4DXAA

Co-crystal structure of rap1 in complex with krit1
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
168
structure length
168
Chain Sequence
SMREYKLVVLGSVGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Rap-1b
publication title Structural Basis for Small G Protein Effector Interaction of Ras-related Protein 1 (Rap1) and Adaptor Protein Krev Interaction Trapped 1 (KRIT1).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 55
structure length 168
sequence length 168
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2012-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dxaA00
5HZKA 3KZ1E 4HB0A 3BH6A 4PC3A 4OI1A 1S4QA 1G7TA 3BGWA 5BQ5A 3T1VA 2ZU6A 1IM2A 1WRBA 3I4LA 4HLUA 2GCOA 3RVBA 2Q3MA 3P27A 1CRPA 3NHBA 2WIAA 4A0HA 3BFKA 1TNDA 2ZU0C 3GLHA 3JZAA 3EZ9A 4CEJB 4DB2A 2OZEA 1KI1A 1BS1A 4EFNA 1B23P 4LV6A 4IJMA 3AP3A 5FL7D 4QHYA 4MQBA 4ZDJA 2VHTA 2ZRAA 4HLDA 1GL9B 4PO8A 3X1XA 2OFOA 3SQWA 2HJVA 3OAAA 3ZVRA 1WDTA 2BBOA 2WWIA 5JEEA 3K0SA 1LFDB 1EFRA 5GJVC 3EC2A 1DEKA 4XTRA 4RCZA 3GLHE 2PLFA 221PA 3GJXC 4B3CA 2NO7A 1E2JA 2ZQ5A 3IQWA 4HAVA 3RRZA 1ZU4A 2DWQA 1XJQA 3BXZA 1YE8A 4TSFD 4E22A 5C46F 1P2TA 2EYUA 4XWKA 1R4AA 1YVDA 2X77A 3GEIA 5H68A 2CK3D 1GNQA 4A2QA 4Q1BA 2B92A 3THYB 5DGXA 2P0EA 3UWOA 1AKEA 2J1LA 3T35A 4HAWA 4Z1MD 4M9QA 2IBMA 1U9IC 3N2IA 2P5TB 2PL3A 4UKDA 4DUGD 5LB2A 3LLMA 4GOXA 1QVRA 1JECA 4AK9A 1XJCA 2AKAB 4ZCMA 2QP4A 5LB4A 1N0VC 2RMKA 4JVNA 2FFBA 3CO5A 1I4DD 4OBEA 4Q00A 1XMSA 1CR2A 3WMGA 2XSZA 2ZXUA 4MKIA 4TT3D 3AVYA 3PV0A 1NN0A 1E2QA 2YV5A 2O0KA 3NBXX 4HDCA 5FI1B 1SVIA 3GLIA 1K6MA 4YMWA 5FH9A 4DRZA 1NL3A 2EFGA 3B13B 4KVGA 2OEPA 1VG8A 1VHLA 5J4HA 2GVZC 5JCPA 1GSIA 1A5TA 4JSTA 5BYKA 4FCVA 3P4YA 4LC1A 2RAPA 2K5UA 4EJSA 1DAHA 1XPOA 1HEIA 5C1BA 1YHNA 1G4UR 4JIMA 3GLIE 2AX4A 4HAXA 1FQKA 4FW9A 3FTQA 4KU4A 3RS7A 5JRJA 1G5RA 1XRJA 2IW3A 4LDJA 5EE1A 3L0PA 3EC1A 1AGPA 2VP5A 3JVVA 3TSZA 4F91B 3UATA 4QFMA 4EQ6B 2FE4A 1FP6A 4D80A 4Q02A 1ZNXA 3TQFA 1G3UA 4UJ3A 1EFTA 4TQUS 3X1YA 1OW3B 1U2RA 2QGNA 3U3RA 1Q12A 3U3OA 3H1TA 2KE5A 3KFXA 3AGPA 4LRWA 2CLCX 4NCNA 3K9GA 4Q1DA 4ZIRA 4DLVA 1VCNA 3TK1A 2IUTA 4RZ3A 1ZU5A 2CLDX 4TWZA 3FMFA 4QOSA 1NI3A 2BJWA 3LAWA 4JVLA 821PA 4DLRA 3WHLA 1NMYA 3BC1A 3IDQA 4LV8B 2GETA 1XCMA 1AIPA 3KX2A 3EIEA 2ZRFA 4PPGA 1KNXA 4BZXA 2BIFA 3DOEA 2CNWA 1U8ZA 2FH5B 3GJ6A 1ZIPA 1Q20A 2FPMA 4M1WA 1D9ZA 1I4LD 1E2HA 3ZS8A 3THXA 2DYKA 3CX7A 1E2KA 2ZAMA 4D0NA 4DLWA 2Y8EA 1U8YA 3U7GA 3HU3A 3LLUA 4PSVA 1OKKD 3AGQA 4Z54A 3CF0A 2IYRA 1D2NA 3QNUA 1OIXA 3ETLA 3BH7A 2GBLA 5TDHA 1KY2A 1QHHA 2GDJA 2IYLD 4Q48A 3U4QA 1Z5ZA 3I5XA 5D3QA 4PPFA 3I8XA 3EX7C 1UJ2A 2GEDA 421PA 1NKSA 4FCWA 3X1WA 5F2EA 2WZQA 3OIUA 4NKRA 5FUVA 4F7WA 4C30A 2BJVA 4A15A 4DCVA 3D3QA 4CEIA 2MSEB 2OHFA 4NBSA 1JB1A 2Q21A 1P61B 5B57C 4A9AA 1E2PA 1KSHA 2ZE6A 2HLDA 1E99A 1N6LA 4IVRA 5EP1A 2RGCA 3K70B 4QGAA 2BM0A 4HAUA 1YZKA 1Z0AA 5E7MA 5JCZA 5G41A 4LOAA 4V0KA 1N3BA 1RJ9B 3WBJA 1U8AA 4UXJA 4IVPA 2V9PA 2F3TA 2GVDC 4WVFA 4JBWA 2D2EA 3CH4B 4EPXA 4NE2A 2J0QA 3CF2A 3W8RA 5FOUA 1S3GA 2HCJB 1E69A 1L2TA 3KFVA 5EQTA 2X19A 4QNMA 4URVR 5J47A 2IUUA 2QMUA 1T0HB 3HR8A 2ZRHA 2ZYUX 5FL7A 3TUIC 1E2GA 4M1KA 1YZNA 4RD0A 4EPWA 4M1MA 3UANA 4A2PA 2J0VA 2OSBA 2P65A 3KJHA 2R2AA 3SQXA 2OILA 3TLXA 3QSYA 1OH7A 1UPTA 3ZJYA 1WP9A 2I3BA 2ZS7A 3TNFA 4EPVA 1II8A 2DWOA 3QPWA 2DHRA 4GPTA 1D6JA 1GAJA 2QTVB 4P3YA 5FTNA 3A1SA 3MRSA 2BM1A 5CB8A 1NIJA 3GJ0A 3KXIA 4TQAA 4JL5A 1P4SA 2OFWA 1EFHA 1OYYA 1ZNYA 3FHCB 3NEYA 4YMSA 4G3XA 1OPXA 3A4MA 2P3SA 2ZSBA 3EIQA 2JLQA 3OIWA 4IEIA 4O0MA 4HB4A 2CJWB 4Z1MA 1LB1B 2PMKA 4NP6A 2WWGA 3IBYA 3G0HA 3PENA 3QOFA 4DUGA 1XD8A 1W46A 2OXRA 4F4JA 1T4GA 3AB3A 3OFND 1VYUA 4DJTA 2F3RA 5JECA 2CE7A 4M1SA 2YJTD 1K5GA 1KMHA 3MFYA 3UKDA 4B3GA 4R9UC 4BFYA 2VP4A 4TT3A 2GF9A 4WIAA 1P5ZB 4BQSA 3MAAC 1P72A 3RHFA 3P26A 3SC3A 3ZLJA 1KNQA 1W2GA 3SN6A 4Q4AA 2J87A 2WICA 1N5KA 3GJ5A 3T12A 5AUOB 4RJLA 3ECCA 4XSGA 5FBQB 2IXGA 4NPHA 3A58B 3QKUA 4TLBA 3NC1C 4O2LA 4QXAA 1HTWA 1ZC3A 2CMKA 3KJIA 4B3XA 4Z8YA 4KV9A 1E0SA 2FZ4A 2JEOA 3FOZA 3W8NA 4D0GA 1L4UA 2CDNA 1KKLA 2H18A 2PEYA 2R6FA 3WNBA 3V4FA 3PUVA 2ZUDA 4ITRC 4I99A 4HZUA 4YC7A 3WNCA 1SVLA 4G0NA 2MMCA 3IIKA 4AWXA 3RS2A 1G6OA 5C4GB 3AH8A 3WYFA 3U3JA 2V1XA 3NBYC 1R2QA 5CIQA 5JS8A 2QBYA 3MLEA 4NYIQ 1AZTA 5EE3A 2ZR9A 1SKYE 4LWZA 3CWZA 2NMVA 2G1KA 3EWSA 3RSLA 3HU2A 1DAEA 3SFVA 4UJ5A 1FNMA 4TZ0A 2QTHA 1KI2A 4C4PA 3OEHD 3AUXA 2HXYA 2BBSA 1Z06A 3AVOA 4C7OB 2ZI5A 4LYJA 5FTJA 3CPJB 4PPQA 2FZLA 4TYQA 5DO9A 4YONB 1A1VA 5M04A 3M1IA 1XDBA 1W36D 3KJEA 1XZQA 2BEJA 1E9CA 2NG1A 2ANBA 2JJ2D 2G0TA 1NVVQ 5IHPA 2C78A 4C0JA 4LHVA 2YWEA 3B1WA 2TMKA 2QSYA 4X8MA 3QPUA 4WOPA 1KO8A 4EUNA 4JYBA 1VYTA 5FBWB 2ZRDA 3VU9A 3B8HA 2UZ3A 2IYYA 4B2LA 2VF8A 1R0WA 4LJAA 5EP3A 3RLFA 5KNBA 1CLUA 2IYZA 2GJ9A 4OQXA 1SXJD 2ZIAA 4I1OA 2QAGC 3W5IA 4KODA 1UKYA 3O8BA 5L3QA 3ND8A 3MMPA 3PVSA 1KYIA 2HJGA 1N5IA 1W44A 3A4NA 4PXAA 1ZMXA 2FU5C 1GFIA 4HDQB 3CWQA 3AEZA 4KYIB 2YOGA 4Q7MB 3L8ZA 2IXEA 5JSZA 2ODWA 3W5JA 4MKHA 2DB3A 1XPRA 1ZM4A 1CJTC 1T8UA 3K53A 1MO3A 3A1VA 3SJZA 3LV8A 1U90A 4U7DA 4A8JC 3ICEA 1TQ6A 4U00A 2ZSFA 3VKHA 1N6HA 2F43B 3L0SA 1YRBA 5KO2A 3L0IB 1Z0JA 2FSHA 3RC3A 1S0UA 2AFHE 2I1VB 2IL1A 1DAFA 1VKJA 3PEUA 5TB5A 1TMKA 1T9HA 4JBYA 5DI3B 2GA8A 4OKSA 2RB4A 2FJUA 1XTSA 3PITA 4DDUA 2BKEA 2YWFA 4URXR 5IK2D 1JR6A 1NG9A 3TR0A 1OH5A 1SVWA 4A8JB 1TQDA 1P9WA 2C95A 2QQ0A 4BASA 1C9KA 1COWD 4DEYA 3U60B 5CK5A 2IHYA 4LC0A 2ORWA 1S8FA 2WBLC 4QBGB 1YU9A 5FL3A 4G5SA 5AJYA 1E3MA 4TLDA 4MUBA 4AD8A 4ASUD 5FUYA 2DWPA 1KAGA 1Z0IA 1A2KC 3UMRA 1JXOA 1ZD9A 1AKYA 1NBMA 1QDEA 4LI0A 1Q1ZA 2B6HA 2JLWA 3OEED 4LHZA 3VAAA 1ETUA 4KBFA 1NY5A 3ZIAA 3AVQA 1LS6A 3QEOA 4KLNA 4POAA 4HAYA 1RFLA 1RRPA 4I4LA 3LA6A 2V4ZA 1MOZA 4MGZR 3RABA 1NNEA 3WRXC 2XXAA 1SHKA 1XD2A 2ZI6A 1A82A 1W2HA 1NBME 2ZJ2A 4RD3A 5H1YA 2HXSA 3SBDA 3Q9LA 2GXUA 1OXXK 2E1RA 4B33A 1U0HC 4MYTA 3BORA 4S35A 5C4MA 3VMFA 4QGGA 1M74A 2FGKA 4RFSB 1X6VA 4P4SA 4L9SA 3OFNA 1OH6A 1JQJC 2VH5R 2NPFA 4KFSA 1IN6A 3SYKA 5AUPB 3QKSB 3W6PA 3C8UA 2VYFA 4TMKA 1KSJA 3KDSE 5E7IA 5LD2C 2J45A 3BERA 3A4LA 3B60A 1RPZA 2H5EA 5GVRA 1NF3A 1EFRD 3KQKA 3EWAA 4X8LA 2NZ8A 5K8TA 1ZP6A 2WSMA 1ZD1A 1DE0A 3E70C 3EPHA 1P6XA 1EXMA 3I3SR 5KDLA 1UKVY 2BCGY 2CVHA 1MRNA 1TF2A 1T5IA 2WJYA 3D8BA 4NYMQ 1II0A 2D3WA 1S2MA 2PLRA 1RRFA 2F9LA 5A0FA 3QY0A 5LD2B 3GJ4A 3BK7A 4TTPA 5E95A 1Q1BA 3AF3A 5EJEA 1ZNWA 1KO5A 2GK7A 3VR5A 3DM5A 2ONKA 4KJZA 4OQFA 4DCNA 1Z07A 1MKYA 3CB4A 2FEOA 4LJ4A 3KQNA 3QBTA 1GRRA 2CEAA 5FPKA 5SZJA 4LCBA 1NG1A 4W7SA 2ZSEA 2C8VA 2AXPA 2WSSA 3IPYA 3W3AA 1H8ED 1XMVA 1ZYUA 2GJKA 4QJ5A 1YR7A 1UDWA 4UNQA 2GJAA 1TAGA 1US8A 3OEHA 5ANRB 3ZGXA 3M0EA 1KI8A 2OM2A 4XH9B 5FTMA 4BFVA 3DDCA 3JVUA 2IUSA 1P2VA 3A37A 4BGDA 1LV7A 2AHOA 1PV4A 4DLUA 3TJZA 3KKNA 4Q9HA 1OF1A 4KSCA 2ANCA 2DFNA 3FE2A 4DT1A 3RYTC 4BLTA 4D25A 2P6UA 1SVKA 2R6AA 3TKLA 3HPQA 4TMWA 3FPAA 1K8RA 4IFBA 4Q4HB 1XEXA 2O8FA 4B3FX 1CR4A 2JJ2A 2KBFA 1KDOA 4LBYA 4JLOA 1OFIA 2A2ZA 3LFUA 4ZV4A 4IDHA 4MDFA 1R0ZA 5J5CA 3R9XA 2JLYA 1G1MA 2GZAA 1MABB 3CRRA 4BWYA 2D7CA 2LKCA 3B6EA 1M7BA 2NGRA 2F6RA 2IF0A 3RS0A 2VTKA 5KUTA 1VECA 2VO1A 1CEEA 5CB6A 2J7PA 5DSZA 1G3IA 1OE0A 4RD6A 4GSYA 2XNDD 3LH5A 4B3BA 3D31A 2Z5FA 1R5OA 4ARZA 3K9HA 1IY0A 1AS2A 1NN3A 2YYZA 3KJGA 1LTQA 2G1JA 4BEJA 1P60A 2DPXA 4B76A 1YR9A 2QNRA 2DFLA 1OXUA 3W90A 2W58A 3IPXA 4AKHA 2HEIA 2YNMA 4NL4H 2C9CA 4WZAE 4CEJA 3I61A 1M34E 2ZRCA 5KOYA 3B7GA 4E5UA 4LUCA 3O8DA 5KSOA 2VEDA 3DKVA 4QC2A 2D7DA 1GKIA 2CNWD 1QHIA 4KO8A 4X8OA 2A30A 3KQLA 1XD9A 5AWFC 1N6PA 4C0SA 3CRMA 1FQJA 5DNYB 4OHXA 1JI0A 1RW4A 1UAAA 4DIEA 2PT5A 4PHGA 4W5WA 3U2QA 3QJYA 4KHZA 4AYXA 5TVKA 2PZFA 3SJCA 1JEDA 4MKGA 1W0KD 3KB2A 2GF0A 5IK2A 5CLLA 1CS4C 5FOSA 4TYNA 4FINA 4EPTA 4JKIA 3FB4A 4GP6A 4Y0VA 3SBEA 1DELA 3THWB 4DZZA 4YDSA 5TXGA 3T06B 4UNRA 3THYA 1COWA 1Z0FA 2HCBA 3BFXA 3CR7A 3MGCA 2QEQA 2WKRA 3PG5A 4GNKA 4K46A 1FMJA 4TMZA 5CLQA 1F60A 1GILA 4URUR 3WYAA 5GJBA 4TYWA 3EAQA 4L4UA 2QPOA 2VHJA 2HYIC 4CYMA 4Q9IA 2IEZA 2I1QA 3Q8XB 3PUYA 3SE0A 3MG9A 4WBSA 4CDGA 1BYIA 1U0JA 2IYVA 5F9HA 3KKQA 2FPLA 1E4VA 1EX6A 3AVVA 1J7KA 4M1TA 2W83A 4IOKA 4TQ9A 3LO5A 3WY9A 3CR8A 5IRCD 2HUPA 2VHQA 1O87A 1U9IA 3TE6A 2BKUA 5JJKA 3U44B 2XEXA 4OI0A 2YOHA 3TQCA 3I8SA 2W6JD 3OESA 3IEUA 4DDWA 1CJUC 3EPLA 1TPZA 3DZDA 3THOA 1MV5A 2J3EA 3OIVA 2IS4A 1XNJA 2B8TA 3NEJA 2XGJA 4NYJR 1S9HA 1Q1QA 4G5QA 4EPRA 3QKRB 2AK2A 1BYUA 4TN1A 4OHVA 2FG5A 3QG1A 4WAUA 2QENA 1R10A 4Q9LA 3BBPA 2HT6A 1KI6B 4PFSA 1N6RA 3IO5A 2OO7A 5BXQC 2XB4A 2Z43A 4EQ6A 1XTKA 3WP0A 3QEJA 1KDRA 4M9XA 4B47A 3EA5A 3AVWA 3VQTA 1SQ5A 3GPLA 2ZRGA 3FGNA 1T3SA 3PQCA 2EFHB 5EE5B 3CW2A 3DM9B 3Q72A 1A7JA 4CW7A 4DHEA 1Z22A 2R6DA 4ZI3A 1MR3F 3BD9A 4QG7A 2H92A 1AZSC 1ELOA 2WWFA 1E1RD 5B30A 1KDPA 2HV8A 5KDDA 3N5CA 2VIIA 1G9XA 4DSTA 2FFAA 2C9YA 3CUEF 3LRPA 1UBFA 5L3RA 3UG7A 4O2RA 4BRWA 4DLTA 3RC8A 3BRWD 5FTKA 2IS2A 2FA9A 5LPNA 2RGBA 3GFPA 2GEUA 1H8EA 4M21A 4HUTA 1W1WA 5GADl 2VPPA 2GILA 3EZ7A 3R8CA 1Z6GA 2OBNA 4H1UA 3EXAA 5H8WA 1OFUX 4LZZA 1N2CE 1NP6A 4D26A 2IK8A 2IYTA 3I62A 1DBSA 2ZJYA 3FFBA 4BFWA 3ZH9B 3L2OB 4Q03A 1JQLB 4YMUA 4OK5A 3QE0A 1UFQA 1YJ5A 4PPNA 1F2UB 2CBZA 1CP2A 3LBNA 2P6NA 2QAJA 3GJ3A 1W4BA 2JATA 1RRGA 4A1FA 3K0FB 1BIFA 2YKGA 2ZR0A 1Z2CA 4R2HA 3V00A 4BPBA 1G5TA 3Q5EA 3VR4A 5JI2E 3NG1A 4ZDWA 4AKEA 1OXVA 3E5HA 4A6XA 4NTZA 4EDHA 1NVUQ 3NDBB 2IS1A 4G1UC 2IWRA 4B3DA 1FZQA 2JJ1A 2F1JA 2XZOA 2GAOA 2XNDA 4JLBA 4YMTA 1W4CA 3ZD7A 2H8KA 4AYWA 5D3MB 3AF4A 2VSFA 1WCV1 1G19A 1ESMA 4CEHA 4LSGA 3JZMA 3SJAA 1G291 4TZ6A 2PZGA 2QSZA 2BMEA 3R7WB 5FOWA 5EE0A 2YWHA 4B43A 3FWYA 2WOOA 3J81k 1GUAA 5DYIA 1TUIA 4NONA 1E2LA 1E0JA 2QT0A 4BZPA 2ATVA 4JKYA 4FIDA 3AVTA 4U02A 3WRYC 4LBVA 1HUQA 2EWWA 1JJVA 5KSYA 1AS3A 1ZUNB 2DCUA 2KI5A 2V1UA 1XXHA 4HLQB 1M7GA 4K81B 3KTAB 1BMFD 1W0JA 5UKDA 1KY3A 1W5TA 1CR0A 1Z6XA 1G8YA 4GBMA 4HLCA 2OG2A 2ODEA 1JEEA 3DOFA 2WMNB 2HDNB 1W0KA 2O5VA 3A1WA 1DAGA 1TEVA 2IYSA 1G7RA 1CJKC 1ZW6A 1J8YF 2GHIA 2QZ4A 4RD1A 1E9EA 1XXHE 4GL2A 1CRQA 4DC9A 1P2SA 1ZIOA 1YQTA 4UNNA 2DR3A 5J4KA 1SVMA 2WPDD 2CJWA 3TUJC 3K70C 1VPLA 1GVNB 4RKEA 4OI4A 2XOKD 4IRUB 4DDVA 4FXPA 2NZJA 4BFXA 4HAZA 2VRWA 3LX8A 1M8PA 2AFIE 2GZDA 4FN5A 1HA3A 4AC9A 2WM9B 1KZ7B 1CU1A 2ECKA 3GLIB 3KXKA 4F93B 1Z83A 5H70A 4E03A 3MWKA 4B48A 2UZIR 2JJ8A 3VR2A 2AN9A 2AWOA 4JLJA 4M9SA 2A5YB 3W3ZB 1NY6A 2QTFA 4YDHB 4BEBA 2W6JA 2BHRA 1KJWA 4UNPA 1KZGB 1E32A 3KUCA 5G3ZA 1IHUA 3W9YA 1XU4A 4ERNA 3WBKA 3SU8A 4NU0A 3CM0A 3RS5A 1HT2E 1OFTA 3K9LA 3QKTA 4MYCA 4WZ6A 5K8UA 4AYTA 1FL9A 3CONA 5FPSA 3WYGA 1QF9A 5CYPA 2QPAA 3TMKA 5K8IA 1NVWQ 3AP1A 4IDQA 4A0RA 5C2JB 4W5JA 1YR6A 3ICQB 2AD1A 1RRCA 3FMOB 2ZROA 1CJVC 2OESA 2QY9A 2ZRJA 1II9A 2YHSA 3RSOA 4DCUA 4GDFA 1T5LA 1NBMD 2WAXA 3M6AA 2IYUA 1Q3TA 3CKLA 4LYAA 4V0NA 1ESNA 2J0UB 1ANKA 3T1QA 3ZIAD 5KDOA 2RGAA 5AUQA 5EP4A 4BLOA 1E1RA 1ZM9A 1UADA 5DH9A 5TARA 1QHXA 1S1MA 3QUSA 2CCJA 2QROA 1VG1A 5JHHB 4B73A 4M8NE 1AA9A 1HE1C 2MSCB 4B35A 1I2DA 3GFOA 3K9NA 2FSFA 4CF7A 3C5CA 3AF0A 1W5SA 1IBRA 4EFLA 1IONA 4D4JA 4Z51A 4JVMA 4W9MC 2ZETA 5FBLB 1TU3A 4R71A 2WKPA 3SHWA 2XAUA 1P3JA 2QT1A 2OCAA 4ZDIA 3ADBA 3BAFA 3TR5A 2LKDA 1WXQA 1N5JA 3QBVA 2RGEA 4HYYA 3NVAA 4LJ5A 5F3WB 4BFSA 2OBMA 3DEFA 2J46A 3SI7A 1G8PA 3KKOA 4KVAA 1RKBA 3LWNA 4CZ2A 2ZJ5A 2FNAA 2VL7A 2ZVQX 1P73A 1S96A 1YZLA 3CBQA 1RE0A 4RKFA 1MRSA 4OJQA 1W4AA 1QZXA 4HEJA 2QAGA 3A1UA 1N0UA 1FUKA 1Z0KA 5KYKA 4DEXA 4Q9JA 2FX3A 3BFVA 3TVDA 3QI2A 2PJRA 4UXHA 3IILA 2F43A 3GD7A 2HF8A 2WSSD 2ZS8A 1VDZA 3S1AB 2CHVA 3KKMA 1GKUB 4HUQB 3VNVA 3SOPA 3QXHA 1FX0B 4JLVA 4B34A 2CCGA 1H65A 5DI3A 1KK2A 3C41J 5A5GA 2W2TA 2F1IA 1JALA 4AG6A 1J90A 1JNYA 3IEVA 3R8FA 1IN7A 1Z29A 2IC5A 2QUZA 4A8JA 3VKGA 1NJGA 5HPYB 5JWHA 1KTVA 4IDPA 4EKDA 1KI3A 2O8CA 3VR3A 2QM7A 3FDIA 1D8TA 3LQQA 4W5HA 2KB0A 1UF9A 1BMFA 1G5PA 5DN6D 4M22A 3GJ7A 1XCPA 5FFMA 1XF9A 1YZQA 1UKZA 5JWRA 4RD4A 4JS0A 3H0KA 3L82B 2F1RA 1NN5A 3DVLA 2V7QD 3WMEA 4NH0A 3BB3A 2JA1A 2J7PD 1XMJA 1X86B 2DFKB 1QRAA 3B78A 1PUJA 4JJZA 4MRVA 4RZ2A 3P20A 2KWIA 1TEXA 1XEWX 2GXQA 4EAQA 5CDFA 4M2LA 1EWRA 2BMFA 2WPDA 5FOTA 1RYFA 2IX3A 4HATA 1AQUA 1VG0B 5CK4A 2VP9A 2XOKA 4LJ9A 3QENA 3QXXA 2RGNC 1FNNA 4RFSA 3IBGA 4P0TA 2B21A 4KFRA 1K5DA 3RDPA 2H16A 1BKDR 2GXSA 3LNCA 1CJMA 1J2JA 5HE9A 5CDFE 2R9VA 4Q4AB 2ZI3A 3CX6A 3TSOA 5AJVB 4ESHA 2BMJA 1VG9B 4Q66C 4ZKDA 3CIOA 4Q4JB 4F4IA 5BW8A 5LDDC 1JAIA 1EX7A 1ZBDA 2QL6A 3B1XA 4NCHA 1E2IA 2REXB 4ZCLA 4CVNA 3CZPA 5AUNB 4I1SA 3QVVA 3RNLA 1QG2A 3U6KA 521PA 1Z6TA 4YMVA 4GFDA 2IEYA 1E2NA 4KCGA 2V3CC 5JZVA 4JYCA 5JHGB 4LJ6A 1Q0UA 1ZCBA 5JI3E 4NYIR 1YZUA 4G5GA 5JJLA 2BEKA 4DIDA 1H8HD 1DS6A 2EFEB 5AR1A 2CCKA 5DHFA 4AURA 3O8RA 2UVQA 3H84A 2QBYB 4IOJA 5DYGA 4QBIA 3O8CA 4MRRA 4KSBA 2ORVA 4LYHA 1KO7A 4AKGA 2XTNA 2WWXA 4GI7A 4DDTA 3VNUA 2G0NA 3OE7A 3TAHA 4NCKA 1CKEA 1TX4B 4A2WA 1DVRA 2CLSA 1ZUHA 3SDZA 1VHTA 3PR1A 5BYJA 3HR7A 2VF7A 3PEYA 1GRNA 3P1JA 2AL7A 4LHXA 2V8OA 4OK6A 1G8FA 5EZ6B 1S1CA 4IVQA 1NVVR 2G6BA 3X1DA 1PLKA 1D2EA 3B9QA 5EXPA 2EWVA 3K09C 4KFTA 2CE2X 3ADKA 2L0XA 2ZUBA 1NSFA 2E9SA 2ZR7A 3RRMA 1PZNA 1KJZA 2ZVPX 3X2SA 3I92A 5BN3A 2QE7D 3GLFB 3MD0A 3UMSA 3KXLA 5KPJA 3DPUA 4PSKA 2IF2A 3GLGA 1KO4A 4ILEA 4PZLA 1Z0DA 3PEVA 2Q9AA 3NTUA 1IJEA 1XEWY 1LW7A 3VU9B 4OHYA 4QRHA 4DKXA 3H4MA 1W49A 2OCBA 4R7ZA 3GMTA 2F55A 4BLQA 4NHOA 3UIEA 1L8QA 1HV8A 3Q3JB 4L5BA 3AKCA 1VYVA 1MABA 5HKKA 1VCOA 3L43A 4LBWA 5HR5A 3VR6A 4EFMA 3GLGE 1ZD8A 3VHLB 4XWOA 3OF5A 3GQBA 4Q1CA 3A1TA 3IGFA 4HSEA 1FTNA 4QM7A 1E9SA 2OAP1 3FMIA 5J4YA 3EG5A 3LDAA 1VCIA 4S2EA 3M4YA 4RSGA 4PHHA 2CL6X 2CL7X 1VIAA 2XX3A 3ZDQA 3B85A 3CH5A 4I81A 3WMFA 5L3SB 4JZKA 1ZVQA 3QXJA 4IXNA 4OQNA 3GP8A 3Q85A 5BWMA 8OHMA 1JR3A 4DLZA 4R98A 5FBVB 5KHOC 4L9WA 3RAPR 4G5RA 2O8EA 1J99A 1XP8A 4TTQA 1E9RA 3W6NA 1LS1A 4V0LA 3SJBA 1ZM3A 2EW1A 3BWDD 3B1YA 2GJ8A 4Q5IA 1KJYA 4OHWA 4PSAA 1JR3E 2BCJQ 1AJEA 1EWQA 3K0AA 1NSTA 2A78A 2D06A 1U98A 2EVWX 4MGIR 4TMTA 3I72A 4DBLC 4PZZA 2BWJA 2F1HA 1OLOA 2W0SA 3AKDA 1OXSC 1ZM7A 2HF9A 2EYQA 2ZSDA 3SYLA 1TQ4A 2VSOA 3A6PC 4URWR 4BUJA 1ZC4A 1DARA 2Z4RA 5JRZA 1EFUA 3A8TA 5CJPA 2C03A 5DN6A 3ZQ6A 2HYDA 2JGNA 4TYPA 2G77B 2QU8A 1W47A 1ZM2A 4LJ7A 2PX3A 2EFCB 2XXAB 4P31A 4QHTA 4QJ3A 2ZE5A 3RWOA 4P32A 4XSHA 1E9FA 1TU4A 2V7QA 1HT1E 2GJSA 4WXRA 3ZS9A 3K70D 2JJ1D 2CL0X 3G82C 3VX4A 1S3SA 4FWIB 3U44A 2ZREA 4DCSA 2QRNA 2WWHA 4JLNA 5FPTA 4XWAA 2O8BB 4P4TA 1UM8A 4B32A 4PX9A 4YQFA 4B74A 3I5YA 1FFHA 2JDID 3SHFA 3QKRA 4PAOA 3TSWA 2O8DB 4IOLA 4JJKA 5EXTA 4JMPA 2QGZA 1SVSA 4NYMR 4Q1FA 4JLPA 4RCYA 3SFZA 1OB2A 1E6CA 2ODNA 1G8GA 1XWIA 3KKPA 4TL6A 4V0MA 4BRUA 1GG2A 2XB2A 1WF3A 5EUQB 3CNNA 2DFTA 2RKOA 2P2LA 3CPEA 4BFZA 3OZXA 1W0JD 5JMTA 3IIMA 3LD9A 4MH0R 2NTYC 3KL4A 2ZJ8A 2JLZA 1X8LA 2DY1A 4DSNA 4V0ME 1AS0A 3CRQA 1NIPA 4QGFA 1IJFA 2FSIA 2J59A 1H8HA 2IHBA 3GCGA 3A36A 2Z4SA 1NLYA 3MCAA 4YXWD 5FOVA 4LX0A 5AK0A 1E2EA 1X1SA 3T61A 4A4DA 1F48A 1KI7A 2PZEA 3TH5A 5AJWA 5DIFA 3BIFA 2O0HA 4QHSA 1D9XA 3DZ8A 2LCFA 4DXAA 4B75A 1PJRA 2VSXA 3BS4A 3NDPA 3QF4B 3RANA 2W00A 4M1YA 1A2BA 4Q19A 3W34A 3PIRA 4MYUA 1AN0A 1Q22A 4M53A 1FUUA 1Q1EA 2EFDB 3T1OA 3AUYA 5F98A 1SVOA 1OHHA 4Q18A 2AR7A 4O3MA 1E79D 4GMXA 5JJIA 1OXTA 2X1VA 2YC4C 2W2VA 3B82A 1W36B 3WHKA 4LBZA 4IXMA 2GXAA 4MA4A 4XD7D 2QE7A 4GT1A 1E96A 1F2UA 3B2EA 1X8KA 2YOFA 3HU1A 2OT3B 2D62A 2Q3FA 3TW8B 2QP3A 4KBGA 3K0FA 4JT2A 5TV2A 4RVCA 4G01B 4M0LA 3LXRA 2VQSA 5LBIA 3CRVA 4B6EA 2GEVA 1UKEA 4ESVA 4H9GA 1SXJB 1XEFA 2VHUA 3Q7PA 5B64A 1M7HA 3SNHA 4ARZB 1E1QD 2C77A 3U6BA 2FEMA 2YVUA 4ZKEA 4NCIA 1CULC 1XMIA 1KK3A 1GITA 5EZ5A 3MUFA 4HI0E 5D3MA 2UKDA 4D2IA 1GTVA 4P33A 2ZRKA 3EZ2A 5SZKB 5IF9A 1FW6A 4M4SA 5CITA 1P75A 3NH9A 3MWJA 4GZLA 2Z6VA 2PMDA 3FHTA 1G8HA 3R7WA 1NRJB 4JLDA 2BDTA 3UWKA 4QBHA 1E0AA 2MMGA 3B9PA 3H86A 4YLGA 3ASYA 1Z47A 2BBWA 3X1ZA 3NKVA 1SULA 2AXNA 4BLRA 2OLKA 1R7RA 2WJHA 4PC7A 4KLZA 4RY2A 2A5GA 2QORA 3IKJA 4A6PA 4OYHA 4AIIA 5F9FA 3QQ5A 1FPMA 4QKQA 4QNRA 4TL7A 3KTAA 3ONWA 2A9KA 1RZ3A 4BFTA 1F2TB 1YZTA 3MJRA 4FD2A 4Q21A 4URZR 4DCTA 1HYQA 4TL9A 3TUZC 3VX3A 3T5GA 2AKYA 3DKPA 2FN4A 4BE7B 1HY3A 3FHOA 5CIWA 2Q3HA 4XVRA 5B58C 1G4AE 1PUIA 1ODFA 1WQ1R 2R62A 2RGDA 2C99A 2OLJA 1QHNA 4XVUA 4GRAA 1IXSB 1SGWA 2J41A 4C0HA 4HLUC 2JLXA 1N5LA 2F7SA 5DHAA 2D4HA 1C1YA 2RH5A 2RGGA 3RS4A 1DOAA 2RHMA 1XPUA 4IEEA 4CIDA 2Q9CA 5BN4A 5CM9C 4OI2A 4OJKA 1EG7A 3EW9A 3I32A 3MWLA 1OIVA 3ZVNA 1TQ2A 2QMHA 2WKQA 2EQBA 2Q9BA 1N0WA 5GJCA 1XTIA 2FDCA 1GM5A 1CXZA 4Q7LA 4JSYA 3VTKA 4MRPA 3F0TA 3HPRA 5E7JA 2JASA 1SHZA 2ZYWX 3U5ZB 3U61B 2GCOB 1Z6YA 3GJ8A 2QI9C 2ZE7A 4HDOB 1YKSA 4D6PA 1WE2A 1DAIA 5L3VA 1W7AA 1EFCA 1RJ9A 3EARA 3GLHB 3NXSA 4OHZA 2J0SA 2ZI9A 1DAKA 1IN4A 1MO4A 1MO6A 1AQYA 3CZQA 4V0OA 1OYWA 1W4RA 5FI0B 1P2UA 3DO6A 3T5DA 2JDIA 1NMXA 3SEAA 3GEHA 2BMDA 1KSFX 4JBXA 4NDZA 1Z63A 1TUEA 1EGAA 2AK3A 1T3HA 1IY1A 3H2YA 3CLVA 1G20E 3NC0C 2WWWA 4O25A 4DWJA 3SR0A 2ZJBA 3QF7A 2H57A 5KSPA 5JFGA 2REBA 3HYTA 1TADA 2IS6A 4MDEA 5DISB 4RZUA 2WMOB 5HTKA 2BBTA 1KOFA 1LF5A 2J0UA 3BB4A 1Q44A 3RWMB 4LHWA 2PT7A 3E2IA 1CF4A 4Z8XA 1GNRA 3TRFA 4PAQA 2NO1A 3UK6A 5TMPA 2GNOA 1R0XA 3RRYA 5DI9A 2OV2A 4YXWA 2GCNA 1LVGA 4D4KA 3QPVA 1U0LA 2C96A 3SS8A 1JPJA 1PLJA 3Q5DA 1NJFA 2XITA 2O52A 2JIZA 3PXGA 2OXCA 2FGJA 4EJSC 4A0FA 1KK0A 2WJIA 5EXXA 3B1ZA 4FMDB 3PUXA 3ZYCA 1GP2A 2OE2A 1DTSA 1N6NA 2IYXA 3FMPB 3ADCA 1AK2A 2BC9A 4PAMA 2NO9A 1XTQA 4IDNA 4US2R 2LWIA 2E87A 2X2FA 4KFUA 2JCSA 4OQLA 2FSGA 1E79A 4C0LA 5AJZA 2CHGA 1ZNZA 2XJ9A 2R8RA 4C2TA 5FR1A 4EJSB 3ND9A 3U3KA 2ZI4A 4XD7A 1TL7C 3Q7QA 5JBQA 1Z08A 4C0KA 2ZRPA 721PA 3AV0B 4D82A 3KUDA 2WWYA 4PC2A 4DB4A 1WBDA 3V9PA 3KQHA 3UPUA 2A5JA 2ZRMA 3ZVLA 2VHCA 1XJ0A 3D7MA 5J4VA 4NCJA 4OQMA 3PFIA 1E1QA 3LW7A 3NHAA 2GAAA 2VP2A 2FWRA 1Z8FA 3ZD6A 2BVNA 3FFAA 4PO9A 3ADDA 4C2UA 4CEHB 3HWSA 1HURA 2NO0A 1BO6A 3K0EA 3EPKA 3OE7D 4ZIRB 3B5JA 1V43A 2ATXA 1O3YA 5IDVA 4RZXA 4FMDF 4D0LB 4GMDA 5J4LA 3S1AA 2IT1A 4HUQA 1E94E 1FX0A 2RHDA 2OFXA 4B6FA 1U94A 2FPKA 4TLAA 3TIFA 4C7OA 2DBYA 4TYYA 3EPJA 1I4TD 4A36A 2SHKA 1XXHB 5EP2A 2R6CA 1N6IA 2GBLC 3NIBA 4TLEA 4WW0A 4TTRA 2XJ4A 4G5OA 4KITB 3THXB 3R9WA 3BE4A 1T3LA 2YZ2A 3OHMA 2ERXA 1RIFA 1NN1A 4Y0AA 1D5CA 1DPFA 1SZPA 2VA8A 4TSFA 1G64A 2I4IA 5SZHB 1TF5A 4PQYA 5AJXA 1X3SA 4FWTA 4C0BA 2CK3A 3DMDA 2JAQA 5HKKD 4IHQA 4DSUA 2YWGA 4JLKA 4PZYA 1G7SA 1JAHA 1KGDA 1QHHB 2W0MA 3K8YA 4LHYA 3U4QB 3BJIC 1M2OB 1HQYE 2X8AA 4OK3A 4M1OA 4F4CA 2YINC 5KPDA 2V6JA 1VIYA 2RCNA 2ZJAA 3MWYW 1GNPA 3AVXA 3LW8A 3FVQA 1RC8A 1J8MF 1JXMA 4CEIB 1N25A 3IIJA 4BLSA 5EE9A 1L7VC 621PA 4H1VA 3T34A 5EUMA 2QG6A 3LQRA 4ACAA 4IKEA 3RRNA 1CIPA 3ASZA 3BOSA 1UBCA 2XZPA 3N70A 4MRNA 4PC6A 4PQFA 4DLXA 3BH0A 2VP0A 3L8YA 4ZDKA 1P7CA 1JR3D 2F9MA 4KAXA 1P9RA 2QQEA 1CBUA 2VBCA 2W6ID 2D74A 1E98A 6Q21A 1E4YA 1NKTA 1T6NA 3HP1A 1AGRA 5C18A 3ZZ0A 5JS7A 1X8JA 4Q4JA 2A3RA 2CHQA 4JL6A 2ZAOA 4N0DA 2RGNA 1IAQA 3U3MA 5J40A 2H7VA 4Q47A 3C14C 4C0QC 4X8HA 5GJWC 2IYQA 3V4RA 1ZINA 1GDDA 1HH4A 3NWJA 5FR2A 2ZRBA 2WTUA 4WA7A 5B2ZA 3PJRA 1C4OA 2WAYA 1WBBA 1QVAA 1KI9A 1KSGA 2NQ2C 2PX0A 4BLPA 3WP1B 3QXCA 5CJ2A 2QRZA 3LBHA 1WB9A 2ODBA 3NH6A 5KSZA 2V54A 2ZS9A 2EU8A 4D4MA 4L16A 1AM4D 4IOMA 3ZQJA 5CYOA 1II8B 1RVDA 4MYHA 1IN8A 2XZLA 3FYHA 3QXSA 2ZE8A 4CRWB 1UEJA 2OAQ1 2JLVA 1WMSA 5TY0A 1T0JB 4I1VA 4GOJA 4XOIA 2KSQA 121PA 1DG3A 1LF0A 3VR1A 1EK0A 4LGMA 5E3HA 4ABYA 3IQXA 5DE3A 1R8QA 1CR1A 1KHTA 3I1FA 5FUXA 3P4XA 1ONBA 2C5LA 3TW4A 3MSXA 1IXRC 4RD2A 1T91A 3REGA 3VKWA 3T1TA 4PQRA 2ONJA 4B44A 1XZPA 2ZPTX 5FPHA 4B2PA 5EXSA 3QIAA 3GLFA 2QM8A 4ACBA 1Z3IX 1KMHB 2FV8A 2JLRA 2JLUA 3OIYA 1YRAA 2C2HA 4QL3A 3ZVMA 3U7EB 2C9OA 3BB1A 4FMBB 4HB2A 2GZHA 3UMFA 3CRW1 3QKSA 4ZO4A 5FUWA 1XFAA 4DSOA 1OKKA 2GTPA 3K09A 3LVQE 4IFEA 4DVGA 2P67A 1DO0A 1NLZA 3F5FA 1GWNA 1UBEA 2ZRNA 3GLFE 1OH8A 1T8TA 4V03A 2PJZA 3AP2A 3DHWC 4E07A 2YC2C 3SYNA 2A7QA 3DMNA 4RFVA 4R2IA 3PCRB 4IW3B 4JVSB 3PEWA 2P5SA 4JL8A 2G83A 4QBFA 1NVXQ 1SKYB 5L8VA 3C5HA 3UXMA 1KDTA 3ZZUA 1OT3A 4N3NA 3TGPA 2XTMA 4HZUB 2PCJA 2BV3A 2NOAA 1G6HA 4PANA 4Q1EA 4UNSA 3C4JA 2QAGB 2J7KA 4U5XA 1J70A 5L3SA 4MGYR 5HE8A 4MRSA 2OCPA 3K1JA 3F8TA 4LY6A 4ZPXA 4CT4B 2R65A 4A0GA 4Q4LA 1M1YE 3PUZA 4J0QA 5KNCA 2WVJA 3EIHA 1QHSA 5A4JA 4WZBE 1UDXA 4OL0A 1G21E 2D2FA 2WJJA 4MUAA 3TVTA 5JEDA 1JPNA 1YR8A 2IXFA 1GRQA 1DADA 2ZJZA 5JLJA 1FTSA 3FKSD 1R5BA 1OHHD 2O0JA 1QHYA 2B8WA 3CF6R 4KYUA 3WXMA 1FOEB 1EESA 1XX6A 1PLLA 1G41A 2O8CB 1KKMA 4ZCIA 1IXZA 4BFUA 1MT0A 1G17A 3UG6A 2BOVA 1YZGA 3LBIA 3LY5A 5IT5A 1E9DA 3R20A 4D81A 4GZMA 2QN6A 4Q4HA 1N6OA 4AI6A 2GKSA 4DLYA 1IQPA 1E9AA 2CVFA 2Z83A 1DO2A 5FPYA 5JWOA 4XJXA 3CNOA 1GL6A 1HE8B 4IDOA 3IO3A 1RYHA 1E2DA 4QGHA 1QG4A 1KIMA 2GESA 2PCLA 4FMCB 2WIBA 3DL0A 4HZIA 4PHFA 2A5FA 2ZRIA 2J5XA 1JBKA 1IN5A 2PBRA 5L3QB 1KAOA 4TLCA 1FMLA 2FFQA 1GIAA 2Q0HA 2ZYVX 4LV5B 5FOXA 2CXXA 2X2EA 1DG1G 2FOLA 5HCIA 4TMVA 1X1RA 2ZRLA 4A82A 1I2MA 2ZEJA 1IY2A 3G5UA 4I1UA 3IHWA 1B0UA 2G9NA 4C3ZA 2N46A 3VHXA 3C16C 5JSZB 4PC1A 2O8BA 5G53C 3NBZC 2W2XA 1XTJA 3KQUA 4CGZA 2NO6A 1E9BA 1G18A 2ZITA 5P21A 2V55B 1QHGA 1KO1A 3EASA 4BECA 3C7KA 1Q21A 3OAAD 1R8SA 4FCTA 2O8DA 4JLMA 4C0AC 1G3MA 5GVSA 5KU1A 3LXXA 1MH1A 1Y3AA 2WJGA 3U7HB 4MGKR 1QBKC 1ZJ6A 2C04A 2W6IA 3HYRA 5SZIA 4F38A 5DLQC 3EZ6A 4Q1AA 4B2IA 5HZHA 4AG5A 2QMEA 1HQCA 4LK2A 1ZRHA 4UXIA 1SKQA 2PH1A 2GRJA 1FP7A 1BH2A 3TBKA 1Q57A 1IOZA 2ASEA 1P62B 2WJVA 4AY2A 5G40A 4L8GA 3K0CA 1GL7A 4FMCF 2OUKA 3N2EA 3R9IA 4US1R 2R44A 3AM1A 2ZUCA 3GEEA 3THWA 3AF1A 1OFHA 3D6TB 2H17A 3VFDA 2P6RA 3CNLA 2QA5A 2KBEA 4F92B 4NMMA 4Q7JB 4L15A 5E4FA 3W6OA 1D2MA 2G88A 2NPIA 2R6GA 2WV9A 3QF4A 4XTCS 5G3YA 2XSZD 1Y63A 2IWHA 2IA5A 4MITA 2KJQA 3CPHA 1VCMA 4CT5A 4ZI2A 3LVRE 3AVPA 4EPYA 4FI3C 1XD2B 5K8LA 1BOFA 1N6KA 3U7FB 3KB1A 1E2FA 1UBGA 1U99A 3HJNA 1KI4A 1VTKA 2N42A 1DAMA 4QJ4A 3GLGB 4GOKA 2QP9X 4M9ZA 1R6BX 3CX8A 4LPKA 4XVQA 1GKYA 4PR0A 2GWHA 3ZZTA 4P4SB 5FBRB 4EIWA 1XCGB 4QM6A 2QMOA 1NLFA 4LPSA 4JLAA 3LX5A 4PTLA 5HCNA 4V02A 1U81A 4PHTA 2OCYC 4E09A 1G3RA 3B1VA 4K8OA 2ZI7A 2AD5A 2OBLA 1LY1A 4KI0A 4WXPA 1PVOA 2XNSA 3K0CC 3AKYA 4A92A 2HT1A 4LYFA 1KI6A 1CTQA 1S9DA 1SXJA 4NYJQ 1KK1A 2XTZA 3PUWA 3AQ4A 1KMQA 4B71A 2V6IA 4BZQA 2FF7A 2ZTSA 2N1BA 2Z0MA 2PEZA 3C15C 4LJ8A 4PO1A 1OIWA 2B7BA 4MKFA 4XIGS 2ZSAA 3QG5A 1SXJE 2GCPA 3IHLA 2GK6A 4NZYA 3O47A 3TAUA 3L0OA 1GZSA 4II7A 2B7CA 1M6NA 1OJLA 2IYWA 4ON9A 3WNDA 2JLSA 4P4UA 2FMXA 3FKQA 2H1LA 2G3YA 2ZYTX 4UQOA 2O8EB 1Z2AA 4DLSA 1UEIA 1P9NA 4TMXA 1OV4A 4Q7KA 1WA5A 1Z28A 2Q6TA 2QPTA 3QVUA 1XBTA 1W36C 3HDTA 3GFTA 3AVUA 4N1AA 2JIZD 1XB2A 3F3YA 1G16A 4US0R 2A5DA 2J9RA 1TTTA 1US8B 2C98A 3K0AB 4Q9KA 3P32A 4LJYA 1F5NA 1JJ7A 1F2TA 3T15A 1NMZA 1F6BA 2ORIA 1ZAKA 3FKSA 1R5NA 5BN5A 2ZJOA 1ZCAA 3SZRA 2AWNA 1R0YA 3MJHA 3NBFA 4JT4A 1OSNA 4C9BA 4DT1B 1E2MA 2RGXA 3IUYA 3RS3A 1Q3HA 3REFA 2REOA 4AKIA 1SXJC 1G7CA 2VP6A 4KXFB 1MO5A 1XEXB 1XTRA 1V5WA 2WOJA 1GOTA 3AKEA 3E1SA 4HB3A 1A4RA 4ASUA 2O8FB 1VMAA 3I73A 4GP7A 1ZUIA 4D4LA 2ZM5A 1E0KA 1W48A 2MSDB 2ERYA 2ZANA 3EZFA 1TF7A 4Q01A 5KTYA 5FTLA 2VLIA 4N0EA 1F3OA 3OEEA 1L4YA 2FFHA 1G3QA 1LNZA 1OB5A 5CM8B 1Z6AA 5KNDA 3AF2A 4URYR 2HLDD 2NIPA 5ELXA 4TL8A 3EA0A 2WHXA
chains in the Genus database with same CATH superfamily
3BYZA 5J3JA 1P1RA 1SIBE 4CLXA 1U3CA 1F0NA 4JB3A 3TZEA 4BBZA 4OKNA 2OPBA 3FI0A 4PC3A 1S4QA 1G7TA 2Q4OA 1JMKC 3V32A 1WRBA 3H5OA 1H42A 4ETNA 1X7GA 1N3IA 2BGIA 2JEYA 2BM8A 1FYFA 2AR0A 3HXTA 4HLUA 1ENOA 3NANA 5D7NA 3U3ZA 5TMEA 4MJXA 3KQQA 4KPGA 3RVBA 5ALIA 1AKQA 3ETCA 1CRPA 2X5JO 3NHBA 4M0UA 5CT8A 3BFKA 2Z6QA 2ZU0C 2VF2A 1LSJA 2PHZA 4G63A 1T1GA 2OZEA 3AL0C 1X1DA 2LW7A 3Q87B 1PGQA 4JP2A 4A6DA 1B23P 5CFLA 5A62A 5FL7D 4QHYA 4MQBA 3AY0A 3W8EA 2N9UA 3ZV5A 2OFOA 3L6BA 1H4QA 1P5HA 5REQA 2ZXEA 4LN1A 3F7TA 3CRZA 5FLKA 1CZHA 1ORVA 3EFBA 1B3RA 1V6AA 3CVOA 1GTL1 2O6HA 3ENZA 3G6KA 1D2CA 1P17A 221PA 3PBKA 1MTZA 4HNSA 4KXLA 4L4SA 4RF3A 5ALMA 5F1YA 1BCRA 3OX2A 5LXTB 4FSXA 3K2QA 2PZJA 1K2WA 3W5CA 4OCZA 3SP1A 1UBJS 3H4TA 3AHIA 3BXZA 1YE8A 3HRIA 4TSFD 2A1UB 4HF7A 1R16A 3EZNA 4JNCA 3X43A 1BN6A 4E22A 2DETA 2X77A 3F2VA 1Y8QB 2BFCB 1DJLA 2GTIA 3USCS 1J0BA 4Q1BA 3R41A 4L3VA 2B92A 2P0EA 3V3TA 3NYWA 1AKEA 2J1LA 4HAWA 4L02A 3JWHA 2Q4TA 4ZOCA 4Z1MD 4EO4A 4E14A 1A4UA 5DRYA 2QTTA 4HADA 1BX0A 4RK1A 3W78A 4DUGD 3LLMA 3W2FA 3CGWA 4HGQA 2C2GA 1QH9A 5E8JA 2QP4A 2WU3A 4C22A 4ZOBA 2VAMA 3DQZA 4RSMA 3S27A 3HGTA 2YJNA 4JVNA 2FFBA 3CO5A 5CFMA 1I4DD 4OBEA 4Q9DA 5EWJA 4ZCPA 1CR2A 3WSWA 3WMGA 2RSLA 2XNHA 3K5WA 2JCVA 4ZYTA 2ZXUA 2HR1A 3GJSA 3UA3A 1MZPA 1FCJA 3IXQA 1RAGA 3GK3A 3EXEB 4UHKA 2XCIA 2YV5A 3LE8A 1X7WB 3PFCA 4WFJA 3RODA 3L93A 3H5WA 1B42A 1SVIA 4HJRA 1IHOA 2C29D 3ZI0A 4GOMD 2B2CA 1MB2A 3OZGA 4KVGA 3ZU6A 1VHLA 5C7YA 3S81A 5JH7F 4X90A 5JO0A 5BYKA 1NE2A 2RHWA 3P4YA 5E2AA 5BN1A 1JDSA 2K5UA 3WO0A 4BNWA 4KXUA 4EJSA 4OGKA 1ZGZA 4MNTA 3V46A 5A71A 3WJAA 3NKLA 4DNQA 5JAHA 1G4UR 1Z56C 1QIDA 4EECA 5LQRA 2AX4A 3UJDA 4FW9A 3FTQA 1ZZEA 4JDPA 4KU4A 1JE1A 4KQMA 4KXWA 4PYKA 5JRJA 1QIIA 4S12A 1PT7A 2NYUA 1L7RA 4DCCA 1AGPA 4B3IA 1X9HA 4RPLA 1NU6A 2L18A 5JDIC 3LWZA 3AY7A 5KMGA 4D80A 1Y4SA 3AZQA 4JD5A 4FNOA 3UTCA 4YQZA 4REQB 3NAGA 1EK6A 2FP4A 4WCFC 1UQRA 2VCYA 2P1RA 4TQUS 4O4JA 2NU9B 4LKRA 2Z98A 1Q12A 3E27A 3GOQA 1M6EX 1Z4MA 3H1TA 3KFXA 3AGPA 4NCNA 4E94A 5KYYB 5D1NA 4ZIRA 2QUBA 5H0IA 4DLVA 5KOIA 3KZMA 2XA2A 3JWGA 4RZ3A 3WLFA 3EXIB 5DLYA 5BSRA 5CEJA 4MCHA 3FOEC 4AL4A 4QOSA 1HOXA 2JKYA 4JVLA 4WBNF 3DO5A 3GVCA 4DLRA 1QGOA 1RXUA 2NZUG 3BC1A 4HNTA 4UHFA 1WV0A 6YASA 2GETA 1AXEA 5EYPA 5K01A 4U9HS 1Q91A 3E7PA 3KD2A 3WGVA 2B7LA 2OGWA 5CB4A 4EB3A 4AY3A 3WGNA 1PSWA 4PLFA 2OKGA 3A04A 3PNYA 2B99A 1Z25A 2FH5B 3QXGA 2JIOA 4BB5A 1ZIPA 4D9HA 4DC1A 1Q20A 4DTCA 5MF6A 2ZT5A 4M1WA 4D96A 4O33A 1D9ZA 1I4LD 4U4AA 3KUKA 1CERA 2A0XA 1DKLA 1NJ6A 3GLVA 3THXA 1K6IA 4RPGA 4EHAA 4S04A 3CX7A 2C9BA 4MVXA 2ORYA 1FYEA 4BNVA 1SVNA 2X6TA 1VSBA 2G7ZA 4JX8A 4OVKA 3U7GA 1QWOA 1R9JA 2WYVA 3HU3A 3ZW9A 1OKKD 1WF6A 2O48X 2C8LA 3SX4A 1YQXA 3ODPA 3ZTWA 3RU3A 1U8XX 1OIXA 2YQZA 4GKBA 4UC0A 2GPTA 4Y7CA 1QHHA 2HW8A 4ZT6A 1FP4A 5HVNA 1KFJB 2Z2XA 5D3QA 1C7IA 3OFKA 4ALMA 5CBKA 1TMGE 2XMPA 1T3ZA 1X15A 4R2XA 3IS3A 1NKSA 4R1QA 1H5NA 1WXXA 3B70A 4P8RA 4P2BA 4WLEA 1DJQA 2BJVA 1HXHA 2FXIA 3HS3A 3D3QA 4E1AA 4ABTA 2MSEB 3EFHA 2J4CA 4QYTA 4H0CA 4CEIA 2Q21A 3LG2A 4JJAA 3ZLUA 5B57C 5ISMA 3DBLA 4H31A 4DQDA 2WTEA 3KU4A 1B3BA 2R1TB 3D8HA 5IDWA 4IVRA 4L73A 3TIGA 4EG8A 1LSOA 3K70B 3R09A 3R6TA 5JYCA 2HLHA 3G2LA 3RYFA 1LPAB 5JCZA 3VVCA 3RSZA 3C7DB 4LOAA 2FB9A 3IR7A 4V0KA 5ICEA 1U8AA 2BLNA 3PDWA 3SYRA 4D45A 4YRBA 1RD4A 2F3TA 2GVDC 3TPFA 4NE2A 3G02A 3W8RA 1ZVKA 5FOUA 2FYTA 2HEGA 5B2FA 2HCJB 3V4LA 1E69A 1KYZA 1L2TA 3R0QA 4GH5A 4QDXA 4YASA 4URVR 5HHTA 1RYDA 5CPBA 4P3KA 2CLIB 2ZYUX 3HJBA 3RT9A 4E46A 1CCWA 1E2GA 1PX0A 1CNFA 1WKVA 1PJ8A 2CXPA 2EBUA 2FKAA 3DNMA 3UAZA 1QF6A 1RYYA 2X42A 2X1LA 4EPWA 3H1PA 4BWVA 2J0VA 4V0QA 2OSBA 4OXYA 4AUEA 2CUKA 1H4VB 4AJHA 3H2KA 3OIDA 3ZN2A 3IUBA 3SYMA 2OILA 4D9IA 4GPBA 3ODGA 4R1OA 3QSYA 1UPTA 1UMKA 2I3BA 2ZS7A 2BEWB 3TNFA 1F8UA 4B1FA 1KEEA 2XWPA 4KPFC 4MWTA 3L1VA 4L5AA 1EQAA 5JPIA 1SD5A 1U1DA 1ZGCA 3KALA 1CB0A 1POXA 3BFPA 5CH3A 1D6JA 5BV2P 1CF2O 4NVRA 1JH8A 5FTNA 1X9IA 4AP6A 4J90A 5CB8A 2BSXA 4TQAA 3VAYA 2L17A 4JL5A 4I0WB 4DS3A 2AFIB 2C92A 1T2FA 1EFHA 4WWHA 5ITWA 1OYYA 4HRYA 3NEYA 4ZVSA 1UM9A 2F4NA 2P3SA 2ZSBA 3OIWA 4DRXB 3K0SA 1VBFA 2G82A 1NE7A 2EHDA 3NIGB 3OC0A 3QWHA 4PM4A 4WXMA 5HMMA 5BSVA 1U2QA 2PMKA 1TM7E 3HB4X 3PENA 3JYNA 4GMKA 2WUFA 3BRWA 4NE9A 5LWHA 1XMQB 2WE8A 3NASA 1JA0A 5I48A 2OXRA 4P7BA 2UUBB 2PUHA 3AB3A 3OFND 2Z6UA 3TXXA 1EDBA 1EM8A 1NBWB 3LDFA 4M1SA 2D1SA 4R1PA 4D3DA 5KYGA 2R751 3E7XA 3NRJA 3MFYA 3TM4A 1R6VA 4Q6BA 4B3GA 1A9RA 3DMGA 3H7IA 1RQ2A 2GD6A 3G9UA 3GEPA 3JARB 1UINA 1D09A 3OBIA 2CXQA 3P26A 3M4JA 2PKYX 4MI6A 5H02A 3SN6A 4NBNA 2RHLA 4X1KB 4KGZA 3GJ5A 5A4IS 2PXAA 4E08A 5I6DA 4MWBA 4XUGB 5JXHA 4RJLA 2GQ0A 2OXIA 1SWWA 3FZEA 2KMLA 3KZVA 3AL3A 3AEUB 3Q0TA 4I55F 4D9FA 3A58B 4LYDA 4QXMA 1MAUA 3KJIA 2OL4A 2DKNA 1KORA 3BN3A 5A7FA 1U7UA 1J0CA 1MEEA 3F5SA 4FVTA 3DOUA 3ZCPA 1OWPA 1RC0A 1L4NA 3AR3A 4XKJA 3RJZA 3FOZA 2DULA 2GR9A 3DHNA 4G9EA 4UAGA 3IIEA 3J81A 5F4BA 2WWRA 4L4ZA 4QECA 3KZKA 3GGOA 4HZUA 3L8HA 2G4LA 2DQ4A 1SVLA 3O6VA 4FFNA 2PV7A 4IRMA 1I6KA 5C1DA 2YN4A 2B37A 3N3AC 4J4HA 1E9VA 3VO2A 4XIFA 4AWXA 3UMMA 1G6OA 3D6HA 4FOSA 4OO3A 4PG6A 4PNPA 1W94A 2YZMA 3AH8A 3GPDG 4IUDS 3RSQA 1TKRA 2GN1A 1R2QA 1MVOA 1AKWA 3GAZA 3GGPA 3IT3A 3KB6A 3KWLA 2JGDB 4NYIQ 2AX3A 1SCUA 1CQIB 2HRQA 3CWZA 2PJDA 1G8MA 2GPWA 3SFVA 2M6SA 3FBWA 1OXMA 4U9IS 2XADA 4EHKA 1NW4A 1JJBA 3ESYA 4RHXA 2QTHA 4PZEA 3FYUA 3P45A 4C4PA 4ENWA 3HJGA 1LSSA 1FLVA 2G04A 4MWCA 4BNIA 1ILEA 1ZW1A 4D9MA 1E0AA 3EQ2A 1QGUA 1Z06A 2GAIA 1LDBA 3O8QA 1E5DA 4DC0A 3PE3A 2IYPA 4PV7A 2GN0A 3O74A 4FHCA 4PTYA 4Y2HA 3OZWA 4JUBA 4X65B 4TYQA 2K4MA 2B4QA 2GPJA 3HM2A 2ZR8A 4JASB 1XLTC 3W1VA 3U09A 2OQ2A 1XSEA 4LJLA 1E9CA 2XF2A 2Q6LA 2NG1A 3LY9A 4Q37A 1GDTA 5AVZA 2ANBA 1PNVA 2Q6IA 2X1MA 1T1RA 4ZGGA 2J5QA 3FZQA 4C0JA 1TYCA 3B7WA 3GR6A 4LHVA 4ND8A 3B1WA 2QAIA 2QSYA 2E85A 1N9GA 1KO8A 2JFXA 4JYBA 1KVRA 3IPAA 4H6WA 5LQKA 4S1TA 5ALTA 1O94D 3TMAA 3VU9A 1ZMOA 2UZ3A 2IYYA 3LDHA 4BATA 2VF8A 3HKCB 2AOUB 4AZ0A 1GFWA 5KYXA 2GJ9A 1PD1A 4XWGA 1SU6A 2TMGA 3OH8A 3G7SA 1FMTA 1H4TA 1SXJD 2ZIAA 4I1OA 1ABEA 5JCJD 5D1HA 4DDMA 4EG0A 5L3QA 4OQYA 2R00A 2FE1A 1RMTA 1TT5A 1IEXA 3EE6A 2FJ0A 1KYIA 4I46A 4F2WA 2CYAA 2I3ZA 4NJMB 3PJEA 4CR8A 3A4NA 1NXWA 1FLAA 1ZMXA 4WA8A 3W04A 4WY2A 1GFIA 2YOGA 1O9BA 3TXYA 5JSZA 5BSUA 1HR0B 3IOEA 3A3KA 3OLCX 2DB3A 3EGXB 3DZCA 2AFHA 3N6XA 3C7CB 1QIEA 3L7OA 1MO3A 2Z9BA 1UOPA 4RF2A 3WA7A 5ECGC 3K1YA 1PV2A 3LPNA 1Z8HA 1U90A 3ICEA 3AHGA 1GPNA 3HVUA 2PKCA 4EFDA 3GA7A 1P45A 2ZSFA 5IM4A 3CT6A 4KVZA 3TQTA 2BJHA 2F43B 4MP8A 4TKLA 5A9SB 3L0SA 3NTVA 4UFPA 3OQIB 3VDNB 2BY4A 1YRBA 1GZ4A 2JW5A 5M34A 3OO1A 2ISCA 3JQDA 3KD3A 2HF7A 3MHPA 4ZRNA 3UWMA 3N2YA 1LJ8A 2EKBA 1GGNA 2PMBA 5FD8A 3LT5A 1Z62A 3CZ4A 4U9UA 5TB5A 4FGUA 5DI3B 1NC3A 1P74A 4NU5A 1JIXA 2AJCA 2G70A 1XTSA 3PITA 4M9RA 4K0KB 2YWFA 3UT5B 1NG9A 3TR0A 1OH5A 4A8JB 2V6FA 1P0QA 3RUHA 4DEYA 1YS4A 1XQ9A 2B1QA 3T7KA 3U60B 4HX9A 1EEHA 2OC9A 3SC6A 1G63A 2WBLC 1CLEA 1WX1A 1URPA 2JFVA 3OEWA 5SV2A 3P9ZA 4G5SA 1ENYA 3ED5A 3GUHA 4FGJA 1S5PA 2WUGA 4JK3A 3HDJA 5CW2A 1JSRA 5HWSA 5J2TA 5HQJA 3SLKA 1B43A 3ITKA 3A3OA 1A2KC 4CM5A 2RGRA 1Z7GA 5H4HA 2ZAGA 1LRLA 2J6HA 3BAZA 3I9KA 2IPXA 1Q1ZA 1JFRA 3WLSA 3EVAA 3EXHC 1VOTA 2E5WA 1ZONA 3NLLA 4KBFA 3N2NA 5FCDA 4U7WA 4IMRA 1SUCA 3ZQKA 5GONA 4LMRA 4EX6A 1EHYA 4KLNA 4OXNA 2DCMA 4BPRA 1JFFB 2DP4E 3K72B 5HOEA 2V4ZA 4BCBA 1MOZA 1Z2DA 2FPOA 3WRXC 2JAUA 5E4TA 5EFOA 4LF5B 1A82A 1KOJA 4RD3A 3KT3A 3SBDA 3TTUA 5EJMA 1OXXK 4B33A 4YAGA 1RWBA 3HC7A 5B3AA 4YPVA 2A14A 3IAAA 4IDFA 4V1CB 5A7GA 3VMFA 4CKEA 1BVYF 2A1TS 1PGPA 4QUDA 2BFDA 1DQZA 2E4AA 1JQJC 2Q0SA 3A0RB 4X9XA 3R7SA 4H15A 4FS8A 2NPFA 3SYKA 1E59A 3C6MA 3QKSB 2BF7A 3GJYA 1PUXA 1DQRA 3RVDA 3W6PA 4C1BA 2VYFA 4D8TA 5B2EA 1SUFA 2Y05A 1GYPA 4QOJA 3KDSE 2D5AA 2J4DA 5AH0A 1PZGA 3NUZA 4HQNA 2IEBA 2GTHA 2VT2A 1MC1A 2H54A 3EWAA 3LYHA 2G1UA 4EY5A 2V0GA 4BMSA 1CC1S 3TFQA 3C85A 4CLDA 1E92A 4WERA 3VI3B 4P54A 3MWFA 5I8ZA 3PT9A 2ADFA 1EXMA 1XVTA 2WJYA 2ZYGA 1T5IA 4CM4B 1Y3BE 2FPIA 3QWAA 4P93A 5F76A 2X4IA 7MDHA 1RHKA 1T36B 2F3PA 4NFHA 3MT8A 4L7VA 1WEHA 5FIUA 2RAFA 1RRFA 3C43A 7MHTA 3MNFA 1Z2OX 1M8JA 2AC7A 2DH6A 2YXDA 4TTPA 4DQKA 4GD3Q 4CM1A 1HG0A 4OX9B 1U0FA 1UQUA 3CLTD 3HCRA 4UZFA 4KJZA 4IQ4A 5F21A 4RABA 3TL3A 2ZATA 2EXXA 4JJIA 3VTAA 3I9V6 5IXSA 1H5QA 3JV7A 4MDYA 1N8KA 5CXXA 3E5MA 4LJ4A 1MOPA 2GZSA 3QBTA 5EL0A 4PN7A 3ZDFA 1ZCZA 2G08A 2GO7A 4W1SA 5SZJA 4W7SA 3ZKAA 5FPKA 1R0RE 5NLLA 3FDXA 3WGIA 3W3AA 4WLFA 4KQIA 3RUDA 1XMVA 4Y1RA 4WESB 3L6RA 1Z2EA 1Y8RA 3TOZA 1UDWA 1SBYA 4UNQA 4D42A 1US8A 2XZTA 4P22A 3SYTA 1D4AA 3DUFB 4R83A 5FTMA 2XVAA 3IPCA 3NU1A 3CA8A 4YUYA 3LUHA 5DMXA 4KSCA 4WY8A 1Z4IA 3CLSC 2K6GA 3TQSA 3FE2A 4ALNA 4UCFA 1VGQA 4BLTA 3MGBA 4XQEA 1SVKA 3DMHA 2WT9A 5DM2A 1KERA 1KPGA 5ECWA 4IFBA 4F96A 4HEA1 2HLNA 4DWWA 3V2IA 4B3FX 1DX9A 1QH8B 1CR4A 4OB7A 1DGQA 2KBFA 1Z38A 2XVMA 2ZSIA 2R85A 2FG7C 5F2OA 3B51X 4MLDA 4GKJB 3QLUA 2JS7A 5G0TA 3K5HA 1MEOA 3KOOA 4A0QA 2CV1A 4XQCA 3HN2A 5C51B 4OX9Y 3CRRA 2D7CA 1RLOA 3FZGA 1XCOA 2LKCA 1B76A 1M7BA 2F6RA 4N12A 2FN8A 4MYRA 5AKJA 2VTKA 1IQRA 2VO1A 1JTVA 3LP5A 4WZAA 1WPQA 4GSYA 3KBOA 3MXOA 3LH5A 5CLGA 1M5RA 2Z5FA 1R5OA 4HDKA 4MVJM 5DKFA 1AS2A 1KE1A 4ARZA 3KJGA 1ZA1A 2G1JA 5AKHA 2I6UA 3CW9A 2O2CA 5AVSA 1D0IA 1QANA 2P2CA 1YR9A 1AU9A 4W4TA 1JU9A 1OXUA 2FZKA 4Y0NA 3TOXA 4ZYYA 1QC5B 5B36A 3CVXA 3ESDA 3AUSA 3JWIA 2V5VA 2YNMA 4E15A 1Y33E 2O3RA 1RQPA 3K73O 2Q99A 2DT5A 2Z2YA 3C98A 3T3OA 4AJ1A 4BTEA 1SY7A 2XUIA 5LZ8A 2Y4NA 1WAMA 2VEDA 5A03A 1JDJA 3ZGLA 3C3DA 3LHKA 5DX1A 1M76A 1X8XA 4X8OA 2WSBA 1UXOA 1YZHA 3V55A 2A30A 3LI2A 2YICA 4OH1A 1XD9A 4C5CA 3TXAA 2WYIA 5BO5A 4Z0PA 3GPCA 3Q8MA 5LXTA 1GN8A 1RW4A 3O93A 1RM0A 4U6NA 2VNIA 4E5DA 1L4KA 1MN6A 1OYVA 1LQ2A 1BHSA 2PZFA 4IZOA 5ERXA 2PSHA 2POCA 4MKGA 1KR2A 3SJCA 3VHRA 1L7PA 1JV2B 1EFVB 4FINA 1GPJA 1GUBA 1Y80A 1Y8QA 2BFCA 2PN1A 4IM7A 4Y0VA 1AHHA 1E3DA 3F1LA 3T06B 1T2DA 2YHBA 3CR7A 5CLQA 1DBPA 1ORHA 1TW2A 2E49A 4FZ5A 4URUR 5I9BA 5GJBA 3HA7A 4OTZA 3ZI7A 4L4UA 5EOVA 4CYMA 1XRQA 1V95A 1L9XA 5JO9A 4ZFNA 5IFLA 4NIMA 5DBEX 2PYIA 3EDQA 1H2ZA 1UT8A 2XLCA 1IM5A 3O83A 4YMLA 5JBNA 1V26A 4WBSA 4BKOA 2VH2A 1WCYA 4TN5A 1YASA 4C4SA 2AG1A 1LC3A 1PQ4A 2YWCA 3PR2B 1EX6A 4HDRB 3AVVA 3NHUA 1UL1X 4G0QA 2LV8A 1X14A 1XMXA 1LK5A 1ZN8A 1RQLA 1QTNA 1GFZA 2HUPA 3DAGA 1X7WA 1O87A 3F47A 4RQTA 5DBHX 1RYMA 3VJLA 2VRCA 3WGKA 1D1PA 1N8TA 1BFUA 2Y0PA 2RDMA 3LCMA 4ZI7F 5I51A 3NYQA 3SSMA 4HKTA 2LRHA 3EGIA 2W2NA 1TZJA 1WHSB 1U2DA 3OESA 1ECJA 3IEUA 4RQAA 4DDWA 4TV8B 4X97A 7ADHA 4MPRA 3V6MA 2A0YA 5T64A 4FOPA 1R4ZA 2IS4A 2XGJA 3JPWA 4G5QA 2AK2A 3GVHA 4TN1A 4ESOA 2FG5A 3QG1A 2QENA 4ARUA 3BBPA 2JK0A 1KI6B 1LVHA 5AIAA 3SGLA 2R8YA 3THSA 2I1WA 1USWA 2X9LA 1IK6A 1AF4A 1Z88A 2OO7A 3AR5A 5KJFA 1NHGA 2XB4A 3OLWA 4BMVA 3MW8A 2EZ8A 1XTKA 4CU2A 2IHTA 2W90A 3QEJA 1KDRA 3H97A 4FHFA 2IUFA 4M9XA 3EA5A 4JIGA 2DUUA 1NFQA 4OHCA 4REQA 3VQTA 3VV3A 4HV4A 2EFHB 4MQEB 2NU9A 4YJDA 3ZK7A 1ZEJA 4GZ3A 2O7RA 3DM9B 1TCBA 1A7JA 2ZWIA 2Z1MA 2JGIA 5KYYA 4UTOA 4HNUA 3EQ7A 2VQEB 4MB2A 4DPMA 2FW9A 2OV3A 2JEZA 2VCEA 5DCUA 1YJCA 3BD9A 2CLHB 3EXIA 2AN4A 5B30A 4XE5A 1VKNA 1ZK1A 2V0CA 2WW8A 1RI5A 4Z3DA 3QVTA 2Y66A 1JPVA 3E82A 2MU1A 3KZOA 2BF4A 3TO5A 2FFAA 2C9YA 3S2EA 1DXHA 1NQVA 4AO6A 5LKAA 4H4CA 4NMLA 4BRWA 2RHHA 3S3TA 3BWYA 4REMA 4WT7A 3BRWD 3SS7X 2JI6A 2IS2A 4EGAA 2PA3A 2RGBA 4UUOA 2P9TA 5K0BA 1N0IA 2HM7A 1B6SA 2GEUA 2O8NA 5ALOA 3HVKA 5DXJA 2NUAB 3T3EA 4ZT3A 3I4CA 5GADl 2H0AA 3CSSA 3EZ7A 3MCWA 4KOEC 3R8CA 4C6TB 3PHLA 3EXAA 1C9EA 1J2RA 3OCCA 4MYSA 1FIUA 4D26A 2IYTA 5LZ9A 2A84A 2FG6C 1THGA 3I62A 1Y42X 3GVPA 1DBSA 1HDOA 3A4VA 4KFCA 1F9EA 4MLCA 1IXKA 4Q03A 4JJ6A 1ZFNA 1W1UA 4XDZA 4C07A 2BTOA 4PPNA 4B3MB 1TKCA 3LP6A 4KQHA 4IMJB 2P6NA 1MGOA 3BD6A 1WNTA 2QAJA 4WCVA 3GJ3A 3W2GA 3DOOA 1W4BA 5HJ5A 6ABPA 4HVAA 2QIPA 3DULA 1YOVB 3K0FB 2CV0A 1N2SA 4ARVA 4R2HA 5AW6A 3L1HA 2HADA 4ZT2A 4H2DA 2CJYA 4D02A 2J3KA 3NG1A 4AKEA 1XLWA 3F7OA 4EDHA 3V1KA 3ETDA 4KDEA 5JNVA 3NDBB 4U2CA 4X41A 2GN8A 1KMNA 2O7VA 1H2FA 2I34A 3E35A 1YB1A 2XNDA 4JLBA 3HACA 4DG8A 1W4CA 2DEUA 4BNGA 5D3MB 4A6EA 4E13A 2VSFA 1NX9A 3AG5A 4IDEA 1U2PA 1Z3CA 2VJYA 4LSGA 3SJAA 1QVVA 4M88A 2ES4A 3ESRA 4TZ6A 3VNBA 3PQ3A 4EZEA 1RQGA 1E5QA 3ZTYA 3T0FA 4B43A 4LDAA 1HYBA 1I24A 1L7DA 1SPXA 3FNIA 3FWYA 1GUAA 4NMXB 4MRAA 4XGKA 5DYIA 4V24A 3NWEA 1E2LA 4M86A 2QT0A 1WZNA 4FT2A 5ALWA 1I7PA 3PNBA 1QHEA 3AVTA 2F00A 2VUHB 3BMQB 2B20A 1NT4A 5KCMA 4LBVA 3C5WP 2HREA 2V1UA 2OKCA 1AS3A 1Y0BA 1ZUNB 2DCUA 4KTVE 4R8RA 4EUSA 1M7GA 4XAQA 3KTAB 1BD3A 1NULA 1BMFD 4B3HA 1KY3A 3B2NA 1V2GA 5A4KA 3IP3A 2BEWA 3R75A 2OG2A 4RPJA 3WWYA 1GTRA 2ODEA 3QLEA 4OYRA 1EDOA 1UUFA 5ELMA 3L8MA 1H93A 1TPYA 2O54A 2WMNB 1U3WA 2ZBUA 1YACA 4U0KA 3T7IA 1VRCA 3A1WA 4UHEA 4YEDA 1TEVA 2IYSA 1G7RA 3UOAB 1AQLA 1L4MA 4IQ0A 4RD1A 3UBTA 1XXHE 2AFIA 3BWMA 2J6BA 3T4XA 2A9FA 4GL2A 4MVJP 1ZIOA 3QX3A 1CV2A 3IAEA 1BWRA 4K28A 3W4IA 3ZCRA 1QRUA 4YR9A 5J4KA 4DRXA 5JAPA 2WPDD 3SQLA 4YAKA 1K4MA 1DQYA 2A57A 3CLUD 1O6BA 1ITZA 1KBOA 2XUGA 2FUG6 3LX6A 1Z0UA 2AOVA 3HL0A 2VUTA 4DDVA 1JEAA 2F1KA 1AO3A 4CCYB 4DQLA 4WKPA 5KIAA 2GEBA 3KJQA 1T5HX 2ZJ7A 3VYRB 3JYPA 2YASA 1ZVVA 3GLIB 1DCKA 3L5KA 1EMDA 2BH2A 1FFDA 2Q5CA 1SG6A 3ABRB 3IBCA 3JARA 5EPOA 2WJAA 4F93B 4RULA 1W5FA 4Z3OA 1WZUA 2BFOA 5FX2A 1N5DA 4FD3A 4HMPA 2J8ZA 1QH1B 2AN9A 2AWOA 2YWBA 3DWGA 2P6OA 2VSQA 3NOQA 4LOJA 4M9SA 4TWRA 4X1KA 3TI7A 3W3ZB 2OZPA 5ICCA 2YFQA 1QYIA 2I3GA 3OZCA 3WYFA 3FSGD 1GG5A 4UNPA 5DFAA 3D6MA 4JGIA 3W9YA 3WAGA 1IXYA 5AD1A 3AEUA 4TS4A 3VOSA 4NU0A 4BXOB 1TZ2A 3LUFA 1PJ4A 3CW8X 4BO1A 3K9LA 4MYCA 2YVLA 4J3NA 4IL5A 4EVQA 3Q9UA 4YALA 3CONA 4K9NA 1V96A 1X38A 2I8LA 5COQA 4D41A 4RVDA 4L57A 4XEHA 2AJLI 3A31A 3TMKA 4EJMA 4ZTZB 2VF5X 4IDQA 2I2WA 5C2JB 4FR5A 2XMBA 3GQVA 3HSKA 4MV1A 4KO2S 2PUAA 4MB0A 3LO8A 4KAJA 3C6KA 2YN2A 2ZROA 5DTJA 3NZEA 2OGUA 1OFVA 2QY9A 4TX1A 1R1DA 2JGDA 1E1DA 1RYZA 5A5FA 1CQIA 3Q12A 5CNIA 1TO1E 1U6KA 4E4TA 1ESNA 3WQQA 1HEUA 1VI5A 2WF9A 3TOCA 3PQDA 1EK2A 1I3MA 3A1CA 4MPDA 4MW9A 1J23A 3DD5A 5TQJA 2OQVA 3MELA 1N5OX 5EP4A 1QCCA 1T8RA 5E9AA 5IULC 3OT5A 5LBTA 4CLRB 2X0IA 5DH9A 5TARA 3MRVA 3OOHA 3MEQA 2X0FA 4KI7A 1WDKA 4M8NE 5H81A 2X8LA 2HHHB 3QX9A 1AHIA 4Y7DA 2CY0A 2FSFA 1PIWA 2WAOA 4YT8A 1R6UA 3A2KA 2F4VB 2Z3WA 4WJKB 4ZJYA 4JBHA 1U31A 3FJOA 3VNAA 3RJ9A 5GV7A 2QTCA 4R71A 4TKVA 2D7JA 1P3JA 2EX0A 1ODLA 4OLHA 2QUKA 3HKCA 1DRJA 3TR5A 2J32A 4ARBA 4BKRA 1NVGA 1VPTA 3C3BA 2P11A 1P0MA 3RFVA 3QBVA 5AK6A 5F23A 5E9WA 3JRXA 4AZTA 4LJ5A 3TGWA 2EZ4A 3DEFA 1ZIXA 1IEQA 3SI7A 2FCRA 4EOGA 3ANLA 1G8PA 3RGGA 2IHNA 3O5AA 5A3QA 5K0FA 3KVNA 3LWNA 4Z0NA 5I7SA 1XZJA 1U2EA 2EWMA 4NJMA 4X61A 4CZ2A 2FNAA 2VL7A 3VDMA 2VYNA 1P73A 1S96A 5AW7A 1YC5A 3FZNA 4BTVA 2G25A 3AIKA 1YZLA 5KNCH 1PYGA 5I7RA 3WL7A 2X6RA 1E6KA 1XVAA 3EGXA 3KOMA 4MWSA 1NFFA 5KYTA 1JDZA 1VLZA 2R47A 1D6MA 2QAGA 3BGIA 3FPGA 5JQWA 3EF1A 4WVLA 3SOZA 3BFVA 1P4HA 4TT8A 4ZOLB 3TVDA 4O02B 5K4GA 1AF7A 1GV0A 5EIOA 2A7XA 2F43A 3CISA 5ITZA 5A9SA 2H2AA 3OTOB 4TRRA 3JAMA 4JOQA 4GXQA 1F06A 2VJNA 4W5QA 3WMWA 1LPMA 3IOMA 4C01A 4PG4A 4ND4A 1LDNA 3HBFA 4IIJB 4DWVA 1HI9A 4B34A 1R64A 1NT2A 1JWBB 3DDSA 4KO1S 1C8VB 3C41J 4O5AA 4HNRA 5DI3A 1T9AA 2E48A 1JALA 1T13A 3PXDA 3TKAA 5MN6A 4G0WA 1U4OA 4LY9A 5FWAA 2B36A 3R8FA 4FYHA 4A8JA 2QUZA 5EJGA 5FLEX 4EHNA 3ZOZA 3R5JA 1H2EA 4CT0A 4D3FA 5HPYB 1EQUA 1JQBA 1K86A 5BSFA 2FUEA 3MBKA 1AQ6A 4EKDA 1RI1A 1JQKA 5DYTA 1E3WB 3KL2A 1FFSA 3STHA 3P2MA 1B8UA 3UV6A 3ZCVA 2QVXX 1NLUA 1C3OA 2JFBA 4W5HA 2JC3A 1JF8A 1I7DA 4AY4A 4L78A 4CDMA 1TJNA 2OO5A 1NUTA 1Y1SA 2P9YA 1YZQA 3E81A 3N8KA 5ERYA 4TSKA 5JWRA 4RD4A 5T6BA 2OCGA 3BWCA 3OECA 1MQAA 1M75A 4C20A 1QDUA 2BM9A 2ONZA 2PANA 3H0KA 3H9JA 4V39A 1NN5A 3ER9A 4G5YA 2V7QD 2O7QA 4EL5A 4NH0A 2FCAA 1VCHA 2JA1A 1I9GA 1Z0ZA 3FHLA 4W9RA 4XVHA 4RF4A 1JFFA 5WRFA 3SC4A 1LWOA 2GXQA 2P9BA 4EAQA 4AG3A 2Q3DA 4K9MA 2NO5A 4M2LA 2VHXA 1TM4E 1XKLA 5K3FA 2X1HA 5FOTA 4I50B 3UAXA 1RYFA 5I8PA 3D2LA 3R5XA 4HATA 4CG0A 1AQUA 1BGVA 3NNNA 3ZWCA 1SZDA 2VP9A 1YL5A 1WCIA 2XOKA 3V7NA 1S2GA 2RGNC 3VPAA 4V1CA 5AKIA 1XMPA 2CW5A 1Z4KA 4TXMA 1JXQA 3CBGA 1X0VA 4P0TA 4ZAYA 1MVNA 2HQRA 1SOUA 3RDPA 3TS1A 1RMYA 1MQSA 2CNNA 3LNCA 5HE9A 1K7EB 4TQGA 3DMYA 3QITA 5C3UA 3BMCB 1HL3A 2XKKA 3OKFA 1LXCA 3T3IA 1Y3HA 4AJ2A 2GZMA 4EZBA 4UUPA 3TSOA 1EBUA 1XZFA 1VG9B 2EKZA 4E5PA 2Q0XA 2W2KB 5BW8A 1K75A 5JAZA 1N2JA 4RKWA 5CD9A 1E2IA 2NTNA 2BDUA 3P0IA 1FSGA 4RLFA 2XCSB 4RDIA 2NXNA 3EWIA 1D7OA 3OT1A 3QVVA 4FE3A 4OLAA 1CQJB 4Q24A 3EH1A 1Z6TA 3W5VA 2C7GA 4YMVA 2BEUB 3FPBA 3JYQA 1E2NA 2IOQA 4GFDA 1CUFA 4RK7A 2AJTA 3ZWPA 4CM8B 5JC1A 1PJ2A 1T36A 4LJ6A 5T6MA 4K9SA 1Q0UA 1ZCBA 2IUYA 5FNVF 3KV3O 1JQEA 4G5GA 4DA8A 4EG6A 1PQUA 3OF3A 4UTVA 2GPAA 5JJLA 3H5RA 3PC3A 4R54A 2XBUA 4PR3A 5AR1A 4MI9A 1RWOA 1L7XA 1EE9A 2UVQA 3BCSA 2QBYB 5DYGA 4QBIA 4Y1FA 5JALA 3A9WA 3WDMA 3O8CA 5J9FA 2PRZA 4LYHA 4DUYB 4AKGA 2FPRA 2BGUA 4UASA 2MJLA 1IEVA 2HMWA 2CHEA 5K3EA 1N32B 3I9V1 2TMDA 4DL9A 2C2YA 4KR6A 2I6XA 1CKEA 1MAAA 5CVUA 2O7NA 9LDBA 2LIVA 1QO7A 1VHTA 4BS9A 5JV5A 3PR1A 4B8YA 2YWDA 2R7AA 3HY6A 1M83A 2P8JA 3HR7A 4WESA 1PK9A 2V8OA 1L3CA 4IWXA 3WSVA 1O4WA 1J0DA 1P7ZA 2CVOA 3X1DA 2GFQA 4NPAA 4O4IF 3TN7A 1D2EA 2I6FA 2H4FA 5EXPA 3UXHA 3K09C 3MQ4A 5DM0A 2L0XA 3M6XA 4MWGA 2YCLA 3AHDA 2J5BA 3PJFA 2JAPA 4R1UA 1ODTC 2VHWA 1YDWA 2ZUBA 4WLOA 3TD9A 4BAUA 3AI1A 3FB1A 1CJSA 3MD0A 1VQ1A 5KPJA 4PYOA 4F9FA 3U48A 3WO1A 1L4BA 2RH8A 3H8JA 4BMXA 1KEVA 1QP8A 3NTUA 1C0EA 5EZSA 1P1BA 1T4MA 1XEWY 3FTEA 5DGCA 1LDEA 3QK7A 1W49A 3QVOA 3SJ7A 4R7ZA 4EABA 1RJGA 2F55A 1OASA 2YRFA 4BLQA 2PYZA 3IPRA 1I80A 4BAZA 1L8QA 4K6OA 4R8VA 3Q3JB 5D5HA 1PZXA 1VYVA 1XQ6A 3V1UA 4CMHA 3WTCA 3EIOA 4LBWA 4DR3B 2C4MA 1DG9A 4IIEA 3GLGE 2O07A 5L7TA 1ZD8A 3GXOA 2B4AA 1GPUA 1T6BY 4C29A 1QZUA 3H87A 3IGFA 4OU5A 3KAKA 4ENTA 1YDHA 4I9UA 3TYXA 2XA1A 3KCNA 2PMEA 3I5AA 4RTQA 1M1YB 1VCIA 2G8LA 4S2EA 1LBIA 1G8KA 4RSGA 3TTVA 4PHHA 1QWSA 2H4WA 2ZBVA