4DXDA

Staphylococcal aureus ftsz in complex with 723
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
307
structure length
307
Chain Sequence
b'ATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVSGEVNLDFADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLETSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPELQDEIVVTVIATGFDDK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Restoring methicillin-resistant Staphylococcus aureus susceptibility to beta-lactam antibiotics.
pubmed doi rcsb
molecule keywords Cell division protein FtsZ
source organism Staphylococcus aureus
molecule tags Cell cycle/inhibitor
total genus 108
structure length 307
sequence length 307
ec nomenclature
pdb deposition date 2012-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
A PF12327 FtsZ_C FtsZ family, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4dxdA02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4dxdA01
1Z5WA 4F6RA 3HKEB 3R4VA 4X20B 5JQGA 3VPAA 1FFXA 3HKCA 5LOVA 3JATB 5J2TA 3VOAA 4TUYB 4KWEA 2BTOA 4FFBA 4O4HA 4F6RB 4I4TA 4O4IA 5KMGA 5JQGB 4HNAA 5LA6A 3HKCB 5LYJA 5LOVB 3VO9A 2R6R1 5J2TB 4DXDA 4ZHQA 5ITZA 4FFBB 4O4HB 3VOBA 3JAKA 4I4TB 4O4IB 5KMGB 5GONA 2RHHA 4HNAB 5LA6B 5JVDB 5IJ9A 5LYJB 5MN6A 4M8IA 4O4JA 4ZHQB 5ITZB 5FNVA 5GONB 5IJ9B 3RYHA 3WGMA 2XKBA 5EYPA 3V3TA 4O4JB 3JARA 4O4LA 5FNVB 2VAMA 4ZI7A 4X1KA 2GVIA 3RYIA 5LP6C 4X1YA 3RYFA 3RYHB 3RYCA 5EYPB 3JARB 4O4LB 1W5AA 3RB8A 4ZI7B 4X1KB 5J2UA 3RYIB 5JVDA 3C8LA 4X1YB 3RYFB 4B45A 3JAWA 3RYCB 4B46A 3JALA 2Q1YA 5EZYA 5J2UB 3E22B 5IJ0A 1W5EA 5JCOA 2XKAA 3CB2A 4E6EA 4X1IB 3JAWB 1W581 3N2GA 3JALB 5BMVA 4EI9A 1W5BA 5EZYB 1OFUA 3M8KA 4U39A 5IJ0B 3WGKA 4WBNA 3M89A 4EB6A 3N2GB 5BMVB 2RHLA 5LP6B 4YJ3A 3UT5A 1JFFA 2VXYA 4U3JA 5LXTA 4WBNB 1TUBA 1RQ7A 4EB6B 3ZBQA 5C8YB 3N2KA 1RQ2A 3E22A 4LNUA 4YJ3B 3UT5B 1JFFB 1FSZA 4TV8A 4U3JB 4IIJB 5LXTB 4X1IA 1TUBB 5MN5A 4IHJA 2BTQA 5CB4A 3N2KB 1TVKA 4LNUB 4O2BA 5CA0A 4TV8B 3VO8A 5M7EA 1Z5VA 2VAPA 4DRXB 2BTQB 4IHJB 5LP6A 5CB4B 4EI7A 1TVKB 4O2BB 1W59A 3WGNA 5EIBC 5CA0B 3ZIDA 5KX5A 2R751 5EIBD 4TV9A 3JASA 5C8YA 1SA0A 2RHJA 5CA1A 4I55A 4IIJA 5KX5B 1FFXB 4I50A 4ZOLA 1W5FA 1RLUA 5MN4A 4YJ2A 2VAWA 3ZBPA 5IYZA 4TV9B 3JASB 4O2AA 4XCQA 1SA0B 3HKDA 5CA1B 3WGJA 4I55B 3HKBA 4I50B 4ZOLB 4YJ2B 3WGLA 2Q1XA 5JH7A 5IYZB 4DRXA 4O2AB 3HKDB 3JAKB 3HKEA 4EI8A 4X20A 3HKBB 2RHOA 5JH7B 3JATA 4TUYA 5JCOC
chains in the Genus database with same CATH superfamily
3FA2A 3ZPXA 4B81A 1DVRA 1ACJA 2ZVPX 3AV3A 4ZO6A 4JBLA 2VWGA 3ESZA 3WLJA 3L7NA 3RAJA 2IH4A 2O7QA 3EC1A 4GLOA 4R8SA 1ZL0A 4A6EA 1FU4A 5KWVA 4NYMR 1N2SA 4TKUA 3VPFA 3MM4A 5DGTA 2LIPA 4C21A 4F5ZA 4WOCA 5KWEA 1FUKA 2FLVA 3RVKA 3DOJA 3G1TA 3I9V1 5CT5A 1BMTA 3JQEA 5LC1A 3S55A 3ZCXA 4JT9A 2DTDA 2FWBA 4QOSA 3T0GA 2P35A 4L4RA 5FP0A 2I6UA 5HIIA 4BZZA 4Z7QB 3MWJA 3NHZA 2PHZA 4KAAA 2O1SA 1TAUA 2V6BA 2GSWA 2Q9UA 4KPFC 1XV2A 4TS3A 1VKJA 4IV8A 3JVVA 1Y1LA 2RGYA 1U7UA 3A6FA 1QKIA 3AKYA 1YF3A 5I7OA 1FUEA 1EGVB 5JSYA 2X5NA 4UW9A 3HTXA 3BJEA 3EVFA 4AYXA 5CX4A 2NPFA 3HWRA 4Y1GA 3GRAA 4J0FA 2O8FA 5EO3A 3K0HA 5F73A 1QYDA 5DHPA 4GICA 3JZFA 4MMZB 3DDWA 5DEOA 4TQAA 4I08A 1VL1A 4LYHA 4MVYA 1RLTA 5A3VA 5PGMA 1YKSA 3LQFA 1L1FA 3C7DB 4BNWA 5T4HA 4YRFA 5DNUA 7REQA 3DYIA 2GPBA 5DNDA 1NW5A 1J23A 4MEJA 1RQGA 2IU4A 1ZH2A 4LCJA 2X6RA 1OYOA 1H8EA 2CLEB 2Z8XA 3ZWBA 2MMCA 1GRQA 3NONA 4BT4A 2DUJA 3AEXA 3ZXIA 4B9EA 5AFSA 5CFZA 1P3JA 3PRJA 4RWZA 3UFXA 3RODA 1M7HA 2EXXA 2QX8A 5GGYA 2NZWA 5TPZA 2G06A 2IW1A 1PDWA 2PSDA 2Z6UA 2NP7A 2ZVZA 4YMVA 3WY9A 3OD5A 1D07A 2O2JA 4MLCA 3CF0A 4Q3BA 4WNAB 1FXWA 3WB9A 1JBEA 2MDTA 5EVJA 5TSDA 4TVBA 1GHTA 4UTOA 5E3JA 4D4KA 2GXQA 4LQ4A 2QUZA 4XTCS 4KPEC 5C2JB 1FUIA 2VP2A 3DMGA 4KR3A 2R7NA 4GMGA 3P9NA 5DRTA 3P9IA 1R7RA 4J0CA 1F6DA 1PNQA 5H0IA 1N0WA 1XCPA 2AD5A 2XB4A 4KLZA 3UJPA 4DLUA 2H1OA 4DM4A 1M0SA 1KXZA 2PT7A 3SBOA 3ZCRA 2W48A 5DXJA 2ASEA 2WU3A 2AG6A 2HS0A 3MHPA 2YCLA 3M7IA 1OFGA 3JASA 3U0OA 3PHBE 3QG5A 4JIGA 4Q47A 1R88A 2G04A 4WCFC 4ALIA 3WGTA 4ZAGA 2Z1MA 1JAXA 1R0LA 1XLUA 3HVUA 3UB3A 4Q4JB 1SU7A 2IC5A 4FI3C 4J6EA 3G7NA 3LIIA 1JG3A 3DMPA 3PEVA 3K2XA 4FMDF 1K68A 1V2HE 4RXMA 4Q12A 5IS2A 1YJWF 3LG2A 3ZBTA 5IUNC 1QH8B 4U63A 3HXPA 2IFTA 2XE4A 1E7KA 1II0A 3HKDB 1QG6A 1U4NA 1P2BA 4Q7KA 1KU6A 1T13A 5DIFA 3HKBB 4G89A 1A4IA 1VQ6F 4HAOA 3RHSA 4JQCA 4PINA 2QROA 2NTJA 3F74A 5JBIA 3U7QB 2HSDA 3W2GA 4R2HA 1U1EA 1L4MA 2GJ9A 1S02A 1WO8A 2AS0A 1WZIA 3CZRA 5INTA 2GD1O 3D8TA 1F9EA 1ESMA 5IJXA 4COKA 1BW9B 2CUNA 3R9WA 4PPGA 3UKDA 3RA6A 3RA5A 1E6CA 4TTSA 3H6GA 4TQ9A 5AIBA 1Y8QB 3LFOA 4V3BA 5DCWA 5KYXA 2WV9A 3R3ZA 1RAIA 2NZYA 1B8PA 1XX6A 2OO5A 1ZNXA 2VP5A 1UK7A 2GEKA 2Q8NA 3H75A 4GEKA 3STYA 3NJ8A 4UBNA 4V0MA 4EO7A 1UKCA 3AFMA 4MUYA 1DRKA 2GRJA 3SNHA 1C9DB 3AR6A 4RFLA 5GINE 3J7AR 3OESA 3D6FA 4DL9A 2J9FA 1NY5A 4DV3B 1HNWB 4F12A 3MDOA 4MB6A 3U5TA 1LS1A 2DB3A 1V2GA 3PC2A 3CKKA 2CYAA 2PMPA 4RIFA 1BQ3A 1OPXA 5MHTA 1P4AA 1APBA 2VXCA 3K5WA 4FWBA 1JU9A 5A4FS 4OX9Y 1SN7A 2V45A 4K9KA 4B44A 1RFLA 3VTAA 3S1AB 3DG9A 3Q8KA 4JYAB 3F47A 5LYYA 3PQEA 2I22A 3G5AA 1A5BB 4L7VA 4S1OA 1E20A 1RIIA 3OKFA 3U4QB 1J8YF 2WALA 3BH0A 2QTCA 4K9RA 4RLFA 5ECYA 1M34A 1FDOA 2RGNA 1UBTS 3T5TA 3V9AA 3FNHA 2BKXA 1OJLA 4FD3A 2XB8A 1K8QA 3KKOA 5EZYB 3AHIA 3PA6A 2VHJA 3ZU2A 3E35A 1MJFA 5UKDA 1WB9A 2H06A 1TDJA 3RBXA 4DA6A 3EIWA 2BMJA 2BO1A 5EUQB 4RKRA 3JQFA 4G1UC 1QFZA 4YREA 1JILA 2X5OA 3L06A 1GQFA 4EPWA 3H3XA 3MJTA 1DEOA 1PRYA 4KWCA 4Z9XA 1O0BA 1Z5UA 1EH5A 4ZMBA 1Q0PA 4TLDA 3ER8A 4DDTA 4F91B 1MAVA 1YHYA 2AFHA 1MAWA 3CYFA 2QB5A 4CKEA 2ZRFA 1EFVB 4KJZA 3SIWA 5CB4B 1QO0A 3WWOA 2F9ZC 2PLAA 2Y1LA 3C5EA 3OJOA 4BQOA 1ADGA 4BX8A 2UXBB 3I62A 3TGLA 5C3UA 1IAQA 3AUSA 4PZAA 5F3WB 4Z4CA 4EL0A 4KW7A 2E4AA 4DA7A 2DCUA 3UGKA 3TLMA 5CFPA 3TW6A 2FPGB 2ZPUA 3R09A 5KDOA 1FCJA 1R5OA 4YALA 1JD1A 1HT2E 1VJGA 2O2SA 2W2PA 2E55A 1K27A 5K6TA 1RRGA 3IEWA 3R7DA 4LGMA 4MI6A 1N92A 5DBGA 1XYYA 5BN4A 3O0DA 1VSVA 2EZTA 1L7BA 3OT5A 3PE4A 4WINA 4N3GA 4NWOB 2ZU0C 5CIQA 5DYGA 2C77A 1G5IA 3WZLA 2Z8YA 1ZMXA 4YMIA 3KTDA 4MUEA 4UOQA 3FI9A 2C03A 4M88A 4C0JA 1E8NA 5JCJA 3GDWA 4HNTA 2ZOVA 1S2IA 3L8ZA 4Y2UA 5KYKA 1AUVA 1RWMA 4DAEA 1W6UA 1LRLA 5CDGA 1QHYA 3G88A 3WLFA 2IXTA 3N53A 3ZD9A 2OHIA 1MOPA 1TTPB 2FN7A 2M6SA 4NBTA 3WLOA 4JITA 1TK9A 2HCTA 2D0OB 3W2HA 3RC8A 4LYAA 4ND3A 1SEPA 1I5EA 3I45A 3CE9A 4KQ2A 4RPLA 1M1YA 1WU7A 4JAVC 4KPGA 5AVZA 2F3PA 4FI3F 1LTKA 1HFWA 1U2RA 1MGOA 2PZLA 3C87A 2A14A 3MUEA 1A77A 2RGUA 3A25A 2P2NA 3G71F 4IGEA 4P3PA 2ERYA 2J6IA 2YN2A 2VAXA 5KTPA 4PSKA 1ODSA 4NG4A 5IJ9B 4J0KA 2B4QA 4KBFA 2BFBA 2P67A 5K5EA 4RIGA 4N3AA 4X44A 3BC1A 4JASB 1AF4A 1CDZA 1E6MA 2R8EA 2YVAA 3FFAA 3CR3C 4RKYA 1WB4A 4WNCA 4DA0A 4JI8B 5HOEA 1UK9A 1RWWA 1Q1NA 1RHRA 1UBEA 2CV0A 4MUMA 2UYJA 4RPIA 4DHWA 5IRCD 4AJIA 2XWJI 5JVDA 3IHLA 2A5DA 4LRXA 2A7QA 2IAFA 3DEFA 4LMRA 4EY4A 3EPRA 2GDJA 8ATCA 3WBFA 1W30A 4GE0A 1OW3B 5DYWA 1U6JA 4MVJF 4EHFA 1OZHA 1S8NA 4NBRA 3ZTWA 3FNEA 4TYYA 2E49A 3BWCA 3RAFC 2BY4A 1GD1O 2RC5A 1KMHA 5DJ5A 1FFBA 3GCGA 4KRYA 1H05A 4KX5A 1H7MA 2IUFA 2C8KA 1ZIDA 3TIGA 1MIOB 3CR8A 1KJQA 2C1EA 3GJQA 3CXCF 2GAOA 1E61A 4R69A 4V1CA 2IUEA 1Q81H 2REOA 3AESB 5ALFA 4EKNB 1P75A 3USES 3RUCA 1FZTA 4FOSA 3AOEA 2H2HA 3LP5A 3PDIA 3ICPA 5HKLA 1UZAA 3TL3A 3MBIA 1MEEA 3QKRB 4GPTA 2CXSA 4P33A 4HAIA 4C87A 5B4UA 5CAEA 1A2QA 4ZQFA 3RIGA 3A04A 4EUKA 3THXB 2WA1A 1EDZA 1G8HA 4HXGA 1U65A 2PAFA 5CTAA 4BO5A 2G9RA 4FYXA 4F92B 4JDPA 1TYBE 4CGYA 1N6RA 4YI3A 4WK4B 3SLKA 3OCJA 5JLAA 4D3DA 1MX3A 5KHOC 2H5EA 4WESA 2C2ZA 3VYRB 2I8LA 2F62A 2FWJA 2XVXA 4PXAA 1FS6A 4K0RA 2L0XA 4KGZA 4XTRA 1D2MA 4L4YA 1WXGA 1PVVA 3K9QO 3D4BA 3A11A 5BW8A 1XMSA 2F1OA 1THZA 3LBNA 2EJWA 1X7XA 1JQJC 1G4UR 3QLVA 2AOTA 1E1QA 2P4UA 4MQ5A 3W5DA 2WIDA 3CGWA 1ZK4A 4X3MA 4AMVA 4D9KA 4RY8A 1KI7A 1X86B 2HJGA 4E22A 2GM5A 3EDQA 2W9XA 4DQLA 1GYRA 4ID9A 3HDGA 5LJLA 3W79A 4HCJA 4ZPXA 2BMAA 2WKQA 1ULSA 3SEFA 3Q7SA 4NABA 1U40A 4N6NA 5DX1A 5C81A 4H7HA 4DLRA 3JRXA 1KOGA 5JC8A 4F6RA 4IIFA 3BRCA 1QE5A 3RARA 2GKGA 1SVLA 1IOWA 1NBAA 1J2TA 1JHRA 1NVEA 1GG9A 2VOJA 3FKSA 1X9IA 1ONOA 2ZCUA 1YONA 4LGCA 3SEQA 5DKFA 4ZTUB 3EXHC 3GCWA 2P2ZA 3M2TA 2O5RA 4UHKA 1N7JA 1TMGE 5KTKA 4ABYA 3FDZB 5DHUA 1B2LA 4ECEA 2HQBA 3N75A 2BMWA 3GEEA 1XCLA 2WKSA 1QCDA 3H8SA 3QVGA 4NWIA 4LDPA 3HVJA 3TRKA 1C41A 5HF8A 4UBMA 5GANK 3VOBA 4JVMA 2ZYHA 3QV1A 5JZVA 2QP3A 3RTDA 5EWRA 1T5OA 1IXZA 1Y37A 2M9MA 2YHBA 4KMSA 4A23A 4C7VA 5B4TA 4TWZA 2JNBA 3Q85A 1W36D 1LVHA 4MRAA 2F8SA 4IX1A 1DQRA 2Y1EA 3UHAA 2H5LA 3ML1A 2R25B 3D54A 2QUAA 4CDNA 4O4JB 3OZRA 4W5TA 3VYWA 3HDTA 1U7TA 1ZNWA 1KFJB 4UHEA 4B80A 3RYIA 4D5GA 3VYUC 4FKZA 4H6XA 4X3CA 4YCNA 2PVPA 4BQNA 1XRRA 1UPXA 2R8XA 1CQXA 1P2SA 1KJIA 3FVRA 4NOLA 4X84A 4GDMA 2WG0A 4F7WA 2CBZA 2ZREA 1RWNA 4URHA 3TN7A 2KSQA 3AEKB 2ACVA 3JQBA 1KMCA 1ULHA 4Q6WA 4UHDA 3WJ2A 4K87A 1SCJA 3OE7A 3PQDA 1E79A 1FXSA 3LUCA 1VL8A 3HB7A 3VR5H 4FLMA 4EQ6A 2ZIEA 3LQQA 2FLKA 2I33A 3E9NA 6NULA 3UG6A 3FNGA 2KBEA 3ESCA 2YWHA 3PC4A 3EWAA 3L77A 3OP1A 3NEYA 3M1YA 4BBZA 4HDRA 3U6BA 4HVCA 1JDZA 1NW7A 3AEQA 3M4NA 5DYNA 5EAIA 2Z6VA 3V2GA 1MB3A 3OETA 4DMKA 2WAMA 3OUZA 4LJ4A 5HY1A 4M36A 1S8OA 2I29A 4C8IA 4L5BA 4ZT4A 1MGPA 2ID8A 4DGQA 4OBXA 2QMUA 3PCTA 3RBVA 2HBRA 3W90A 1KI1A 1OZGA 1SU4A 2B34A 2Y1GA 2OUIA 1DAFA 2RGEA 4OEHA 3NFRA 1L7DA 2J6BA 5C8ZA 3U7HB 4H27A 3VTFA 5L3SB 2OSBA 4TLLB 4DBZA 1XZMA 1ZAKA 3LXXA 2WIAA 4ARUA 4LFAB 3T7DA 3EN0A 2FPOA 2EJUA 3NTXA 3I8OA 2Q28A 3SVLA 2E4ZA 3IPXA 4I8XA 621PA 2JAPA 3PC8A 2K2WA 5CW2A 4XYLA 3T1QA 2WF5A 5EMLA 3L4KA 2QSUA 3IUNA 3HBAA 1THTA 2AL7A 3GFFA 1U8TA 1U0LA 3ID6C 2C61A 4NYIR 1SXJC 1PLJA 3DXFA 4YEDA 2YXEA 3IQWA 1HE8B 3OLWA 1IN5A 2AX4A 1IN7A 2ZDGA 2H8KA 4I1UA 2ZVYA 6GPBA 5JAZA 4QYTA 1YR6A 3GRRA 3TQTA 3WQBA 2J3QA 3QVWA 4CN9A 2JL1A 3ESDA 2HDOA 4HB4A 2EFHB 4LYEA 1SUSA 5AOAA 4KEAA 1L5WA 3F6PA 4JI2B 1CSEE 2J30A 5DNWA 1C8VB 1ODJA 3JXEA 1IPFA 3GLSA 4GW3A 3ZKWB 4ZIRA 1JQAA 1E8DA 3TQIA 2PMDA 1QDEA 3QSYA 2IS2A 1TM4E 2CL0X 2IELA 2BN4A 3C3AA 3SIXA 3KSZO 5KOHB 3KUCA 4MMYB 2CYCA 5TVGA 5HUQA 3URKA 5JRJA 5D6OA 1M1XB 3ZTYA 1YQXA 3NUGA 3MTQA 1M2VA 1H2YA 4ZCTA 1XF9A 3CNNA 5EMHA 1FFXA 1SCUB 1UJCA 3W8RA 1NJFA 1PJBA 2BMFA 5L3QB 2IF0A 5KJ1A 5LQDA 4QPPA 3AL2A 1I3NA 1JQEA 1YE5A 2G17A 5IT0A 2OAGA 4LHVA 1KZ1A 3EVNA 5BO5A 4FKMA 2VCEA 1KIFA 3V7YA 3D6AA 3MJ4A 1GA6A 1I6KA 3Q88A 3CCRF 4HY3A 1Z8HA 3U3JA 4BLWA 2M98A 2OXIA 3R8CA 1R4NA 4HWSA 5JAMA 4D9IA 1C0IA 1GG8A 3J81A 3B3QA 3GLFB 2YNMA 4D9BA 1VQ4F 3SHQA 3USCS 1A9ZA 4YMSA 5KWIA 3CRMA 4X64B 3FLBA 2FR8C 2P9QA 3EFHA 3N9IA 3DZHA 1O08A 2YWEA 1O6ZA 2HP0B 2FQ1A 5CGQB 4ARSA 3AW9A 3L6RA 3E82A 3HU2A 2CMFA 3I05A 1LBEA 1ADYA 1PJCA 2IPLA 2J45A 3RG8A 2X22A 2ZBFA 1XTSA 2DPHA 1M8JA 4DDKA 1I2DA 1L1QA 3SHWA 4JC8A 2WT9A 3OY2A 4LMPA 5K3SA 1GA1A 1XTZA 3OZAA 3S29A 1RPAA 3FUWA 2DWUA 5DHSA 5E1MA 5IARA 2GUWA 1CIVA 1IUNA 3RDPA 3VVMA 1PJRA 3A05A 1J0BA 1GPDG 3K05A 4MNTA 3VZDA 4E03A 2B7LA 1NQOA 4B82A 1RLGA 2H3HA 1T1GA 3WG9A 2IH5A 1JQDA 3DLCA 1CJBA 1FNNA 4YIHA 3ETGA 3W1WA 2V7PA 2CHVA 4BVLA 3QEBZ 3G2JA 3WWPA 2BGJA 1YRAA 5THKA 3Q9NA 1EXVA 3J80A 3AOGA 3HNPA 2PUAA 3R0ZA 3L0YA 4PC6A 5DM1A 3ZWXA 5JXHA 4GPIB 3LMEA 4JXZA 4JUDX 5ESXA 5AW8A 2JCVA 3UBTA 5IZCC 3PEUA 3G2MA 2P2LA 5JMOA 1KMNA 2ZZMA 1J1UA 1CDEA 3KJQA 5FUQA 3L6BA 1L5OA 5G4UC 1RC1A 1YS9A 2QWXA 2WWGA 3CUSA 4G1VA 4U3JB 4Y2SA 4YV7A 1T29A 2CCJA 3LBAA 1RZRD 1E3MA 4IDHA 4DWJA 1QSGA 3JQPA 4U7HA 1QM5A 2HK9A 5F64A 4BMSA 1NY6A 3ZQ6A 3ENZA 2ZUVA 3CLTD 2VPXA 3H8JA 4M9SA 3C39A 4OM8A 4UNIA 4E94A 4K9DA 2JLYA 3KPJA 3DSRA 3MF4A 4JUFA 3JWHA 4PBRA 3WVNA 4XIYA 4YUVA 4E5VA 8GPBA 1SCQA 3DC7A 5H7XA 3LNTA 1T3GA 2ZYSA 3I9KA 2JFXA 2XNDA 2DWPA 5TV2A 1GUBA 4BV3A 4BQSA 4DUYB 1JPNA 5TDHA 3WK8A 4ENWA 2AJBA 3G59A 4LE0A 2AJTA 4V0RA 5IULC 1DKLA 2JARA 5KEIA 2IYQA 4RHAA 1JGTA 2P78A 2DGDA 4QTTB 3RSQA 1WVIA 1AS0A 3IHTA 3PE3A 5DX0A 1NNEA 3HJAA 1ZZEA 3E3MA 4XIGS 3GEBA 4PG8A 3CQ9A 4C43A 2ZPTX 3IA2A 4IV5A 3AB8A 3HDQA 1HE2A 1J06A 5DDIP 5JQGF 3PD7A 1NXPA 3BF7A 2QN6A 1IVNA 3QY0A 2ZROA 5HBRA 2PQMA 4L76A 4MV7A 2OG2A 5FR1A 3O75A 1T8YA 2FWNA 3H2ZA 1NPYA 4E51A 1U2QA 2AOWA 3M4JA 1KAHA 3GRYA 3PUJA 1J33A 4YI5A 1WBJB 1W88B 2WVGA 3AKCA 4INOA 3VPAA 1ZUNA 2GD0A 4IZOA 3IIMA 3PKJA 1HE4A 4HDSB 1QO0D 3SDZA 1QVFF 2H1CA 2BJVA 3LC0A 3F6YA 1K3TA 4KQXA 4Y1RB 3NAQA 3FYDA 3CINA 1HKHA 2P6OA 4HTAA 1L4LA 4BVBA 1CQJA 2PRJA 4HRYA 4HFRA 1NMUB 3OTGA 1PGOA 5EGSA 4A6XA 5H1YA 1DKMA 3T7TA 4CU5A 5TQJA 4P7BA 1MRNA 1EUCA 3GL9A 4MP8A 4YDHB 1YRQA 2BJWA 3JVDA 3TLBA 1E0SA 3H4MA 3NDBB 1N2HA 3W5CA 2XEXA 1LH0A 3TTUA 1QP4A 2IL1A 1K86A 1ZXLA 1WMSA 2R8PA 1PF5A 3F5FA 5FORA 3UJ7A 4BVHA 1BCSB 1D1SA 1MFPA 1USGA 2Q4RA 5AUQA 3FOZA 1G8SA 1NVGA 2AA3A 1ZCBA 3PPIA 1QQ5A 3MFQA 4RSMA 5DRYA 2JGDB 5HCNA 3NHJA 4AJOA 4UNRA 5JCJD 1GZ5A 2IZ1A 2OFFA 2C4HA 3UKJA 4GSLA 4C0LA 4B6SA 4CODB 1RXSA 4FGKA 1XMIA 2WSIA 5CBPB 5COAA 3ELCA 2FN9A 3EGIA 3WMGA 5CHYA 4RD6A 5CLJA 3FHTA 1S8FA 2M32A 4CT5A 1HY3A 3KJNA 2ZI3A 4TRMA 3BMQA 1EA5A 1X87A 5ES3A 4OQQA 1Q92A 3A1SA 4B4DA 2OILA 4AG3A 4CM4B 1CUGA 2P3OA 4G8CA 3EDRA 1FW8A 3BIWA 3PZBA 1VHWA 4AS2A 2ZS8A 4EHJA 3IPLA 1TQ6A 5G4KA 1CBUA 3BVPA 4MYHA 3RREA 3DS8A 1UJBA 4L08A 1IE3A 5DP1A 3FTCA 4RIHA 5HM6A 4QTZA 2MT9A 2NU8A 4WA8A 1GADO 3GCXA 3ZW8A 4L5YA 4AZVA 4JJZA 3IS3A 2GK4A 4EFNA 1TW2A 3DDCA 1GCGA 3NOQA 5E1DA 4BVQA 1XXHA 2ZSJA 3L46A 4G24A 4CV1A 1O54A 2D7DA 4G0ZA 2PLFA 4TV8B 1ZU5A 2FZEA 4TLCA 4QGSA 1FU8A 2ONKA 1VQMF 2V1UA 3PWTA 9MHTA 3F6CA 3F0TA 1R6AA 3DONA 2DQ4A 3QOXA 5F5LA 2XUFA 3PVZA 1BOFA 2ENUA 4AYTA 4BNFA 5ANRB 4YN3A 1RI2A 3KL4A 3O74A 3O4JA 4FSXA 3NDIA 4A1FA 1FE8A 2O8EA 4G9EA 2HPHA 2WYIA 4NJOA 3BHMA 1KBQA 2KB0A 4PWTA 3D0QA 1X8XA 1NRJB 2L42A 1NYRA 4V38A 5EKXA 4NAHA 1N9GA 1WUKS 1ZICA 3A1WA 2W22A 1V8DA 3CH7A 4I14A 3TD2A 2BDUA 3DR3A 5I9IA 4WWHA 1R4MB 1B7GO 1VC2A 2YVQA 3EW9A 3S0HA 4R8LA 1KBZA 2C99A 2W8BB 4RFSA 4NNOA 3VHLB 4Z3DA 3EVTA 1ZJJA 1KPGA 1Z07A 3AHDA 2FEKA 4HWKA 1GV1A 4QGFA 4DNPA 4MS1A 4JC4A 1R8YA 4WZBE 4A4DA 3G0IA 5AHWA 5ED4A 1VJTA 1U5BA 2HQ1A 2WDZA 2X7JA 3C3XA 5KYYB 2PRZA 3EX7C 3VKHA 4HPWA 2HXGA 1ENYA 3EZ9A 3IQXA 2HRDA 1P72A 4UDOA 4PANA 5BUZA 1PNRA 2WHYA 3HI4A 1GFZA 1RHMA 3BGOS 2O8NA 1ZS9A 5TPWB 3VC2A 3LY9A 3W5VA 2XVAA 3H7AA 3O93A 5AKIA 2RBEA 4DZTA 1PE0A 4OB6A 1G16A 2C4UA 1JJ2F 4C30A 2EBHX 3HBJA 3OLYA 1ZIPA 2V58A 4CG2A 2HQRA 1EWQA 4PU0A 3OJ0A 1SC6A 1XN4A 1XHFA 4II7A 4XKJA 5JDCA 3SP1A 2F3UA 1E89A 1I8TA 2P62A 2OQIA 4UJ5A 1PFUA 5HNKA 4X90A 2F8TA 3H9GA 3LWZA 4N39A 4LF5B 3GHZA 3BCUA 3HB9A 3BX1A 3B3FA 3WPWA 4II3A 4A8JC 2FWMX 2YQZA 5B2EA 2WW8A 1SD2A 1XTJA 2BBTA 2RK3A 4REOA 4XYGA 3DGFC 2BFWA 3BK1A 5ALTA 5ESRA 2NO5A 3SZOA 5DE3A 4KDEA 2Z8YM 4U2CA 1HR0B 1JA1A 1RWOA 1XRSB 1ZVJA 4ZXPA 4QBIA 4YJHB 3NWPA 5J5VA 2XRFA 2CN1A 2OKGA 2ZETA 4MAAA 5BSFA 2C78A 2YHUA 4YJGA 2JGKA 2ZRJA 3ONFA 3X1WA 2Q1UA 4ZI7F 4FXPA 2P75A 3TE6A 1MX9A 1W46A 3FKJA 1JVNA 2ETXA 2X5XA 2Y0EA 5L3RA 4Z5XA 1XPRA 1JR3D 2LCAA 3E9DA 4YP1A 1IBKB 3IVGA 1F6WA 1SCBA 3THSA 3K6KA 2AG0A 2NM0A 3OPYI 4QBKA 3D2CA 4N12A 5A6SA 4BPBA 3GRCA 2NPOA 4MV8A 1JJAA 2WVHA 4YJ3A 4V2IA 4JWTA 2H2IA 3OZUA 5IDQA 4C9BA 1RVDA 4MARA 4A8TA 2EW8A 1ENOA 3NAMA 2HXSA 4TTTS 3E7FA 4QUHA 3WGHA 4JXJA 3SX2A 2LBXA 1Y7LA 1YL5A 1H2FA 4Y0AA 4DR1B 3EGEA 4JBXA 3RG2A 5IG2A 1JT2A 1NOJA 1YJNF 3HDVA 4RZ2A 3LX5A 3WDKA 2OHWA 2JLXA 1U3WA 2AFIB 2ZJ8A 1W1WA 2QRVB 4BO7A 4DS3A 2P0EA 5LUBA 1M6HA 2FOXA 5EIOA 2AKYA 1JIUA 2DUMA 1SJ9A 4TXNA 3B1KA 1PGQA 2QUJA 2GXSA 5EJAA 5G1PA 3TWOA 5L3VA 1OH7A 1L4HA 1RAFA 2DECA 4N01A 3CMEF 2RBKA 4BLTA 1YOBA 2X77A 4OLBA 2YV3A 3AUYA 3AGQA 3WZ2A 1NP6A 2ASVA 4IRXA 4X54A 4F6LA 1IZ9A 1ONBA 3GG2A 5IN5A 1TB4A 5CLQA 2CJXA 2IYXA 1L4FA 2B25A 2O1EA 4KUEA 4V0QA 4D3SA 2WU8A 2WZDA 2H4JA 3OJCA 3AVOA 5EJ8A 2QTHA 1G38A 1H3EA 3ZVNA 1CEYA 5ECDA 5K4AA 1GYQA 1ZGHA 4RVHA 4PF1A 4JK3A 1JAIA 2ATXA 4C7MA 1OT5A 3L3BA 4YAGA 3K9NA 2L18A 2PO5A 4G37A 1NYTA 1V1RA 1Z35A 5E6RA 3ZJTA 4BVGA 3GW8A 2YN4A 1KEEB 3KD3A 1ULZA 3P8ZA 1L8AA 3H11A 4GZLA 4RGBA 4INJA 1KVTA 4EW1A 2PKCA 3S70A 1MQ9A 4PYMA 5ETJA 1NV8A 3A14A 3DMYA 2NUAB 1MUUA 1HG0A 5LOVA 1PKEA 3KQSA 1DC8A 2Q3HA 1T91A 1Y4AE 1C1HA 4D0LB 1LQTA 3G6EF 3PHLA 3TW4A 5KVAA 3WLPA 2QN2A 5CVUA 5HRAA 3ANTA 3QVMA 2NMVA 4W5NA 5KSYA 2RK6A 4TKUB 1EP2B 4EVIA 4A36A 2QGNA 4U7WA 4GUDA 2HM7A 4V3CA 3OU7A 4U9HS 4W5WA 5HKKA 5G1OA 2JZCA 3QOYA 4MWSA 1DG9A 2F9MA 4JB8A 1LZKA 1ZG3A 3HJWC 4I5EA 3HY3A 3BK7A 4OJTA 1IH8A 1B8NA 1GSAA 4OSPA 5EXSA 4DB4A 3O8BA 2RFLA 4BVJA 5EFZA 4CMGA 1AN9A 2QEXF 4LS3A 1U7XA 3RBZA 4CVNA 5EJMA 1YMUA 2YJNA 3D0KA 2VDQB 4H1HA 1YRYE 3BE6A 1QOZA 4HI0E 3DMHA 1HEUA 2PY6A 1T9DA 3HGTA 4IOJA 4F4JA 2VNAA 3UAGA 3ANSA 3VXKA 4BU1A 1FYXA 2Z1DA 1X38A 2GKOA 1VJ0A 1LEHA 1UJNA 2X3YA 3IULA 2O8FB 1NVMB 5LPNA 5LD2C 3V8VA 1OLXB 3HZOA 3GFTA 3OJEA 1XPOA 3RHFA 1O97C 3UH0A 1Q1QA 2VHWA 5C7YA 2R7AA 3B2NA 3ILYA 1DBQA 2FZ4A 2HN9A 2PTGA 4FBGA 4KNWA 3HQ4O 2J7PA 1JSLA 1OI4A 3AJAA 4ZQBA 4UFPA 7REQB 2WU1A 2ZWPA 3VJLA 2GNOA 1JIXA 4O1HA 4GS5A 4QLOA 5DGXA 5F98A 2X1HA 1DBFA 2RE8A 2DAPA 1QCYA 4UTVA 2C4MA 3PHCA 3UFXB 1ATIA 3PB3A 3G2LA 3UN1A 2VK1A 4L51A 3P9YA 3MJVA 3LWNA 4HWOA 5A2QA 3B60A 1S3FA 3PGJA 2EYQA 3SZLA 2H2FA 5JY6A 4J0GA 1VXOA 3I4LA 4C89A 4CL3A 3NNDA 1Y3HA 2R1TA 1I6WA 1QV9A 1TEVA 5IVIA 1PSZA 3DC2A 1NAHA 4MWOA 4EMSA 1T1IA 2RAUA 4OXXA 3E3AA 3ECCA 3CJTA 2R4QA 4COOA 3O92A 5EP1A 4GMKA 5J58A 4QNRA 3X2SA 1HDIA 4FINA 4QXAA 1T4DA 2ZS7A 1AA9A 1DJLA 1ZH8A 2VCYA 1MOQA 1IV1A 4GMHA 1H1LA 3DZKA 3IAXA 4S1NA 3VSBA 1CIJA 5AESA 2AXNA 3HC7A 3KE1A 3TFWA 4MKFA 1AQIA 1NXVA 2ATCA 3C4JA 1XQ9A 5C1PA 4RPHA 1G17A 3CCQF 3OQ6A 3JASB 1TZMA 3DWGA 3K96A 1ORDA 5F76A 1C9JA 3VC7A 3RR2A 1TVMA 3BBLA 1S1MA 4DREA 4N1AA 1Z28A 2XZOA 1TJNA 3Q7RA 4ESHA 3WLQA 1O6FA 1VLJA 1KAEA 2A94A 3NIFB 3PNYA 4PW0A 3U39A 4E2FA 2B5OA 3ABSB 4K6GA 3ZOKA 3KOUA 2R6FA 1CPYA 2ZI9A 1A72A 1GPKA 2OHHA 3D7RA 2QYHA 3E8SA 2Q4DA 2UUOA 2DHCA 4X5OA 4KQ6A 4EA8A 5LDGA 3HFJA 1E8MA 3E1GA 5ALRA 2DR3A 4QDTA 4EY3A 4ZVQA 4B8ZA 2XCIA 5J2TA 1G19A 3A1NA 4EP1A 2D8MA 2G71A 4IVNA 3EUAA 2VVTA 2ZJAA 4EA7A 4R1QA 5ALPA 4DA8A 3QNMA 1FVHA 3AYZB 3OZIA 4G67A 3IPCA 1V7ZA 1CUCA 3K09C 1BWQA 4L2IA 3SYKA 4YUYA 4RDCA 2IYWA 4LF9B 2C0PA 2O2XA 5D5HA 5EZ6B 4FTWA 5KAMA 2JB9A 3QPCA 5AVXA 3FYSA 3TF5A 3X3HA 2X7HA 4FQ7A 5F1PA 2LNDA 3STWA 3AJ8A 4NENA 3LYHA 1DGQA 5HDQA 2FW0A 1YI2F 4EHDA 4FOLA 5KTSA 2G6BA 2XKBA 3WGMA 3PNSA 3REFA 4Q3DA 1BDHA 4IJMA 4YROA 3KQKA 5A06A 1EB8A 4MVJI 1IDN1 1E64A 2HHAA 2C9OA 4WX2B 5DWQA 3SX4A 2E5WA 2DKFA 5DNAA 1KDZA 2UZ3A 4KBYA 5CH5A 5ALSA 3SJZA 3WMWA 2CF6A 1V4BA 2HU2A 2FPKA 4WCVA 3SPXA 5FWXA 2IKQA 3QKSA 3AINA 1NVKA 2XPCA 1BE8A 1SZJG 3NC4A 1JKFA 1SULA 3L0SA 4WKBA 1Z4LA 3TXXA 4UOEA 5KX5F 2SICE 5DTIA 2PZ8A 3FXAA 3MD9A 4GHWA 3A4VA 3FRIA 1XZKA 3CZ9A 3NXSA 4K8OA 2PT5A 2D5LA 1V1JA 1SHKA 4FXOA 4K9OA 3GBPA 1GUDA 3H3JA 3IXMA 3D02A 5A05A 2C4WA 5CJPA 2IUUA 3TTSA 3GEPA 3PK0A 4K6HA 1M34B 2XADA 2WA2A 1P2TA 4DMUB 4DQDA 1MR3F 4GPAA 2CNNA 4R7TA 4RPKA 4C0WA 1P5JA 3J81M 1E6EA 3NIWA 1SVOA 1K9MH 3AIIA 3GFGA 3E5NA 4R9VA 1II9A 3AV0B 3ACCA 4RBNA 4F9TA 4CQLA 3E61A 4O2BF 4PYJA 1KAGA 2DM6A 1T0HB 2IY7A 1IVSA 5HGXA 4D26A 3EZXA 4Y8VA 1RQ2A 4RZXA 3ENQA 1IIBA 3OONA 2YV2A 4IIBA 4KK4A 1ADJA 3ENKA 1OIXA 4OLAA 5JNSA 2QQGA 1WZNA 2KM1A 1TCBA 4ZAXA 5SY6A 1RDFA 1GCUA 2B1IA 2WVAA 1Y3FE 4KDRA 3C0KA 4V0KA 3QH4A 3L01A 2KW5A 3NVKI 2AFHB 1IN8A 1ICIA 4TSRA 4FLFA 2QRHA 2JC3A 4GZMA 4Q1CA 5BQFA 1Z17A 3SC4A 2WVJA 3U44B 3FWKA 4EJ2A 5FA8A 2HJ9A 1UFVA 1X1CA 3I72A 2E0IA 3K0CA 5AI4A 4CKEB 4Z7NB 1T5DX 2YC2C 1QIJA 1IJBA 2OAQ1 3BBPA 3DZJA 3EGCA 3AVPA 3FNRA 3IAFA 1VE1A 3G7UA 3MK31 3QXHA 2FB9A 4HGQA 3KJFA 4GLBA 4IQ0A 1N2JA 2IE0A 3DEYX 1U3TA 4QODA 3D4OA 3GJSA 2DF8A 4B3JA 3GLUA 3L8EA 1P7PA 3RVJA 1IK4A 2WP8J 3JZAA 4JU8A 4MPTA 1ST3A 3FPAA 2BR5A 2VDPB 5FTMA 4Q9KA 3VZSA 3FMPB 4BUZA 3O8OA 2FXIA 2BELA 2WEKA 1C9EA 1T9GS 2CLMB 1OXTA 1RXVA 2ZTMA 3M1LA 1Z37A 2AXQA 2GPAA 3GRVA 3IBGA 1KO7A 4KRGA 4Q9IA 4GP6A 3ROXA 3I1FA 4XFJA 3W3AD 1Y82A 4MCHA 4LX8A 3ISJA 1I4DD 2AYZA 5BN4B 4BMCA 3F0EA 3ZWDA 2A86A 2RAFA 4RX1A 5JCOC 4I9NA 2YDXA 1TKAA 2ZI6A 3ZE1B 3KM0A 5E9QA 1G8MA 1QOPB 1EKXA 3H1AA 4EG8A 1QK4A 1QH0A 2BEUA 3DUFA 1KEPA 4CXMA 5CPBA 1JMYA 4R2XA 2A2ZA 1BE6A 4NZYA 4KN6A 4CM3A 2JFOA 1MZPA 4ZCLA 2MU1A 4JLAA 4U7DA 4ZOBA 3LHSA 1T6YA 5K4HA 3ZQ4A 2H2AA 5BW6B 2YXNA 4ARIA 3GFPA 4EWLA 5F4ZA 1S01A 3OFNA 3C3YA 4K81B 1YVPA 2R47A 2R00A 3G8YA 4PG6A 3PQFA 1UBMS 1ZOIA 3ZWOA 3ZWAA 4E5YA 1RMTA 2I7CA 3KLOA 2NVUB 4NJMA 4E14A 1NR7A 3VH4A 1M1YB 1XRMA 1F3OA 2QJFA 4ZAWA 5TXGA 3HCOA 2OTMA 1N6PA 4KLRA 4DDMA 3NU1A 5JZOA 1DBVO 3N74A 2IXEA 3Q1LA 4I5FA 5IM4A 4G1BA 3W8DA 4FHFA 3RLIA 3WWCA 2G0AA 3GT0A 1F38A 3SVZA 2YV4A 1XSEA 5AVQA 2LE0A 1ZN2A 2BFBB 2JFFA 2ODEA 4L0DA 4Q00A 3CC7F 3RV4A 3RF7A 3BEDA 3T6KA 3IEKA 1OYYA 3X1ZA 2WB4A 4YUZA 3VNAA 2PX3A 2EEPA 3N70A 5JE8A 5EPUA 1KDOA 4UCQA 1YHZA 3W6PA 4B62A 1HYQA 1QJCA 1M1UA 5CT6A 4ZHSA 9ATCA 3ORFA 2WMOB 3RS5A 3GLIE 1DSSG 1WBDA 1DJPA 5EKUA 3HWSA 1WUIS 4U5XA 3RVNA 3GFRA 3MNFA 4JNCA 4BJ5A 4BQIA 4TLMB 2NVWA 2O9JA 2WTXA 3NHPA 3WB2A 2X0NA 3USZA 3REGA 4QYXA 5I3CA 1SUWA 1Y6GA 2AF4C 4JJ7A 1J2UA 1K8YB 1X25A 4N49A 3DZ8A 1KMHB 5I8PA 3RH0A 4BFSA 4LI3X 4B75A 5LNK1 1GL3A 2IOFA 4N40A 3CCEF 3FTEA 3ZZUA 1A5TA 4INPA 1UZMA 4IH9A 5CXUA 1P0FA 4V1CB 3U49A 3LKZA 5EFOA 3M3DA 3LDUA 1B43A 1RXEA 3WGYA 5KTOA 3M84A 1NX6A 2HMTA 2G70A 5DXFA 4HQKA 5FPSA 2OXTA 3PDIB 3TZKA 4X8LA 5JW6A 2VUTA 1BG6A 1Z83A 3GAAA 3RVSA 3ZJVA 4NJEA 1FLAA 2PUJA 4MQUA 5CAEB 4PIMA 1O9HA 3V34A 3GBSA 3I09A 4B40A 3HLTA 2A6PA 4XQEA 3JQ9A 2JA1A 4UAVA 2C2MA 1FQWA 4PO8A 4QSHA 4PYOA 3QVXA 5B3AA 3WYBA 1NUQA 1BIFA 5JMPA 1OTYA 3WGNA 4GWGA 1I3LA 2B8TA 5A7HA 1C8LA 2XUAA 3ETNA 3NHUA 1YUMA 4WESB 2H9IA 4RXUA 2XJ4A 2ERCA 1RBYA 1SBHA 1HA3A 1YNOA 1KJZA 2YHIA 1OZAA 4JJGA 3P2EA 2XT9A 3KKLA 4BTLA 4NS1A 4YFYA 2VAWA 2H6EA 4QNNA 4IQFA 3K9GA 3K16A 4B3DA 2O54A 3AF5A 1YQEA 3NANA 1X7XB 1DZIA 4OY3A 5SICE 3FB1A 2AOTB 3U7RA 2XUKA 1M2NA 2MTBA 1XP5A 2V55B 3A2MA 3AF3A 3PNOA 4FYVA 1X8KA 4JKYA 1ABBA 4J7AA 4JLOA 4IIEA 5HS6A 4Y2GA 1ISSA 3CF4G 2OM2A 1RJGA 2J67A 3PRYA 3ON5A 4P98A 3TXYA 3ABOB 4CQJA 1SKUA 2CKDA 1VBKA 4TLEA 1NXSA 2QPTA 3IALA 3VIUA 5FTLA 1RTKA 3QWIA 2K4MA 1CX9B 4JN6B 3Q9UA 2G4CA 3LUKA 3VSDA 3O5AA 1KTIA 1NVVR 2YRWA 3HPQA 4F9GA 4F6RB 3NCHA 4LYDA 3V97A 3VNBA 3WO0A 2BBSA 1ZW1A 1FFAA 2J9ZB 3CEJA 3GRFA 3E03A 4G6ZA 2DQSA 1IB0A 1VGQA 2A7XA 3RS4A 3KYCA 5CURA 3KFVA 8ABPA 2AMFA 4KXWA 1Z6GA 3EZFA 1MQSA 3AI1A 3BFJA 3QVGB 4B3XA 5JSUA 4HNRA 2FP4B 2R5NA 2I4TA 1DEAA 3VI3B 3RVQA 3FMIA 1DEHA 1GRVA 4FCTA 4P3YA 3T1VA 3C6QA 2W2OA 4DJEC 3WXMA 1MDBA 3F9IA 1FTWA 2ECQA 3IVXA 2DJIA 3ILXA 3QW2A 4BASA 3WA6A 3IEIA 1EGHA 1OI3A 1YRHA 3L6EA 3WKDA 5B3JC 3LUJA 1YBAA 2VHCA 3U3RA 3BREA 1U8ZA 3AERA 3IP5A 3KHSA 3I9V6 1PJAA 3U3ZA 3RYIB 2J6HA 5D3MA 4BT7A 2Q0XA 3GCZA 1TO1E 3NQ41 4OBBA 2G6TA 4XWKA 2FG5A 1GAWA 4B46A 1WF3A 1W75A 2CB9A 4BNIA 1Q0SA 1T9CA 4DCVA 2XUPA 3A4LA 1YASA 4KNVA 4FFRA 2HRRA 1XZLA 3RRXA 5L53A 3TGPA 1JUDA 4H18A 2JKVA 1J1ZA 4WL0A 2C4KA 1CR4A 3GDGA 1W6RA 4OA8A 1BMFD 3JSXA 1VBMA 3MSXA 3OQIA 1TRKA 1WHSA 4IZHA 4JQZA 1USKA 4KGXA 1L3IA 4EQ6B 1PFKA 4A0SA 4BE7B 4F0JA 3DNMA 1T4CA 3MUFA 2ZIVB 4R8KA 3C3DA 4EFMA 4ZWNA 4U2BA 4AW9A 1QHHA 3S2ZA 1A7KA 4HDRB 4W5QA 1GM5A 1KTVA 2HRQA 2MYNA 3AEQB 1U1DA 4L8WB 5FL3A 5K8TA 1JHXA 4IIDA 4AQYB 3ZUGA 3CUEF 1SZCA 1JQKA 2P68A 2QRZA 2J87A 2V6IA 3DF7A 3ZBQA 4EG6A 4YAJA 3VV2A 1VBFA 1AMOA 2Q7DA 2TMKA 4AB1A 5BSWA 2HCBA 3W2EA 3PCXA 2N47A 2JH8A 4FZJA 3VYTC 4IMJB 4PV7A 4YRMA 1EBFA 2Z9BA 4UU0A 3D6NB 2R6DA 3ZXXA 1Y4DE 4LC1A 1L7VC 1NYLA 2WJ4A 3TNJA 2EL9A 4I55F 4D0SA 3OE5A 3CRW1 4MX8A 5AH0A 4EI7A 5B5SA 2YRXA 1JDSA 4UATA 3T06B 3ZIDA 1K92A 4MPRA 4R71A 3GRKA 3RTEA 1N7HA 4JJIA 2YY7A 1ADCA 1EDOA 1E9FA 1W0KA 4Y2YA 3K70B 4UBKA 1DRVA 2AZTA 1JDTA 1V8ZA 3BJZA 3SM9A 3A27A 3QPUA 2QJRA 2Y4NA 1P18A 4YC7A 3B8EA 2XBUA 2IT1A 1RVV1 3VH1A 5GOZA 2HX1A 3GHHA 2VOEA 4M1ZA 3OC0A 2OFWA 4NCHA 2D5AA 2QY9A 1X1RA 1H4SA 4KQ9A 3OX2A 1G2IA 4ZIRB 3BMNA 2A0FA 4TUYA 1YQTA 2BSXA 4H7EA 4PRYA 1Z5WA 4UVGA 5EE9A 3VJRA 4FNAA 4TTPA 4NX2A 1OWMA 4WBSA 5JXJA 1YDFA 3G9TA 3I04A 1VQNF 5DX8A 1HFJA 3RFUA 1KQGA 1KSJA 3SBDA 1M2VB 5LA6A 5C1BA 1XBTA 3L93A 3W77A 3O4HA 3ORHA 2PTHA 3RBAA 5ITSA 1PYGA 5DBEX 5LKAA 1JEAA 3C43A 4R8RA 5EG5A 3WLHA 1H0RA 1WW3A 2IQIA 2Q4TA 2QZJA 3AO0B 5JSQA 4N47A 5KJ6A 3ULKA 3VNUA 4KKXB 2JI7A 4WVFA 3G7SA 3M4SA 2QU8A 4QHTA 1HLGA 2AC7A 4G1FA 1R4NB 4TL9A 2AOXA 1CUAA 3NATA 4M9RA 1FSGA 2QGFA 1Z5NA 3E9EA 2DU8A 1QBGA 4O5OA 4P4TA 3LSTA 1U8XX 1R0SA 1SVKA 1U3UA 3IEPA 1T5HX 4H15A 3SDSA 2UZ4A 1XHOA 1FW6A 1S2LA 4LWZA 3EGDA 1VDMA 4R6XA 5BW5A 4QYIA 4NE2A 1ZIOA 5ALIA 3QJYA 13PKA 1JWBB 2CCKA 4Q03A 1D0VA 4P0QB 2XSZD 3LPAA 1GGMA 2ZB8A 3FPSA 2SECE 3E15A 4J76A 3TDKA 4B45A 1A9QA 1KRXA 5AUOB 3L8DA 3QU4A 3HUUA 3PDUA 1NUHA 5FO0A 4AICA 4LF6B 1W4ZA 1P6XA 2IYSA 4Y2XA 2ZJYA 3DBIA 4A7PA 2A92A 3AQ4A 4GLFA 2Q9BA 1GRCA 1MOZA 3K4PA 2Y71A 4MINA 3NHYA 1EWRA 2G5PA 2WIKA 1XZAA 3ONWA 4LN1A 5AKKA 2DSTA 3FMGA 1U0OC 4IXMA 4GMXA 4OQYA 1D6JA 1EJ2A 4OQ4A 3DLBA 3UT5A 1A7UA 1KYVA 3QVSA 1Q0RA 1RQLA 4MKHA 3AILA 2ZIXA 4IGIA 4EJSC 1QZUA 3ANLA 2PWBA 3JR3A 1V8OA 4IRUB 3DMNA 3KT0A 4NZPA 5FOVA 5JADA 4DLLA 4HLUC 2GN9A 3GCDA 4CG3A 4RC9A 1FDVA 5C31A 3V1UA 4YRDA 1FA9A 5CNJA 4I1PA 1B4DA 2OPBA 1VSQA 5DH9A 4REMA 2X0FA 1S0UA 1X1EA 3D31A 3H4VA 4H7FA 4HMQA 1LRKA 3I2HA 3C8ZA 3U62A 4DQ0A 5AVUA 5AQ1A 3QFCA 5U4QA 3UH1A 5IYZF 1U43A 1Z5GA 2VYQA 3EMBA 3EY9A 1XAJA 1CZLA 1JSZA 1S4QA 2B37A 1U94A 4FHZA 2B8NA 1P19A 3HJGA 2CFTA 1TYCA 3M3PA 4OHUA 4YXWA 1JQ5A 2NIPA 3OTQA 4RVGA 1DXOA 1IEVA 1YQDA 1Z2AA 1UEJA 2PUTA 3AG6A 2FVYA 3FH0A 4MWBA 1MTZA 2PGNA 1JSRA 3DDOA 5LQSA 2AEEA 2VYFA 2JCYA 3JRWA 4Q9HA 3KXIA 4BPRA 2QLMA 3C4VA 4YRRA 9LDBA 3WL6A 3MJFA 5HIAA 1AG9A 1E2JA 1MRSA 3AU8A 2JLRA 1KNKA 1I6MA 3FYHA 4AYWA 3C3PA 3KRTA 3VSCA 5JIBA 4FYHA 4P0PB 1C30A 3WRWA 3HKEA 3NIGB 3OT4A 4XW2A 4EARA 5JFGA 3HA7A 3IQHX 1JFRA 1N1DA 1IJEA 1UBGA 3HWWA 5ILGA 3ZZMA 5HZHA 5A2QM 3OZSA 4O59O 4Y9UA 4C7OA 1V5GA 3JWJA 2SKDA 4JP2A 4R7ZA 1L7NA 1BH6A 4GVLA 3G0OA 1XJ5A 4AKSA 4CM5A 4PHHA 1LJ8A 3T1HB 2XMSA 1IVYA 2IOYA 2R86A 1ZYUA 1UIMA 2WI8A 1W40A 7YASA 3IQDB 3JQGA 4UMVA 1ZUNB 1RS0A 2XMBA 3NW9A 4H0NA 2E82A 3IL2A 4MV6A 5BNZA 2NZVG 4LJ5A 7GPBA 1CF2O 4ZHWA 2OFOA 3R0XA 3WK6A 4QATA 1F2TA 1VBNA 1DARA 3LT4A 3LT0A 4Q4LA 3DZGA 1OMOA 3SSOA 5FWDA 4DSOA 1Q6YA 4RTRA 4IL5A 1Z6XA 4NXNB 1SQ0A 1U0HC 1ULBA 2FRVA 4AZWA 4DIDA 4OBWA 3UWPA 2A1IA 4GM1A 2WHEA 3ASUA 3MWGA 1X2EA 1EUCB 3TM5A 1VG0B 3F2VA 4L9RA 1XNJA 3HFRA 1NU6A 5KVQA 2CJYA 1NP7A 2F4NA 3RAGA 4ER0A 3LQYA 3HMQA 5FBHA 3P9SA 2FPLA 3HSKA 3NALA 5GV7A 1K9VF 2C3YA 1M75A 3NBFA 3UO8B 2W2NA 2GD2A 2J3EA 4E5UA 1BO6A 4ETMA 2XQGA 1RYYA 1TZCA 2VP3A 3L0OA 3M6VA 4BGUA 3VR1A 5ALXA 2N48A 3SM3A 3L7IA 2HSGA 5BW4A 1MH1A 3B53X 1XMPA 3F3KA 3LLVA 3L7AA 4HK4A 5F7JA 5KCZA 1GDTA 1FMLA 2TMGA 4DLSA 4LSMA 4J1SA 1USUA 3KB1A 1X1AA 4XVCA 3GLKA 4RTSA 5CNKA 1R5JA 3RS3A 4G4VA 1U31A 4GR9A 4DSUA 2DWCA 3JVIA 4B09A 1TKCA 2JLVA 2BZ1A 3EGVA 1SUEA 2B8WA 3IJ5A 3PDCA 3WL7A 5ALMA 2QTVA 4TMFA 3WV5A 2QLNA 2GGSA 4Q7MB 1L3BA 2IQQA 1SC3A 1G9SA 4Q24A 3ZW9A 4GYJA 4D4IA 4E46A 2ZWIA 3HCDA 1RZVA 4QXQA 1Z68A 2BEVA 4LJLA 2FR1A 1KAOA 5G4KB 5KREA 2IYYA 2CXTA 1R00A 4AMYA 4E5MA 3VR6A 1K8ZB 4DLPA 2NU8B 1D2NA 3NHFA 5KYNA 2J08A 4LRQA 4UVHA 1E3EA 4OTZA 1ZMRA 1XXHB 3VR2A 2VAPA 1N1EA 1BJTA 2GPYA 3HWUA 4DV0B 3D43A 2IGBA 1DWPA 1L6IA 3H5IA 3OPYA 4Q3OA 4RCZA 2GEUA 4UMEA 1H2AS 4L22A 3TAHA 5LFAA 2JW5A 1YACA 1ZX1A 2QV0A 3H9JA 3K92A 4OK5A 4S35A 4AKEA 4DCCA 2DY0A 1BGVA 4JHXA 4RYDA 1ICEA 3FNFA 3JVEA 1ZEJA 5JAPA 3UKOA 3QKWA 4UAJA 2O8EB 2HCFA 4NAVA 5KHAA 4ZYXA 3CCMF 2JFUA 2RONA 3PEFA 1EZ4A 4F3KA 3QWHA 2P6MA 5HQ3A 4MXDA 3VR4H 1YFJA 3PQ8A 1N9GB 3NBYC 5AM3A 3ZGVA 3SOPA 2QLFA 1GO0A 1EHIA 3DW3X 1O4WA 1YXMA 4IP0A 4BX9A 3CH6A 1BWRA 1TFUA 4LG1A 1WCXA 1MJHA 3K6RA 1WJGA 1CUDA 1ZI6A 1XD8A 3EE6A 3QU2A 1NC1A 4YT5A 5JWHA 3WLEA 4FYPA 1P1HA 4MS1B 2Q29A 4EKYA 3LBYA 4OF4A 4QM7A 3E4CA 3K1ZA 1VFNA 3PWSA 5CNMA 4GXTA 3U1VA 5I7VA 3FCAA 3MB8A 3CCLF 2XBMA 1U5BB 1VB3A 4HNAA 2X9GA 2OPHA 1ECFA 1WOYA 3MWKA 1Z39A 2O3JA 5K0TA 3RS9A 4DXDA 5AJWA 4UUPA 2WJGA 4FDTA 4C4WC 5DHQA 1WDWB 1XKXA 2PKYX 3CVWA 5C80A 1W36C 1KJ8A 1IQUA 4LV6A 4AIIA 1UAAA 3EXIA 1CS0B 4X00A 2CHUA 5HY0A 2VLIA 3TW0A 5KU1A 3UUFA 5GMOA 4KFUA 5BYBA 2PLNA 4TWBA 1E2MA 1TX4B 2A9RA 2NVBA 2QRJA 2VCHA 3CNLA 2PSHA 2QZPA 3I92A 3IE2A 3NASA 4JP5A 3WK7A 3CW9A 3WWZA 3LECA 1HMYA 3WWDA 1EX7A 5AKLA 1XE3A 2ZQ5A 2YZ2A 2PZJA 4JENA 1XZIA 2Y9MB 4ZRNA 3UMRA 2V9ZA 3HVKA 4NV1A 1NJ1A 1KOFA 2IHTA 4HNQA 1A8HA 3IP8A 4NAUA 3QYAA 1E9CA 3DKRA 1HT0A 3IBYA 3OCWA 1K1EA 1XTQA 1SCNE 2FSUA 3AM5A 5AJYA 3VVBA 3KKMA 5ALYA 3ETEA 4DLVA 4JY7A 2WHXA 5BSEA 1JEEA 1CLIA 3ENNA 4YJGB 4UHFA 4GL2A 2VF4X 4I0WB 4YO8A 3MJHA 1N2OA 1FFGA 1NBMD 4L5IA 4EB6A 2UYHA 4O3MA 4XIFA 3TG2A 4LDNA 1OI2A 2VBGA 3LDAA 4UREA 2H00A 1RJ9B 1EGAA 2CVPA 3U40A 2PPVA 5CCDA 4S12A 4BNMA 4D4MA 5B58C 1JLHA 3NBXX 1IZZA 2Q41A 2JBHA 2ZLBA 2XE8A 4YJ3B 2W71A 1E9VA 4OYLA 4TWAA 3A0RB 121PA 1CD5A 2VHTA 2GNAA 3UMFA 1GNVA 4RKFA 4L8FA 3ZHZA 1I7SB 4HR7A 2DZDA 4IUBS 4D0RA 2B0CA 4N8EA 1G66A 1RCFA 4GMDA 4TM8A 1OXUA 4ERHA 4ZZ3A 3LA6A 1UH5A 4WFQA 4TZ0A 4F4FA 3ZW7A 4L73A 3EVEA 3ZHQA 4KK3A 4QUEA 2C3MA 5DGIA 5FTNA 1BS2A 4PZLA 5FKJA 3LL4A 1N8NA 1CQPA 2XOEA 4IS2A 1QU3A 1SC9A 5I8WA 5K8CA 3GA7A 3WRXC 1NNSA 2I7XA 4HRVA 1NP3A 3H13A 3X1YA 2K7FA 4K6CA 3TCXB 3C1AA 3LA8A 1DBPA 4BO4A 3TSAA 3QXXA 4XFDA 1PL6A 1ZSNA 3QP9A 4KXNA 5I45A 5ALEA 4EVSA 1IY1A 1NQTA 4JBIA 2PL1A 4R40A 5AVRA 3TLXA 3JATA 1U0RA 1LK0A 3CRQA 1T0PA 1GEEA 4QJIA 1HTBA 3OA2A 4K9NA 2R6ZA 3ZD6A 4ME6A 1V1RB 5E6RB 2IIVA 1YC2A 3QBTA 4BOYA 5K3FA 3H11B 3VOAA 1NKTA 3SR3A 4MTLA 1NG1A 2GX6A 1RM3A 3C3CA 5EPEA 3JPYA 4LZJA 5ARBA 5LIRA 2WTBA 1Q0QA 1GZ7A 4B2PA 3FYTA 3BYZA 5LOVB 2PGDA 5EUMA 4TZTA 3AVWA 4KH0A 2ISSD 1ZGJA 3KUKA 4FNOA 3S2YA 4HGNA 3ABRB 4Z8YA 2LCIA 1W0KD 1V5IA 2G5CA 2Q2NA 3HB0A 3S3TA 2J5RA 2INGX 2BKAA 3QLUC 3RRYA 3JY6A 1TF5A 1X7HA 2CDAA 1W44A 2RHMA 3B13B 1NPTO 821PA 3BSYA 4O8ZA 2NXEA 4LXTA 2P9BA 1FRZA 1Y4SA 2CJFA 1OFTA 4WCFA 4UUMA 2CJWA 5GJVC 3LFTA 4YP9A 4EYGA 1IBCA 2I1QA 3A2LA 3IP7A 1K63A 1KI9A 3DP9A 2ODQA 2P4HX 1MO6A 3JYPA 3RC1A 1M0EA 2H8CA 1PS0A 3FAKA 2B36A 5E0OA 5EE5B 2CEAA 3S81A 1KOJA 1ZM4A 2HNKA 2PH5A 3NT5A 2II6A 5DIZA 1ECBA 3CISA 2JD1A 3SS8A 2KG4A 1V43A 3THOA 3ZJUA 2ESRA 2UYQA 4BEBA 3A70A 1KZ7B 4NBLA 1GDHA 1CUVA 3GEHA 2MSLA 1N1MA 4UARA 1QG0A 3H5LA 3CCFA 1I2CA 3I12A 4MLPA 4PSCA 4FHGA 2FXVA 5BN3A 1FJXA 3GGOA 1U8YA 3HCPA 2AJ8A 4TZZA 2OD2A 4M2LA 3WHPA 4X1IB 4ER5A 4PNEA 1YR8A 2IWHA 2G9ZA 5JS1A 4ND8A 2CK3A 5CCEA 1XQYA 2GILA 2HWXA 2UVPA 3IDFA 1E66A 1I5RA 4K05A 3I2GA 4MCJA 2DG2A 3UZUA 4DBLE 4NTZA 1G3UA 5DP2A 5ELLA 4MVJA 4OYYA 3U61B 1SNYA 4PRKA 4G2NA 1TNDA 2UUAB 3FSEA 4QTXA 3AUTA 5BP7A 3DPUA 4JCOA 1LBQA 2L82A 3RK1A 1F2UA 5K9ZA 3VDQA 1UM9A 2W2VA 3JRNA 4UAGA 1RRKA 5G0TA 4CLHA 5D84A 2WM9B 4J3FA 4S1VA 1KAMA 3DQQA 4FFOA 5BWCA 1F12A 3TFOA 2NQ8A 3F9CA 1CULC 3S2IA 4EKIA 3UB4A 1ZGAA 3CLTC 2RCNA 3GARA 4IYRA 1C3OA 1JNYA 1G3IA 4Q1AA 4WXHA 2OV6A 5E4FA 3TKYA 2YR0A 3VZRA 5EN4A 4RLHA 2ZCJA 4BO6A 1UP6A 4G26A 3KZXA 2R1TB 3BRWD 1X7WA 2BT4A 3IR5A 4R1OA 2H48A 4MR8A 2OEPA 2JANA 4YJ2F 2I7VA 2OMEA 3NTVA 3DB1A 5LZ8A 2JJ8A 1JL3A 3DKIA 1LW6E 2NTNA 3AGKA 1ZWLA 4CWAA 4F3NA 4FDUA 1MKYA 3EWIA 4F4IA 2P77A 4O6VA 4C0BA 1G5HA 2A9VA 3TL2A 4Z0PA 2XT6A 1DKNA 1FX1A 1QHXA 1H1LB 3A31A 2GEDA 3ORSA 2CY0A 4NQ3A 1G60A 1Z3CA 3IFSA 4GXNA 4PVDA 3RVMA 4WLUA 5JZBA 2QYSA 4YGYA 1VCIA 5I9NA 5ILOA 4O29A 3PDJA 2I0FA 3KOZA 5K3BA 1QO9A 4NCXA 3H5WA 3UVEA 4JUCA 1PWYE 2YYZA 3KE9A 4J0IA 4XUGB 4D2IA 5BV2P 1IZ7A 4QJ4A 3BYQA 1MHTA 4FD2A 1R64A 4IZ6A 1ZH6A 4TN5A 5M3BA 3RTGA 1PFQA 5BY2A 1GKIA 3MJDA 3N58A 3P9KA 3FD6A 5ALJA 4AX8A 1QLWA 2C5HA 2GTIA 4MICA 5IKOA 3LW8A 4ZHQF 1WP4A 3MOIA 1CYEA 1G7RA 1OV4A 1WY5A 1VQ1A 5CDFE 1T43A 1SBYA 4ZDIA 5L45A 2EF0A 3R0QA 2GJSA 1YUNA 1XCBA 1ZUHA 1W4RA 5J2TB 1MN6A 2XCUA 1YAJA 2ZATA 1FP7A 2J32A 2C98A 1ECPA 1BVUA 4KGDA 5I7AA 5J9FA 3KQWA 4FZ3A 3GRZA 4L2IB 3CT4A 3ANMA 4D43A 1OV6A 5FDFA 2AJCA 3AZOA 3RS0A 2BRUC 1VSUA 4RZSA 3KUXA 1L0BA 2YXPX 1UXHA 1L5NA 2LV8A 1ZRSA 2MSNA 3CLRD 4NENB 4J16C 4BGDA 3T9BA 1O87A 2H92A 4R83A 1N0UA 2BCEA 3IJEB 3P4UA 3VC1A 4G23A 1RI1A 4PHGA 1COZA 4Y7CA 3TEFA 2WIGA 4ZI5A 4MPJA 1L5FA 3OJXA 4QDOA 4HYEA 1BEEA 3IO3A 2HU5A 4B3RB 1JDBB 3INTA 4G0QA 1ZOSA 2DRIA 2X2EA 4PNZA 4YRZA 3PTAA 2O7SA 5FWXB 3KR0A 3I04M 3HCEA 1XLTC 3SNKA 2J6CA 1ZOLA 1OXVA 4EGQA 3L02A 3QM1A 3HYTA 4LMAA 1Y5IA 1SHZA 3TQCA 5T5QA 4EPTA 1G6Q1 3GLFE 2GN4A 1FVXA 3M8KA 1W41A 3BWYA 3PSAA 2HXYA 4BP3A 4AWBA 4ZDKA 5SZIA 1KYIA 4A0QA 4CZ2A 5K0BA 1UI9A 2M6RA 1WXQA 3ICQB 1M6YA 1VPVA 1ZOOA 2Z98A 4PSVA 4A9AA 1DJMA 3D5EA 3EIQA 3D8UA 1H2RS 3FDXA 4NZMA 1I36A 1ZD4A 4NMHA 2GF0A 2GXUA 1LDMA 1PK7A 1U9JA 2RH5A 3M9LA 1QU9A 1FJHA 1WA5A 2O48X 4NI5A 4L3OA 4CQLB 4HATA 4A2CA 3V8RA 1ZHHA 3FGZA 4K88A 1OGJA 2EWCA 3BTVA 3DMTA 3KFLA 3EIFA 5TS3A 3VHQA 2NV6A 1FUYB 2G1KA 4OGLA 2IBTA 4H35A 3NM6B 3OO1A 2FKNA 4KJXA 4G88A 4DIOA 4EW2A 1UF9A 4TMYA 4E13A 3MWDA 4G5YA 3VR0A 3SIRA 2PX0A 3F0DA 2X0IA 3W7AA 3NYRA 1J20A 4I3GA 1SC4A 5BVHA 3LVFO 2A9FA 1EG7A 2YY6A 5FR2A 5A4MS 1LV8A 2E89A 3RIXA 3IGFA 3W3AH 2JS7A 3KQMA 1KS9A 2QVBA 5K0JA 4FEYA 1E3WA 2QX6A 2FSSA 4J07A 4Y6LA 5B30A 1ISIA 2CMGA 2XA1A 3UMGA 5CK5A 4F2DA 5EB1B 1I3CA 3C6MA 2VS1A 2CLOB 3BWVA 3FNBA 3FZYA 4N5NA 4RAOA 3WYNA 4DQKA 2A5FA 4EHIA 1GNRA 1Q19A 2VSYA 3O8OB 4KG7A 5B8FA 3TKLA 1NUPA 1ZCZA 4O4IF 4C05A 4MUNA 5MFZA 3DCNA 5H3CA 4DR5B 2C9DA 4W1QA 1SD1A 2F6RA 4MV0A 4EG0A 2C8LA 1NNI1 2BP7A 5JT1A 1W96A 4ZARA 4WOKA 4C7JA 4OREX 3ET4A 5H3HA 3VR2D 4E5PA 3NK7A 4K86A 3WHKA 2QZZA 3FUXA 3Q0TA 1XU7A 5HOQA 3G89A 3QQPA 1AGYA 4HP8A 3DUFB 2BEUB 1CZOA 2X2OA 2HFJA 2P9YA 2IV7A 2Y1DA 1HSOA 1L4KA 2OGWA 5B2FA 3ESAA 3EUFA 4O4LF 1A8SA 4Q02A 2GBPA 3GZTB 2ZT5A 1XTRA 4CJXA 1MG5A 1XMOB 4BDTA 4YYEA 1VL0A 5IXYA 5K09A 3L0BA 4E1BA 1E92A 2R87A 1UJ4A 4YJFA 4E7OA 1V45E 1SKQA 5JAIA 4D4LA 1HETA 1TF2A 1H6CA 1VH8A 4YWHA 4AZTA 4CCWA 4D74A 1TPZA 2XGGA 4UQOA 5LDHA 2W6MA 4DR7B 3QFFA 3Q5DA 4NJMB 3GWZA 2WB2A 3MCTA 1KEVA 1TZBA 1SXQA 2VF8A 1ESZA 4L85A 5THQA 2C9ZA 1OWNA 4URZR 1XNQB 4ZA2A 2HA6A 5BT9A 1GLNA 1C7ZA 2BIFA 4UE2A 2OL4A 3E2PA 4C20A 4B4UA 1T1JA 2PNJA 2Y1XA 2VO1A 2YZKA 1QVAA 3BTUA 1MT3A 2NZ8A 3TZCA 3O2JA 2VRBA 4BX0A 4OGGA 5CG1A 2BHSA 4AMZA 4LHYA 2RC6A 3HVHA 4W63A 3OWOA 2FY8A 3UF0A 4GI2A 1E62A 2KTUA 4QPDA 2CNOA 3NT4A 4RVDA 4WGFA 4DLBA 4YAKA 2C95A 5IH3A 3K9CA 2EF1A 2FGYA 1NJ8A 1SG0A 4KUGA 3S0JA 3UMJA 3ZE8A 4YPVA 2OO3A 3KKZA 1NMYA 1PD0A 2E3JA 4F3RA 3HI6A 1J5XA 1KQOA 3M6AA 1XMJA 2O05A 4URWR 3RSGA 1JXMA 4QBFA 1EVEA 1ZD2P 3SHVA 5LP6B 4DA4A 2WBLC 3B12A 5EE0A 1DCMA 1LPNA 4NY1A 2R2GA 1RYFA 3JWGA 4LJAA 3K14A 1I9GA 3P9PA 4TZKA 3KOYA 2ZE6A 4WSOA 4WY2A 3HO6A 3K0BA 2EQAA 4KYIB 1FSZA 2PEYA 1UOPA 2HA7A 4MR9A 4F2WA 3JAMA 2FQWA 4GSYA 2ODPA 2G88A 4BX3A 1YQQA 4C03A 3S1SA 2FEOA 1XD9A 5AUPB 1ZPDA 3B78A 4I8DA 1GPWB 3L4BC 1ZFNA 3SYTA 2NW6A 4D8YA 1UFYA 2M2IA 3PF9A 5EGNA 3Q8MA 1DNPA 3GH1A 4FGSA 4I4CA 3VTIC 3I8XA 3B9RA 4FR5A 4NJEB 3U4AA 4LF4B 3L0IB 1F5SA 4X66B 4KAJA 2NMUA 3TLKA 2IEDA 1EUQA 2NADA 5ESWA 2QM7A 1WQ4A 1K9SA 3BGDA 2WFAA 1WMAA 2AE2A 3OQJA 2QPLA 4FHCA 4ZOLA 3OU6A 2F43A 2I55A 3QX3A 3IQFA 3OM0A 1N3IA 2QR5A 2JLUA 1MNAA 1TMKA 4M7WA 2GYYA 2JGEA 1QGDA 4RH1A 4EG1A 3PXEA 3AEUA 2ZYWX 3ZJ5A 1YZ3A 3PQCA 1G7SA 4WY5A 4M53A 3KV1A 3OCCA 4IKEA 2CVZA 4GM0A 2P2DA 5K3OA 2PS1A 4D8TA 4JLDA 1UOOA 2BGUA 1AE1A 3OD1A 2WJJA 1VHDA 1N78A 3T34A 1E1RD 1YUBA 4GNRA 5B1SA 3F4LA 3ZDAA 4P92A 4OHYA 5JQGA 1KL7A 1NUSA 4B8WA 4JLWA 3A1DA 3W7VA 5GONF 2A78A 3BRSA 2FFQA 4TMVA 4U02A 5D3QA 3ROGA 4KV7A 2ZBVA 4ALLA 5A4KA 2MSDB 4LBYA 1A4UA 4MWGA 5CVDA 1ULUA 2P5UA 1VYUA 2G4VA 3PFKA 3WYAA 3OCZA 4IDGA 2BI4A 1MPXA 5FLYA 1G8GA 3WBBA 5IBCA 1UKVY 1VKNA 3KYCB 5ED0A 1FNKA 4KH1A 1UPCA 3OUTA 1RRFA 2G9IA 2FEPA 2GF9A 3L82B 4H0CA 4QVKA 1V26A 5D1HA 1Q7CA 5T67A 3DTYA 4N0QA 3O8CA 3BH6A 4UEOA 5HQJA 4IJUA 2HK8A 1RYDA 3WJ7A 4X1KA 3WIEA 2D5IA 4AMUA 3PJGA 4L50A 3PXXA 1B1AA 4RANA 1E2IA 3WXMB 1GDDA 1N2ZA 3DPIA 4MVCA 4YCSA 4OOEA 4WNYA 5SYAA 1KRHA 3TMKA 3X1JA 3ZIAA 4JIMA 3SLGA 2Z9CA 2H4XA 3ED1A 3PJRA 2IS4A 1H2HA 2WHRA 1CJKC 3LUAA 4YP7A 1OLUA 5FLEX 3HA5A 1Y8RA 3AERB 1KP2A 2AGVA 3RKRA 2GTHA 3MLEA 4MW2A 1U63A 4J7UA 5T8KC 1RJDA 1DS6A 3KB6A 3DBHA 4RZQA 5AJTA 1K97A 5ITWA 1R27A 2B21A 3F5SA 2OORC 3DAFA 3AKDA 4Q15A 1YMVA 5GP1A 2BJHA 4HDQB 1O96B 1CE8A 2NN3C 3MTDA 3KSBC 3MXTA 3B3JA 4BVTA 4HF7A 4RKQA 3W04A 3OQIB 5DLPA 5JDIC 3KWJA 1WHSB 3ADKA 3FM9A 1X9GA 1T3LA 3AY0A 4FWIB 5FBLB 2Y0PA 1T4CB 3PNKA 4DCOA 1TECE 4FDLA 4IWNA 1N5IA 1QHHB 3C98A 5G41A 4AN0A 4EUHA 5CW1A 5F23A 1F8UA 3OMLA 3WFIA 2Z1FA 4LC9A 1GSHA 4G86A 3M81A 4J1NA 4IJ5A 1X6VA 1UKEA 2FR8A 2AIZP 3EVAA 3FCEA 5A3JA 3A58B 1GUYA 2H3EA 3HFGA 4BEWA 1H5NA 3E58A 3SQWA 1GO1A 2OCIA 1PT8A 3BIXA 1T34A 2I2AA 1T9HA 5C1IA 5LXTF 2VJKA 1HQYE 1RMQA 5D6NA 1HV8A 1E7SA 1CUXA 2PMKA 2O0KA 4TKLA 4LZAA 1P17A 5EXTA 1XDBA 2WRZA 3ZI0A 2CK3D 1F5NA 3BB4A 3FCUB 3KJGA 4IF4A 3GV0A 3P9CA 3H2JA 1JHVA 3A1UA 1AQ6A 4G09A 3H4TA 1G21A 1GGJA 3EA0A 3VHXA 1WNFA 1XUOA 4K26A 2XQJA 2DSNA 4PAMA 3RC7A 4C3UA 2ZUCA 3I0NA 3Q3CA 4PHFA 5KVCA 3CUYA 1RZUA 2ZSBA 4OQZA 1TW3A 3UC5A 1NSTA 1YB2A 2Z1TA 2WDPA 1EUZA 3O26A 4JT2A 2XMDA 4J1QA 1Q3TA 3F6SA 4UJ3A 5LZ5A 1JKIA 1UINA 2G8NA 3IJRA 3I61A 1VKHA 2PIAA 3FFXA 4D82A 2WUWE 2AFIE 2C9MA 4S3MA 1E1MA 3TBFA 3NT2A 1Z45A 5BQXA 5IZCA 4M9QA 3CCSF 1DKRA 5FHRA 2C84A 3TLGA 3A37A 5DU2A 1V71A 3V4FA 3BMNB 4TUYB 2WKRA 1X7YA 4GPZA 3GPBA 4M0LA 5J1TB 3DNPA 2FFHA 3RIMA 5DBHX 1QGAA 1QYCA 3A4IA 4UFOA 3IP9A 1AJEA 3WX0A 2BFEA 5CB0A 5TGTA 3WRYC 2H9AA 4HZIA 4QT0A 1FFSA 4BQPA 3BJIC 3Q8LA 4S1TA 3SJBA 4AZSA 3DEIA 3DHYA 5J4HA 2UKDA 3SK0A 4CL2A 5LA6B 3HZRA 2FMXA 2J31A 1YRBA 2HC9A 3VDNB 3R5JA 3DCIA 2GBGA 1DC4A 1UAYA 1KJWA 1N6KA 2DQZA 1M10A 2PCJA 3U0VA 1AV7A 5HP4A 4BFCA 2EWMA 4EMUA 2V7BA 5A9SA 4AMBA 3CWQA 2QV7A 4QGBA 5ES4B 2HFKA 3BWXA 1P7CA 1EK6A 1T3TA 4JROA 1MH9A 3DHEA 2K87A 4MYDA 1IM2A 4KIJA 2GVIA 4DFDA 2J85A 4S04A 3L05A 1O58A 3LBHA 3EIEA 4HL6A 1EVQA 4MIYA 4W82A 5IVKA 1QS0A 5CB8A 2QD5A 3EAGA 3GDFA 2OZBA 4K9SA 4MKXA 2O2IA 4YAWA 1IPHA 1X74A 1U7ZA 2X8JA 1RM0A 1V9CA 2J5QA 3EGDB 1TTHA 4G25A 4QYIB 4KO1S 1KS2A 3W6ZA 3C16C 4HD8A 4AFNA 4D1YA 4LK2A 4KO3S 3ZZ0A 4ZDJA 1V16A 4JKOA 3T80A 5CGZA 2VJQA 4HYQA 5ALHA 3ZVMA 1UKZA 1ZWZA 3CMCO 1K7YA 1P1KA 1VJ1A 4I5IA 3WAJA 3TUJC 4GF5A 3T7EA 1C2YA 1CK4A 5DVZA 2MWMA 3LPLA 1FFYA 1T2FA 2C2OA 2QD1A 2WIJA 3C5VA 3M6XA 4MA0A 1T15A 3RS7A 4NFHA 3WYFA 4BN5A 2V4ZA 3ADOA 3RE3A 1SXHA 2GA8A 1A9TA 1G42A 1H0SA 3KKPA 3U09A 1DC5A 5IASA 1DRWA 5HUJA 3B82A 3VRHA 3CPSA 4WK6A 4DNXA 3UT5B 1FZQA 2VYVA 3MGAA 4NZZA 4MROA 1ODFA 1J4AA 4ZCMA 2ZIXB 4Z1OA 3BIOA 3DLIA 4UBLA 1XNHA 4H3SA 3F90A 4CKWA 1Q84A 2IUSA 4RHFA 3BHIA 3I6QA 1FRVA 4PCAA 3GPIA 2YYYA 3BL5A 4QXRA 2VDJA 1Y6QA 4IVQA 4TV9F 2FPWA 5F5XA 5A3SA 4GNKA 4YRGA 4U7FA 3PJEA 4QX6A 1RJEA 3UHJA 5BWLA 3PQ6A 2WSMA 4LYYA 4P31A 5JZ9A 1GCIA 1I01A 4P4NA 1JNXX 2JLWA 2OGUA 2Z5VA 3KYBA 3QITA 1DTWA 3V1KA 1NFFA 4AZ3B 2QSYA 3O94A 5JROA 4R8VA 5EHXA 4B2YA 3HP4A 5DV9A 1W49A 2X9NA 2YWDA 4DUGD 1HNZB 1WBBA 4FHEA 3N0WA 1JJBA 1AT1A 2DUNA 2FEWB 4MVJM 2VJPA 3KJEA 1LS6A 1S4MA 2PSJA 2YWXA 3E48A 3I6ZA 2W2LA 3GJ8A 2BI8A 1PF7E 2C0QA 2HL6A 5B1IA 2XMPA 2X13A 3KEFA 4JGGA 4JL6A 1NQ5A 2CVLA 3OBIA 1WUJS 5HK9A 2BZSA 2ZODA 1AVTA 3LUFA 4RF5A 2EG9A 4CPDA 3OSUA 4EAQA 3ITNA 4RTQA 1JXOA 5E9AA 5AVOA 5LQAA 2ZZNA 1C30B 3CWCA 4QQRA 2AG1A 3A4YA 4B73A 3HKEB 2ZXEA 4UVEA 1GQSA 2RKBA 4R2JA 3W6UA 1IWPB 5D5QA 2DLCX 1QYRA 1UXKA 1YO6A 2EVWX 1RR6A 3P5SA 4J03A 4FFBA 1Y48E 1AKMA 1L7AA 2C2BA 2GZDA 3KD2A 4KAXA 4C7OB 3H99A 1K0UA 4JXKA 1LBHA 2CDNA 3W1EA 4YMHA 3FETA 3TSZA 1YIOA 2IDZA 1W9MA 4PEVA 4ZCRA 2H1IA 4JLJA 3JQGB 4J1TC 4HYTA 4UEJA 4AWXA 3I9FA 1OU0A 3DP7A 3HNOA 3IBTA 1XLWA 2ILVA 3CIOA 1ZMOA 1LWOA 3LPCA 2A5LA 5HCUA 3ZWWA 1S2OA 1DELA 4GYKA 1F2TB 4RKEA 4ZU6X 5A1TA 1FLDA 1QB7A 3O91A 3RW9A 5J2UF 1NZDA 1XJQA 1C7QA 2D1TA 4V2UA 1B6RA 4L3VA 1TIPA 4ZEMA 4G8DA 2E4UA 2IHKA 1T9GR 2HIHA 4RVUA 3SXUA 1TQ8A 4FB5A 5E2IA 5AW1A 4C2AA 1NJ6A 3PITA 4Y2QA 1OHHA 2W7TA 3GJ3A 4JX9A 1YDGA 3ECAA 3HZHA 3C7CB 4R98A 5JYEA 4ALMA 5M29A 1GKLA 4AP6A 3STXA 4TVSA 2LVBA 2UVQA 1BFKA 2QRKA 3A9UA 1IOLA 4ZT3A 3ZCUA 2OWDA 1V1MA 1JEYA 4QE3A 1TKBA 1LV7A 1Q3KA 2ZYAA 4DY6A 1HRKA 4HXYA 1EVZA 5GAJA 2A8YA 3SN6A 1Z2PX 4MGEA 1Z22A 1E18A 3KKEA 1M3SA 1WEKA 4XQ9A 4B74A 4RDXA 5ILQA 1XTPA 3E1YA 3ZV3A 5F2KA 3IH5A 4BRWA 1WSBA 4CF5A 2GJKA 2IOHA 1NJ5A 1ILEA 2P9EA 1ZONA 4JI7B 2J3DA 1ND5A 1SGWA 1U2GC 2XA2A 3KSRA 1F0NA 1ODTC 1L5MA 2K5UA 5FLXA 2IEYA 2YRFA 2I3BA 3JQQA 4IIJB 2CLKB 2ENWA 1L5GB 5A3QA 2R84A 4KYVA 3RRBA 4EHBA 5CDHA 5FA6A 4C2TA 2Q4BA 3KZ1E 5DCYA 1OWLA 2HHCA 2Y1WA 4CMKA 1U9YA 1ACMA 1FXUA 2CWJA 1T5IA 2B4TO 5KDDA 2BEVB 2CHQA 1J90A 1UBLS 3MILA 4A8JA 2I34A 4GEGA 4EUEA 2C59A 2A9QA 4I50F 3QGMA 1QV6A 4YR7A 3DUWA 3ZGZA 1Y4UA 3SIVA 3IC5A 3V46A 3SY8A 3QUCA 3YASA 3L79A 1IC6A 3T3HA 3M1XA 5EIBD 5FUBA 3T94A 3S02A 3IMEA 4JYBA 5KTNA 4WKPA 4D02A 4N48A 4D56A 3OPYB 4MA4A 1Y5NA 1KO4A 1MC5A 1Y81A 5LR6A 3RKSA 3F4KA 2LBWA 4B5KA 1OLOA 1RE1A 3MCVA 4GWKA 2ODBA 1AHPA 4K03A 4Q19A 5DOVA 4JXXA 2VDKB 4CQNA 4HYYA 4L8LA 3Q6NA 4DBLC 5HQ3B 3VR5A 4M86A 2QE7A 4LC0A 1X94A 1YB1A 2Z8ZA 4JHLA 2WU4A 4E31A 4B3FX 2QVGA 3ENVA 3ZCPA 4EFDA 4GYYA 2C57A 3CVXA 1R9MA 2OV1A 4IFEA 4Y1EA 3UGTA 4FMDB 5F1YA 1TL7C 4B3GA 2Y6VA 1ZC3A 2A57A 4Y2RA 1Z26A 4A03A 2HVYD 2GBFA 2EW1A 1I3MA 1IQPA 2HBQA 1XAIA 2FMKA 3P0IA 3PG5A 4WEQA 4E6PA 1BMDA 3PQ3A 3GLGE 1W55A 3CLUC 3ZE9A 3CWZA 3THWA 1QV7A 3EHDA 4ZVMA 1SWWA