4DXAA

Co-crystal structure of rap1 in complex with krit1
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
168
structure length
168
Chain Sequence
SMREYKLVVLGSVGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Small G Protein Effector Interaction of Ras-related Protein 1 (Rap1) and Adaptor Protein Krev Interaction Trapped 1 (KRIT1).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Ras-related protein Rap-1b
total genus 55
structure length 168
sequence length 168
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2012-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dxaA00
3QF7A 5FPTA 2GHIA 2ZYUX 2OESA 2QQ0A 2OV2A 4RD4A 3T15A 4BLPA 5ELXA 4MGYR 4Q5IA 2P65A 221PA 1Z6TA 2NPIA 4JJZA 2WJVA 3QKSB 1FPMA 4M9QA 2Q3FA 3GLGA 4C0LA 1ZUNB 4CEHB 2CJWB 3AV0B 2FSFA 2V6JA 1U81A 3PG5A 1KI9A 3EPKA 4POAA 2FV8A 4JT4A 1AK2A 1N6RA 1R5OA 3LAWA 5JEDA 5JFGA 2C2HA 3CR7A 1Z06A 2XZPA 4OQNA 4W5HA 4ABYA 2YC2C 2QENA 1W0KA 1YZUA 4TLEA 2A5DA 5CDFA 2OZEA 4Q47A 1GITA 3K9NA 4Y0VA 4XWKA 1AIPA 4DLYA 1SKYB 3SC3A 1R2QA 2Q6TA 4PO8A 1F6BA 3FYHA 2IWHA 2HYIC 4PPQA 2BMJA 2OSBA 1G17A 4LWZA 2R44A 1XXHE 3U7FB 4G1UC 2GAOA 4M1OA 1CS4C 4GPTA 4Q7LA 2YJTD 4IXNA 3A36A 4N0EA 3L43A 3ZVNA 1G5PA 5HKKA 3FMFA 2IXFA 2LCFA 2BM1A 3TNFA 5D3QA 2H92A 2QBYB 5D3MA 1Y3AA 1KNQA 4O3MA 4AIIA 1AKEA 1KI6A 4U02A 1E2HA 1NLZA 1OFTA 2ZRPA 2NO0A 4Q9HA 4E09A 4LUCA 3CNOA 4ZDKA 4L4UA 1N5KA 1VYTA 1ZCAA 4MRVA 1SGWA 3P26A 1XMSA 2WPDD 2NG1A 2ANCA 2BIFA 2G9NA 2XTZA 4EPXA 3DL0A 3SJBA 5TMPA 3DKPA 1GVNB 1NG9A 1QHXA 2IYRA 3E5HA 1QVRA 4GSYA 1GG2A 1VYVA 3BH6A 3GLHA 2WSSD 1RRPA 1ELOA 1BMFA 3QQ5A 1GNRA 1HE1C 1UBFA 3GFTA 2V7QD 1G9XA 1KMQA 2FNAA 3A8TA 4G01B 1G18A 2Q9BA 4M1KA 4DRZA 2X2FA 2XNDA 3BB4A 3C8UA 3OFNA 1W2GA 3HPQA 4QGGA 5J4YA 2E9SA 3A1TA 1FUKA 1NVWQ 1L4YA 3QUSA 1SVSA 3K8YA 2JLWA 4DLRA 1XDBA 2IS6A 1ZBDA 5DI3B 2CL6X 3CB4A 4IJMA 4BFWA 1BIFA 3LH5A 1XCPA 2V55B 4KO8A 2WOJA 4QKQA 2ZTSA 1G8FA 4LV8B 2FSIA 4KLNA 2QMHA 1Z5ZA 5LBIA 1N5JA 4M9XA 1JECA 4Q1CA 1QHHA 5EUMA 4NL4H 3GLIE 2DR3A 2ORIA 2JIZA 5DE3A 1N2CE 5J4KA 1E9SA 3B13B 2ONKA 4BZQA 3BS4A 2J1LA 2A5FA 4DUGD 2BDTA 1RRGA 1Q57A 3B9PA 4OI4A 1PZNA 1NMZA 4D25A 2IW3A 2PL3A 2QPOA 1NN5A 3ZVRA 3IEVA 4B43A 2IS1A 1DAFA 2QE7D 4BE7B 1DG3A 1DAHA 4KV9A 5IRCD 2IYQA 3PEUA 1TQDA 2WMNB 1OB5A 3TH5A 1T5IA 1COWA 4DEXA 1OSNA 2IUSA 3UMRA 3D6TB 1N6KA 5C18A 1CJUC 4X8OA 2RGEA 4ZO4A 1XXHB 3VU9A 2ZITA 4DLSA 5CM8B 1R0WA 5TVKA 4KBFA 2EYUA 2CLDX 4V0NA 2RHMA 5AJVB 1I2DA 2FEOA 1UPTA 4G5QA 1R0YA 1W44A 2IT1A 3MGCA 4B34A 3B1ZA 1X8LA 4IXMA 4B75A 4PAQA 3LBHA 2O52A 4A4DA 4TWZA 3THYA 1M7BA 1JR6A 1QHIA 2CHQA 2V54A 1HT2E 5DN6A 4F4JA 2KI5A 3E2IA 4QJ4A 2G77B 2V8OA 2OCBA 3W3AA 1QG4A 1GL7A 2UZ3A 3LD9A 4A6PA 2WWXA 3CX7A 5IK2A 2FJUA 3V9PA 4QBGB 2LWIA 3EIHA 4B3CA 3P20A 1Z07A 1U9IA 1ONBA 2J46A 3Q3JB 4HDQB 1OE0A 1G1MA 2WMOB 1ZCBA 2F43B 2QMEA 2RGXA 3NBXX 2CLSA 4LJ7A 2QT0A 2EFHB 4NYIR 1MO5A 5FOVA 1FP7A 3O8DA 4XVUA 1OIVA 4OI0A 1FUUA 1Q21A 2BBWA 3K70B 1P6XA 3WNCA 1AM4D 2XOKA 3AP3A 1CULC 3UANA 1G4AE 4LBVA 4JMPA 2G1JA 1SULA 2OHFA 2WWIA 4Q18A 3KTAA 4JSTA 3ZQJA 4GI7A 1CJMA 1RYFA 1MRNA 4TMWA 3EZ9A 3Q7QA 3QJYA 1FX0B 2P3SA 3ZH9B 1ZC4A 4GMXA 2ONJA 3CRVA 3QXHA 2GZDA 4PPNA 1SVWA 1AQUA 3LW8A 5KDLA 3HU2A 4BLTA 1HEIA 1ZNYA 2AD5A 4GOKA 4PPGA 2Z6VA 4M21A 1NKSA 4X8MA 2HDNB 1WCV1 1O3YA 3REGA 3LQQA 1R10A 3C5CA 1KY2A 2YWEA 5JECA 2FN4A 4OJKA 2H8KA 1G3UA 1CXZA 4IRUB 1FW6A 4NONA 4ASUA 2XTNA 4O2LA 4OQFA 3ZS9A 2MMCA 2XZOA 2DPXA 5KSYA 1COWD 2A9KA 3WRYC 1TQ2A 2J0QA 1QHSA 3GEHA 3FFAA 3A6PC 1G5RA 5E4FA 2YKGA 2XOKD 1PJRA 4PR0A 2IHYA 4CEIA 1M7HA 2FSHA 2ZRNA 5J5CA 4L16A 4QRHA 3T06B 3AKCA 3MSXA 1TU3A 4M0LA 2O8CA 1LFDB 4C4PA 4OQXA 3QXJA 5EXSA 2RH5A 3NEYA 4URUR 1CR0A 4MGZR 4DKXA 1E9CA 3I1FA 1KGDA 1YHNA 2Q9AA 4A82A 2BM0A 4LV5B 2ZRIA 5FH9A 3CNNA 1S4QA 2IYUA 3BRWD 2QP9X 1VKJA 4XJXA 5JWHA 3OAAA 1W0JD 2B7CA 3CPHA 5IK2D 1IY2A 2VF7A 4M1YA 1OXSC 1P5ZB 4HB2A 3K0AA 1VHTA 3HU3A 3SEAA 2MSCB 4D0GA 3B85A 4RZUA 3EZFA 3ETLA 3RS5A 4RFSA 3TGPA 2BJWA 3DPUA 4CEHA 2B92A 4W5WA 4U00A 1W7AA 3IO5A 1EFUA 2Q9CA 4F7WA 1E2LA 3CF2A 2J87A 1XEWY 2I3BA 2N1BA 3FVQA 4NCKA 1Z28A 1WE2A 2Z83A 5FBQB 1I4LD 1W1WA 4JL5A 1OXXK 4NCJA 3CX8A 3ZZTA 4BZPA 3THXA 2IX3A 4P4SB 4HAYA 2YWHA 3CZQA 5JBQA 5JEEA 3DOEA 3EZ7A 3A1SA 1XTSA 1JPJA 3VKWA 1DG1G 1U99A 1P9RA 1G41A 1KJZA 3N5CA 5AK0A 4BLOA 3K70D 3EX7C 1XEXB 2OXRA 3DDCA 3UWOA 2V3CC 4N1AA 3IEUA 4XTRA 2PT5A 1JEEA 1NSTA 3BH0A 4OBEA 2IYTA 2ZVPX 1TUEA 2YNMA 1RRCA 2Z4SA 1UEJA 3RRYA 4TLCA 3KUDA 3PUZA 4EAQA 1GRQA 2DFLA 1OXUA 3NBFA 1UFQA 5DLQC 2WWHA 4DT1A 1KI2A 4K8OA 3WHLA 1CRQA 3U3MA 1XRJA 1S96A 1N5IA 4M1TA 3IPXA 3IHWA 721PA 3MG9A 1P2TA 2F1HA 4PHGA 2WOOA 4FI3C 5EXPA 5LD2C 5GJBA 2OG2A 4GDFA 3U2QA 3CKLA 5CJPA 4GL2A 2F43A 4URXR 1BO6A 2GXUA 1E96A 3B1YA 2YOHA 4HB4A 5A4JA 3W8RA 2QMOA 3R9XA 3RDPA 3V4RA 3B7GA 1E2FA 121PA 4DBLC 4Q19A 1WP9A 2CK3D 2W2XA 1RJ9A 2GETA 4TT3A 4D80A 2VYFA 5DYGA 5FFMA 3W5JA 4BFXA 4ACBA 3B78A 1ZD1A 3AKEA 5CM9C 3EPHA 4JBXA 1ZM3A 2ZAMA 1YR9A 3A1VA 2VP5A 5HPYB 5KDDA 2XAUA 1EWRA 2AFHE 4FCWA 4PANA 1L4UA 1P7CA 3CF6R 5DHAA 3CLVA 1IN5A 3I3SR 1M34E 4RD6A 3A58B 4TT3D 4HUTA 2QQEA 5DISB 1HE8B 1KDTA 4Z54A 2XJ4A 4EKDA 1E32A 2JLUA 1TF7A 2GJAA 4D4MA 1A2KC 3VFDA 2ZSAA 1G19A 1E2EA 3H84A 3AM1A 1YZLA 4XWOA 4HZIA 1J99A 4RJLA 4PFSA 1FQJA 4XTCS 2QROA 1II8B 2Y8EA 1E1RD 1Q1QA 2W0MA 3BFVA 4C0HA 4DVGA 5GADl 1W46A 3PUYA 1T0JB 2UVQA 1KZGB 4BLSA 1XMVA 1OW3B 3U6BA 3PJRA 5P21A 4DLWA 4LPKA 1GILA 1OXVA 1Q3HA 3GCGA 4IHQA 3N2IA 4MYCA 4Q1BA 4Z8XA 4EQ6B 1YVDA 2J41A 2OT3B 2W83A 5KHOC 1OH5A 4GT1A 4IFBA 4ZCLA 5F9HA 4B32A 5FTLA 5M04A 4B47A 4LZZA 1TMKA 1ZJ6A 1E9FA 1IXRC 3L0IB 4WAUA 3MLEA 1DAIA 1S0UA 1PV4A 5KNCA 4OK5A 2XSZA 2J0SA 2GZHA 3CONA 4LCBA 1KTVA 4B2IA 4B76A 1CBUA 3IIMA 2V7QA 3KKNA 2ZRLA 4JL8A 4M2LA 2J3EA 5JLJA 3OIWA 1OHHA 4JL6A 1LS1A 2VP9A 4NCIA 3TE6A 2CVHA 5HCNA 3SYKA 3OFND 3K9LA 3SN6A 4BEJA 1IM2A 1V5WA 1ZRHA 4DEYA 2XB2A 2CNWA 3GLGB 2C04A 2FFQA 5EP2A 4AWXA 3PEYA 1BOFA 2VBCA 5AUQA 3T1QA 4TMTA 1SHKA 1TEVA 2JA1A 1OJLA 2XXAA 4V03A 1EG7A 4DLUA 2EYQA 4BRWA 1KY3A 1YJ5A 3OHMA 3VR1A 2JLSA 1TF2A 3QXSA 2IYVA 3H0KA 3AGPA 3CRW1 1II8A 2R6CA 3BOSA 3I4LA 3NIBA 2QN6A 4D6PA 4S2EA 3ADDA 1FMLA 1Q3TA 1UJ2A 5FOWA 1T3HA 2IXGA 3KQHA 1A7JA 1E2NA 1S9HA 3A1WA 4N0DA 1IN8A 4NMMA 2C9YA 4D81A 4EFNA 1AN0A 2BVNA 1JPNA 2ZRFA 3W3ZB 2R8RA 2YC4C 3U7EB 5FI1B 3U61B 1R8SA 2DBYA 2HXSA 3B60A 5EQTA 4OJQA 3N2EA 4HAWA 2GDJA 1XZQA 4B3DA 3AVOA 1HUQA 3LBNA 2W6JD 1GNQA 2RKOA 3VR4A 3T1VA 1Z0FA 3BFXA 1N6HA 3MRSA 1YU9A 1TQ4A 1SHZA 2RB4A 4LOAA 1OFHA 1CR1A 2GCOB 4QJ3A 4US2R 3C14C 5SZIA 4GP6A 4K46A 1RKBA 2ZANA 1IONA 1D8TA 2J0VA 4FMCB 1QHHB 5AJXA 2X19A 2ZRBA 3L2OB 1F48A 4V0ME 4EQ6A 1T8UA 1E2KA 2BEJA 3Q72A 3QF4B 2FEMA 3FMIA 2CE2X 2QGZA 2IUTA 2DWQA 2JATA 1W4AA 3IBGA 2J5XA 3V00A 1U8YA 4TL7A 2WPDA 5CYPA 1U2RA 4G5SA 1ZIOA 4BQSA 1W4CA 2PLRA 2OLKA 3KXKA 4ZIRA 1ZD8A 4LDJA 2JDIA 3Q9LA 3VKHA 1N6NA 2ZJ8A 4ZCIA 3RS0A 1KI4A 3KKPA 3HR7A 4JBYA 1Z6AA 2WJHA 3C5HA 3EA0A 1OKKD 2AN9A 4JIMA 1E99A 4LHVA 2O5VA 5L3RA 1ZW6A 1XEXA 2QL6A 4DWJA 1NRJB 1S3GA 4NCHA 4UNPA 1OV4A 2PX3A 4US1R 4AURA 4IEIA 3VHLB 2RCNA 3Q85A 1XD2B 1G7RA 2ZR7A 2IYSA 3QG1A 3UMSA 4XWAA 1WDTA 2ZEJA 5F9FA 3CNLA 1KSFX 2JLVA 3QKSA 4YXWD 4C7OB 2GILA 2IHBA 5EE3A 2ZXUA 2F1IA 2GJSA 2V4ZA 3GD7A 4D4KA 4C9BA 1WBBA 5EP4A 4DIDA 4F93B 4CEIB 3M1IA 4BFYA 1GL9B 5FPKA 4IDPA 5DYIA 1N3BA 4Q48A 3CRRA 5FPSA 4MKHA 1BYIA 3R8CA 2FSGA 4OI2A 2B8TA 3X1DA 1KDRA 5JI3E 5KSOA 3R8FA 3NG1A 4M1MA 4IOKA 2ZRMA 4KCGA 2ZJOA 1LS6A 2BCJQ 4LX0A 3TSOA 3FMPB 5E7MA 1W4BA 3K0CA 4WOPA 5A5GA 5J4VA 2F3RA 1GNPA 1FFHA 2ZROA 5FL7A 4F91B 1M7GA 3KB1A 4LJYA 1TX4B 3NTUA 5L3VA 2N46A 2ZS8A 2IXEA 3PEWA 1LV7A 1HQCA 1SXJA 4CF7A 5HZHA 2FGKA 1PUJA 2Q3HA 1X8KA 1N0UA 2WWGA 4QBHA 1JQJC 2GVZC 1IJEA 4C0JA 2WJYA 5CITA 4A92A 2ZRKA 4URYR 5E7JA 2A2ZA 1JXOA 2A30A 4YC7A 2WV9A 1I2MA 5CYOA 2IBMA 3R9IA 3W6OA 3U4QA 3E70C 3MJRA 3UG7A 1W47A 4O2RA 5A0FA 3X2SA 2KBFA 2QAGC 4P4TA 2GKSA 3THXB 4QNMA 2GEDA 1KJYA 2DYKA 4NYJQ 1XTQA 2A5YB 2QY9A 1U9IC 2QEQA 2GAAA 5EP1A 2ASEA 1ZINA 3QIAA 3PUXA 1YKSA 3TUJC 1E4VA 5KNBA 3ZD6A 2IS2A 4B2LA 2C5LA 3QXCA 1CJKC 2QAGA 1E9AA 5CK4A 2JEOA 2DFTA 4H9GA 1PLJA 3C7KA 3LXXA 3GLHE 5TV2A 5CLLA 1KSHA 3QEOA 3CZPA 1KO4A 2BWJA 1QHYA 1RIFA 2HLDD 4M8NE 4NU0A 4QBIA 4X8LA 3OE7A 3I32A 2F1JA 1KKMA 1XWIA 5EE0A 1VG8A 4IVQA 1Z0IA 4TTRA 3WMFA 4D0NA 4RZ3A 1EX6A 4W5JA 1OF1A 3W5IA 4A0FA 1T8TA 4LJ4A 5AUOB 3AEZA 1Q22A 4IVPA 2A7QA 4G5OA 5EZ6B 4Q1FA 3GJ0A 4TZ0A 3KKMA 1Z83A 3TSWA 1D9XA 4KSBA 4JVLA 1X8JA 4HAZA 5AJWA 2VLIA 3B6EA 2ATVA 2ZREA 2GF9A 1BS1A 2P5TB 2VEDA 4WVFA 4A8JB 5JRJA 4FINA 1RYHA 5EXXA 3PQCA 1E69A 1E79D 4AI6A 1DARA 1KAGA 1MO6A 2VTKA 2C78A 5J4LA 3ASZA 2G0TA 2C03A 3K09C 1FP6A 4YMUA 3E1SA 4CW7A 2R65A 4G5RA 1J90A 5DI9A 1N0VC 3C15C 3SE0A 2C9OA 1X1RA 4HDCA 1NN1A 3GMTA 2OBLA 2OBNA 1CRPA 1GM5A 2KJQA 5E7IA 5DNYB 2VF8A 1QVAA 3DM9B 4M22A 3BGWA 2Z43A 3TLXA 4HAVA 3G0HA 1K8RA 3EARA 4FCVA 3CM0A 4EPRA 2ZE8A 3K70C 1G7CA 3SOPA 4RSGA 4G0NA 5KSZA 2W00A 1UM8A 1F3OA 4I4LA 4IEEA 5GJWC 4JBWA 1U0HC 3CWQA 1RW4A 5G40A 4DDWA 6Q21A 1KO5A 1US8B 2DHRA 2ZYWX 2PT7A 4R9UC 4LGMA 4M1WA 5CIWA 1SVMA 1NN0A 2GF0A 2FZLA 2PJRA 3CX6A 1NLYA 2CCJA 4Q66C 1YRAA 3K9GA 3PIRA 2GCNA 3BK7A 5DGXA 4HEJA 3EZ6A 4YDHB 2W0SA 3OAAD 3WP0A 1SQ5A 1NL3A 4RKFA 1VTKA 3W6PA 2O8DA 3TSZA 3PEVA 4HYYA 3UXMA 5KPJA 5HCIA 1LNZA 3I92A 5KOYA 3D7MA 2J7PD 1T0HB 5HZKA 2KBEA 4LSGA 2YHSA 2HLDA 3BH7A 4KJZA 2UZIR 5FTMA 2J0UB 1XJ0A 2XNSA 2GCOA 4UXIA 5LB4A 3S1AA 3X1ZA 4DXAA 5KUTA 1TUIA 1A4RA 3FKSD 2ZYVX 4L8GA 1E94E 2HF9A 3BC1A 3MWLA 4CRWB 4LBZA 2EQBA 3U4QB 3V4FA 3ZVMA 5JSZA 3FB4A 4EIWA 2VRWA 3U3JA 1SVOA 2UKDA 2YWFA 1MABA 1OXTA 3ZS8A 1E2PA 1RE0A 3SJAA 1RVDA 3RSOA 3K0SA 2CXXA 2NTYC 2W6IA 1XPOA 1ZIPA 2FWRA 1KSJA 3TVTA 4P4UA 1JAIA 2YOGA 3D8BA 1U94A 1ZD9A 1ZMXA 3ZZUA 1VPLA 1WRBA 2K5UA 1ZYUA 1C1YA 1BKDR 3LY5A 2PEYA 5CB8A 4AKHA 1EFHA 2D2FA 3AQ4A 3PCRB 4Q4JA 2O8EB 1W36D 3C41J 1XEWX 2DWOA 1E2IA 3TW4A 1IN7A 4QHSA 1AA9A 2ZSDA 4AG6A 3RS4A 3VNUA 5J40A 3U3KA 1T6NA 4XH9B 4DCNA 5AWFC 5DH9A 5L3SA 1IBRA 4AYXA 4QM7A 1NSFA 2HCJB 2W2VA 2ZRAA 1GIAA 3AVQA 4Z51A 4HUQA 1P2SA 2B21A 1G8YA 1Z47A 2VSFA 1XD9A 2ZI7A 3FGNA 2RHDA 2VHJA 3QI2A 4NKRA 5C1BA 4LV6A 2PZGA 4TN1A 4LJ8A 3EPLA 5JCPA 1YZTA 2GK6A 4PSAA 3X1XA 1EESA 2F6RA 4A15A 2HEIA 3B82A 2E1RA 4OKSA 1JAHA 3MD0A 3KZ1E 4W9MC 2VP4A 3O8BA 2AWNA 1GKYA 3ZD7A 2IUUA 4H1UA 2HT1A 1KI1A 3CPEA 3LLMA 4ERNA 4ZCMA 2R6FA 1G7TA 4HI0E 2R62A 3LFUA 1MO3A 2DFNA 4ZKDA 3F0TA 1DBSA 1ZU4A 5JRZA 3NDPA 2GTPA 4PSVA 1G7SA 3DEFA 3WY9A 1OH6A 2IC5A 2XZLA 3PVSA 4LJ6A 3T5GA 1P62B 2KSQA 3UMFA 2C9CA 4HLUC 1NN3A 3VR3A 5EP3A 2OEPA 5KU1A 3NVAA 2JASA 2O0HA 4I81A 3SNHA 4NYMR 3PV0A 4CGZA 5FOTA 3TJZA 5FR2A 3J81k 3ASYA 4JLVA 5ANRB 4ACAA 2W58A 4FIDA 3ND8A 1DAGA 1DELA 2JLYA 1DO2A 2D7DA 4K81B 3K09A 4MUBA 3ZIAA 5SZKB 1HT1E 2N42A 2ZE7A 3QKTA 2HJVA 4GRAA 4IDOA 4W7SA 5GVRA 3U5ZB 1EK0A 1GFIA 2ZJ5A 3IGFA 4C3ZA 1HTWA 5FTNA 3TRFA 4D2IA 4TYNA 1KHTA 3RABA 2CCGA 4UKDA 2NO1A 1VDZA 4BFTA 2ZIAA 4ON9A 2WAYA 1M8PA 4Q1AA 3RC8A 1Z2AA 3LVRE 4A1FA 1AS0A 3K0FB 4RFVA 2PBRA 2D7CA 3SJCA 3KJGA 1Q1EA 4A6XA 3JVUA 3O47A 5TARA 3WBKA 1KSGA 1T91A 4IDQA 3X1WA 3IO3A 1G6HA 5JI2E 3THWB 3GP8A 1A1VA 2O8BA 4MGIR 2FF7A 4ZDIA 5KYKA 3TK1A 4EFLA 2GXAA 1X86B 3NWJA 2REBA 1F60A 1U0JA 4JKYA 1YQTA 3T5DA 1M2OB 5EE9A 1PLLA 5G3YA 4Q4AA 3WNDA 2QM7A 1W36B 2V9PA 4EJSA 4AY2A 1OT3A 2OFWA 2NGRA 3AH8A 3DVLA 4Q4HB 4EDHA 4Q9IA 4MDEA 4PTLA 3WYGA 4YMVA 4FMDF 1FTNA 3RS7A 4Q03A 2JLRA 4YDSA 3HDTA 1XTIA 5K8TA 1OIWA 3DMDA 4RY2A 3MWKA 2V1XA 1E98A 4BFVA 3VMFA 1B0UA 3FWYA 4C2UA 1JBKA 4I1OA 3AP2A 3CRMA 4PQYA 5B58C 1TPZA 4LBYA 2NQ2C 2RGBA 3Q5DA 2A3RA 1UKZA 3RS2A 4QG7A 4OQMA 2IYLD 3D3QA 4GMDA 1WBDA 2GCPA 1D6JA 4DIEA 2ZJ2A 4FXPA 4J0QA 2J7PA 3JZAA 3MMPA 3GJ3A 3FFBA 2V1UA 2WTUA 4EJSC 4MITA 3C4JA 5B64A 2ZRJA 2VA8A 2VPPA 1YZQA 2Q3MA 1Z6GA 2B6HA 3IIJA 3NC0C 5EZ5A 1KAOA 4ZV4A 1G16A 3KQKA 1GWNA 3N70A 1ZNXA 3U3RA 4BASA 1ODFA 1E2MA 2D62A 1DAEA 2R2AA 2DB3A 5F3WB 5KNDA 5L3QA 2CVFA 4P3YA 1E0SA 4TLDA 3VX4A 4ZPXA 1VECA 2WM9B 4S35A 1G291 4TLBA 3HYTA 1R5BA 4URVR 3KTAB 3VQTA 1AQYA 4ZDWA 2GRJA 1WXQA 5J4HA 1MT0A 1P2VA 1NBMD 3AVUA 3LRPA 1N5LA 2EFCB 2F3TA 3VR6A 1P9WA 3NH6A 2IL1A 4A0HA 2QA5A 3HU1A 2FGJA 2I1QA 3KJEA 3GFPA 3P32A 1KYIA 1AZTA 1DAMA 4XSGA 2H57A 1T3SA 4BECA 3BAFA 5BW8A 4KFTA 2FDCA 2C99A 3QE0A 4DDTA 1OLOA 4GP7A 1XPUA 1SXJD 1VCOA 1UKYA 1W4RA 3B8HA 4M53A 4B73A 2FPMA 1CTQA 4XVRA 4JLPA 1OKKA 3SBDA 4PC2A 3SS8A 1IHUA 3BBPA 1RRFA 3MFYA 4I1VA 1ZC3A 2ZETA 3DMNA 1TL7C 5AR1A 1R0XA 1UF9A 2QZ4A 1ZAKA 5G3ZA 4ARZA 5GVSA 1R8QA 3FHTA 3RWOA 2JLZA 1E0JA 1W2HA 4DDUA 2IEZA 4GOJA 1E1QA 1QDEA 3I73A 4DCVA 4KI0A 2IA5A 2G1KA 2GK7A 4LYJA 2HUPA 2QNRA 1XTRA 1SXJC 4XD7D 3WYFA 1E2JA 1P61B 2J9RA 2GWHA 3GEEA 1E9DA 4DUGA 3NXSA 3QSYA 1R7RA 3W9YA 2ZE5A 4OYHA 1Y63A 5JWRA 1OH8A 3UKDA 4YXWA 1NMYA 3CF0A 3RRNA 4G3XA 4KFSA 5TB5A 1II0A 1VCNA 1Z8FA 4A9AA 1KO1A 3FE2A 4E5UA 2J7KA 2QRNA 2EWVA 2WSSA 2Z5FA 1UADA 4GFDA 1ZVQA 5BN4A 4QFMA 4PSKA 3SR0A 4D4JA 2XITA 3BXZA 3KFVA 4KXFB 4Y0AA 2OBMA 4Q9JA 1TNDA 3RAPR 4Q4AB 5L8VA 2GNOA 4QGAA 1GAJA 3LX8A 1SVKA 3PUVA 2CBZA 3PENA 3TMKA 4TQ9A 1F2TB 4RD2A 4NYJR 2PMKA 4IKEA 3RANA 1VG1A 5GJVC 1P9NA 3KL4A 4KSCA 4G5GA 3SYNA 1II9A 3JZMA 3CR8A 4A2PA 1YE8A 2HCBA 3AVXA 2RGGA 1D5CA 1E9BA 1MABB 1NVXQ 4BFUA 1XTKA 3IIKA 4JZKA 4JLOA 4RCYA 3L0SA 2HJGA 5B30A 4JYBA 1NG1A 3SBEA 3TQCA 2A5JA 2EW1A 1GRNA 4I1UA 2ZRHA 2O8CB 3KDSE 4DC9A 3AUXA 5C4MA 1SVIA 1IJFA 2RGNA 2ZU6A 4F38A 1NLFA 2CMKA 4P31A 4WW0A 2QAJA 2WICA 5UKDA 2CLCX 4TQAA 2Z4RA 2QAGB 4MH0R 2XEXA 1X3SA 1EFRA 5EUQB 1A82A 2HF8A 2QPTA 3ICQB 2WIAA 3QBVA 2BOVA 3I61A 2IYZA 2HYDA 3LXRA 3QKUA 1JJVA 2QBYA 5B2ZA 4C0SA 3NDBB 2PH1A 3OF5A 4PXAA 4IDNA 3F5FA 2GBLA 3A4MA 4LBWA 2OCAA 4HUQB 1MH1A 1J2JA 4RD1A 1V43A 5CIQA 4YMSA 4TSFA 3AVVA 5H8WA 3EASA 1IY1A 4I99A 1DE0A 1G21E 4OHZA 3EWAA 4DCUA 5J47A 1G5TA 4MA4A 3TKLA 1YR6A 3LDAA 4O0MA 4BEBA 4JLBA 3TW8B 3H2YA 1CU1A 4KYIB 1E0KA 4FMDB 2HT6A 1T3LA 3R20A 3EIEA 3Q5EA 2F55A 3GLHB 3U7GA 3EC1A 2CNWD 2QG6A 1UKVY 2QSYA 1FL9A 1CJVC 1IQPA 4YMWA 4BLRA 2ZJBA 1E4YA 1LTQA 4A8JC 4R71A 3CW2A 2NMVA 2QP4A 1J7KA 1S2MA 4TTPA 3T61A 4TYYA 4Q4LA 2OAQ1 1S1MA 3TAUA 1TF5A 4QGHA 1FOEB 2AXNA 2ZI4A 1Z6YA 1VCIA 3IQXA 4KAXA 4AD8A 2JLQA 4E07A 4DCSA 3RC3A 1IOZA 3G5UA 2P2LA 3WMEA 1WA5A 3BIFA 4B3XA 5E95A 4AC9A 5JJKA 3P27A 1JJ7A 2H18A 1EGAA 1YRBA 1IN4A 3W8NA 2EFDB 4YLGA 4HZUA 1ZUHA 3EIQA 2JJ1D 1D2MA 3RHFA 3EC2A 4BLQA 4PC6A 2RGNC 2REXB 4UXHA 1VCMA 1JR3E 3QVUA 4L9SA 3VKGA 1Z08A 4LPSA 2PMDA 4MYTA 1E0AA 4JVNA 4FWIB 1FX0A 1XP8A 4ZIRB 2FX3A 4BFSA 4EPTA 4CEJB 4LYFA 2GJKA 4UJ5A 5CB6A 2WJJA 3BWDD 2VP6A 1MR3F 4II7A 1NVUQ 4V0MA 4CEJA 2BBOA 1XU4A 5FL3A 3HWSA 2BEKA 4F4CA 4M1SA 1U98A 2NZJA 3GJ6A 1G3QA 1SVLA 2QE7A 4KFUA 4QJ5A 5SZJA 2AKAB 3FKSA 3M0EA 1MO4A 3FPAA 4C0BA 4ARZB 3SQWA 1IXZA 1CIPA 1T4GA 4TL8A 4AYWA 1GOTA 4B3GA 2MSEB 2QU8A 1KDOA 1IY0A 2DWPA 2W6ID 4V0OA 4OK3A 4RVCA 2JJ1A 3KQUA 4OHYA 2O8DB 3M4YA 1QF9A 4A2QA 1N6PA 3A4LA 4PQFA 1JXMA 1NF3A 2AFIE 3BB3A 2NPFA 3GLIB 4HATA 2I4IA 3KUCA 1HH4A 1P72A 1NY6A 1H8HD 3K0EA 1T9HA 2BKUA 4B48A 3IQWA 2WVJA 2WHXA 2O0JA 4HLDA 5HKKD 3ECCA 4Q00A 5CLQA 2O8BB 2RGCA 5BQ5A 1US8A 2VP0A 5LPNA 4PPFA 1S8FA 3B5JA 4ESHA 1NJGA 1YR7A 3U60B 2AK3A 1M74A 4HLUA 2ZR0A 2P5SA 2GXQA 1KK1A 2EFGA 2IYXA 4D26A 2ZI9A 1G8HA 4JJKA 3PXGA 1HYQA 5AUPB 2LKDA 1XCMA 4GOXA 5BN5A 3LX5A 3GJ7A 4HB0A 4PC1A 3SI7A 1DOAA 2X8AA 1N6LA 4HB3A 4FWTA 3QPVA 2AX4A 2EFEB 1KIMA 1I4DD 1XMIA 2D3WA 3EW9A 1S9DA 1VMAA 4IFEA 3LWNA 5F2EA 4RCZA 5FOXA 1HA3A 1VIAA 1W49A 3VX3A 5CDFE 3LA6A 4BUJA 2GXSA 3SHWA 4U7DA 2DCUA 2R6AA 4EPWA 2OO7A 2JJ2D 3ZGXA 4Q1DA 2XX3A 1Z0DA 1M1YE 3SFZA 4C0QC 3IKJA 1VG9B 4PZLA 4MYUA 2C8VA 3BB1A 4IW3B 2ZI5A 5GJCA 1E2DA 1OFIA 2QM8A 3NHBA 5FUYA 3NKVA 5B57C 2X1VA 4QOSA 3A37A 4C0KA 3OEEA 2CEAA 3ZDQA 1KMHA 2ODEA 1BH2A 2C77A 3QOFA 4IVRA 3L0PA 3QG5A 5AJYA 4FN5A 3ZJYA 3T1OA 3MWJA 3B1XA 1Q0UA 2DFKB 3TIFA 4KFRA 4RZXA 4Q21A 3IHLA 4PO9A 4MYHA 3ADBA 1AGPA 2O8EA 4L9WA 3THWA 2QSZA 1FNMA 3GLFE 2PZEA 4UXJA 1CKEA 3IILA 3CPJB 1KZ7B 3SJZA 3JVVA 4JLDA 1G20E 4PQRA 4UJ3A 3RYTC 4Q7MB 4L15A 2FFBA 4LHYA 4JSYA 2IK8A 5IDVA 1X1SA 1G3MA 4V0KA 2A78A 2ERYA 3PUWA 4QC2A 4DB2A 2HV8A 5JCZA 3OEED 1KK0A 2ZAOA 1N25A 1ZP6A 3RNLA 1CLUA 4EUNA 1MOZA 3AF3A 2F7SA 5H70A 1ANKA 2CDNA 1LW7A 3GJ5A 3SFVA 1DADA 3THYB 4MKIA 1OH7A 2FOLA 3F3YA 4AG5A 4F92B 1YR8A 3HJNA 1NNEA 2P0EA 5F98A 3TVDA 1FZQA 4RFSB 3QBTA 4UNSA 1XCGB 1BYUA 3KKQA 1WB9A 1ESNA 3K1JA 4QBFA 1NY5A 3P4XA 4LRWA 2C98A 1KJWA 1EX7A 3KJHA 3C16C 1H8ED 2BMEA 4C2TA 5LB2A 4QNRA 1OFUX 5FPYA 2BKEA 2NO7A 4OQLA 3DOFA 4MDFA 5IT5A 1XFAA 5FBWB 1GUAA 2QORA 1W36C 3ND9A 4MQBA 1E9RA 4CDGA 4AKIA 5H68A 2XSZD 3GLIA 3GLFB 3H4MA 4E22A 1ZM4A 3EA5A 3G82C 3AF1A 1N6OA 1KNXA 2ODBA 1K5GA 2C96A 2JLXA 1U8AA 1UDWA 2OILA 2PJZA 2J0UA 5AUNB 5BWMA 4E03A 2ZR9A 4BWYA 3FOZA 4YONB 4HZUB 3U44A 1XPRA 1NKTA 4UNQA 3ICEA 2XTMA 2G3YA 4ASUD 4YQFA 2MSDB 4MRRA 4AYTA 4HSEA 3GLGE 4WA7A 4EJSB 4Z1MA 1JEDA 1Q12A 2ZUCA 3GFOA 4PHFA 1Z29A 2ZSFA 1KK2A 5BXQC 3KKOA 4OI1A 2FMXA 3PFIA 1C4OA 1UAAA 1FQKA 2IYWA 2OFOA 4UNNA 1AS2A 3BE4A 1MRSA 2PCJA 4JLMA 2FFAA 1QRAA 1DPFA 3WRXC 2BHRA 1HQYE 2H16A 3SYLA 4ZI3A 2FZ4A 4AKEA 1B23P 4QM6A 5DO9A 1C9KA 5JMTA 3CIOA 4D82A 1MV5A 1UEIA 1JI0A 3AKDA 4KBGA 2GJ9A 5TY0A 2QTVB 3ADCA 4ZDJA 2QPAA 4IOJA 4OHWA 5JHGB 1NBME 4GZLA 2JDID 3SZRA 2BBSA 3THOA 4R7ZA 1KMHB 3EWSA 4DSNA 1RC8A 1XD8A 4Z1MD 1XEFA 2NZ8A 1NP6A 4QXAA 3AKYA 2QT1A 4LJAA 1E1QD 1E6CA 1W5SA 5TDHA 1TU4A 5FL7D 1KI3A 4A0GA 1WQ1R 3BJIC 4C30A 4FCTA 2H1LA 3UWKA 2B8WA 1GTVA 2YZ2A 4XD7A 3ZZ0A 5FBVB 4R98A 3I5XA 3LQRA 1SKYE 3T1TA 1RPZA 1LY1A 1EFCA 3OZXA 4JKIA 3B2EA 1XF9A 4RD0A 3S1AB 4TYPA 3U3OA 3CH4B 4Q01A 2RMKA 2G83A 4LJ9A 2VH5R 4BFZA 3GLFA 4DCTA 2ZQ5A 1J70A 3CRQA 3CWZA 2XJ9A 1A2BA 2ZI3A 3GEIA 2I1VB 4TMVA 4CIDA 4C0AC 2ZS7A 5EE1A 4F4IA 2OM2A 2ZUBA 1W0KD 2VO1A 4LY6A 4LI0A 4Q4JB 3WNBA 1SXJB 1QHNA 4DLTA 1PUIA 3QVVA 2OXCA 4NP6A 2AXPA 2R9VA 4XSHA 1EXMA 1ZM7A 2BMFA 3AB3A 4TL9A 3U6KA 2VHCA 1IXSB 2OE2A 2L0XA 2JCSA 5BYKA 1Q20A 5EJEA 1DAKA 3FTQA 2GBLC 2ANBA 3PR1A 4NTZA 4AKGA 1NI3A 1SKQA 3IDQA 3LV8A 5K8LA 4R2IA 3VTKA 1LF5A 2NOAA 4HAXA 3AVWA 2BCGY 1P73A 2ZM5A 3DZDA 4Q1EA 5JZVA 4M4SA 4B35A 1XBTA 1PVOA 4B3FX 4PO1A 3MJHA 2ZRCA 3B1WA 3K9HA 4KHZA 3W6NA 2ODWA 1Q1ZA 3H86A 4US0R 1GL6A 1QHGA 4DSOA 2VHQA 4KYUA 1ZM9A 2GEVA 4M9ZA 3D31A 3I72A 1VG0B 4A8JA 1NVVQ 2FA9A 3MCAA 4BZXA 1W0JA 4NH0A 3L0OA 1XB2A 5FPHA 1KK3A 1UBEA 5JWOA 3Q8XB 2EWWA 1ZM2A 2G88A 3KFXA 4KODA 4PX9A 3FHOA 821PA 1RFLA 2D2EA 2P6NA 5G41A 2SHKA 1P4SA 1LF0A 1R5NA 3K0AB 2WKPA 4FW9A 3RRMA 3TAHA 4ESVA 3Q7PA 3IPYA 4EPYA 4A2WA 1XXHA 3IUYA 3VU9B 2GVDC 5KSPA 1WF3A 3ZIAD 4DSUA 1O87A 3B1VA 2GEUA 3AF4A 3QNUA 2GESA 4OHVA 3RWMB 4B6FA 1G3RA 5L3QB 2FG5A 3KXLA 3QPUA 3KQNA 3P4YA 5C4GB 2XXAB 2IF0A 2YVUA 3OEHA 1P2UA 3KXIA 5FR1A 4UNRA 5SZHB 2ORWA 1H8EA 1QG2A 2KB0A 2QGNA 2ODNA 1Z2CA 3AP1A 2HXYA 1T5LA 4B3BA 4JVSB 1ZNZA 3KX2A 3MAAC 2ECKA 4M9SA 2BJVA 2NIPA 1GP2A 3VR2A 3LO5A 2OLJA 4NPHA 4D4LA 5JJLA 2AD1A 1KO8A 3BFKA 3TQFA 1DO0A 3I5YA 5E3HA 2WZQA 3RSLA 2MMGA 3AF2A 2W2TA 1S1CA 1EWQA 3W34A 3X1YA 4XVQA 4LYHA 4NE2A 3W90A 4FMBB 1ESMA 4BRUA 2YOFA 3A4NA 4HLQB 3AVTA 2WKQA 2CHVA 3O8RA 1OIXA 3WHKA 1EFRD 2BC9A 2WSMA 3P1JA 1AS3A 4PAMA 2WWWA 1ZNWA 1OHHD 3AF0A 3OIYA 1FMJA 2CL7X 4TL6A 1CEEA 2FE4A 3WP1B 1XJCA 4ZI2A 2F9MA 2ZRDA 4MKGA 4U5XA 4LC1A 3QY0A 4MKFA 5FOSA 1CR4A 1P3JA 1XZPA 3B9QA 2H7VA 3I62A 4KU4A 3TR5A 2P6RA 2VIIA 1UKEA 5KO2A 1GKUB 3BORA 2RGAA 4CT5A 1XTJA 1OB2A 3FDIA 4PC3A 4DLXA 1E9EA 2VHTA 1JALA 5JS8A 2ERXA 3HPRA 3ONWA 4PAOA 4CT4B 5KPDA 2H5EA 5C46F 3EG5A 3K0FA 1H65A 4TYQA 2IS4A 4HLCA 4EFMA 1LB1B 3FMOB 1TEXA 3VHXA 1KDPA 2YV5A 2OCYC 1U90A 2QRZA 2REOA 5DHFA 4V0LA 4KITB 2J45A 1D2NA 3KB2A 4RZ2A 4AK9A 1SZPA 1RJ9B 3UATA 3SU8A 2AL7A 4TMXA 3SHFA 1W48A 5JSZB 4NDZA 3VNVA 5HE9A 1R0ZA 3TUIC 4QHTA 4A36A 3ZLJA 2ZU0C 2ZYTX 3LW7A 3OEHD 1R6BX 4BPBA 1R4AA 3R7WA 4PZYA 1P60A 5FI0B 2BMDA 2PCLA 2WAXA 4JLNA 1XD2A 2VL7A 3RRZA 4YMTA 2CL0X 4URZR 1E2GA 1PLKA 3EAQA 1E79A 4P32A 4Z8YA 1JNYA 4DDVA 4DT1B 4D0LB 3HYRA 2AKYA 3GPLA 4Q9KA 4MRPA 5CK5A 1G4UR 1QBKC 3SDZA 3R9WA 4DSTA 4QL3A 2ZVQX 3TUZC 5DSZA 2TMKA 4IOMA 2B7BA 2YYZA 3CH5A 3QENA 3H1TA 1HV8A 5CJ2A 1F2UA 4TLAA 4WXPA 1XX6A 1Z0JA 1VYUA 4NBSA 2O0KA 3L8YA 3O8CA 1D9ZA 1UDXA 2V6IA 3OIVA 2QI9C 2PX0A 1I4TD 1ETUA 1CJTC 2R6GA 1GSIA 3NC1C 5HTKA 2ZJYA 4ZKEA 4P33A 3EZ2A 3HR8A 5JS7A 1MKYA 4OHXA 2YWGA 4Q9LA 3TR0A 5C2JB 2ZJZA 4B33A 5K8IA 1YZGA 4LJ5A 3NHAA 5H1YA 4CVNA 3GJ8A 4KVGA 4X8HA 2IF2A 4DHEA 3BD9A 3LLUA 4LHWA 1GZSA 3U44B 2FU5C 3K53A 2DY1A 3AUYA 4WXRA 4JLAA 4DLZA 2AWOA 1KI7A 4Q4HA 2PEZA 3TBKA 2JJ8A 4FD2A 3LVQE 5FTJA 4LYAA 1Z6XA 2D4HA 1S3SA 2WJIA 2G0NA 3CO5A 1F5NA 2RAPA 3MWYW 3WXMA 3SQXA 5FUWA 2ZPTX 3DKVA 5FTKA 4OK6A 3QPWA 3KQLA 1P75A 3ADKA 2J59A 1Z0KA 2ZE6A 5IF9A 1G6OA 5G53C 3K0CC 1G3IA 1NMXA 2VSOA 2P67A 1D2EA 1GRRA 2F9LA 2X2EA 521PA 5BYJA 4CZ2A 1K5DA 2WBLC 3IBYA 4B44A 5FUVA 3QXXA 4WZAE 3ZVLA 1HURA 2CJWA 3WBJA 2KE5A 1Z63A 1KOFA 4NHOA 3T34A 3DM5A 4C7OA 1K6MA 2QP3A 1LVGA 421PA 2WKRA 5KDOA 4TZ6A 5DIFA 4Q02A 1L2TA 2NO9A 3AVYA 4TMZA 1H8HA 1DEKA 1M6NA 2IWRA 3OE7D 4H1VA 5LDDC 1CR2A 4KLZA 4PHHA 4BGDA 3GQBA 1G8GA 4URWR 4ITRC 1L8QA 1UBCA 4JLJA 5D3MB 2KWIA 4FMCF 4LC0A 4MUAA 4NYIQ 4PZZA 4Q7JB 1KKLA 1N6IA 3UK6A 1Z0AA 2ZSEA 1G8PA 3RS3A 4RKEA 4PC7A 1QZXA 3NBYC 2JJ2A 4I1SA 5FBLB 3RLFA 2O8FB 2XNDD 2YINC 3DZ8A 2F1RA 3MUFA 1DTSA 2GA8A 5KTYA 4PHTA 2VHUA 3LNCA 1JR3A 1NJFA 1AZSC 3EXAA 3L82B 3T12A 2GZAA 2BV3A 4B6EA 3VR5A 1F2TA 2VSXA 4WZ6A 2OAP1 2WJGA 3U7HB 2CK3A 1JR3D 2AR7A 1OYYA 4JYCA 5LD2B 4LHZA 3R7WB 2JIZD 3RVBA 1GKIA 2FPLA 3OIUA 1Q44A 4NZYA 4CYMA 1TAGA 2XGJA 2Z0MA 1ZUIA 4GZMA 3GJ4A 4B74A 4JLKA 5HR5A 2C95A 3F8TA 2VQSA 4O25A 4GBMA 4XIGS 1XMJA 4JS0A 1YZKA 4RD3A 1CF4A 5FUXA 1UBGA 2QMUA 4MRNA 1AJEA 1KI8A 1W5TA 3VAAA 4A0RA 4NCNA 1FTSA 2JAQA 4B2PA 2QTFA 1AKYA 2FPKA 2ATXA 1VIYA 3BERA 5HE8A 1Z22A 8OHMA 2H17A 4XOIA 4P0TA 1XNJA 4TMKA 2OCPA 1ZU5A 1J8YF 4OL0A 4R2HA 1HY3A 3OESA 2ZSBA 1E2QA 4IDHA 1CP2A 1KI6B 4JVMA 4L5BA 4WBSA 3UIEA 3ZYCA 1L7VC 4Q7KA 2AK2A 2EVWX 1U0LA 2WIBA 3M6AA 3LBIA 1Q1BA 2W6JA 4LK2A 2NO6A 4TQUS 2CCKA 2D74A 3QKRB 2ZUDA 1FNNA 3CBQA 2G6BA 2QUZA 1IN6A 1DS6A 1AGRA 1IAQA 3AGQA 5EE5B 2IYYA 3HP1A 2ZJAA 2AHOA 4EPVA 4KVAA 2D06A 4QGFA 3DO6A 2R6DA 3FHCB 2LKCA 1E1RA 5AJZA 4DLVA 1SXJE 4NYMQ 3T35A 1J8MF 5FOUA 4TSFD 5FBRB 4WIAA 3A1UA 4UQOA 4QHYA 3NH9A 3QF4A 5EXTA 3EPJA 1OYWA 2ZS9A 4DZZA 1OPXA 1WMSA 2A5GA 1BMFD 3GJXC 1E3MA 3KJIA 2JGNA 2OFXA 5IHPA 1DVRA 3FKQA 4GNKA 4LHXA 2EU8A 1NIJA 2CE7A 5K8UA 3PITA 4V02A 4B71A 4MRSA 621PA 2PZFA 5BN3A 5L3SB 3WYAA 1TTTA 4WZBE 1YZNA 1EFTA 1JB1A 5JJIA 2QTHA 1X6VA 2PLFA 2RGDA 2ZI6A 4P4SA 3WMGA 5JHHB 2VP2A 2ORVA 3UPUA 5DI3A 3NEJA 2ZRGA 3UG6A 3I8XA 1NVVR 3ZQ6A 1JQLB 3NBZC 4MGKR 3L8ZA 2FH5B 1TQ6A 1RZ3A 3DHWC 4IOLA 1NIPA 1F2UB 4TYWA 1Z3IX 2Q21A 1NBMA 2X77A 4JT2A 4DJTA 2WWFA 5TXGA 2XB4A 4DB4A 2P6UA 1A5TA 2BBTA 2O8FA 3QKRA 1N0WA 1G64A 1U8ZA 2GJ8A 3I8SA 5DN6D 4HDOB 2CHGA 4HAUA 2Q0HA 1GDDA 4N3NA 1VHLA 2E87A 2FFHA 1XJQA 2OUKA 3QEJA 4ILEA 3CUEF 3REFA 2WWYA 3AVPA 4TTQA 2IEYA 1KO7A 1TADA
chains in the Genus database with same CATH superfamily
1J49A 1NBIA 2DU8A 4B84A 1X7ZB 2WILA 2PUFA 1V2HE 4RD4A 3UHFA 1SFRA 4MGYR 4A5OA 1QOZA 4DRYA 3EVBA 3OHSX 3OHPA 2FEPA 3FAZA 4DW8A 5HRCA 4Z4HA 1GNTA 1EFLA 2WJVA 5KJCA 1FPMA 3R09A 2C5GA 1ZUNB 4YI5A 4CEHB 1ZA1A 4PIVA 2FPUA 3EXG1 4LZPA 4M54A 3LYHA 3VHXB 4CG0A 5HXAA 2FXVA 1ZJ5A 3CKMA 1Y80A 1N6RA 1R5OA 2SKEA 2OAGA 3OCJA 3LHSA 3CR7A 2Z98A 5REQA 2QYOA 2YC2C 3WLTA 1BX1A 5DHTA 1YRHA 2FLKA 3QVGA 5EIBD 3WK5A 1S2GA 1BROA 2YMLA 5EMHA 5K51A 2Y9PB 4TLMB 3VR5H 4EY4A 2XMDA 1Q50A 2QV0A 4KE7A 3PNKA 1U63A 4WKCA 3R3WA 1KAMA 3RKUA 3EIUA 3HYNA 1WXXA 3KTDA 3M9LA 2O3UA 3SC3A 4ZP1A 3FXAA 2QVBA 1JKJB 2XEDA 4PO8A 5F2NA 1CQJA 4PPQA 2BMJA 3I42A 3K9QO 1Z4IA 5EJ2A 3TAXA 5IUJC 4LWZA 3KDAA 1N2HA 3LVBA 3L06A 3U7FB 4O6VA 1QYWA 3FPLA 4FFDA 4XDGA 2BFMA 3H99A 4PG7A 4MWSA 3ACBA 2UYQA 1JR2A 2WNIA 4Q7LA 4A8TA 3OWOA 2XD9A 4WXYB 1QRSA 2RE8A 4C5AA 4H35A 5DNAA 1GDHA 5LIRA 4MIKA 3A36A 4J1NA 2C7BA 4N0EA 4MUJA 3F6SA 4PRZA 1G5PA 2QZ9A 4TRRA 1O94A 2RGYA 2IXFA 2XE7A 2LCFA 4I08A 3V8MA 2QS9A 1UBSB 1YD7A 2OVFA 3FNBA 3FPEA 1LBEA 2AOUB 2X0IA 5H3LA 5IDQA 2R68A 2H2GA 2OBYA 4AIIA 1AKEA 2JRCA 3WL6A 4C89A 3GNQA 1DQPA 2VDWA 2GT1A 3QV2A 4Z1OA 4B1FA 3ZHUA 4IHKA 5DHQA 4DJJA 2FKAA 3D4OA 1GHTA 4UARA 3UK1A 3P8ZA 4Q9HA 3HA2A 4RGYA 4LUCA 4D1YA 3CNOA 1HDYA 4L8VA 1E1KA 5HJ5A 1SIUA 3GDOA 3TLKA 2CWDA 3EZGA 5DCWA 4V1CB 4ALKA 1Y7IA 2B1QA 4MRVA 4RMIA 2ZGVA 2PGLA 1HFEL 4XYBA 3T7SA 1N32B 2I6GA 3O9VA 1PJZA 2VJMA 4XKJA 4ZPJA 4UFPA 1Q1NA 1NG9A 4KYVA 3L6BA 2UUCB 3IAAA 3I4FA 3T1OA 3LX6A 4JUFA 1ONSA 1RWQA 4MW2A 4N5LA 3U4MA 3BH6A 1OBVA 1ORTA 2PX6A 1RRPA 3AEUB 1V5IA 1BSVA 1QKKA 2X5KO 3ADPA 3PC4A 4GF5A 2X3UA 4J91A 4W1SA 1UBFA 3MD9A 1TK2A 4F3RA 4BX9A 3DAOA 3DCIA 4RDIA 5AVWA 2CNDA 2I9PA 3P52A 1H4VB 3PC2A 4M1KA 3ZGLA 5IWAB 2UUPA 5JC8A 3BB4A 3F9RA 4B7UA 3K1TA 3OJOA 2WV7A 1IK4A 1J8DA 4ZVUA 2E9SA 2EL7A 4AJPA 5BQXA 4L5AA 2Z95A 3A6FA 4RL6A 2JLWA 3RTEA 3HFJA 1Z4KA 4DLRA 2IS6A 5NULA 4Q7QA 1J0AA 3A2MA 2CL6X 3GVIA 3UMGA 2HMVA 3MHPA 1TM2A 4C14A 2PPVA 1PG2A 1QVZA 1XCPA 3OOEA 2ZXEA 2GN2A 4FJ0A 5TC4A 1ZSNA 2JFHA 2YIVX 1HMPA 1Z5ZA 2RBKA 4NPCA 2WZDA 5LBIA 3JCZA 1A9RA 4Q9AA 3WJ1A 3I0ZA 2NO4A 1TLTA 5KJ1A 4RHYA 3SC6A 2ORIA 3GNLA 3EGDB 2FR1A 3GLIE 1N2CE 3OPMA 4KPGA 4DMMA 1Y4UA 4BZQA 1W8DA 2J1LA 3BS4A 1X1DA 1Z9BA 4FNOA 4P22A 2YR0A 5B55A 3B9PA 1O97D 1NMZA 2IW3A 1NN5A 2ZSUA 2B4YA 1V8DA 4BNJA 1N3IA 4COOA 1S7GA 1RSZA 1DG3A 3OT1A 3S1LA 4AJEA 2JH9A 1U6IA 4GGOA 4YHHB 2QN8A 1UQTA 4DNFA 1B15A 3PEUA 1R0LA 2OO5C 3O73A 1XK6A 5DNWA 1R27A 2E1PA 4TV8A 1T5IA 1THMA 3D0QA 1N6KA 5C18A 3G17A 3AB7A 4X8OA 4BC0A 3VU9A 1I5OA 2ZITA 4YGYA 4DLSA 1EXNA 1R0WA 2WD9A 3ZCUA 1BVYF 3C2QA 1J9GA 2VXOA 1SIWA 4OX9B 3CH6A 4PW0A 2PUWA 1RQ7A 3KAPA 4XOIA 1I2DA 2FEOA 2HY7A 4GLBA 4DCCA 2HW8A 2IT1A 3QUTA 3SVLA 4GR9A 4LOKA 4ENVA 1AO0A 3M4XA 5TQJA 3KYCB 3K6SA 8MHTA 5AW9A 1QLJA 4R1QA 3IAHA 1PJCA 1RAGA 2FPPA 2NM0A 4FHZA 4TWZA 5LIPA 2MSWA 4F1KA 1JR6A 1QHIA 4K3VA 4KXYA 1CZOA 4BGVA 4HWSA 2XIJA 1HT2E 3DFKA 2AG0A 4EABA 1QQAA 2IXTA 2CDRA 4C7XA 3E2IA 1PGNA 1B00A 3G3EA 5BVHB 1V8OA 5EJGA 2OXFA 1QG4A 1GL7A 1WSDA 3T1NA 4F2PA 4A6PA 4I7EA 2GCIA 4QEKA 4RTOA 2PQ6A 1V0JA 2F67A 3V9PA 2F17A 4LGCA 4KRGA 5BVHA 1YB1A 3P20A 2GOYA 1YI0A 1MDFA 3FR7A 3I5MA 1MBZA 1GTMA 1T6YA 3DWIA 2J46A 5F1OA 3Q3JB 4KQWA 5A9SA 1OE0A 1CNEA 1SHTX 4WNYA 3VPHA 4LJ7A 2RGXA 3AWDA 1IUKA 2CLSA 3W3AD 2EFHB 3CHYA 1MO5A 5LP6B 1FP7A 1OIVA 2ZUFA 1MIOB 1CULC 3CF4G 4WBNB 5C5IA 3IOCA 4EATA 3COYA 2QLJA 5BW6B 4R1OA 2GEKA 4Q18A 3KTAA 5JMWA 4INAA 2ZTVA 3ND7A 4K9QA 4Z9BA 2YL2A 5AK5A 1N2EA 3EZ9A 3Q7QA 1NQTA 4MKRA 1E3EA 2PS1A 5BQ3A 1KFEB 1FX0B 2P3SA 1G20A 1A9OA 1ZC4A 2VDRB 3FYTA 5IJWA 2ONJA 3CRVA 4G6ZA 4ZYZA 5A1TA 3DEYX 2VF5X 1SVWA 4EHJA 3IXLA 2CFSA 1T5HX 2Q5CA 2ZOSA 1BEZA 4BLTA 1HEIA 2AD5A 2D1YA 2CNOA 3WIUA 4DMCA 1ISMA 2HRRA 3FZGA 4OFZA 5TQ2A 4ZICA 4GYWA 1QH8A 4OHBA 1DINA 2IDKA 2FN4A 4OJKA 1HNNA 1QUEA 2H8KA 1GA1A 1G3UA 2PTGA 4LRSB 1BS9A 2VCEA 4NONA 4BAGA 4M38A 3NS7A 2XE6A 3KHSA 3PCXA 4OQFA 3ROQA 3TSAA 3ZS9A 4B79A 3FUVA 5KSYA 3AK4A 1COWD 5EXDA 4F1JA 4RNDB 1ZL2A 4KE6A 4YAKA 4F06A 4KO3S 4NBUA 3WBFA 1GZ4A 3TLJA 4YUAA 2W6QA 1G5RA 4NENB 5EHIA 2YKGA 1TKCA 2XOKD 1Z12A 4P3OA 1M7HA 5JH7F 3T06B 4L16A 4QRHA 3A0RB 2FMTA 1OGYA 3VO9A 4ZT5A 4M0LA 3CNHA 4GZ6A 1L4EA 2Q2QA 1IBKB 4C4PA 2GPWA 2XUGA 1IY9A 1DB3A 5EXSA 3LZCA 1PFGA 4U7WA 3H9JA 4AD8A 4EW3A 3W4KA 3JY6A 2CFCA 3JQAD 4OXNA 2Q9AA 3PPWA 4N47A 3LSTA 2BM0A 1FDSA 1EZ1A 1GYRA 1BX0A 2IYUA 1I1HA 3HCWA 1VKJA 4UTOA 2E4YA 4I3FA 3FCSB 5JWHA 3OAAA 5ARCA 3RJZA 1C1DA 1W0JD 2GEJA 5B7QA 3K30A 4BJ6A 4HB2A 2B2CA 2I62A 3C6YA 3K0AA 4LS3A 3TRDA 3QU5A 1KZ6A 4MV7A 5L53A 5BMVF 4YV2A 1T43A 2IITA 1YC2A 4FEEA 4RFSA 2NT3A 5EMLA 1SBTA 4HX2A 1A5ZA 1OWOA 5CD1A 3HCDA 1Y8AA 3B1JA 3DWEX 3W2EA 1E2LA 4II2A 4ENPA 2I3BA 3PNSA 5HS4A 4HTFB 5JALA 1XYYA 1Z74A 1OZAA 2N1BA 1K88A 2A3NA 3I64A 4PYLA 3BILA 4OF4A 4Z9XA 1H93A 4CM9D 5A06A 3FVQA 3BT7A 4NBTA 4L7VA 1FQOA 2Z83A 2VDVE 1P17A 3AIKA 3P9QA 3OKFA 5JQGB 2HSWA 3O26A 4JL5A 4BZPA 3OJXA 2OV8A 2D0OB 3IAUA 3THXA 1QFYA 4HAYA 2AJLI 3G89A 4HDRA 1JWBB 1ADBA 1USKA 1M6VA 3DOEA 4CFSA 1XTSA 1RHMA 5JV5A 1JPJA 3VKWA 2VWPA 4U2CA 4OXIA 5AK0A 2XB9A 4Z9YA 1MZVA 5AKYA 3E4CA 4KDFA 2HPAA 3R3ZA 2PMWB 3JQGB 4NCXA 3UWOA 4DTIA 1XNRB 1BFKA 4N1AA 1KYXA 2I4RA 3ID6C 1JEEA 1VB5A 2HLHA 3BH0A 4OBEA 2E4ZA 3T3HA 2IYTA 2ZVPX 1TUEA 3S2FA 5IFLA 2W6OA 2Q4BA 2YNMA 3AEQA 3NIGB 1EVIA 2NUAA 4HG2A 4TLCA 2J6CA 2CJPA 4DJEC 1KBZA 2WJ6A 4PCAA 4DAOA 4Q12A 2QL5A 1NAHA 3I9KA 1T0IA 1SCAA 3IEMA 2IY7A 5KC9A 3VPGA 4LXGA 1Y6JA 4TGLA 5ER9A 4NI5A 1K66A 1ZOLA 4MIYA 3EQ8A 3V2UA 3U3MA 2W42A 1YL7A 5ES3A 1XRJA 3A2KA 1MZPA 1Q7RA 5C1DA 3SSMA 1WUJS 1Z6PA 1V1RA 2B99A 3IHWA 1GN8A 3IAS6 3TLCA 1VQ1A 2F1HA 4FI3C 5EXPA 5LD2C 5GJBA 3WAGA 1CY2A 1E3JA 1O0BA 4JHXA 2F43A 3F7MA 1EM8B 1BO6A 2I8LA 2PL9A 2R86A 1E96A 4KV7A 3UFXB 2MSKA 1FJHA 2NV2B 2YNMD 4RV5A 3W8RA 3GI1A 3RDPA 3R9XA 3WL8A 3AR3A 3QHPA 3EY4A 3L8HA 3ASUA 2WD8A 3ZE2B 2H2WA 4DBLC 3DMFA 5DSTA 3AHJA 5I7OA 2GETA 3DBRA 5FJIA 5ALZA 1UJ6A 3W5JA 2BE9A 4BFXA 4ACBA 1PV2A 2XWJI 2MT9A 3F6YA 4BNMA 1K9SA 2ISQA 1W75A 1DCMA 4DV6B 3EPHA 4FE7A 2CT8A 4IDCA 2MYUA 3ZCPA 3B2NA 5EJAA 1PV1A 3A1VA 5KDDA 3QE3A 2BRUC 3G02A 2W48A 4FCWA 5G0UA 2ONYA 4ER0A 1P7CA 5T64A 1E59A 5DHAA 4E1AA 1OI3A 4RD6A 4C5BA 1VBKA 1VSTA 2NXWA 1GSAA 4Z54A 3AG5A 1S2DA 4HH0A 1FLVA 4C7JA 2JLUA 1P74A 4AZ0B 4D4MA 1A2KC 5KCZA 1H9AA 2Y93A 3JSXA 1SCKA 4HZIA 1XDDA 3D1JA 1QF7A 1UMDB 3AC0A 3INGA 1GPLA 4PFSA 5C3MA 1VPWA 1UANA 2FVYA 3BFVA 1E1RD 4WDRA 1W46A 3R8XA 1OZHA 1Z6ZA 2BGMA 3R5XA 4QULA 4YAFA 1E3TA 2Q6LA 1Z35A 4DLWA 4F1WA 1OXVA 1KA9H 1ZA2A 3GCGA 1JZQA 1CUEA 1GZ6A 2WU4A 3PKZA 4FGSA 2FWIA 4K26A 4Y6OA 4YRNA 2J41A 4E4RA 5C80A 1OH5A 2HR1A 1BWQA 3W8EA 2FR8A 1HSZA 2BDEA 3WR5A 3HSYA 4B47A 4LZZA 4CMEC 1TMKA 7AT1A 2QJFA 2AJDA 1EDZA 1FSSA 1NHGA 3P9CA 3MLEA 5IU6A 1HK7A 2C0QA 1LW6E 3DTTA 1A1SA 1HTTA 1BS2A 2OR3A 3PXBA 5AOVA 4BGEA 4IKPA 4LCBA 2J4FA 3FOEC 4B2IA 3IQDB 4TS3A 3IIMA 4HEA6 2V7QA 4JL8A 5F9MA 4GWGA 3VR6H 4EI9A 4PINA 5JLJA 1E1NA 3OIWA 3RVRA 4JL6A 1C1XB 1LS1A 1OX5A 2VP9A 3Q7SA 5CX1A 2CVHA 2GASA 3HN2A 4X7BA 3DLHA 1ZMTA 2QQ5A 3VR5D 3NNSA 3BMOB 2ZTLA 2W4MA 3TXAA 4DEYA 4WY5A 3VKVA 4ZV7A 3GLGB 4UU7A 1RXUA 4EB3A 4J0FA 1TC2A 3ZE9A 1L4KA 3LFTA 4ER7A 4NICA 1P0CA 2JA1A 3USCS 2OXEA 2XXAA 2ZYSA 3NTVA 4DLUA 4JJEA 1AY0A 2JAXA 4P7KA 1IEXA 1PJTA 3WQBA 1A77A 2G70A 2F3PA 4PSCA 3TOXA 5LR6A 2FE1A 2Y0DA 5E8JA 1IQ0A 2R4TA 4UCFA 2HSDA 3TB4A 4PRKA 2QVXX 3BOSA 4I5EA 3ADDA 3TKYA 3EEOA 2B36A 3DEHA 3QOYA 1T3HA 3PNYA 2IXGA 4QUAA 4KREA 3S0JA 1KS9A 4F97A 4NMMA 3ZE0B 2C9YA 4HL6A 2VNJA 1XHFA 2Q0XA 1JPNA 2O4CA 2ZRFA 2CLFB 3L7LA 4KN6A 1E3SA 4L9AA 3A10A 4ND4A 5AHRA 5BUZA 1KEKA 2DBYA 4YJFA 3F6CA 3FLMA 5ALOA 1CWUA 2HXSA 3B60A 2Q46A 2NV0A 5AVVA 3KYIB 3AHEA 3N2EA 2GDJA 1ISFA 4TS4A 5MFZA 4LVNA 1OWNA 1XV5A 3LBAA 2VSNA 4ZT2A 3BRWA 3LBNA 2JLCA 1JVNA 2XF8A 3BEOA 1LI7A 5EERA 2DT5A 1KRHA 3V4VB 2LW7A 1Z7EA 3A14A 3GRVA 3S4YA 1Z15A 4J1QA 4QE3A 1OFHA 1CR1A 1PRYA 2GCOB 5JG7A 2JHGA 4QJ3A 2Y1FA 4JAVC 4ZYXA 2Z04A 2HZ7A 2DUJA 4QOHA 3E18A 4J03A 5SZIA 4CM6A 1ZS9A 5G1PA 1R4MB 1M8KA 1RKBA 2ZANA 1HQKA 3P4UA 4GICA 1LDYA 3SSNA 1QHHB 3FCAA 5AJXA 1ULZA 1UIRA 3HXQA 3SS9X 1QH1A 1JWAB 3EDCA 3NKFA 2UV8A 3L2OB 3O0DA 3OC0A 2V5UA 4UUOA 4V0ME 4G0ZA 3ZU3A 1K2VN 1U1CA 5DKFA 4DV7B 3Q72A 4RK0A 4CCWA 2DOKA 2I6XA 1H42A 2I6FA 2WHYA 3L7YA 5JANA 1JT9A 1KOJA 2DWQA 2IUTA 2JATA 2UVPB 3QNMA 3VYSB 1GU1A 1SC6A 2WKSA 4LZNA 3DZKA 1EMDA 4E1BA 4G5SA 5ECGC 1MOQA 3DKRA 3KXKA 3GT0A 1HBJA 2JDIA 3AONB 1V16B 1ZY2A 3Q9LA 3RIYA 4GL4A 5CDTA 1VB3A 4XJTA 1KI4A 4NZZA 1FDOA 3A6LA 1VPTA 4JBYA 2BH9A 2RFLA 1Z6AA 2WJHA 2WG0A 2ZCVA 3GCWA 4JIMA 1WTCA 2Q50A 2OA0A 3LUGA 5L3RA 4KE8A 1DKRA 4IEFB 1ZW6A 4UOQA 4D9KA 4DLPA 1JIJA 3KBOA 2H7CA 1XEXA 4IINA 1S3GA 2WTEA 4RK4A 4HQ0A 2XUKA 1JR4A 1OV4A 2VA9A 3OI7A 2JIRA 4AURA 3U1BA 3MTDA 1ULAA 1ZH0A 2BP7A 3TS1A 1I7NA 2RCNA 3IFSA 3KT0A 4LC9A 3V8RA 4MIEA 2VT2A 2IYSA 1VHJA 2MWMA 3Q8WA 3R0JA 3LIPA 3UMSA 2Y1XA 1FXWF 1VI2A 3AIIA 1KSFX 3AM4A 3FGOA 5HIJA 3QKSA 4WBNA 4R8KA 3LC7O 4LISA 4RETA 4AY3A 3OOHA 5L45A 3RIHA 3IP7A 2HLNA 2JFNA 3GD7A 4XAQA 1NLUA 4L4XA 2I4OA 3OPNA 5DXFA 3SJ7A 4C9BA 4DIDA 1WBBA 6CHYA 4CEIB 3IE0A 3M1IA 4G56A 1KDYA 1GL9B 3ZWYA 5DYIA 1YQDA 1VCHA 2D1RA 4FS3A 5ALSA 3ZDRA 5JARA 1JDNA 4GE3A 1IWBB 1BYIA 1GTG1 4DILA 3R0QA 4MWBA 2JRLA 4DV5B 1J23A 2JK0A 1LLQA 3MAGA 5KSOA 3NG1A 2HCFA 4M1MA 4IOKA 2HO5A 2C2OA 1MH9A 3K31A 3EBPA 3IP5A 4KCGA 3TSOA 3BWXA 4KMOA 4KKXB 3ZK8A 4E2XA 2PQ0A 4HXFB 1MT3A 4GD3Q 3FCOA 4F91B 1V47A 3NTUA 2N46A 4UBIA 1UWLA 1JFFB 2EJVA 4DA4A 2X13A 4OLFA 1JIKA 1SXJA 4CF7A 1FDTA 4RM2A 4LJRA 3KD2A 2XUOA 1WQ3A 2Y77A 3E22B 4PLZA 5CCEA 1X8KA 1ULSA 2WWGA 4FHDA 2GVZC 3F1LA 4J2HA 4MB0A 4RX1A 3IQFA 4ILKA 5J2UB 2I3GA 3UWDA 1XMXA 1IJEA 1GGJA 4DM4A 5CITA 5KNLA 1V8BA 3Q3EA 1Z5VA 1YS7A 4URYR 1RPTA 1JUDA 1ZI9A 2LIVA 1YZYA 4WXEA 5CYOA 5SY4A 1OZGA 4DWOA 4QUIA 4E94A 4X54A 2I7VA 3MJRA 1RE1A 2OBBA 3UMYA 5A0FA 3H75A 1JLKA 3H9UA 2I99A 3QMPA 3KAJA 4HGPA 2EW8A 3JYNA 3NGMA 4P4TA 3G5TA 1L1QA 4NS1A 3OQHA 1SCBA 1XTQA 1TYDE 5JASA 2J3KA 4MLZA 3MWFA 1TA0A 4RFLA 5AW5A 4D8WA 4AKTA 1E3DA 5EP1A 4EB0A 1ZMRA 3QIAA 1X2EA 1YKSA 5TGDA 1E4VA 2XT6A 4QATA 4B2LA 1XWWA 1XTZA 3IT3A 4C43A 3K71B 4KXLA 3VR6D 2LCIA 2AZ4A 4O4JB 4JC8A 1CQJB 3GLHE 5H82A 3A6ZA 1JKJA 1WLSA 3HJCA 3IQIX 1RLJA 2WSIA 4M8NE 2VYQA 2C4VA 2FZWA 4Z0TA 1K5HA 4RH1A 3Q5GA 3ZHBA 3FZNA 1KKMA 1XWIA 5D6NA 2Q3DA 1VG8A 3WMFA 5H80A 4RZ3A 5CFPA 4X1KA 4DLKA 3QA3E 1SUIA 1WB6A 4DM3A 2J8ZA 4IVPA 2UVPA 4UHHA 2XI4A 2AOXA 1EVJA 1H2AS 4G5OA 4GC5A 4QU5A 4EGFA 3TSWA 3T3OA 1UAYA 3FRIA 5TGZA 1B6GA 2OZVA 3NDIA 2QRLA 4AJHA 1X1EA 2PKQP 3JTEA 5AJWA 2JBHA 1Z8NA 4GWKA 3JQAA 4WVFA 2GF9A 1EUDA 2P5TB 2VEDA 3ZV6A 4YAWA 5JRJA 5FIUA 4MMZB 2C4TA 3SC4A 1WL8A 1C9YA 1E69A 3PQCA 1IC6A 2O2XA 1RC8A 2WJPA 3T5BA 2VTKA 2VPXA 1TCVA 5TVGA 4OBXA 2QGFA 4DG9A 1YQEA 4YRDA 1FP6A 1OX6A 1M2EA 3GFSA 1ACMA 4JVOA 2RARA 4G5RA 4PBTA 4BAUA 4FYKA 5DI9A 4ZMSA 3NCHA 3H6GA 3SE0A 2C9OA 1T9DA 1UFRA 1I3OA 1X1RA 4HDCA 2OBNA 2FN7A 1CRPA 3LVFO 4MVJM 4ALMA 1N2XA 3PGMA 5H4GA 1RLIA 5DNYB 1BEEA 4D45A 2VF8A 1QVAA 1SO8A 3HJUA 5HOEA 2WMDA 3BGWA 3TLXA 4FCVA 1L0BA 4EPRA 1XDZA 4RPHA 1QVVA 1XU9A 2Z5GA 4MUGA 4TWAA 3SOPA 3V4SA 1T2CA 4RSGA 3ICPA 4G0NA 1FFAA 1V6SA 2W00A 3W79A 2P62A 4I4LA 2FW0A 1TTQB 1H4QA 1LZKA 2I03A 1U0HC 4M0KA 2PRZA 2Z1NA 2IE0A 5GJWC 3RVPA 3TSYA 1BD3A 2DHRA 4Y6QA 4R9VA 2NUPB 1V7PC 4KO1S 2PT7A 4QOEA 3LLSA 2L17A 4BMNA 3PQ8A 3STUA 5BYAA 1SVMA 2ZJ4A 1L5LA 2IQ5A 2GF0A 3C6KA 4BO2A 2F90A 1K7EB 2FZLA 2QLBA 1F5SA 2ZIFA 1GY8A 3AF6A 1FK8A 5DGXA 3RJMA 2YDXA 4PICA 3NEPX 4ZT6A 3ZDXB 1IVYA 3W05A 2GBCA 2W0SA 3FPGA 3W8FA 3MERA 3WP0A 4IILA 1MU0A 4CG3A 1VTKA 2BFPA 1Z4OA 3KB8A 3T94A 1A9ZA 3PICA 2OD9A 4MVYA 5KPJA 5KOYA 3I92A 1U2QA 2B34A 2IUEA 5AKEA 4ZT7A 5AVQA 2O59A 4TKUA 1OILA 1CRLA 3BH7A 3KCNA 4KJZA 1XJ0A 4YR7A 4M99A 4NK4A 2Q6VA 4UXIA 4E08A 5K05A 3OZRA 3IUBA 1UBOS 2CB0A 4DXAA 3P9NA 3E2MA 4JWKA 3FNGA 2H2HA 1A4RA 4S1PA 1ZG3A 3BC1A 4L6IA 3MWLA 1MENA 1SBZA 2XLBA 3V4FA 4KR7A 2AEFA 3AR7A 4JH0A 2AXQA 2BISA 3I9OA 2YQ5A 3TSCA 1QIFA 2HSZA 2Q45A 4CLXA 4XCXA 2H9AA 2LZ0A 2QL9A 4EEKA 2PWBA 1NVTA 2DWCA 1Q15A 2DPLA 5GZ6A 3W3AH 3QWIA 4GYKA 3D8RA 3AYXB 4IY1A 3NM6B 5LCXA 1QYVA 2D00A 3R24A 1LSUA 3N75A 4BS9A 3V8QA 1Z37A 1GKKA 3ZS8A 3SJAA 3RSOA 3K0SA 2CXXA 2NTYC 2W6IA 4K0RA 1AQJA 1DCTA 1OGIA 3PKJA 3K5IA 3KEQA 3EIOA 5HKAA 3D5EA 2FCAA 1MAUA 1C50A 2JFGA 2W6PA 3TIIA 3WDLA 1KSJA 4W99A 3TVTA 1JL3A 1Z16A 1JAIA 3DDWA 3EZLA 4P4UA 4XYGA 4AJ9A 1UFVA 1JJIA 3WG9A 3ZZUA 1VMKA 1WRBA 3QK7A 1WUTA 4FYHA 2PEYA 2YJZA 5CB8A 5KYGA 1UBJS 1YUNA 1P0FA 1XEWX 5DIZA 4HEA1 5PNTA 1E2IA 3TW4A 1IN7A 1USIA 1U2TA 1JG3A 1AA9A 1BCSA 3BSYA 2ZSDA 3NHPA 2QRPA 1KU6A 3OE4A 3Q87B 4YAOA 3SM9A 4AG6A 5CA1F 4EHKA 3QEKA 3VYVA 1FFWA 1T6NA 1YZHA 2JGLA 4RKYA 4XH9B 1AMUA 2GN4A 4PNPA 4Q3EA 1CS0A 5AWFC 5L3SA 4XEHA 3BICA 1P3Y1 2HCJB 2QRKA 2QXTA 4JHLA 2W2VA 4CCSA 1Y98A 2GM9A 1HE3A 4HUQA 4DARA 1CDOA 3EOAI 3QKIA 2B21A 1Z47A 2Q5QA 3CH7A 3FGNA 4LRYA 3HY4A 4KOAA 4RK1A 1JQKA 1OD6A 1QO9A 4NKRA 4L2IB 3E7DA 4AN1A 5C1BA 3TE7A 2RG1A 3D6NB 3CVXA 5JCPA 3EPLA 4U8HA 4YQYA 2GK6A 4I9NA 5C5EA 4QODA 3R3YA 1EJ6A 4MWEA 4U4AA 1R6VA 4A15A 1EESA 2HEIA 1YHYA 2LBPA 3KZ1E 4MKXA 2YVKA 4J49A 4BNDA 1XCLA 2JI7A 2P27A 1S02A 4NE9A 4AJ4A 2IUUA 4Y6RA 2HT1A 3M6LA 3LLMA 1KH2A 3ZV5A 3RV3A 1R6XA 1LQTA 4ERNA 2R7NA 1NURA 4ZREA 5JSUA 2R6FA 1X19A 4HI0E 5TQ0B 1MO3A 4ANFA 5JRZA 4UDYX 5C7IO 4JDUA 1VGQA 2QV7A 4MR9A 4YNBA 1BGWA 3WY9A 2EBFX 4I4TF 3O7WA 3ONNA 4M49A 1P62B 2KSQA 4U6NA 1UCFA 5DNDA 1NN3A 1RRVA 1YVRA 3V48A 3K9FC 4CCYB 2YASA 2ZWMA 2B6NA 1XKXA 3KYDA 5JZSA 4MVJI 3P2OA 2IPMA 2GZRA 1K7FB 2VAVA 3FKJA 1PGOA 3MYYA 1RZRD 4EHBA 3MWDB 4CGZA 3BE8A 5EZQA 2FW9A 1POXA 5KVQA 1F51E 3J81k 4IO1A 2XADA 2W58A 1DQYA 3H2BA 2JLYA 3BJEA 2D7DA 1QO0A 2VKTA 4J0DA 5AVOA 4DCGA 1P6QA 5SZKB 4X95A 5CR9A 3H18A 1BWSA 3I6ZA 1GFIA 3B38A 3TRFA 2Q1SA 1KHTA 5IMBA 4R01A 2L82A 5I7VA 1NP7A 4YFYA 5C8YA 1HX7A 3RC8A 3QWAA 1JIXA 1AS0A 1JW9B 3SJCA 2D7CA 3UCFA 1R4NA 1NF8A 5JDCA 4OB8A 3HNRA 3WBKA 3D59A 3QM1A 1KSGA 3CGWA 3F90A 3H8JA 4IDQA 1UK6A 1MEEA 3X1KA 3EVEA 1P4HA 3UGTA 4IX9A 4UHDA 3MRVA 4QYIA 4G9EA 2JAPA 2REBA 1BRTA 3UUWA 1FS6A 1UQUA 2DCMA 5JD6A 1A0OA 2VVTA 2QM7A 3LKZA 2V9PA 3PGKA 3EZYA 3OJLA 4BO7A 2NGRA 2G09A 3AH8A 3HB1A 3ACCA 2H4HA 2XXBA 2P2CA 4G63A 4QBTA 4QBKA 4Q9IA 4EDHA 1JFLA 5BUCA 2CXSA 4C0WA 2OPBA 4Q03A 4QOIA 1T1RA 1CCWA 2Y1KA 4GLOA 4KUHA 2Y1DA 3ZIUA 4RELA 1RLOA 3QEMB 3GWGA 3DMDA 4ZAWA 4TSKA 4RF2A 3WJ7A 1E98A 1GGHA 1AG9A 1FTGA 2VP3A 2VYVA 2WU1A 5CCXA 4YRSA 3FWYA 4ZRMA 2WYHA 3TLYA 5A0TA 1M6VB 4PQYA 5AXAA 1SWVA 1HI9A 1WD5A 3HBFA 1RWOA 1J22A 3KZMA 3OETA 4TTSA 3QTTA 3ESCA 3E53A 1UK9A 4XR9A 2QIOA 3EXIB 1ES9A 1N9KA 2DSNA 4Q6WA 3AINA 2J7PA 2GSDA 4BZZA 4ID3A 3SZ3A 1BMQA 3RGWS 1P2GA 1MPXA 4MITA 3T38A 2PYZA 3TEFA 2EP7A 4EY6A 4ZQGA 5FFFA 3M70A 2ZRJA 1YJXA 3NC0C 2VPPA 1YZQA 4OU5A 1FCJA 2RC5A 1HEUA 2JPDA 3EDQA 4YRJA 4NR0A 3ZWNA 1V5EA 3PQ4A 4Z4CA 3S8YA 2C1EA 1YCFA 3K3PA 4F5EA 3LK7A 2D2IA 2GN8A 3DHYA 3DOCA 2D62A 4M3NA 2R2AA 5ED0A 4TN5A 2XUJA 2VPIA 3EEBA 1DCFA 5GV8A 5L3QA 1CUYA 3E9DA 3IUNA 3AR8A 3HXKA 1PR4A 2OBFA 3DA8A 3M5CA 1U1DA 3PZBA 4II3A 3P2KA 1DBRA 4G09A 3HYTA 4WNAA 2GO1A 3KTAB 4NX2A 2P9CA 3T0GA 1OZFA 4LF9B 3LRXA 3LDHA 1DTWB 2HTEA 2XMSA 1OOEA 1WNFA 3HNPA 1WXQA 4JUCA 4ZDWA 5BURA 1MT0A 3VAYA 3T4XA 5J2TA 1ZRSA 2B1JA 2D0PB 3VVLA 4DDMA 3MIZA 3OTIA 3D8SA 2EFCB 4YQEA 5T8KA 1HL7A 1YBVA 1QP8A 1XA4A 4M1EA 4NMXB 1RS0A 4A0HA 4MO9A 2A92A 2QA5A 3LUAA 3LTNC 1JU4A 1GAXA 3P94A 3UYKA 1V4BA 1Y48E 4LF6B 3P32A 1KYIA 5A2GA 3IUMA 1AZTA 1JJFA 3D2AA 1DAMA 2VJCA 1ND5A 3OD5A 4XSGA 5C4IA 3I0MA 4N5DA 4CE6A 2R2GA 3ESDA 4KFTA 3N87A 4PM4A 4WOBA 5TS3A 5C53B 1HDZA 2AF4C 2A1UB 3IP1A 1ZGZA 2C99A 3T7EA 4GP7A 1J9ZA 2GEBA 3G5MA 3G7NA 1VCOA 4B73A 4YRZA 3L7CA 4D9GA 1OKKA 2WW8A 1QAMA 4QWWA 4PC2A 4B3HA 3R2JA 4WE3A 3VZSA 1RRFA 3MFYA 1KEWA 1LPAB 3W9SA 2RGUA 1JLRA 1ZUD1 2JGKA 4ETMA 1Q83A 3B36A 1CQIA 2FF5A 1E7MA 1R0XA 3UV7A 3KTFA 3QVTA 3GEBA 4HQOA 1IDOA 3AXTA 4JUBA 4MI9A 5AOAA 1ZESA 5T4EA 3WOVA 2IW1A 3FHTA 1NYRA 1LKZA 1UFOA 3RWOA 3QQPA 2ZAIA 4MUYA 4CKEA 3AEXA 1SKBA 4QOJA 4X90A 1W9MA 2IEZA 1E1QA 4DCVA 5D5HA 3V8PA 2IA5A 2G1KA 2IU3A 4DLNA 4JKOA 3N0WA 2CD7A 2HUPA 4KIGA 3G0GA 3ZZ1A 4JSRA 2HAEA 1NNSA 1MMFB 3WYFA 2J9RA 1QP7A 4ND8A 4BMXA 1SQ6A 1B93A 3W9YA 3NTLA 2ZE5A 4D96A 1Y63A 2H1FA 3B70A 3RE1A 3RSGA 1YDWA 4J0JA 5T7BA 1OH8A 3CF0A 2IU6A 3BG5A 1O4WA 1J2UA 1RXIA 4G3XA 5HEKA 4QAQA 4AL4A 4XUGB 1II0A 4J16C 1VCNA 4OM8A 4B3TB 2NZUG 1KO1A 3FE2A 1C7EA 4QRDA 4R51A 4E5UA 2QRNA 2XYQA 2P69A 1GUDA 1HFJA 4FVTA 3QEAZ 5FYDA 4HGQA 1U0GA 1RZUA 3ES9A 4GFDA 2I8CA 3OVMA 5JS1A 5BN4A 2PWAA 3VR3D 5FNVA 3BFPA 1EM6A 3QTBA 4NFLA 4YWHA 4C87A 2XITA 3E9YA 3L1IA 5LQRA 3EE6A 4BYMA 4DV1B 1QXSA 4PYIA 4Y0AA 2OBMA 2YICA 4Q9JA 4AJ1A 3EPRA 4CMGA 1KERA 3JWEA 2AUNA 5TPZD 3DVQX 4Z0NA 4IZOA 3ZY3A 4JB8A 2GNOA 3O2JA 3EDYA 4X64B 5KVCA 3FM9A 1NM5C 1IPFA 2C2YA 3IPRA 5M3BA 4TROA 5FA5A 2DLDA 2O2YA 1SD2A 3L8MA 4PIMA 1P31A 1P4JA 3TMKA 4RD2A 1Z6QA 3C4VA 4E5SA 1T0BA 1PHRA 3ESRA 1MIHA 3QWFA 1VG1A 1WDLA 3P0JA 1N3LA 4YJ3F 4OJYA 1T0UA 2G07A 2X15A 4J1TC 5AI9A 4TRMA 4I4TB 4D4HA 2FZEA 3O8OA 3CR8A 3RYIB 5C1OA 2D0IA 5ALKA 4JOBA 2HSGA 3TW0A 2WDPA 4KSYA 1PF7E 1ZKDA 4EB8A 1L7EA 4HQLA 1QIMA 1NVXQ 3WKCA 5JUWA 4HS4A 3IIKA 1XYVA 4CUKA 4JLOA 5DHUA 4CBVA 3G8DA 3I34X 4JYBA 4WOCA 4X71A 3TQCA 3THSA 1XKTA 2QJWA 5JW6A 1OPRA 1GRNA 4I1UA 3HXPA 4MVJA 2OD2A 2P1RA 2R3SA 2QJOA 1GQRA 5AVYA 3KDSE 1FLNA 2KLBA 3AUXA 4KXNA 1SVIA 4YJHB 4CM7A 5HF5A 2ZU6A 3DBHA 1F6WA 2HCRA 5B37A 4P54A 2BFAA 4RTLA 5I7SA 3N86A 2V3WA 4WW0A 3DFZA 1SZDA 4KDRA 3LWDA 1RKUA 2QAGB 1G2IA 2XEXA 2JA2A 1A82A 2HF8A 2P41A 4BVKA 4BQIA 2P79A 1TUBB 2QPTA 2RHLA 2BOVA 2WIAA 3KALA 3KFLA 4XFDA 1T2FA 1NQXA 4Q82A 3SXJA 2JGIA 3HLYA 4BLUA 1GQOA 3ZGYA 1JYSA 5B2ZA 2JIBA 1P7ZA 1SJ9A 4RK7A 3F5FA 1KP2A 1D1PA 3A4MA 3UF0A 3FY4A 1PEYA 2OCAA 4LCEA 4N8DA 1J2JA 1C8KA 1E6LA 4R8VA