLA 2ZYUX 3T5GA 4IXMA 4NCNA 3B2EA 4XOIA 4XIGS 4EIWA 4BGDA 3I1FA 5AJZA 4DB4A 3L8YA 1R8SA 2FEOA 2CCJA 4ZI3A 3T06B 2ZR7A 4Z8YA 2QENA 1AQYA 4OI1A 1VYTA 1KK3A 1YZNA 2HLDD 4NCKA 2QU8A 5EZ6B 2YV5A 3BRWD 3DMNA 1U0LA 1KK0A 3DM9B 5EE0A 3QG1A 1VHLA 2IS1A 1EX6A 3C5HA 4TMXA 4BRWA 3SR0A 1R5OA 1WP9A 4GSYA 5E95A 1P75A 2P6UA 5FTKA 3IO3A 3GJ8A 1E9CA 1ZM4A 4FMBB 4KLZA 3ZGXA 4LYJA 3QPWA 4DLYA 1XJ0A 1XZQA 3GLHE 2P6RA 2QEQA 4TL6A 4QBFA 3GD7A 2PJRA 1GTVA 1GAJA 2FPMA 3CR8A 3OE7D 5TVKA 5ANRB 4DLTA 2IS4A 2JAQA 3CPJB 2IT1A 2ZU0C 1J90A 4JT4A 1HQYE 2X2FA 4MRSA 1TAGA 2WTUA 2O0KA 3PIRA 4Q4JB 3SYKA 1RKBA 3GQBA 2QL6A 4E07A 5BWMA 1WB9A 2ZJYA 4ZDWA 1MABA 1JI0A 2GTPA 3SFZA 2OBMA 2V1XA 4JZKA 5FUYA 4EJSC 2CLDX 2VRWA 1W0KA 1HA3A 3CUEF 4OK5A 4UJ3A 3OIUA 1E2KA 3LNCA 3MWJA 5ELXA 3VNUA 4LYAA 2GJSA 4LJYA 2J59A 1LNZA 3BD9A 1C9KA 4A36A 5DI3A 5A4JA 5KPDA 1VYVA 1G7TA 4HLUC 2J0SA 2KB0A 1MR3F 1L2TA 2IYYA 4BQSA 1TF7A 2HCBA 4M9ZA 4URVR 1XMJA 4DCSA 3WP0A 2P2LA 3OZXA 4YONB 4F4IA 3I5XA 1CR1A 4BWYA 5DO9A 4CYMA 1FQJA 2GZAA 3LWNA 2F9MA 2YVUA 1HE8B 3I8XA 1EK0A 3G0HA 5HPYB 4KYIB 3BS4A 4NHOA 4JVMA 2ZSBA 2QNRA 3GLIA 5KPJA 4QHYA 3AP1A 2VO1A 3VR5A 2HYIC 2Z43A 3QBVA 4RY2A 2PCJA 3WHKA 1LVGA 1F48A 2VBCA 4L5BA 4GL2A 4EPVA 2XTNA 4J0QA 5E7JA 2O0HA 2G6BA 2NO6A 5JWOA 3EZFA 1ZNWA 5FFMA 2GZDA 1KKLA 3TVDA 3R20A 3K70D 1ZU4A 4G1UC 3NC0C 4QNRA 4ACBA 1KDTA 2N42A 4HB4A 5TARA 5HZHA 4EFMA 1SKYB 3SE0A 4WIAA 2WKPA 5SZJA 2Z4SA 4DZZA 1SVIA 3U7GA 2PT7A 2PMKA 1ZUIA 3IKJA 4C0QC 3QPUA 2F1JA 1E2PA 3RANA 4DHEA 1T6NA 3L43A 3VMFA 2CDNA 4KBGA 1W46A 3C4JA 4ARZA 3K0EA 3SNHA 4C0BA 3E1SA 4P4TA 2QMOA 3DM5A 4TL7A 4NYMQ 4V0KA 1W36C 2V6IA 3FPAA 3TBKA 3P27A 4R2IA 3ZLJA 4B75A 4OBEA 1T0HB 4TLAA 4X8MA 4F91B 3VKHA 2QMUA 1HEIA 1IXSB 2JCSA 1G3QA 1VPLA 2B7BA 3H2YA 3I72A 2DFTA 3PR1A 1Q57A 2LKCA 4Q02A 4R9UC 4TT3A 5D3QA 4JLMA 5TDHA 1BYUA 4BZXA 4ARZB 3U3KA 3A36A 4PX9A 3KX2A 2H8KA 3W5IA 4TYWA 1XDBA 5FPHA 4EQ6B 2XITA 1AZTA 4Q4LA 4LV8B 4U02A 3CONA 2OXCA 3Q85A 2IBMA 1AQUA 2N1BA 3EIQA 4PAQA 1ZW6A 1MO5A 2GVZC 1Q1BA 2J9RA 4U7DA 1R0ZA 1IBRA 1VCOA 2A5GA 4NTZA 4NZYA 1V5WA 3GJ3A 5TB5A 3F3YA 1XTSA 2EFHB 3FHOA 3RS3A 2W2VA 3CW2A 3QJYA 2OAQ1 3B13B 5F2EA 3TSWA 4PFSA 3C5CA 2XSZD 2AFIE 4EUNA 1OKKA 2PLFA 4QGAA 1ZM9A 4FCVA 1ZRHA 3V00A 3KXKA 1RYHA 1NMZA 2WOJA 2VTKA 4MRPA 2EFGA 3W3ZB 3Q72A 5AR1A 1E4VA 4V0NA 2F9LA 1DPFA 4A6PA 3BFVA 2IK8A 2QE7A 2ZAOA 4HI0E 4C2UA 4LYFA 2QQ0A 1H8HD 5J4YA 4NMMA 5FPKA 1NLZA 4PAMA 3BORA 1E1QD 1F60A 2ZPTX 4KAXA 1Q44A 2IUUA 1Z8FA 3AVUA 1ZNXA 1U2RA 1GITA 3OF5A 5EZ5A 2NO0A 1RFLA 2A30A 4KFSA 2CE2X 1QHXA 4C7OA 4PC3A 1XX6A 3UWKA 3QSYA 1OIXA 3TVTA 2BMDA 2X8AA 5A0FA 3U3OA 4XWOA 2BHRA 3BOSA 5KO2A 5BXQC 1FMJA 3P20A 1KMQA 2W58A 3AQ4A 4E03A 1YZTA 2JIZD 3EX7C 1RVDA 3IHWA 3PCRB 1P62B 2CMKA 4LGMA 1KDRA 2Q9CA 1S0UA 2ZVQX 4M1OA 1XF9A 3WBKA 1SQ5A 1RZ3A 1R5BA 4OQMA 1IOZA 5TV2A 1ZINA 1S2MA 3OEEA 4GFDA 3AF4A 2ZS9A 3GLGB 3QXHA 4NBSA 5JWRA 1EFRA 2OV2A 3EPKA 2HCJB 1U0JA 4OI0A 1J8MF 3Q3JB 4M9XA 5TMPA 4ZCLA 1CU1A 4IDHA 4Q47A 1LV7A 2ZJ5A 3BC1A 3R7WA 3LBHA 3TK1A 1JB1A 4YQFA 1PUJA 4XTCS 1W1WA 1X1RA 3ADDA 3I73A 4Q66C 1G6HA 4PQRA 2XAUA 1WDTA 5JS7A 3ADBA 2RGCA 2GRJA 3EC2A 1CRQA 2WKQA 2G83A 1KGDA 4ON9A 5K8IA 4OHVA 1S3GA 4KJZA 4EJSA 2JLXA 1U81A 2RH5A 1Q12A 3QF4B 5DN6A 2J0UA 2VHTA 3R7WB 2QRZA 1N6LA 1XFAA 2OFXA 2YOFA 5CM9C 1ZUNB 2P3SA 1JXMA 3KJHA 4LUCA 1HYQA 2OXRA 4KITB 3BERA 3NVAA 5FTMA 4PZYA 5BW8A 4JIMA 5F9FA 3VR3A 4HLUA 3BBPA 4M1MA 2WPDD 3W6NA 2VSOA 1TQDA 3SHFA 2XNDA 3Q5DA 1YVDA 3EWSA 421PA 4ZCMA 4B76A 2AX4A 4RFSA 3QKTA 2C95A 4JYCA 3K0SA 1CXZA 1KI9A 1A1VA 2JASA 1GWNA 3CRMA 2HV8A 1DAHA 3PV0A 4B3GA 4H1VA 4Q1BA 2QG6A 1P2SA 4D0GA 2YWEA 2ZYVX 1O3YA 4HB2A 3LQRA 2P0EA 1A2KC 1SZPA 4IFEA 2V54A 2GF0A 1F2UB 1KAGA 2R6GA 3NHBA 1KO8A 1VHTA 4IFBA 1YHNA 2J0QA 1ZD9A 4A0RA 1KMHA 2R6CA 2IYWA 4U00A 3B78A 3IGFA 1E79A 1IN5A 1GKYA 1PZNA 5FL7D 3RS0A 5DNYB 2JLWA 2VIIA 3KKPA 2FN4A 4HUQB 2ZEJA 2MMGA 4ZKEA 3X1WA 3TUIC 3C15C 4LHYA 1G7SA 3SFVA 5JHHB 1KMHB 3S1AB 1AM4D 5CYPA 1IY2A 3SJZA 3AKCA 1KDOA 3B1ZA 4D6PA 4F4JA 3B1XA 4AI6A 4K8OA 3LW7A 1RW4A 4ASUA 2XZOA 2PH1A 1G20E 2J87A 1GP2A 3WNDA 1QHHA 4IOLA 1VIAA 1XD9A 1M7BA 1NP6A 2WM9B 1G3UA 1P61B 1VTKA 3EXAA 3NTUA 3Q7QA 3LX8A 4B3BA 4HDQB 3LA6A 3QE0A 3TH5A 3LQQA 4NKRA 3IIJA 2REBA 4EAQA 2DFLA 1QHNA 3UG7A 1G7RA 4D82A 5IK2A 2PEYA 5HKKA 1GL6A 1W5SA 4HAUA 1G291 3VHXA 3IPXA 4CEIA 1S9HA 1EFCA 1GOTA 5LD2B 4ZCIA 1D9XA 3VTKA 1HT1E 2QMHA 3FMIA 4US1R 1XXHE 1W2GA 4TLCA 2EYUA 1MRNA 3SU8A 4XD7D 3CLVA 3IQWA 3F0TA 4K81B 5SZKB 2CNWD 3DHWC 4E5UA 3E2IA 4QJ5A 4V0ME 1HH4A 5FI1B 4FI3C 3KZ1E 4GMDA 2MSEB 3RRZA 3RS7A 5HR5A 4IOMA 3MRSA 4CEIB 5L3VA 1IXZA 5AWFC 2GDJA 3EPLA 2DFKB 5E4FA 3TGPA 4LY6A 4QGGA 4FWIB 4MGKR 3RAPR 1GL9B 2OSBA 1EWQA 4QJ4A 1PV4A 3LH5A 4PZLA 2J1LA 3P4YA 2RB4A 2WWFA 3BH7A 4PC7A 4CF7A 2QP3A 3NH6A 3B1WA 4TN1A 3FTQA 1II0A 3HYTA 2YYZA 2Z6VA 5FOSA 1D2NA 3R9XA 2WOOA 3CH4B 1E98A 1CULC 3THXA 1QRAA 2P5TB 1N6OA 1KJYA 4YC7A 3QY0A 2Z5FA 2OM2A 1C4OA 1N5LA 3QXCA 4KHZA 3CRVA 1NN0A 2IHBA 4KCGA 5HCIA 4A1FA 5L3SA 5HZKA 2BEKA 2VQSA 3NEJA 2V6JA 4DJTA 1MO6A 1T4GA 1CJTC 1JXOA 5FOWA 4QM6A 1N6PA 2KE5A 1OFTA 1Q1ZA 1E1RA 1XD2B 2BBTA 1XPRA 2GA8A 4MYHA 1ZIPA 1EXMA 2FH5B 4LJ7A 4DUGA 5CB6A 2VSXA 3TR0A 1NJFA 1HURA 2JJ8A 4QOSA 4O0MA 1DO2A 3NIBA 4DC9A 3TUZC 3BWDD 1ZUHA 1G64A 5CB8A 2NMVA 1SVSA 3NG1A 3VKGA 3I3SR 1SVMA 2IUSA 2JA1A 2Z0MA 1QVRA 3IBYA 4YLGA 4TYNA 4ILEA 4OQFA 1YR8A 1P73A 4JVSB 3ICQB 1D2MA 4B6EA 1YR9A 3A1WA 1JQLB 4MGIR 4MGYR 1KZGB 1DARA 4LCBA 2J7PA 1E9AA 4V0MA 3WYAA 3AVWA 2XJ9A 3WRYC 4LBVA 1FL9A 3FWYA 1UDWA 4P32A 1MT0A 3ZVNA 1E0KA 4V02A 5GJWC 1UDXA 1H65A 2HLDA 5JSZB 2ZITA 4A4DA 2GJAA 2ERYA 1CJMA 2PLRA 3CZQA 4RKFA 2WICA 3IIMA 4B3DA 2GCOA 2YWHA 2IL1A 1ZM7A 3O8DA 2RGAA 3TQCA 2IA5A 3PUYA 2IXFA 1OXXK 1N6KA 1DTSA 2H57A 1CR4A 4G0NA 5KDOA 1KY2A 3ZZTA 1Q1QA 2XXAB 3AUYA 5KDDA 2D4HA 5FI0B 2FJUA 2GXAA 2FMXA 4JLJA 2WWHA 1H8ED 5EQTA 3GLFA 4I4LA 4P3YA 2NG1A 2FPLA 1P3JA 3W5JA 3ZS8A 2ERXA 5H8WA 3AVTA 4DCNA 2R44A 1B0UA 1RE0A 2IEYA 5KHOC 4GMXA 2WSSD 1OE0A 2FSIA 3I5YA 1VECA 5EE3A 3ECCA 2H17A 4OK3A 4PAOA 4BFWA 5JS8A 2XZPA 1FPMA 1IONA 3B5JA 4TQAA 4UQOA 2HF9A 4C0KA 2VA8A 4KYUA 1VCNA 5FUWA 1XZPA 1KI6A 1MKYA 1XRJA 1Z3IX 1DG1G 4LPKA 2RGGA 1HQCA 1KAOA 4Z51A 2QQEA 1ODFA 1TF5A 1E2EA 2AD1A 2F1HA 2GJKA 5IHPA 2FFAA 1KDPA 4FXPA 4MITA 1GZSA 1QHIA 2BMJA 2Q3MA 4KO8A 3UIEA 1Z0DA 2LWIA 2BJVA 4N1AA 1KI6B 1CKEA 2ZSFA 1UPTA 3WY9A 1AGRA 1W0JD 1SXJD 1CLUA 2B8TA 1JR3E 1P2VA 1XP8A 1P4SA 3HWSA 1GM5A 3BFKA 1DEKA 2C2HA 3HP1A 1XEFA 2FGKA 1NY5A 2IYTA 5KNBA 1EFHA 2REOA 2ZU6A 3AF1A 3I8SA 1L7VC 4BEBA 4WAUA 4JLPA 4KODA 1XU4A 2GCNA 3KJGA 2GXQA 3MD0A 1U98A 4JL5A 4A2QA 2O8DA 3EA0A 1MOZA 2VH5R 2ZRIA 1SVLA 2GXUA 4Q9JA 1IM2A 1TQ6A 4ERNA 1SVOA 2RGNC 2O0JA 3T5DA 4Z1MD 1RJ9B 1NN1A 1G5RA 2A5FA 1KI8A 3QXXA 2FFHA 3KKQA 4A6XA 4C30A 2D2FA 5CYOA 3CF6R 2XB2A 4MYTA 1HTWA 4QL3A 4N3NA 1E2HA 5LBIA 5G3ZA 3NDBB 2BMFA 3W6OA 2ASEA 1U90A 2TMKA 3EIEA 1VG9B 2J7KA 3U7FB 4TTQA 1Z0FA 4GP6A 2YOHA 3GLIE 3K70B 3T34A 2GETA 3CH5A 3SQWA 2OZEA 1TUEA 3JVVA 2C99A 1RIFA 3PUVA 1J8YF 1S1MA 2WAYA 4A8JB 4HAVA 1DADA 3TSOA 2ZE5A 1LB1B 4YMSA 1BKDR 2OCBA 2ATXA 1N25A 1DG3A 4JSTA 4IVRA 4DLZA 1N5JA 1SKYE 4IKEA 4AKIA 1T8UA 3OFND 3MG9A 4ZDKA 3CF2A 3CNNA 4DVGA 4TWZA 3LV8A 1E9BA 3VU9A 4LHZA 3WP1B 5BN5A 4Q4JA 1F2TB 2QAGB 5D3MB 4B43A 3R8FA 1BYIA 2GK7A 1F6BA 5CDFE 3DMDA 2A78A 4A2PA 2DFNA 1JAHA 5J40A 5JCZA 1A5TA 2NZ8A 3RC8A 4O3MA 4Q7MB 2VSFA 2WWIA 2IXEA 3U3JA 2W83A 2D2EA 2FFQA 4OI4A 1P9NA 3GCGA 3Q7PA 1JR3A 3AVOA 4AD8A 1JALA 3VU9B 2JGNA 3IQXA 5BN4A 3ND9A 4Q1FA 4QHTA 3HU1A 3PITA 4C3ZA 1E4YA 5JJLA 2AXPA 2WHXA 2Q3FA 3V9PA 5B30A 3EARA 5DYGA 1ZU5A 4R71A 2G3YA 4TSFD 2IYZA 4LBZA 3DOFA 4WZ6A 1Z0IA 4TZ0A 2A5YB 2AK2A 3L2OB 1O87A 4ZV4A 3RRNA 4MYUA 3FE2A 1G3RA 1Z6YA 1CRPA 2W6JD 3RNLA 4TMWA 2FV8A 1ANKA 5FTNA 2ZTSA 1E0JA 3AVQA 2AN9A 2BC9A 4TYYA 4Q9LA 1I4LD 3ICEA 3PQCA 4ABYA 5AJYA 1GFIA 2JJ1D 4OHXA 3A1UA 3BAFA 3K0FB 1PVOA 4AKHA 4CEJB 3LD9A 2WVJA 1E1QA 4B2PA 1OIVA 1QDEA 2REXB 1W4BA 2IWHA 4DLSA 1IJEA 4BLOA 4B44A 4MH0R 2VP5A 1Z47A 2QPAA 3K9GA 3UXMA 3HPQA 3FFBA 1NF3A 2AXNA 2SHKA 3N5CA 3A37A 1BMFD 1Z6AA 1FFHA 2AFHE 3LBNA 4QG7A 4ZPXA 1RRPA 3VAAA 1FNNA 2A9KA 5JLJA 1NRJB 2KBFA 1KI7A 1XCMA 1D2EA 4M22A 5GJBA 1IAQA 3C14C 4V0LA 1GILA 4HDOB 4KSBA 3L0PA 3SQXA 1QZXA 4FW9A 1FNMA 3A4LA 2JIZA 4BFUA 2EU8A 4QKQA 2CCGA 5CLQA 1N2CE 1Q3HA 2V9PA 4JLBA 2EYQA 4D2IA 4PHHA 2WIAA 1Z22A 3FYHA 5CDFA 5KUTA 4H9GA 4JT2A 2QP4A 4W5JA 3JVUA 2CE7A 2AR7A 1FX0B 5BYJA 1YU9A 3OEHD 1AIPA 1R0WA 3BB3A 3A4NA 4PO8A 3VFDA 3U6KA 4LHWA 2YKGA 1S8FA 1UEJA 1SVWA 4R98A 4HAZA 2PT5A 2VF7A 2XNSA 2IYRA 1XPOA 1XTIA 4UNQA 1ZNZA 3P1JA 1RPZA 4CVNA 5KU1A 2WBLC 4LJ4A 2YWFA 3ZVRA 3CIOA 2X1VA 3FKQA 4EQ6A 1M7GA 1NSFA 4Q1DA 1N6IA 2QSZA 4JYBA 4AWXA 5IT5A 4LBWA 1OH8A 2O8CB 4BLPA 2H7VA 3WNCA 3ZQJA 2DYKA 3GLGE 4C0HA 1CR2A 1N6NA 4BE7B 2GJ9A 1NBME 2OESA 1RYFA 2P6NA 2RHDA 1JQJC 1MO4A 4G5OA 4UJ5A 2RAPA 2YC4C 3UK6A 3T1OA 721PA 1FW6A 4IDPA 2WIBA 4JS0A 2FFBA 2XOKA 2NGRA 3A1VA 2ZI4A 3THYB 3QXJA 2C77A 1LW7A 1AN0A 3K53A 4O2RA 4M4SA 2IX3A 3EPJA 3A1TA 2VHJA 2GAOA 5FUXA 2WV9A 4D26A 3L0SA 5FOXA 3EZ2A 4FN5A 3MCAA 2EW1A 3EC1A 1M74A 2C04A 3KXIA 1YZQA 4JLKA 2QBYB 4MUBA 4DSTA 2JLQA 4I1OA 1N0WA 3Q8XB 2QGNA 4LV6A 3GJ0A 3FGNA 4RD2A 4CDGA 4ACAA 3K09A 2WSMA 4DLRA 1ZAKA 1G41A 1N5IA 4BLTA 2YWGA 1OW3B 2QSYA 4EKDA 4HLQB 4RCYA 5LB2A 4BEJA 1VCIA 1XMSA 1XTJA 2VHUA 1DAIA 2H92A 3NKVA 4JLDA 4DSUA 2C9YA 3E70C 3AVXA 4TMZA 3SBEA 4LJ5A 1IN7A 1NIJA 4URYR 4ZI2A 2Q3HA 1KK2A 2RGNA 5FL7A 2FZLA 2I3BA 3TKLA 1I2DA 3VX3A 1VKJA 1W0KD 3TNFA 3K9NA 4A0FA 4QBHA 5JI2E 4V03A 2V7QA 2EFDB 1JJ7A 4EPWA 2D7CA 2FX3A 1GG2A 1OXSC 2VHCA 2IYQA 1QG2A 3GEIA 4WZBE 3N70A 2WWYA 3KKOA 3G5UA 3OIWA 2W0MA 4QM7A 2EWWA 1KI3A 1W44A 2PJZA 2CK3A 1XTQA 1NG1A 2BBWA 2WJGA 4UKDA 6Q21A 5FTLA 2OBLA 1DS6A 2KWIA 4RZXA 3GLGA 3HR8A 2GVDC 1G7CA 3DKVA 4GOXA 3NWJA 1K5GA 2MSDB 2X77A 5JRZA 1NBMA 1HUQA 5JFGA 2JLSA 2V4ZA 3VNVA 4LOAA 2ZS8A 4LJ8A 2YZ2A 4GZMA 1TQ2A 5F9HA 4XSGA 2FNAA 1WE2A 2NPIA 2XEXA 3A6PC 5FBWB 4RZ2A 4A2WA 1E0AA 4NL4H 1P5ZB 3EAQA 5FBVB 1JPNA 4B2IA 1R5NA 4K46A 5JECA 1M34E 1T0JB 1GIAA 2P5SA 4XJXA 5KYKA 1N6HA 1Z6TA 4NCHA 5KSOA 2CNWA 1KO1A 3QF4A 4PPNA 5DYIA 4B71A 4IDOA 4CT4B 5CITA 3SYLA 3X1DA 4KI0A 5SZHB 4ITRC 4KSCA 1S96A 4DCTA 1OFHA 1CF4A 2ZYWX 1NIPA 1DAKA 1Z0KA 4PPGA 4HATA 1S4QA 2C78A 1KNXA 1G8YA 2D74A 2WJVA 3VX4A 1UBGA 5E3HA 3AVVA 2E1RA 2X19A 1OH7A 1JBKA 3ZJYA 1XEXB 5AUPB 1E99A 5J4VA 3W90A 1XMIA 2CL0X 4B3FX 3KQHA 3W6PA 3DZ8A 1E2FA 3EIHA 1DO0A 4Z8XA 3W9YA 4Q4AB 1G17A 1GRQA 4Q9HA 2MMCA 2VP6A 3AV0B 1ZJ6A 2QGZA 2C5LA 1GNRA 2G0TA 4RJLA 1U9IC 1A2BA 4Q7LA 5FBRB 4B2LA 5FR1A 4WW0A 4PHGA 4C4PA 1GKUB 2QP9X 4BASA 1F2UA 1NKTA 4NDZA 2GNOA 3PFIA 4E09A 4TLBA 2ZUCA 3DVLA 1X86B 4Q48A 4JLNA 2UZ3A 2J0VA 4TTRA 2CJWB 5GJVC 4Q5IA 1PLLA 1E2DA 3AP2A 1DAGA 2NIPA 3LO5A 3ZZ0A 2G9NA 1YQTA 1KI1A 2G1JA 4HUQA 2ZREA 1Z2AA 4M8NE 3TUJC 2FOLA 3ASYA 3RHFA 3MFYA 1KTVA 5EXXA 4Z54A 1ZCAA 1NI3A 1Q20A 1T3HA 3QEJA 4U5XA 1KI4A 4PR0A 1X8JA 3S1AA 4NP6A 2BM1A 4PXAA 2HF8A 1W4RA 2OBNA 2D3WA 1FP6A 1G9XA 5UKDA 1OLOA 3KFVA 2DR3A 4UXJA 3KB2A 1P9WA 2ODWA 1Z0AA 3BGWA 2ZRNA 3ASZA 3RDPA 3QVVA 5EJEA 4OI2A 3CNOA 3EZ6A 3QBTA 2R62A 1K6MA 2R9VA 4LPSA 2QE7D 3KFXA 2JLYA 3W8RA 3TIFA 1OPXA 3ZZUA 4ESHA 2ANBA 2RMKA 3HYRA 1OB5A 1LTQA 4LSGA 2VP9A 5K8UA 5L3QB 1YZLA 2JATA 3RS4A 4DLXA 5G53C 4HAYA 5G3YA 3PEYA 2ZUBA 4Q01A 3K70C 2GAAA 5H68A 1TL7C 1ZM3A 2OO7A 2VHQA 3KUCA 4MKIA 4WZAE 4A8JC 4B73A 2VP4A 2AWOA 3LY5A 2DBYA 2GWHA 2EFCB 3M0EA 2FA9A 3TW4A 3WYFA 1R8QA 2ZIAA 2ONJA 4BECA 1XTKA 4A15A 3A8TA 5AK0A 3X2SA 2WJIA 2OHFA 2ZSAA 5P21A 4DXAA 2PX0A 5C4MA 5KSZA 2QAJA 4FIDA 4IDQA 2F55A 3IIKA 4GPTA 1G4UR 3H0KA 3J81k 1S9DA 3A58B 3IEUA 2QT0A 1TNDA 3WBJA 4AKEA 1QF9A 3AKDA 4BLRA 1DOAA 2K5UA 1OT3A 3B9PA 4OQLA 4GZLA 3X1YA 3KJIA 4TZ6A 2P65A 1I4DD 2WSSA 1GSIA 1KIMA 1ZP6A 4D4JA 3AKYA 5J4HA 3OEED 1R0YA 4IEIA 4OYHA 1EFRD 4QRHA 2WMOB 3ZIAD 4ZIRB 4KVAA 1NNEA 1CJVC 821PA 2D7DA 3FKSA 2QPOA 1P6XA 5GJCA 4DDTA 2GKSA 2CLCX 1M1YE 1KZ7B 2PZGA 3KXLA 3Q5EA 4DSNA 2LCFA 2ZVPX 2XGJA 3IHLA 1CP2A 1UBEA 2CEAA 2Z83A 4LJ6A 4MDFA 3U5ZB 2B21A 4TYQA 4NPHA 4G5QA 5IDVA 1TTTA 2OG2A 1XD2A 4G5RA 4I1UA 4I81A 3U60B 5J4LA 3GP8A 5F98A 2FGJA 1P2UA 3RWMB 1BH2A 1GRRA 1DELA 3LLMA 1RRGA 3GLFE 3O8BA 1II8B 1OHHD 1W0JA 1SXJA 1Y3AA 2CHQA 4HEJA 1NKSA 4F92B 4DT1B 2EQBA 2IHYA 3FVQA 3OAAA 4C0LA 4EPRA 4Q00A 4V0OA 3X1ZA 1E2NA 1PLJA 2KI5A 3U2QA 5G40A 1EFTA 5J47A 3B1VA 4AY2A 4P4SB 3UWOA 2OLJA 2F43A 1XB2A 3KDSE 4KFRA 4LDJA 2F1RA 4MRRA 2B8WA 1SXJB 4PHFA 2VPPA 3U7HB 4OJKA 2OFWA 5IRCD 2F3TA 2JEOA 4L4UA 4XTRA 1J2JA 4Q4HA 4F93B 1OYWA 4Q9IA 2OEPA 4CZ2A 3D6TB 3EASA 3GFOA 3REFA 3NBFA 3CKLA 3THOA 3RABA 2QTHA 2G0NA 4W7SA 4ZDJA 1JJVA 3X1XA 2ZJ2A 2WMNB 1SHZA 2F43B 1YRAA 1N0VC 1WMSA 4NYJR 3BH6A 1YR6A 4UNNA 2J5XA 5JSZA 2Q9BA 4KFTA 5FBQB 3V4RA 3AP3A 2VEDA 1KSFX 5B2ZA 5LDDC 3BJIC 4Q4HB 1P9RA 4PANA 3OESA 1Q3TA 1UM8A 1LF0A 4IXNA 4US2R 5FUVA 1XWIA 4D0LB 3AVYA 1E79D 2O8FB 1U8ZA 3PEWA 2VLIA 3IDQA 2QPTA 4M1SA 1B23P 3P32A 2XXAA 1Z83A 2GHIA 2BCJQ 4PC2A 3CRW1 3MJRA 4KLNA 4YXWD 5BYKA 1Z63A 1G8HA 2OUKA 3OFNA 1OF1A 3T1TA 3RSLA 1Z6XA 2G1KA 3W34A 4B48A 1E2LA 3I61A 1A4RA 5AJVB 5KTYA 1OH5A 2F3RA 1HY3A 1J99A 4P0TA 2KSQA 2VP2A 3A1SA 1OFIA 2GEUA 4FINA 1UKEA 1XXHB 2ZR9A 1A82A 1OJLA 621PA 2FZ4A 1JECA 1Z5ZA 5EUMA 5FBLB 3RWOA 3UMRA 3THWB 2BJWA 2YHSA 1OSNA 2ZRJA 3OE7A 3IBGA 4Q03A 3QKSB 2ORVA 4RFVA 2V55B 1W36D 4TMKA 4TMVA 3DPUA 5AUNB 4MYCA 1YR7A 3WMEA 3ZDQA 4JL6A 3LX5A 4IHQA 4US0R 5K8LA 2ORIA 1EG7A 3KUDA 1U9IA 4NH0A 3AVPA 5IK2D 1FOEB 4LHXA 4LC0A 2ZUDA 4QBGB 3ZVMA 2A5DA 3P4XA 4JKIA 1LY1A 2W2XA 4TMTA 3SEAA 3TW8B 1ZMXA 4GRAA 4LWZA 4P4UA 4TSFA 1PUIA 3A4MA 2RGBA 1R6BX 4FCWA 1SHKA 1K8RA 1DBSA 3ZH9B 1U8AA 2IC5A 3DO6A 4LRWA 3TLXA 3FOZA 2QM7A 2PCLA 2ODBA 1TX4B 3FMFA 2MSCB 2W6JA 2HJVA 3DKPA 1YRBA 4CGZA 1R0XA 3ZQ6A 1XJQA 1KO4A 5L3RA 1MV5A 4I99A 2JDID 1AA9A 1Z06A 1UBFA 4AC9A 2BBSA 3MWKA 3NEYA 4MDEA 1PJRA 2CL6X 2IS6A 4PQYA 4B74A 4M2LA 1KNQA 1TQ4A 2BVNA 4LYHA 3SS8A 3QPVA 3MWLA 5FL3A 5F3WB 3GPLA 4LHVA 4GT1A 3T1VA 4CEHB 3K09C 3EG5A 3I32A 5EP3A 1RJ9A 1UEIA 1BMFA 2IS2A 1E6CA 3VR6A 4JL8A 4PHTA 4UNSA 4IW3B 1NN5A 121PA 5EUQB 4LJAA 1YZGA 2DWPA 1KJWA 2ZJBA 2A5JA 3GJ7A 4OHWA 3CBQA 3G82C 1VIYA 3PG5A 1SKQA 1E9FA 3QKUA 5JJKA 1AZSC 4WXPA 4M1KA 5JEEA 4Q9KA 2ZI6A 4S35A 4TYPA 4N0DA 2VYFA 5HE9A 4JLOA 2IWRA 3CB4A 3HU3A 4CW7A 4KV9A 5LB4A 3U3RA 2O8BA 1L4YA 1NLYA 1QVAA 3T12A 4QJ3A 4A8JA 2OCYC 1E1RD 1KO7A 4PC6A 1FUKA 4AG5A 2JJ2D 4Q7JB 4LBYA 4B3XA 2XB4A 3U44A 2QUZA 2QORA 1IY1A 2ZXUA 2HT6A 4HDCA 4I1SA 4XVRA 5JJIA 3BB4A 2L0XA 5KNCA 1EESA 4YMWA 4NYJQ 3EPHA 4RD3A 3CPHA 1UBCA 2O8BB 1TMKA 5JZVA 1F2TA 2QAGA 2HXSA 3W3AA 5D3MA 5KOYA 4NYIR 4QFMA 4PPFA 4Q19A 5HE8A 1G3MA 2F7SA 3PUZA 2C8VA 1UJ2A 3BK7A 2AKYA 4PPQA 3U44B 2RGXA 2BOVA 5J5CA 1KYIA 3I92A 1EWRA 3QKRA 4KFUA 2Q0HA 3GJ4A 4B34A 1N3BA 1W4CA 4GBMA 1T91A 1KKMA 4KVGA 3MSXA 4OL0A 1G8PA 4JMPA 2ZJAA 1VDZA 2NOAA 4NYMR 3ADKA 3QNUA 3VQTA 4HB0A 1DAFA 3CRRA 1E2MA 1IY0A 1W49A 1QG4A 3L0IB 3K8YA 3PEVA 3QKRB 1J70A 1VMAA 3TE6A 5CJPA 4NONA 5K8TA 5L8VA 1BOFA 3LBIA 4WA7A 4NE2A 1W48A 2FF7A 2AWNA 5JI3E 2Y8EA 3LRPA 4PSAA 3GFTA 5BN3A 4M53A 1R7RA 1J7KA 1KI2A 2XTZA 3WMGA 5FPSA 4CIDA 1JNYA 1F3OA 1L8QA 4LC1A 3LAWA 4QC2A 5EE1A 2XSZA 3K0FA 2YC2C 2ZE8A 2BV3A 3LDAA 4D81A 2VF8A 4CEJA 4RCZA 1E9EA 3M6AA 5C18A 3RRYA 4C0SA 2DB3A 3LXXA 2OILA 1UADA 3K0CA 3Q9LA 1P7CA 2ZI5A 3B85A 2E87A 1A7JA 2NZJA 1T3LA 5G41A 1XPUA 5TXGA 3SOPA 3RLFA 2CVFA 2XJ4A 1H8HA 3PENA 1E32A 5EXPA 3KTAA 3E5HA 221PA 4TQ9A 2RHMA 2ZE7A 1ONBA 1Z0JA 1U0HC 2GK6A 4UNPA 3AM1A 1OB2A 2JLVA 1EGAA 1F5NA 1I4TD 4L9WA 4MKFA 3ZYCA 2V3CC 4AURA 2ZRCA 5EP4A 4MA4A 2GXSA 3N2IA 1XMVA 1OXVA 2GCPA 3T1QA 1U8YA 2W00A 4DIDA 2NTYC 1MABB 2Q6TA 4A9AA 4JLVA 3KTAB 4ZKDA 5HTKA 3UMFA 2WKRA 3D31A 2C9OA 2BM0A 4W9MC 4M1TA 3FFAA 1D6JA 2RKOA 4MKGA 2CBZA 4BFSA 1FX0A 1RRCA 1WF3A 3SDZA 2B7CA 1TU4A 2BIFA 3M4YA 4AYTA 4URXR 1E2IA 2W6ID 3AEZA 4GP7A 4JVLA 3H86A 4XWKA 1E3MA 3C8UA 4YMTA 2XTMA 3WXMA 4BZPA 3QI2A 3O8RA 5DI3B 3TR5A 1N0UA 3EZ7A 1XD8A 4R7ZA 5DGXA 1FQKA 1GKIA 3GEHA 3U6BA 2UKDA
chains in the Genus database with same CATH superfamily
3VC2A 2PFKA 3M4JA 3JTEA 3DFMA 1QHYA 4RGVA 2HHAA 2ZRAA 3G79A 1E5QA 1TVMA 3JQBA 3LKBA 1RYYA 3VVLA 4RMIA 3QMWA 1UMCB 1J0BA 4E1VA 4WSOA 2V8BA 1V95A 5KYTA 4H18A 2XKKA 3C70A 3FVTA 3SDSA 3BQMB 4GOLD 1E94E 2I6GA 3B89A 3H16A 2QM8A 4JODA 1DVRA 2GPJA 1SHJA 3EH1A 5K3FB 3KUXA 3MN1A 3PTLA 3HDTA 2PVCA 1NM5A 3KNZA 2XLCA 1ONOA 3AWIA 4ZVRA 1CJBA 3FCEA 1GSAA 1LPSA 3A0RB 1OTYA 1COWD 2QD4A 4QDOA 1NI5A 4JB0A 1K3FA 2Z2IA 1G8JA 4C78A 1YQXA 4UUBA 3WWZA 1QRSA 4H3KB 4OX9B 4NYIQ 2TMYA 3GHHA 3LSTA 2J3JA 1ZXLA 1P2TA 1MVLA 1S8OA 2ZYTX 3A9SA 4HGOA 4UUOA 5F2OA 4TLEA 3ISJA 1LDYA 5U4QA 5EIHA 2WYOA 2HIHA 3UJ3X 1DAPA 1TADA 4OXIA 2AEFA 4WOJA 1DCMA 2OE2A 1WVIA 4LY9A 3NH9A 1NDQA 4QYIA 5H59A 1W96A 5CDHA 3WMRA 1NQWA 1QPZA 4HYQA 4N0QA 4WOBA 3H65A 2Q4TA 2I2AA 5DHAA 3KV3O 4OX9Y 4EEKA 4QG3A 1XDDA 5INTA 3OFKA 4LF6B 3K9HA 2HCRA 3NDPA 4WQMA 1AUOA 3OHMA 4NCXA 5JH7B 2ETVA 1T8WA 3I9V6 4KAJA 4L7QA 1CS0B 5HK8A 1T5LA 1KYTA 3DL0A 3HWRA 1MC8A 1K75A 1X9GA 1ZIDA 1U0NA 1L7NA 1LV8A 2CVOA 1G8AA 3ITNA 2GD0A 3C6YA 4LRSB 5DNDA 1PUXA 1Q11A 2PG3A 3H1AA 1DAMA 3X1JA 3UKDA 3AF3A 3AF6A 3ZTTA 4S24A 2WIDA 4FHDA 1EBBA 1YUBA 3ESBA 4HPXB 5FPTA 4G4SO 4H35A 4KN5A 2DKNA 5JXJA 1LW6E 2WUFA 4CQMB 1QFXA 2HWXA 1D7AA 1RTKA 3PUHA 1TEVA 4FYKA 1YS9A 1Z2OX 1IIRA 2VL7A 2VNKA 3ZZ1A 5LN1A 4YY3B 3GMTA 3HHPA 1KFEB 3FHTA 4M0FA 4UZSA 3BJZA 4GQBA 2ZSKA 3PL5A 2R5WA 3VR1A 4TM7A 2PNFA 4Y98A 2FSVC 3UAOA 4BVLA 1YCDA 4OH7A 4AJHA 1MW8X 5BSMA 2G0AA 4O5AA 4ZICA 3EZ9A 1I7PA 3IP8A 1EFLA 1AGPA 3G7SA 1ZA2A 3PTAA 2W2TA 4BB5A 3BIFA 4LVNA 4M9UA 1OX4A 2JLRA 1XDSA 1X39A 2HA5A 4QRDA 4M1WA 1RAIA 3H1TA 2ID4A 2VHWA 1MH9A 2NT3A 1D07A 2ZE6A 5BMVB 1NJGA 1NUPA 4IFTA 2QVXX 2PX3A 3CVOA 4LE1A 3NZEA 1GU7A 1WD5A 4RK4A 2HA4A 2NZXA 3OTQA 2B9VA 4GI7A 2JGLA 3PD0A 2IY9A 4J4TA 3E1KA 1J0EA 4JT9A 4Q3DA 2YJTD 1POWA 4BUJA 1MZPA 1O77A 3OBIA 4BTVA 3S2ZA 3V2UA 3WC4A 3P5SA 3LPMA 2Q7DA 2B4AA 2QTVB 5ICFA 3MTBA 3KEGA 1RRVA 1Z29A 3NBYC 1MJHA 1N9GB 3DFKA 2X2OA 3T3EA 1NRXA 2P2CA 4YRQA 2HYIC 2BI8A 3BWYA 4A8HA 1QGZA 3D2CA 2ZRHA 3TNDA 3EGEA 4UTXA 2VJMA 4ZV7A 3U7EB 3VZQA 2FPIB 1D9ZA 4BFZA 3UGQA 1AS0A 1A8SA 2FTKE 3KJEA 1EP1B 1LNQA 4F2PA 2H1FA 1JXQA 2VK2A 2CJPA 1YBMA 2PV7A 5ECDA 4JSRA 4P22A 3PQEA 3UJAA 1WB4A 2D2IA 2GK3A 3WGJA 3WNQA 3AHFA 4EHLA 4GX5A 3X3HA 3N87A 4ZARA 1N34B 3FB4A 4X3OA 3W9SA 5C7LO 2BGTA 3JATA 4CIYA 2OC4A 3EW9A 4YGXB 2CD9A 4JJZA 3WGQA 2YYAA 3EIXA 2PGXA 4RSGA 3TLBA 5LFAA 3B7GA 4EECA 3QKWA 2MT9A 4HAXA 4O4JB 1NVXQ 4Q21A 2I3GA 4KQMA 5AVJA 3QENA 2BSXA 4GH5A 3QH4A 1CS4C 2YRFA 3DMRA 1MRSA 3B1YA 4QO8A 1NUHA 5FPYA 1XEXA 4BEVA 4C7OB 1QF6A 3OCZA 4RK5A 1MNQA 2IYSA 1C5KA 2EWMA 3AY7A 1OZAA 2ZJZA 3LCVB 4RV9A 3KU1A 2ZUEA 1GEGA 2QW1A 1T9CA 2X13A 2JS7A 3OCYA 2HXYA 1KPIA 5SV2A 3ZHTA 1AKTA 1T4DA 4GD3Q 5K6AA 4EYKA 4KBFA 3L8ZA 1ZZGA 2J9GA 2IUEA 3AR5A 4L8WB 1DMRA 3KKNA 4M49A 4NFSA 4NMHA 4X8LA 4C4ZA 3KBBA 1SXPA 1GO2A 5B57C 1NNSA 1SUPA 2FB9A 3P94A 4E5SA 1A97A 4DDVA 3LW8A 3HKCA 2WUEA 2OPHA 3SKYA 3QYPA 4X63A 2ONKA 4L08A 3VBEA 3SYNA 3FRJA 5DNCA 4NCIA 3L0DA 3PSAA 4IDNA 3VVMA 3U4QB 4NBWA 1ZVVA 4TKVB 2RH4A 3N3AC 1OV4A 3GBSA 2HW8A 3VJMA 5JZ9A 3E9RA 3IAAA 3W8DA 1OH6A 1U5AA 2CJWA 2AF3C 2O23A 5HA5A 2AE1A 4ME6A 4M1YA 4X1IB 2D62A 1FJXA 1LZLA 4JK3A 3DT8A 1QOZA 2A1IA 1P72A 3ZCPA 2FE1A 1Q3KA 4CBVA 2W4IA 1NNLA 1U28C 3L7CA 1OHHA 5HGJA 2YCLA 4YIKA 3F8TA 4F9GA 3RBXA 1FMCA 3V1NA 3WLKX 2WA1A 1L5NA 1DP4A 1IUOA 1PG5A 1KQ3A 2AFIB 2GEKA 3JASB 4ZHQA 1CRWG 3V3KA 2OHJA 1J1UA 1KQGA 2CLSA 3H5IA 4CTMA 1ATIA 2JLZA 1XZFA 2AJCA 2FZWA 2VDNB 1BU5A 4XSHA 3T9BA 1Q21A 5A3SA 3WOHA 4R0MA 5A3RA 4HUTA 5HF5A 1U99A 2C9MA 5B3KA 2NZWA 2EL9A 4FHFA 3MMPA 3SM9A 2NU9A 1SXQA 3M2TA 3ZXSA 4PWZA 3QELB 4R81A 5KQLA 4DCPA 3CCCA 5EXSA 3CLRC 1GCOA 4CTKA 2IHUA 3BAZA 4PIPA 3CPSA 4K03A 4KWIA 1KFKB 1CTQA 1ZYUA 2GR9A 2MOKA 4ADSG 4EVSA 4FFNA 2B98A 1I3LA 2Z4RA 4H7IA 4PICA 2EX4A 4KE8A 2ZRMA 3W4IA 3IAXA 2P1RA 1HLDA 1T0IA 4CKBB 1BKSB 2C4KA 4J0CA 5TQ0B 2GBLC 2JG3A 1R9NA 2XYQA 3GQVA 4MCIA 3N6XA 4BGIA 4EPTA 2VVTA 4M0LA 1SBZA 2K2QB 4I55A 4CKEA 9GPBA 2LTAA 3VXKA 4AUMA 5C52B 4MEJA 1LFDB 4QJIA 1PNTA 1XBTA 2EVWX 3HXPA 4HPJB 4N5IX 1R5JA 1X1DA 2HK7A 1EK2A 3DFIA 3W05A 2I4NA 4DAEA 1FTYA 4FD2A 5AJXA 3BZBA 4L15A 4ZWNA 1QIMA 4IZOA 1UKCA 3GXBA 3MBKA 2RDMA 2NWQA 2B5OA 3RADC 3CGWA 4DREA 4CKCB 5EZYF 5HFNA 1M1NB 1SUFA 3RWBA 2FF5A 1MEEA 2Q3CA 3AIOA 2G1UA 3AUUA 3CR7A 4HLCA 4XVHA 1GHTA 1VSTA 3TEFA 4MTCA 2XB6A 3BL8A 1SUWA 3DVAB 1SULA 4RH0A 1CHNA 4TVKA 3BM5A 1I51A 1QYWA 1GR0A 2ZSDA 5EA2A 3PX7A 1M34B 3O1HB 3PLAE 3KJFA 1TUIA 3NM6B 1V7CA 3R09A 2INGX 2UZIR 3IKVA 1G21E 4P58A 1GPH1 1Y37A 2DJIA 2R48A 4AZ0A 4S2EA 4BV9A 3INNA 3BXOA 1UJCA 3UAYA 1FC0A 1H8EA 2Q8NA 2R1ZA 2FSFA 4Q3NA 2A4KA 1KR5A 1NW7A 1OLXA 1XQ9A 3UA4A 2D0OB 4LNHA 3VKWA 3HVJA 4MHOA 1EEHA 5AW5A 2A9QA 1F0KA 4MWBA 4Q1AA 2R2AA 5CP8A 4DIEA 2ZPUA 4NS1A 5IAJA 3BMQA 2Z1MA 3A6EA 5J23A 1QHHB 3AEXA 2CHGA 2D0DA 1V16B 4MKHA 2OKCA 1JWBB 2EFEB 4KWHA 4TVBA 3V8QA 4ER6A 4QZVA 1ZHFA 1XZEA 1W36B 2FR1A 2J41A 3IOEA 1CR0A 4O2BB 4AIIA 4WCDA 5IHXA 4AN0A 3TFQA 1O95D 4IJKA 3PQ5A 2CCKA 2X8LA 4GS5A 1IXKA 2WHPB 1YJQA 3GJ5A 4JCCA 4DLWA 2PHZA 3CEPB 4ZYXA 1Y5MA 4LE2A 3GWZA 1SEPA 3VHXB 1OA1A 3FPKA 1Y6QA 4L16A 3LCMA 5J59A 4B33A 5F7OA 3KQUA 2W6OA 3DEKA 5COBA 1M5UA 5PNTA 3GZ4A 3N2KB 1E2GA 5JNSA 2W93A 4CUKA 3O0DA 3PDUA 4MUAA 4C06A 5IABA 2Z4TA 3I62A 2P1DA 3K7EA 2XMPA 1FMTA 1DAEA 4B46A 5DN6D 3EGIA 3ROTA 1G3IA 5IEJA 1AKQA 3KJQA 1EA7A 4Z9XA 1JJAA 2QW0X 4BV2A 4ZEVA 1ADCA 2CN1A 2JH3A 5LNK1 5DTEA 4H08A 4BY9E 1RD4A 3B6JA 3U3DA 3S44A 5HOEA 1Z07A 1KFCB 3AB7A 4DJFC 2XXJA 1W581 4QQRA 5HW0A 4ZJUA 2FUG1 3P19A 1SXIA 1Y3BE 4UCXA 4IDGA 5EKTA 4GKVA 2FLWA 5KYWB 2XYRA 5BR8B 3ADOA 4QBIA 3RVDA 3BGDA 1U8UA 3JD3A 1LQTA 1SOVA 1RRFA 1EJBA 3EOBI 4LF5B 2GLUA 1ZK4A 4B5LA 1DCKA 2DWOA 3GBPA 3R6LA 5EE5B 3HCFA 3I2HA 4KEAA 2Y2UA 4O4LB 1YJ5A 4IYJA 3IEVA 3CZPA 4DLKA 3GGJA 3LUJA 4LCEA 3H5WA 1QQBA 2CT8A 2WFAA 1G8GA 2O8FA 2B4RO 4IJMA 4JOBA 4R3WA 3CNBA 3PR2B 4WL0A 5E4YA 3PXGA 5AVQA 3F73A 1U31A 1OZFA 1XUOA 3BK2A 3AJEA 2GEDA 2ZIZA 5D5PA 5ALDA 1L1RA 3D6FA 4I4TB 1ATZA 1VL1A 4CMJA 4PFQA 3GF4A 2PKWA 3I12A 1GNPA 2C98A 4KQXA 3B82A 1NULA 3D7SA 3OQBA 1J2RA 4XA8A 3S29A 3AW9A 4O4IB 4KG7A 5IZCA 3HBNA 3VTFA 1RWQA 3S8YA 3W7BA 5LZ5A 2XF2A 1KY4A 1U0GA 3PQ8A 2H2AA 5BV1A 2D1YA 4GW3A 1IN8A 1GTMA 4N3BA 3VPSA 4F86A 5KNDA 4DDHA 3DW1X 4AMGA 1XXHA 2CXXA 1BA3A 4HG2A 2OYRA 2OB1A 1YFLA 1C3OA 1NY6A 2H7CA 1P5JA 3LY7A 1M66A 3DP7A 3K1AA 4MUFA 1SD1A 1N2JA 4P31A 2FUNB 2HYDA 3FGPA 3IJRA 4M7PA 1YZUA 5F1OA 4DM7A 3GEPA 2D4AA 4Z99A 5K0LA 1UBKS 5JCPA 3JVIA 3KAPA 4JNCA 3RVBA 1P9OA 2FPGB 1UKYA 5LP6C 3AEKB 5K0JA 5IM5A 3CF4G 3GFBA 2D06A 1FRZA 1O94C 2NVWA 1G5PA 1P4AA 4IEEA 4OMFG 3N8IA 4FMDF 1ADGA 4OGFA 4PAGA 2ZGVA 1C30B 2W48A 3V7WA 3WB0A 4EVRA 5DXAA 2IGBA 4KO4S 4W6QA 1DWQA 1ES9A 3MWDA 3MHPA 1BCRB 4G89A 2P2YA 4YWJA 3CZMA 4L0CA 3DTVD 2VHVA 3K8OE 1IATA 1FQWA 5CK4A 5I01A 2TS1A 4RD6A 3VR4A 2P69A 4L76A 2E4XA 5TMDA 3RVKA 5AUOB 1R00A 2NO5A 3AJ8A 3HCPA 2NSJA 4PGMA 3UANA 4E15A 1YB4A 1Z6GA 4JLWA 3WFJA 1FTNA 1VP9A 3D3QA 2XDAA 2XKAA 1MGPA 2E4UA 1ZWKA 4QDKA 2WJHA 3TJMA 3WKDA 3HBMA 3I9JA 3M1YA 1SCUB 4NATA 1Q0QA 2F1OA 4P5EA 4P54A 5JJCA 3DLBA 1ZNYA 1Z45A 3DBRA 4M6WB 1OIWA 2FEMA 1TI7A 3E53A 3NW9A 4P4NA 2GZSA 4BNKA 4DLVA 2GCOB 5JCJA 4OIFA 1QU3A 2PUWA 4K9PA 1JUDA 2VNHA 4YDSA 1BTOA 1II9A 1YJAA 4XGIA 3ZWAA 5H3CA 5K3AA 4TS3A 5LVAA 1ISHA 4RTOA 3QG5A 4CEHA 2ZI9A 2F6RA 4RTQA 4HN2A 2R6AA 4LX0A 3ZDCA 4HWPA 3FKJA 1JQDA 3KT3A 1T43A 4CFYA 1PVVA 3ZQ4A 2CDCA 3MLEA 4FMDB 4CJXA 1P7WA 2IIVA 3SF0A 3ZBTA 1IH8A 1TTQB 3GLFB 4UREA 3BSYA 2AQKA 3R4CA 3DW3X 1QMGA 2ZQ5A 1RXUA 3ZXYA 5DLQC 2IF2A 3FKSD 1MC4A 2C96A 1ONNA 1FU8A 4DZTA 1TECE 3EXEA 1A8HA 2QNIA 5C3MA 3FTCA 5ILOA 5IJWA 1T34A 1LJLA 1N6RA 4WECA 4XYMA 3RVPA 3U7QA 5AW8A 1GPBA 1ORVA 4PZZA 3ZHZA 1LBEA 3D6VA 4CG0A 1AF7A 1LBSA 1P5FA 3HKEB 4F1JA 2FSHA 4BN5A 1YZKA 3GMIA 5E6RA 4RV5A 1DFHA 2FYTA 3QW4B 4NS4A 1TA4A 1YACA 4XIIA 1DC5A 4MVJG 4BJ5A 1JU4A 2OCPA 3T0FA 1O7JA 2Q5FA 3BWBA 1NVMB 2G36A 1KEZA 3G6KA 1D8AA 3H6GA 3SE7A 1NLUA 2MYPA 4PNEA 2A2ZA 2QMEA 5TQJA 5K5EA 4TUYB 1T8TA 5I3ZA 1BW9A 3D8TA 1XLVA 2GN6A 1I3OA 3QUAA 2YMQA 3Q0TA 4Z0PA 1CUGA 5ALTA 4ZCPA 4CXMA 2AYYA 1NVEA 2PQ6A 4B3MB 3WA7A 1KIAA 3UPUA 5KSWB 2CZCA 3JQFA 2J45A 1NV9A 3ZDDA 3C3CA 4HLDA 5AI4A 2RG7A 2WWXA 4PYNA 3RYIA 4EEXA 1QJ4A 2PN1A 3CWZA 4KH0A 4K3UA 1CJKC 4LK2A 5E7MA 5AJWA 3M9LA 5H70A 2DFPA 4IGEA 1EAYA 1OFUX 1YO6A 5DTQA 1JN0A 2P35A 1FCJA 4JASB 4QDUA 3O8OB 4TWIA 4GMGA 5I8PA 1YC5A 5L9AA 2PZJA 2ZT8A 2C7QA 4DQXA 3DKRA 5CT6A 5DHSA 1COWA 3GB9A 3HXMA 1V3UA 3IE0A 1HYEA 2D2VA 1W5AA 4DXHA 3TI7A 4X71A 1IG3A 1KJJA 4N47A 3QEAZ 3PEFA 1MF7A 2ANCA 1EUCA 5EJ5A 5K0EA 4R01A 4G25A 2BM9A 5KYYB 3OBBA 3O9MA 1RKUA 1GCIA 2PQMA 2XADA 3PUJA 3I6BA 3QHPA 2ZW9A 2M98A 1KE1A 4IXMA 5E0OA 5AI6A 3UMJA 4BB6A 4F7DA 4XOIA 3V6MA 4DLLA 4CMCA 4PU0A 3RIYA 3OZWA 1J8VA 4CE6A 5F73A 4U9IS 2ZR7A 4Z1OA 4KXQA 4AF8A 1AQYA 3QGMA 4KPEC 1PFYA 2DH5A 1ABEA 1W73A 1PKXA 2TECE 4LYEA 2O2JA 2Q41A 1U3TA 4K9MA 5EE0A 3Q3EA 5C9ZA 3RVMA 1GQ2A 1MNAA 3S2GA 4CNBA 2FFRA 2VHEA 2XUAA 3C5HA 3LC0A 3PZBA 4PX2A 3WL8A 1D4FA 4BRWA 3QP9A 4R8VA 3NIFB 1AH2A 3REOA 4Y18A 4U7JA 3IP6A 5LL6P 1E9CA 2CLOB 3IELA 4MV4A 3ZGXA 1GAWA 1LPPA 1TZMA 1UBTS 3I0NA 3ASUA 4DLYA 2QEQA 3H3JA 2FMIA 4UBLA 1D6NA 4QBFA 1M5TA 3I58A 1GTVA 3KHSA 3OFJA 2XB9A 5TVKA 3AV3A 4DLTA 1SURA 4NU8X 4E94A 2QSUA 2I7DA 2CMGA 3CPJB 5J63A 2ZUTA 4CFSA 2GN1A 2VSQA 3PNQA 1WO8A 4JT4A 4CTJA 2QRGA 1Z5PA 1BMQA 4GPBA 1E20A 3PIRA 1BVYF 4L74A 4P8RA 4EYSA 4MVJF 4E07A 2WTUA 4QLBA 2JVKA 3IESA 3LUPA 2NYUA 5C8VA 1I3NA 3KYDB 3L04A 1A27A 1MABA 1LDGA 1ODIA 3HJCA 2IBTA 2R6JA 3DH0A 4GO1A 4N76A 2I8AA 3G68A 4WEOA 2JHPA 3SFZA 1K7EB 4DS3A 2YZ7A 1K9VF 1JHZA 3CUEF 3PYMA 4FFBA 2HSJA 4UJ3A 3OJCA 4GR9A 2AOUB 2V7WA 3LUHA 1JDBC 4UTZA 4DRYA 4X84A 4Z4EA 4MO2A 1ZITA 3FA2A 4L9AA 3ZV5A 4LJYA 1JG1A 1LNZA 2I2CA 2YR0A 2YY6A 3QWAA 3ROQA 3CCFA 3RYCB 4CNQA 2BFNA 2ZIXB 4A36A 3CNEA 1L7DA 1MR3F 1E9VA 3HI6A 3IMGA 3KT8A 4U1RA 2HCBA 4M9ZA 5CLIA 3L02A 1IB0A 1XQYA 4F4IA 5KAPA 3DV0B 4PYMA 1CR1A 4AJ9A 1CCWA 1UMCA 2HNAA 2NXNA 2GZAA 3OJWA 2HMSA 4UARA 3WI7A 1NRWA 3RROA 2YVUA 1HE8B 1EK0A 3REQB 3IRVA 2X9NA 5HPYB 3BS4A 4MCHA 4XWGA 4DANA 5JO9A 2QNRA 3FVRA 3AP1A 3HLKA 2EBUA 2MCFA 3UBMA 2BKVA 1NFRA 4ZOLF 3VR5A 4PXSA 4YUXA 1P0MA 2A9RA 3RI3A 2PYDA 3MMXA 2VBCA 4L5BA 1E3JA 4MRAA 2A67A 1X0VA 3TOVA 3DUFA 2YZGA 3KP1A 3A4IA 3LC7O 3P2IA 4N3GA 2ZULA 4GXRA 3ABOB 1E8MA 5G1NA 2XCRB 1CUBA 3TVDA 2GSWA 1I0LA 2H1CA 1QCCA 1YS2X 4WLUA 4ARVA 2PSFA 3K70D 1WUYA 1ZU4A 4G1UC 1OA0A 3TDMA 3ZIDA 3HJRA 4EA8A 1UBUS 3UMYA 2IEDA 1YQGA 4H59A 4KE6A 1JHMA 1KDTA 1Q7CA 5TARA 1W76A 2PAAA 3WAGA 3FWPA 3PHCA 1LBQA 4KGXA 1K86A 2PMCA 3Q7SA 3SXUB 1JFLA 4GGPA 4DZZA 2DP4E 5JH7A 5ALQA 1Y7HA 5CRIA 3A6DA 4KQ6A 1CS0A 4XFDA 3E6AA 4RTLA 2E18A 4KVFA 4UHDA 5HUHA 3IKJA 5CEFA 1MDBA 1HDOA 4KE7A 4L5JA 2EHJA 1NUSA 1T6NA 4U9HS 5JD5A 4KBGA 1VE3A 4B6SA 3C4JA 1GV1A 2JRLA 2ID9A 2NLOA 3E1SA 4ZOLB 3VYSB 4C0BA 1V6CA 2R6ZA 3H5OA 3BWXA 1HQDA 1IZ9A 3HXOA 4V0KA 2V6IA 3EZXA 1S2IA 2RK4A 3P27A 4G0QA 3NBQA 4B6OA 4P5PA 4B75A 5JXHA 1E8DA 4TLAA 4X6XA 5C1PA 3UWSA 4ARSA 4CQMA 4U6NA 1IXSB 2WZCA 1OTHA 2VH2A 3JPWA 4QLAA 5DGHA 5JDCC 1VPLA 1EVEA 1YB6A 2XUPA 3H2YA 3PR1A 1Q57A 1VLQA 1H9CA 1J0CA 4IHJB 1BYUA 4A6DA 4BZXA 3L5KA 4EA7A 3A1DA 2QIPA 3THSA 2AFVA 1EVKA 2IODA 1TM3E 3KX2A 4L72A 2EJTA 1MIOB 2H8KA 3KUKA 4IIJB 2ZB4A 1YR3A 3S2YA 4H2DA 4LFAB 3TRHA 4RHUA 3A3KA 3CONA 1Y9DA 2AG6A 1U7TA 1VLMA 2JZCA 4JMLA 4RENA 4TM8A 2QVZX 2YHIB 3LA8A 4UUAA 1ZW6A 4ER3A 5K0CA 4KK3A 4ESEA 3FHJA 1SRRA 3H04A 5BMVA 3GUUA 1XCBA 5AXCA 2X76A 1VCOA 3ABZA 5HF6A 5AI9A 2A5GA 3DS8A 3EDMA 2IKSA 3R41A 4NZYA 4BVJA 3F3YA 2VQ3A 1XTSA 2AMVA 2JCXA 2W2VA 3QJYA 4PE5B 1GD1O 5LDHA 1J8QA 4IDBA 3ROMA 3I09A 1SBIA 4LDAA 3GFRA 3PUKA 3QUTA 4J76A 2QTVA 4PFSA 5BRJA 2HK8A 4L2IB 1PQUA 2NACA 2QXYA 4DJEC 2PLFA 1N9GA 1ZM9A 1TMYA 3H2JA 4LNUB 4A91A 1ZRHA 1QLJA 1RYHA 1EVLA 4QOFA 3L79A 1NMZA 4R31A 2RD2A 2VTKA 3MRVA 4ZC8A 3W3ZB 1TZKA 1YZYA 3NBAA 2JI9A 4UD2A 5AR1A 3VVCA 3D6NB 3UMMA 2Z08A 1E4VA 2Y0BA 1WL8A 2AX3A 1DPFA 2Q5OA 2QE7A 4J75A 4HI0E 3DGFC 1ADJA 3JYLA 4MVJD 1ZXBA 4G9EA 3KEMA 1N92A 4G81A 5J4YA 2M1XA 4AB1A 3S55A 1P91A 3AERA 4XB1A 4F96A 3GNSA 5TMEA 2P9EA 3CINA 4MR7B 1CUVA 3JV7A 1XRLA 1EE9A 3HA5A 4AKSA 5L4LA 5EUCA 4XDGA 2IUUA 1PL6A 2UYQA 4O4JA 2GFHA 3LCRA 4E51A 3CQ9A 1ZNXA 1U2RA 3WK8A 4J1QA 3AVUA 1FMFA 2H1WA 1FFWA 1ORRA 2JBAB 3IPLA 1GPLA 1QORA 1INLA 1GY8A 2FPWA 1H2EA 2NO0A 2PUTA 4FOTA 4KFSA 4MKXA 2ASVA 2FK8A 4HWGA 4CN8A 4C7OA 4PC3A 2XKJE 1YAJA 3PC3A 4RH3A 2D1TA 4EVQA 4QYXA 2QD5A 3TVTA 1S8NA 3QSYA 3NVKI 2BMDA 2X8AA 1A72A 1ZSVA 3BOSA 2J5BA 1WABA 2P7HA 3WLTA 4OLJA 1FMJA 4FVTA 2RHWA 5BXQC 3COJA 4HK4A 1SUAA 2PX5A 4P6VF 1K92A 2Q45A 3UF0A 3UH0A 4E03A 3M7IA 1PW7A 3V7NA 1DXHA 1H3NA 1VPVA 3EX7C 1RVDA 1DNPA 1CQPA 3AT1A 3MMZA 3PCRB 4OAPA 4UU8A 1E60A 5BSUA 3L77A 5CNMA 2BZ1A 4RJJA 3CG0A 4YASA 1QGDA 3RHZA 2WTEA 2Q9CA 4AO8A 1S0UA 4C2AA 1B8VA 4M1OA 1PZGA 4DNXA 4F3CA 4YCBA 4WY8A 1R5BA 3L4EA 1DIBA 1DEXA 3MQFA 3OOEA 3UAVA 1ZINA 1P1HA 1U3FA 2V58A 3OEEA 1C7JA 4FC6A 4MIEA 4Y1RB 2EDAA 2ZQZA 4EUSA 3GLGB 1J5EB 3FOFC 4NBSA 1EFRA 3E2MA 4MNTA 2QX6A 3M6MD 4K26A 2EKDA 1RI2A 2H59A 1U0JA 3O21A 2D13A 3LHIA 1E1KA 4WLOA 4K05A 1FSZA 2IYNA 2IE8A 3MOGA 2XDWA 2YQ4A 1GGJA 1HTTA 5JG7A 1PWEA 3Q3JB 1GQYA 2P1ZA 3K92A 3MTAA 4HNGA 4YAOA 3GOQA 3ZZMA 1ZN9A 4JI7B 1O95A 3AHCA 1P2FA 3KKLA 4ETMA 3WGOA 1YWGO 1RHJA 1CZLA 1M6WA 3LBHA 4YQFA 3RRBA 3H83A 1X1RA 1X14A 4OU5A 3JASA 2R8YA 4RAQA 4LC9A 1UJ6A 3UCXA 1C9JA 4Q66C 1UXKA 4TZKA 2I4TA 2QNBA 4DAOA 4E21A 1HE5A 1Z18A 2RGCA 2VJKA 4Q12A 4QTXA 1KRHA 1IHOA 2FWJA 5ER6A 3D4BA 2VWPA 2FWPA 1JA0A 1W5FA 4OHVA 3E9NA 1WUKS 4YR7A 3UHPA 2JLXA 5KTMA 2RH5A 4NV1A 1P1BA 2CUZA 2PZ8A 3QELA 5DN6A 4AG3A 3SYRA 4Y7DA 2QRZA 2GZ2A 1PIWA 4TRJA 3D9QX 4HH0A 3JQDA 1ZUNB 5JS6A 3KJHA 4LUCA 4YCJA 4BAZA 3B53X 1E66A 2OXRA 1EE2A 4P98A 4YREA 1EHCA 1U65A 4JIMA 4DV1B 3PDHA 3H1PA 5F9FA 3L8DA 4BGEA 3NWOA 5KWEA 1CUCA 4CKBA 2E82A 2VSOA 3F97A 1TQDA 4IGAA 4JBNA 1K4MA 1QDLB 3FWKA 3SHFA 1NQVA 4YYEA 3ZE8A 4EG3A 5AW6A 3TEMA 3EWSA 421PA 4ZCMA 2O59A 2VR1A 4C6HA 2I65A 4GM4A 3JYOA 2AX4A 2YASA 2NZUG 5L6LB 1GQFA 2D54A 3PPWA 4DVJA 3AILA 2NXEA 1MB9A 2PH7A 1CDEA 2I3AA 2E6KA 2YX1A 3HKBB 5HILA 4L5CA 3I45A 3VO9A 1P2SA 2XMCA 2YWEA 5MDHA 1O3YA 1A4UA 3L7NA 3OZAA 2OV6A 3VU3A 4EGSA 2VQEB 3PP8A 1SZPA 4PX5A 4BKPA 1TJNA 2GF0A 2YN4A 3MTDA 1KAGA 1KYXA 1PT9A 1M1NA 2YJ6A 2YZMA 1QE3A 1V8BA 4FHCA 4MVJP 4FJ0A 1KO8A 1VHTA 4QNNA 4EG7A 1ZD9A 2R6CA 3DVAA 1OT5A 3KHKA 1CNFA 2GLXA 4U00A 2PZLA 1IN5A 1GKYA 3RS0A 4ZJZA 1ESCA 3QYFA 2JLWA 3USES 3MYRA 1QOPB 4RGQA 1B1AA 1M34A 2GKOA 1PG0A 2UU9B 2XT9A 1FE8A 3ZXIA 4OREX 4N9WA 1ORHA 1SZJG 3X1WA 2AMJA 4J0KA 3DC7A 1W29A 4IXDA 1T9BA 4J29A 4M0EA 1HDYA 4OLAA 3MEQA 3X1KA 3BN3A 4P3XA 3LTEA 1KMHB 1L7BA 1YXMA 1U3UA 2I6SA 3PNLA 1O57A 1YRLA 2P78A 2XBUA 3B1ZA 4EFKA 5IJZA 1RWBA 2AFRA 2M32A 5I9LA 4DTCA 4DA9A 1NJ6A 3LW7A 1RW4A 1IWBB 3LVFO 4F5YA 2DH6A 3I5AA 3MVEA 5EPOA 2XZOA 2J87A 4K5QA 2Q1YA 3IHKA 3WNDA 1J9ZA 1QHHA 4D56A 1D2GA 3CNQS 1V16A 2OO5C 2VK8A 1M7BA 1X87A 2WM9B 3EODA 3FZYA 3R5KA 4KNWA 4X6YA 1FUEA 1GFZA 5LLDA 1TUBB 4R8MA 4GKBA 1AXEA 4B3BA 2NU6B 4BVHA 4RWZA 2UUPA 1U1IA 2A3NA 3H5RA 4NKRA 2A35A 2XMQA 4O2BA 4Q3BA 3VHRA 5A06A 1L7PA 5IK2A 2WHPA 3M2PA 2R4QA 4RQTA 1FSGA 1OROA 1G291 1RQGA 4KWEA 3VHXA 1S9HA 1WIWA 3LWBA 4PW0A 3AESB 3L6UA 4QU8A 3SD7A 1PNVA 3VTKA 4ZCIA 4S04A 1JFRA 1XXHE 4TLCA 4XYBA 4XE5A 3DDWA 3WB2A 2QI9F 3N2KA 3SU8A 5EINA 3M8KA 1FNSA 4MQFB 3NGLA 5SZKB 2AQHA 2VC2B 3E2IA 4QJ5A 3BIXA 4PYRA 2RI6A 2OQ2A 1SQ0A 3T1HB 4C6TB 3E5RA 5LYJB 2QYOA 1JSXA 3C7AA 3IQDB 4WLEA 4ZANA 2YJ3A 4UTOA 2P2DA 5CVUA 4JGBA 1IXZA 5AWFC 2NAFA 2EC5A 5E4FA 4IIBA 4Z0TA 4QGGA 5M7EA 3OA2A 1LLDA 2I4OA 4MGKR 1HYHA 1GL9B 2CXRA 1MEJA 1UKAA 3PC8C 3KZXA 2Z2ZA 4FMPA 1F1BA 4QJ4A 4UPDA 4YK7A 1SFRA 5D2CA 3WO0A 5KYWA 2H2HA 2GN2A 4RMNA 2FUCA 2GM5A 2HA3A 3BH7A 1CUEA 3T95A 2QP3A 3B1WA 1F3LA 4FFSA 5A3JA 3FTQA 4OJTA 3JYPA 3W4KA 4EGJA 4IUCS 4ZO7A 2VTBB 1OPRA 2A33A 5FOSA 5HIAA 1MHPA 5K3EA 3U56A 4TRMA 1E98A 2VCHA 3OPQA 4PZDA 1QRAA 1R9GA 1P7PA 2OKGA 3N39C 1C14A 2AA3A 1WF6A 2P5TB 4ALNA 1S3FA 3EEOA 2DR2A 4N03A 3ZWQA 4XPIB 4BZWA 5IFKA 5FAKA 4UE2A 5K3DA 1NN0A 4B84A 4HKTA 4ZAYA 2VQSA 4O4IA 1KEEA 1A9QA 2C2BA 1UWVA 4DJTA 4FOPA 1CJTC 1SWVA 3MTQA 1T24A 3QYJA 1QIEA 1VFPA 3QVSA 1XD2B 2BMAA 2NVOA 5L7TA 4D8YA 5HM8A 2EBFX 1ZIPA 5CFNA 1LDMA 1A9ZA 1SO8A 3FNBA 4LJ7A 4K87A 4BFLA 4DIUA 1HURA 4HNUA 3NHMA 2QVYX 4AROA 1XELA 2PIDA 4CLXA 1B8NA 2V96A 2BYTA 3C0KA 1EFPA 3LC2O 4EG6A 3PEEA 2OCKA 2YWCA 2FPGA 4UEJA 3NG1A 2UUBB 4G63A 3HUFA 4EITA 2BFAA 1T10A 3PGA1 4O3FA 3RF7A 2IUSA 4DMMA 2Z0MA 2QXTA 1QVRA 1VJTA 3RIXA 3VKVA 4D8WA 3IBYA 4G1CA 4YLGA 1WDKA 4ILEA 1C30A 1EM8B 1YR8A 1XC7A 2X0RA 4EKIA 2Q49A 4XWTA 4QRIA 4B6EA 2YV3A 3N76A 1BCRA 3E1GA 2QTNA 2LCIA 1V11A 4U39A 1DARA 1R6VA 3HA2A 2JBHA 2D8AA 3AHGA 3J80A 3ZYZA 3CZ5A 1CLEA 3EFBA 3MFQA 4YV0A 1F06A 1Y6RA 5IDWA 1YBAA 4R54A 5C31A 1MT0A 1UJMA 1XT6A 5GJWC 1CZRA 4F5EA 1KAHA 1UDXA 3LK7A 3FNGA 3ZY2A 2HWWA 1SCUA 2ZITA 4Z9YA 1X1CA 2JIMA 4A4DA 1M2WA 1RYMA 2O2CA 3X2EA 1LEHA 1JBEA 4A0QA 2J3IA 4E0BA 1P8JA 2GCOA 3UXHA 2IL1A 4YJ3F 4Y6SA 1ZM7A 5I45A 1G5IA 1NQUA 4LGYA 4RXUA 2IA5A 1RADA 1C1HA 1R66A 3O95A 1CR4A 2VCYA 1LXCA 5DVZA 5KDOA 1NQOA 4EGAA 1KY2A 5ES4B 5KNDH 1O6GA 1CEQA 2PGNA 3LT0A 3SNKA 2GN4A 2ZIFA 3N6RA 4YXFA 5L45A 5B7QA 5BT9A 1PJSA 3KR1A 3SHQA 2E55A 4MQ6A 1U0BB 1OZHA 1DUSA 4HS4A 4DV0B 4NFHA 5EQTA 3GLFA 4I4LA 5MFPA 3AF5A 1P3JA 4ZEXA 2ERXA 2WNIA 3AVTA 1FF9A 1L5HB 3BIJA 1M6HA 2JD2A 4R1TA 2EEZA 3T0IA 2VBFA 2R44A 2H9AA 2C92A 2J85A 5IFLA 5TPZD 1Q50A 2AMYA 1B7GO 2AQIA 2FSIA 5I7AA 1HSZA 1EGMB 2DQYA 3P9XA 1VECA 4HFJA 4WFIA 3ZE0B 3OJFA 2H17A 3SYMA 1PR6A 4EOGA 4OK3A 1K08A 2FMUA 2HQOA 2Q62A 3HKEA 1FPMA 1IONA 1YDWA 4PAOA 5ECYA 4OYLA 5BRNA 3TB4A 2DPGA 3HA3A 4YTEA 4KYUA 1JP7A 1QIIA 1VCNA 2K7FA 1NWCA 2A9VA 1R4MB 5JAMA 1I10A 1Z3IX 4YAIA