4DXDA

Staphylococcal aureus ftsz in complex with 723
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
307
structure length
307
Chain Sequence
ATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVSGEVNLDFADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLETSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPELQDEIVVTVIATGFDDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division protein FtsZ
publication title Restoring methicillin-resistant Staphylococcus aureus susceptibility to beta-lactam antibiotics.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Cell cycle/inhibitor
total genus 108
structure length 307
sequence length 307
ec nomenclature
pdb deposition date 2012-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
A PF12327 FtsZ_C FtsZ family, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4dxdA02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4dxdA01
2R6R1 4YJ2B 4X1IA 5EIBC 1W5FA 3WGNA 4DXDA 4TV8B 3JALA 5KX5B 4TUYA 4HNAB 5JCOA 4B46A 4X20A 4X1YB 5KMGB 1Z5WA 4O4JA 5CA0B 3CB2A 4EB6A 2Q1YA 3JARB 1JFFB 3JASB 5LOVA 1RQ2A 4O4HA 5BMVB 5JVDA 5ITZB 4O4IB 3JAWB 4DRXB 5GONA 3RYCA 2VAWA 4LNUB 4ZI7B 2RHJA 2BTQA 1TUBB 3N2GA 3JATB 2VXYA 1TVKA 5JQGB 1W5BA 5CA1B 4O2AB 3RYFA 5J2UA 2XKAA 5LP6A 3JAKA 4YJ3B 5EYPB 3HKBA 3UT5A 4ZHQA 5IYZA 3HKCA 5FNVB 3VOAA 4IIJA 5J2TB 3WGKA 2VAPA 5LA6A 4IHJB 1RLUA 3RYIB 4ZOLA 4I55A 1SA0B 3N2KB 3WGMA 4I50A 3R4VA 3E22A 5JH7A 2RHLA 4TV9B 3HKDB 3RYHA 5EZYA 5C8YB 3HKEB 1FFXB 1Z5VA 4O4LA 4KWEA 4YJ2A 4WBNA 2RHHA 4X1KB 4F6RB 4TV8A 4U3JB 5KX5A 4FFBB 4HNAA 1FSZA 4EI8A 4O2BB 4X1YA 5CB4B 5KMGA 3WGLA 5CA0A 5LYJB 5IJ9B 3C8LA 1W581 5LXTB 2GVIA 3JARA 1JFFA 3JASA 3M89A 4I4TB 2R751 5BMVA 5ITZA 4O4IA 3JAWA 4DRXA 5IJ0B 5JCOC 5MN4A 3V3TA 4LNUA 4ZI7A 5EIBD 1TUBA 1W5EA 3JATA 5JQGA 4X1IB 3VO8A 2BTOA 4O2AA 5CA1A 3JALB 4TUYB 3RB8A 4X20B 1W5AA 1RQ7A 4YJ3A 4O4JB 4EB6B 5EYPA 3ZIDA 5LOVB 2Q1XA 5FNVA 4O4HB 5JVDB 3ZBPA 3RYHB 5J2TA 5GONB 3RYCB 4IHJA 4WBNB 3RYIA 2BTQB 3N2KA 1SA0A 3VPAA 3N2GB 4E6EA 1TVKB 2XKBA 5MN6A 3RYFB 5J2UB 4TV9A 3HKDA 4U39A 5LP6B 1W59A 5M7EA 5C8YA 3HKEA 3JAKB 1FFXA 3VO9A 3UT5B 3HKBB 4X1KA 2VAMA 5LP6C 4F6RA 4ZHQB 4U3JA 5IYZB 1OFUA 3HKCB 4FFBA 4EI7A 4IIJB 2RHOA 4O2BA 5CB4A 4EI9A 5LYJA 3VOBA 5LA6B 5IJ9A 3WGJA 5LXTA 4XCQA 4ZOLB 4I55B 5MN5A 3M8KA 4I50B 4I4TA 3ZBQA 3E22B 5JH7B 5IJ0A 4M8IA 4B45A 5EZYB 4O4LB
chains in the Genus database with same CATH superfamily
4FIZA 1F4LA 2GHIA 3N8GA 4IH9A 1W5FA 1NW5A 3OEEA 3ZUPA 5KNDA 3FOWA 2YY6A 5JCOA 1P0IA 3ESQA 1EGMB 1B2LA 4F72A 3DEHA 4TTSA 5IKMA 1W2WB 4G01B 5FNZA 3AVPA 2JEYA 4QJBA 2CVQA 2IHVA 4RQUA 3QGMA 4L9RA 1XC7A 3H83A 4O4IB 2O20A 3D7KA 2O0MA 4R8VA 1HT2E 1OWNA 2BPOA 2YHIB 1HPLA 3IT0A 3SZOA 3W4IA 2OFWA 3X1DA 4YXWD 5ARDA 2D2FA 3TTXA 4DAOA 3JCMM 5LJLA 4EDHA 4YQYA 2IE8A 4DV1B 3ON1A 2WM8A 4M0LA 3EA5A 2Z8YM 4H1UA 5JASA 3OHMA 1Q6YA 4KGZA 2C4MA 1QHEA 1J1ZA 1QE0A 1YU6A 2X8WA 3FPLA 4X0EA 5ERGB 2R8ZA 2BEWA 4JELA 5EWLB 3ZOZA 3VR5D 1LNSA 3AY7A 3V4PB 1VXOA 1NXOA 2NGRA 2I8AA 3R1IA 4D43A 1OLOA 3KT3A 3N2ZB 4WWHA 1P45A 3K14A 3DOEA 2RSLA 4JP1A 5GV8A 4AYTA 4C6RA 1GGVA 2XMGA 4U0JA 4NFHA 1WZCA 4DV7B 2VPTA 2GZ2A 3ZHCA 1PDOA 3VCZA 2J08A 2V58A 3E22A 5E8JA 2X23A 4Q16A 1EWTA 1U9JA 5TMPA 4LGCA 3RYHA 5LZ8A 2IPAB 4KP7A 4IFBA 3SJ7A 4L22A 2C88A 4J1NA 4L5IA 4UM9B 2FZ4A 3VR3A 2AEJA 1JDBC 3D3JA 4K6GA 1V9SA 5BVGB 3DFMA 3AI2A 2Z6QA 1N5JA 3I3FA 2H2WA 2AMTA 3DV2A 4BT2A 4F56A 3ZDQA 1G6KA 4UBKA 3ZCVA 3KQOA 3AMVA 4MRRA 3AEQA 3ZQJA 2PUEA 5BMVA 3A6PC 1QIHA 2WQ7A 2PA3A 1TC1A 1VKHA 1N57A 3CPSA 5JY1A 5EMJA 4CM7A 1SOWA 1KD1H 5IBCA 1MRNA 2EFEB 2QUHA 4D79A 1TM5E 5DBEX 5JE8A 5KCMA 3G0GA 5JD4A 3CN7A 1HMPA 4LNAA 3ICQB 1VG8A 1JJVA 4E2ZA 1OYOA 2FFBA 2IY7A 3CUWA 3H6GA 2C8KA 4XJXA 1AMNA 1LTQA 3Q9NA 4TSKA 4LJ8A 4B71A 4C0QC 2PD4A 2ZSAA 1NJ2A 3KJFA 3Q9SA 1YWGO 2RHGB 1IDOA 2XB4A 3DLCA 1LTKA 4TGLA 4D9IA 3P9KA 1SA0A 4NV3A 2WILA 2BI7A 3KB6A 2GXAA 1S8NA 3IUBA 4YIKA 4PAWA 1PS9A 2PUHA 5LB2A 4KLAA 1VHJA 4MJLA 4B09A 1PUXA 3M3DA 5IYZF 2XT6A 5JO9A 1L3BA 1RYEA 2Y92A 3GY0A 2CYBA 3LM8A 1U4SA 1YRLA 2ATEA 3GG2A 3ND8A 3F97A 4M83A 3SJZA 5KYYB 1YASA 2FC3A 1T4CA 4QOGA 5EXTA 2XLBA 4DWJA 1NVEA 5FTLA 1QAHA 1WABA 3L5OA 4Z0TA 1BWRA 4MMZB 1ZJZA 1T9DA 2FXVA 2XUKA 3RSOA 5BXYA 4E32A 2CV1A 4WXEA 2PS1A 5TQ2A 2Q9CA 2XT9A 2ZU0C 3K9HA 2VPPA 3D3WB 3GNTA 3VHLB 4ZRNA 4BDSA 2NMUA 4GYYA 4CTMA 3L82B 1NR7A 5JSFA 1AHPA 5ALXA 4DXDA 1ZL2A 3IILA 5EPOA 3A9WA 4Q9IA 4V0KA 2ZIEA 3KU4A 4F5ZA 3FCXA 1HDZA 2PMPA 1X94A 2YIVX 4TRRA 4RFLA 5IABA 1O54A 3HUFA 4C30A 4Q19A 4BUZA 5I7WA 2F3PA 3MLEA 4DQKA 1HE4A 3NATA 1C4WA 1D0SA 3TBKA 2P9HA 5EZ5A 4RPCA 4BXOA 1O77A 2AOUB 1AE1A 2PMDA 3F8WA 5LA6F 5T3YA 3TIFA 5HFJA 5DYTA 1EFDN 1GSAA 1LBTA 1F3OA 2Y0DA 3RAPR 1ZRSA 1TA9A 1WHSB 1XVAA 3JPWA 3M2PA 4R41A 4UM9D 4X95A 1E5QA 4FK8A 1IBCA 3EULA 5DLEA 2HXGA 3C97A 1LX6A 4OXKA 3KUXA 4EELA 3ZWWA 4LV5B 3ANLA 1CRZA 3B1YA 1F0YA 2OHHA 4WK0B 4XB1A 1T5IA 4P82A 4UHBA 3SSNA 1J0AA 2G5GX 1F20A 3HUDA 1FFEA 2J6HA 5E9JA 2VKQA 3WLTA 4I6GA 2OLKA 2RJ3A 3G0IA 3Q7SA 1DXHA 1RABA 4RSRA 3ZE2B 4I4NA 1KBQA 2GFIA 1X3LA 2J3EA 1M0TA 1EWYA 2PS0A 4IWYA 2H52A 2NZWA 4GBJA 2VP4A 4CQLB 4R1MA 1RWKA 4Q1AA 2K2WA 3F8SA 2CE2X 1OR8A 4FLEA 5HS4A 4MDYA 3FLMA 4A3SA 4GX2A 5A05A 2DH6A 2IYPA 4F9EA 5CVJA 4BYGA 1NY6A 2AW3A 3GYGA 2WTBA 5SYMA 5FPKA 1TYAE 3IX7A 4WNAA 3KL4A 1LBHA 1GSIA 2CWWA 2ZSEA 5CMLA 1H1DA 1RMQA 2PUFA 4WZBB 1ISPA 2FGYA 4A23A 4EGQA 2C3UA 3PUVA 4EP1A 1QVWA 2QT0A 9MHTA 2WMYA 1BMDA 3VISA 5F5LA 5LQDA 2B1IA 2E1PA 4XLZA 5HE8A 1NMUB 1S3SA 2W71A 3HP4A 2GZ1A 2CL0X 3K0KA 1S2GA 1K3TA 2Y1KA 4G5OA 4YB8A 5FLEX 3GH1A 5TLSA 2J3HA 2OWEA 4JBYA 4P22A 1QK5A 3V6LA 3OQJA 5HZMA 3KAKA 1YIDA 2FX3A 4GVPA 3LDTA 2ZATA 4YT8A 3TK1A 5FOTA 1YITF 3A7DA 4R2KA 3LTNC 2EG5A 2IW3A 2W37A 3PYMA 1RWPA 2JVJA 4BVLA 1YKFA 2HJSA 1Q21A 1OC4A 3TRIA 3H5OA 3VSDA 4EL5A 2DEUA 4LOAA 3K4HA 4P3NA 1EPUA 4OQXA 3JQFC 1WKBA 3I9V6 3WHKA 3RF7A 4I2NA 1KK1A 1XRLA 4TWRA 4A8HA 1ZNQO 3CS3A 4LJRA 1H4SA 2XGMA 3T38A 4R9UC 1ADBA 3HYCA 5JCPA 3WMRA 4EA6A 1RBZA 3K73O 4KPUB 4HEHA 1IEWA 1BVUA 3LL7A 3B9QA 3OBWA 2M6KA 5ALVA 3L0OA 2FR1A 2Q5EA 1H3NA 3U61B 5FBZA 5CAEB 4ZQGA 2QQ5A 1H9BA 1ADJA 2Q0QA 1PGQA 3E8SA 1SCQA 1U99A 2WP0A 1L7DA 3MAAC 1EVJA 2I33A 2FPGA 4FMDB 1E9EA 5BPFA 2Q5IA 3MCTA 4LXGA 5C32A 1CZRA 2IXDA 4X8LA 5E7JA 4HAVA 3W3AA 3WMWA 4BNHA 5A6SB 1XPOA 3T12A 4ENVA 4MWZA 4KVGA 4ND8A 3FBTA 4J7AA 2H48A 1IG3A 1HE2A 2XNKA 2Y0EA 4MAAA 4PFKA 4YRRA 4BFCA 1QFYA 2C5HA 3SYNA 3WTBA 2WAMA 3UC5A 4ADSG 1MQSA 2FWRA 4HOYA 5HWSA 3IMKA 2VJCA 3PGXA 5TY0A 2QSYA 3R6TA 2VTBB 4R3WA 2WD9A 3PICA 3ZGOA 1GU1A 3M1AA 3W2IA 3PEEA 2AG5A 2DR0A 5FR1A 3R7DA 4QA9A 3SR3A 1Z5UA 2PX5A 3LBYA 4QGHA 3IL2A 3W2TA 1WXDA 4EECA 4OX9Y 2EEZA 2CMGA 4I0WB 2BZ0A 2Q29A 2PVCA 4LJSA 1Y6QA 3WLLA 2R25B 4F2HA 3OM1A 2ABWA 2JK0A 4UVEA 1O96B 1SKQA 2Z6UA 1G8FA 3OKFA 1DWUA 5FI3A 1G3RA 2F17A 4BZQA 2P67A 1EI9A 3OTGA 1XCBA 4MIKA 2JA1A 3ITKA 3LOQA 3HN7A 4CCSA 3U16A 4TXNA 3RRMA 1C1DA 3CW8X 2IKQA 3D5QA 3GT0A 4RHEA 2ZR8A 4NBVA 1EJBA 4MVJD 3SFZA 2ONCA 2D1TA 4I55A 1LJ8A 4TV9F 1CDOA 5EVJA 4B6SA 4ALNA 4ILEA 4W1PA 3EEYA 5FIUA 3TCKA 4Z9BA 4UASA 4U2BA 3DLIA 4EA8A 1SR8A 2XHZA 1FQJA 3N7UA 4MYRA 1BXRB 1N2CB 3G9UA 2JJ2D 1YJNF 4FOTA 5E3IA 1Q0HA 1QOPB 3GFVA 1F60A 3CHYA 4FFRA 2Y27A 4P80A 5HCUA 4CCAA 3T9EA 5LVAA 4GMXA 4YP9A 3ZNNA 3C3XA 1VI6A 2QM7A 2IPOA 1MQ8B 1Y9AA 4GSLA 3V8NA 5AOBA 3IPLA 3QPVA 4H1VA 1H6DA 4BOYA 5ALNA 2VXCA 2PJDA 5LLTA 2B8WA 4Z4EA 4ZCIA 4R8KA 1HUQA 4D9NA 3ICVA 3WRXC 5ADUS 5GTDA 2HT1A 5HQTA 3KCQA 2B3DA 2X19A 3TOSA 5EA2A 4FFLA 5JZMA 4F38A 2DTDA 1ODJA 1H5UA 2QRUA 3AL2A 4IX9A 1I1OA 1W57A 1R9JA 2XCIA 2ZVDA 5B6PA 2CN1A 3VNUA 4N8DA 1FNMA 1NQ3A 2VDMB 2OXTA 4JC4A 3UAGA 1YFLA 3N07A 4L0MA 4H7HA 2NTVA 4I9NA 2QN1A 4EUSA 5AW2A 4ZJPA 1NVKA 4NOKA 1C7ZA 3JZIA 4CKCB 4PINA 4RVOA 4OUDA 1M0EA 2JFFA 4E5PA 2FSVA 4JBLA 2F1JA 4BDTA 1K98A 1UPFA 4HAIA 4R0NA 1R0KA 3DOHA 2C2KA 2DWOA 1EP1B 3K2XA 1NJSA 3H11B 1ABFA 3WYDA 5EUBA 4Z1MA 4ZHQB 3QVVA 2CXHA 4MO9A 5BOVA 4J91A 4ZO8A 3GMDA 1OFUA 2Z8XA 1GA6A 2X4IA 4RL4A 2JDIA 2ZR9A 2WB4A 5EP4A 1XJWA 4G5XA 1XCJA 2GBCA 3MWLA 3K32A 4DNOA 5JATA 4Y0NA 3KKQA 3A2KA 3EIFA 4P33A 5HW0A 2ZFUA 3VAAA 1X7YB 2G09A 3CTPA 4LDNA 3JQFA 4JYBA 3KSBC 3LK6A 3CY6A 5JCJD 2I4LA 3MZ0A 1T0JB 5ALJA 1UPBA 3EFBA 3V1KA 3ASUA 4B9AA 1ODLA 4EB0A 2YV3A 2LR0A 2YS7A 5DM1A 1RM3A 2E4YA 4CF3A 1OFUX 3EGDB 4BPBA 3RIHA 5BR1A 1NBIA 3PDCA 2UYJA 3V4ZA 5TMBA 1TO2E 4WKOA 4JLNA 1RZVA 4GI3A 4RULA 4PRKA 4E21A 4NENB 4CVNA 3W5UA 2QRMA 1A9RA 3DTVA 3E9CA 2R44A 1VYUA 3G2QA 2VAWA 3WSTA 2QTNA 3OPYI 1GGNA 2PANA 3K70B 4LFAB 1JKJA 5M04A 1S9DA 4KI7A 5CRIA 4CIDA 1YIJF 1OVGA 1X1RA 4RPLA 5KQGA 2WG2A 3LQYA 4GG1A 1Q1BA 3LUGA 5BN5B 5PNTA 4JBWA 1ZLYA 3ZJUA 3QU4A 4R40B 3RC9A 3BHJA 5IW8A 3RUEA 2IJGX 4BIIA 4L6IA 5DYGA 1T0IA 3BFVA 2OYCA 4EFMA 3SCZA 1K9SA 1O9BA 4N18A 2QMZA 2O3QA 3W9YA 5IZCA 4FGUA 4XYGA 4ZA2A 4XD7A 2NU8B 5B5SA 4IZHA 1J5XA 2AUNA 3LFTA 3D3KA 3VPXA 4ACBA 4ZYYA 1U2EA 1WPGA 4GWKA 1SH7A 4LTMA 3AFIA 1K68A 3GCWA 4GZ6A 4RX1A 2DKFA 2PWZA 2SCUB 3AM5A 2Y9MB 4HZUB 2P91A 2WVGA 3BXHA 3AGPA 3NAQA 3F0FA 4WESA 2H2AA 2CFRA 3CISA 3LUDA 3ND6A 4HN4B 3R2JA 5CB4B 2NZYA 2QZJA 3OKPA 2EW1A 3H5VA 4HAWA 4BVTA 3FSRA 3TLMA 4MPRA 4C3OB 4GP7A 2JFQA 1G8HA 1ONOA 1BXZA 1VC2A 2IPXA 1G17A 3QNUA 3QX3A 1U1FA 1USGA 1ZISA 4AC9A 1T9BA 3HU3A 3C16C 1NZJA 3V3TA 1NBOA 1YACA 2XZDA 4OXNA 4R1SA 4UMDA 4X6LA 3L6DA 3CH7A 3L1JA 4NZ9A 2A67A 3GRRA 3JATA 3KVNA 3LT0A 4TL7A 4C76A 4I5GA 4KQ1A 3H4TA 4F4FA 1VFPA 4GFDA 2RIPA 2OV1A 1UDRA 4H08A 1C1XB 2QTPA 1QKJA 1Z26A 3JR3A 4JLWA 2H16A 4AF6A 3IP7A 2E48A 1B0UA 1BYUA 4C2BA 3T15A 3MJEA 1DKUA 4NU6A 4DCSA 2C7PA 3VKHA 4NJMB 5K0JA 5CDFA 1WV1A 3P9QA 1JMYA 2NAPA 3Q15C 4HAOA 1L4KA 3GVHA 3D4BA 4WLFA 2VS1A 1VQ6F 2SKCA 4HKTA 3ZJYA 4J0GA 3IBFA 3DVSX 1DRVA 4HNGA 1GYQA 4EABA 4ZOQI 5I4BA 1CZKA 3GLIE 4R98A 3ZWBA 2CLLB 2ZANA 3BE4A 1YQEA 1PDWA 3DFIA 2BEJA 5CG1A 3UT5B 1KI1A 2JLYA 1YF3A 1Z45A 1BS1A 4G4VA 3R23A 3RVMA 4EYEA 3DJYA 4WOJA 2AG1A 1VOTA 3JQPA 3FLAA 1IN8A 3CCRF 4UBIA 1I3MA 1QH8A 3RAGA 1YO6A 4JR0A 4KXUA 1GAXA 4IF4A 2IYXA 1BNCA 4FB4A 2NZ2A 1GFWA 3ER8A 1FJGB 3I9FA 4OYYA 1HNWB 4MIOA 1I6MA 1USUA 2FPWA 2WYWA 3CMMA 5ALFA 5SY6A 4BMOB 1YZLA 1UKZA 4K3UA 5EIEA 4JI8B 1PK9A 1RI4A 2QROA 2F1IA 3KEOA 3CNHA 4Z2YA 2WFMA 3PHLA 1XF1A 4M53A 3V2GA 3WLOA 1ZVMA 4TLDA 4LZJA 4QXOA 2AXEA 3E61A 3QE4A 5KAPA 1Z22A 2QRVA 4FFVA 1SELA 3PE4A 3UIEA 1Q92A 4M7PA 4HB3A 1O9GA 3HBLA 4OEHA 4Y6SA 4IS3A 1NXPA 5E7MA 4XWKA 5LQSA 1RPZA 2ZAYA 2QN2A 2GASA 3UXHA 3IT2A 3VV3A 5JYEA 1M0SA 2CDRA 4ZC8A 3HXMA 1LSOA 4D3YA 4IXMA 3RYFA 4BV8A 1C9KA 3DE1X 1PGPA 1V5EA 1GNTA 2H65A 3R3HA 4TWAA 4ZCSA 3RHTA 5EXXA 1XDDA 3L0ZA 1PVDA 1A1VA 3BC1A 1UJCA 5C2JB 4BKUA 1D7OA 4PV7A 4B76A 4DMMA 2O8BA 1AK1A 4MRAA 1E2PA 1XD2B 1YBVA 2JFBA 3R09A 4F46A 5J43A 1FIUA 5NULA 2HOQA 3H19A 5IC6A 5JJIA 2QYSA 3UFXA 3VTFA 3DFFA 2XQKA 3JWIA 4RPIA 4QAQA 1IM8A 1YTUA 5ENVA 4BKMA 4S2EA 2JIZA 1MO5A 2R1VB 3GNLA 4OF4A 3UUFA 4EJ6A 2HZBA 5ALZA 3OC0A 4O1MA 3HKEB 1GRCA 3SOPA 5C0OE 5HJ7A 5JI2E 1TO1E 2ONKA 1V3TA 3R5HA 2C2OA 1NMQA 4JNKA 4KQHA 4TV8A 3J81M 1RKXA 5D3KA 1CEYA 1N77A 4EI8A 1UOQA 2B8TA 5D3MA 4DG5A 4QOEA 1H3EA 1V45E 4NH4A 2GXSA 2Q4EA 4FR2A 4LZWA 3RSCA 4KYIB 4F04A 4G4SP 1QRTA 1ZWKA 4BFVA 3D8NA 1VQ5F 4EZBA 2GXUA 4IMIB 5FUWA 2IQIA 4Y6RA 4C04A 3DT8A 4UQOA 1Z6QA 1P2GA 3E2IA 3FTEA 4S1NA 2HA2A 3HWUA 1N0WA 3GEHA 5CVVA 2A5GA 4UDXX 4D4IA 4H3KB 2PH1A 1OFVA 1TMGE 2WDPA 3W04A 4E94A 2Q8PA 5DNCA 5HUJA 2ZT7A 2P11A 2C78A 3G23A 2BJVA 5LM3A 4KB5A 1IY8A 1L4UA 3PUWA 4RLHA 1C41A 2JCBA 3GLSA 2V96A 1DZIA 5JZOA 1XI2A 3I9LA 4I4TF 4E2XA 3L1KA 5AK6A 3BQ9A 3CNEA 4P3YA 3DBLA 3IP3A 3NX4A 5J2UB 3AR9A 1TTQB 2ODWA 1ZA2A 4OQFA 4UMEA 2IU3A 4Q3KA 4DLSA 1RQXA 1LZKA 2MSWA 2X1LA 5TEWA 4TKLA 3DMPA 3RFFA 1HSOA 3JWHA 3A9RA 2AZTA 2BGTA 1YRWA 1O0CA 4IDEA 3O8OA 3IJ5A 5AVRA 2HCTA 3S8MA 2ZIVB 4YJFA 2NUBA 2ZYIA 2PL3A 1E4OA 4HQKA 4QE3A 4BQEA 3Q2OA 4PG6A 2P2YA 3G6WA 1FTSA 4LDQA 5KX5F 2W93A 4G8BA 2PJZA 3LCCA 1WCWA 3W6UA 3WTCA 2P8JA 4KXXA 3V4SA 1N5LA 1CKEA 1IQ0A 1JKIA 1U31A 4RGQA 2AE1A 1E2MA 4AROA 4OQDA 4QVKA 2BKEA 3ETEA 3G88A 2VHQA 2IHTA 3VHXA 1X1AA 1F8XA 4LHEA 4PC1A 2GM3A 2AMYA 3Q0EA 4L51A 2PFSA 3Q40A 4KMOA 5HFNA 1HQYE 3TPFA 3TRHA 5L6LB 2G5TA 4QC2A 5EP1A 3FD6A 4ZOEA 4TVBA 3ZY6A 5HRUA 3GPBA 5JNWA 1V7CA 3OX2A 4OYRA 3VKUA 1ULZA 4OLHA 4R2JA 3FUWA 1G16A 5ILQA 1JG3A 3TLZA 1ZS9A 2C4WA 2GPNA 4Q7LA 3V9PA 1NLZA 1TLTA 3NNDA 4B1FA 1NBWB 1KL7A 4LDZA 3BKXA 2CB9A 5IYZA 3RFUA 1SCJA 3IRUA 3PPIA 4Q18A 1N6OA 1DDGA 3A0UA 3I2YX 3I9JA 4L9AA 4J1TC 1QCDA 1CY8A 2CE7A 2FFHA 4NR0A 3RVQA 2B4AA 2XYQA 3A10A 5AK3A 2WLSA 2REXB 4JJEA 3SR0A 1VIAA 2PVPA 4DV2B 2FPIB 1KYVA 1B74A 1QK3A 5HQ3A 4YCMA 1F2UB 3M84A 1PYOA 2H31A 3P97A 4PZAA 5FFNA 4FFOA 2Q45A 3EFOB 1IH8A 4PIVA 2IA5A 4H16A 5ITWA 3S1SA 3ESZA 3IQWA 4HNAA 3T4PA 5JTUA 4KWCA 3OJLA 1OZAA 4B3CA 4U1RA 1NF2A 2G9VA 1OXKB 2WJZB 3EXG1 4CFSA 4H18A 1DQYA 1KEPA 1PTKA 3FOCA 1MXHA 4JY7A 5I51A 3DVAA 3ND9A 4KQ2A 1QZZA 2BHRA 3C4VA 1WXQA 3MBOA 1KA9H 2N9UA 2PBLA 5HY2A 3QWAA 5ADHA 3FKSA 1X1BA 1SCUA 3ZGVA 2Y0BA 3E5MA 4OAPA 2RB9A 5FWXB 1MH9A 1JI0A 1UADA 1XXLA 4MHTA 1GILA 2FSHA 4IMPA 1PWYE 1NRJB 3QVJA 2BMJA 3KR0A 5TQ0A 3TLBA 3PGKA 5ALOA 3FMIA 3ZBPA 4NE9A 3T1TA 1ZCFA 3VJLA 2K2QB 1OWLA 1JA0A 1K8YB 2LW7A 4IGEA 2JIPA 1T29A 3C7KA 3CV3A 3NW9A 3A7EA 3PPXA 2XQGA 4MQEA 3S29A 1ZHOA 2LIPA 4YDHB 1YH3A 1FXWA 1IV2A 3GZJA 4IV5A 4DLAA 3BD8A 4F5DA 1A9YA 3ENQA 3EGCA 1SKAA 3RVPA 1QB7A 2GPJA 3PFBA 4UE2A 4LBYA 4LXTA 4YO8A 4MVYA 2QJOA 3DL4A 2JHGA 4AKHA 4M99A 1UT8A 1PEKE 3LW7A 5JO0A 3IUPA 4A26A 2Q4BA 4NXMB 3MAJA 1WX1A 2IG8A 5DNAA 1ZAKA 1XKTA 4U6NA 4QASA 1IB0A 2Y0PA 4WXYB 1FP6A 1KE2A 5MFZA 1QQ5A 4NS4A 2NVWA 2N48A 3CVXA 3OZRA 2LBXA 1XX6A 4EUKA 1S3GA 1MTOA 2GK7A 3IPAA 3MD0A 2XMBA 5IBPA 1FXUA 3TZLA 3VR4A 2MT9A 4C6HA 3AZOA 1ZX1A 1ZN9A 2GILA 1QHIA 4GP6A 2OCPA 1UMBB 3GLHE 1W0JA 3GPIA 3WLIA 2AOVA 1TZKA 3ICOA 3Q9LA 4HVCA 3DYBA 3OSUA 5KYKA 3FI9A 1ECCA 3Q88A 1FJXA 5E4JA 4TKVB 3FSGA 2I1VB 1N9GB 1W76A 4GPIB 1KJWA 1XMSA 5DNWA 3E1YA 2EBUA 4OJNA 5AM4A 3VYRB 2FW6A 2NTEA 1PK8A 1NKSA 1D3AA 1UQTA 2JI4A 2CHSA 2OILA 2RARA 1A9XA 3SHFA 2JLVA 1XMIA 4EZIA 2P62A 1LW7A 5IP5A 2O2CA 4Q3AA 2KTUA 1B7GO 2OMKA 3BXOA 1SN7A 4REMA 3PXDA 2FSFA 4OQNA 4TZ6A 2Q5OA 4N39A 3ANSA 2D0OB 1A88A 1VMDA 3LOUA 2RJOA 4FGKA 4FXOA 2DWCA 4RK6A 5FOXA 2QD3A 4ZRMA 2ORYA 1XZQA 1LRKA 1OLXA 3Q3IA 4MGHA 1BWSA 3EVTA 1UBRS 1OI7A 4QYTA 3QJ5A 3VR6A 3HAXD 3AUXA 3NHPA 2DT5A 1TEXA 2V7UA 3MD9A 4K1XA 2O1SA 2HUPA 3K0AB 4G8CA 5ALKA 1CF9A 3PFFA 5ER9A 4BCDA 5KJ6A 1URPA 1H0SA 2VN8A 2SICE 1LH0A 3VC3A 4P58A 2HPVA 2EQAA 4R71A 3IXQA 1VE3A 3BREA 1H69A 4YDQA 1AA6A 2F7SA 4JSTA 2PWBA 1RI5A 2Y6VA 5HJ5A 4FDMA 1WB6A 2A94A 3EQ6A 3NNNA 2OFFA 3K1AB 1OAOA 1Y7IA 1CK4A 2FCRA 3VNAA 5ITVA 1IZ0A 2FWJA 3H2HA 2YYZA 3NTRA 4M0KA 1LC0A 5BR7A 3G0BA 3WYEA 1XPJA 3HRHA 5LQKA 4Y7DA 1SAYA 2ZIZA 5FH9A 2AHOA 4WECA 5FUQA 4DADA 1D2RA 3WL6A 2H3HA 3U6KA 2AC2A 2BFBA 1JA1A 2XXAB 2AQIA 3QITA 4P35A 3KSUA 5CA1A 4A6XA 3WO1A 1UFVA 3DKRA 3ILXA 1N2XA 2AF4C 4KH1A 1JEJA 5GZ6A 2AFIB 3RGGA 5B3LA 2OVFA 1EEHA 1W48A 1XEWX 3FCYA 3JSXA 4B85A 1VL5A 4XDYA 4D4KA 3LUPA 5J47A 3DZJA 4RGBA 1HY3A 3MTDA 1R4NA 1ZJ6A 1CJMA 2IW1A 3ONDA 2WUEA 4XRRA 5CNMA 4P0TA 3VDXA 5LNK1 3L4JA 3KFLA 4MQ6A 2EZ9A 4F3NA 3F0GA 1UMCA 4DJEC 5HK8A 1GZVA 4TV9A 3MDOA 1EFVA 1Z2NX 2CMHA 3COVA 3DL0A 1VYVA 1Y89A 4HT3B 5K8UA 1EE2A 1G5FA 3C0KA 3RW9A 4Y6QA 4RV5A 2QGNA 3VMMA 2O8CA 4QLAA 4KEAA 2JFNA 5LWQA 2KSQA 1EUCA 2XB9A 5AFSA 4IIJB 3AVOA 2CVLA 1VCMA 1YE5A 1AXEA 4I6EA 4MW5A 1JNYA 1R5NA 4YBZA 2X0RA 4F86A 4TQUS 5I9IA 4RS3A 1GNLA 5DHPA 4B7XA 4AIRA 5ILOA 3PT9A 4AL4A 3G2MA 4V0MA 3N4ZA 1H5QA 1JPNA 4KSBA 3C7CB 4XR9A 3VYSB 5AVSA 1VA5A 5LU9A 3E18A 2J0QA 1T1GA 1U1IA 3I55F 3OOHA 4MRMA 5E38A 3GEPA 2YXZA 3ICEA 3WGNA 3GCDA 4OQQA 2PT6A 2REQA 1USVA 3ORSA 3G6KA 1VQ8F 3NAMA 3PQEA 3IQIX 3O4JA 4WKGA 5DASA 4DFDA 5IG2A 4LHWA 4EY4A 2XMRA 3C43A 4KIGA 3I5YA 2JLWA 3G0HA 3KQYA 4Z7NB 1KAGA 2IZOA 3HZHA 4XQEA 5B1EA 5T3UA 2WM9B 3KR2A 2AOXA 1E2BA 3NEJA 3TQFA 1E60A 2P2ZA 2X3YA 3ENKA 4NU0A 1N33B 3UUGA 3KUDA 3STXA 3QBTA 1U0JA 3FPAA 4CMBA 1SB9A 3CRRA 4QD3A 2NNLD 2D7DA 1OFHA 1PG5A 3EX7C 5AI9A 3K6JA 5D1NA 1SXHA 1AGRA 3GEDA 2ZTHA 3N58A 3PHIA 1Z07A 1ZNYA 2ODTX 3MCWA 1U7DA 3D2LA 3OZ7A 3GHZA 3QV1A 4L73A 4WDRA 2Z1EA 4ER5A 1BCSB 1EX1A 3OAAD 2HDOA 3NJ4A 1IIRA 4JGIA 2O2IA 2ATCA 3UMRA 5A0TA 4C6TB 5EJAA 5SYAA 2WV9A 4UM8B 3TRKA 1E6KA 1VXRA 1J7KA 3A3OA 4BMDA 2UXBB 1XBIA 4PWYA 5C34B 3RADC 2H8CA 1ST3A 2IQ5A 2M6SA 3MTEA 3T5CA 2G9UA 4XQ9A 2H4JA 2XXJA 3MOGA 4GX5A 1IZ7A 3KQVA 1W46A 2ZS8A 1E58A 1VLQA 1WNFA 1PJSA 2FRXA 2PX3A 3B20A 1LBSA 3KM0A 4N8EA 2PWAA 4C82A 1G38A 4XVHA 4YAFA 1P2SA 1VLMA 3EBOA 3GDHA 1MEEA 3T6KA 4P0QB 3WAGA 5JIBA 1GYPA 1Z4KA 3DOOA 5BRAA 2VK4A 4PIPA 3AILA 3FGOA 2G28A 4WBSA 3T5GA 4OI1A 3DVQX 2Q3FA 4U9HS 2QD5A 5DO9A 4U7JA 2OTLF 4D0GA 5JI3E 4BAUA 2EV9A 3MT8A 3WJPA 3TD4A 2F43B 1F1JA 2AI1A 3NO4A 2PNFA 1CFZA 5AK5A 3I76A 3LLSA 5H9WA 1M6NA 3ZY5A 5JISA 2ZOVA 4K0RA 2JJ1D 1OHHD 3ZJ5A 1CUHA 3FDIA 2RH4A 5C1OA 3L5KA 4PHTA 3SKXA 2AB0A 4DS3A 1MR3F 5JVDF 3SYMA 1T0UA 1JSCA 1VH8A 2Y8EA 1QB8A 3D6VA 5DTRA 5SY9A 4DA7A 2YDXA 4E5KA 4C2TA 5HJ2A 1KFJB 5IRCD 3DDSA 1Q0QA 1Z0ZA 4TROA 2Q3CA 3UNXA 1CQWA 3CLHA 3VVCA 3GJ6A 5B4TA 4DV6B 1XRRA 5LUBA 3RLFA 5HKAA 1XDSA 2ZBUA 3UW3A 4CKEB 5JS6A 4JI7B 1GKUB 1WXFA 1SVOA 4NPCA 2AN5A 2I2WA 1NT2A 2ZYDA 4EPWA 4UNRA 3TFOA 1SWWA 3N28A 4PPGA 2W8BB 5IDYA 3VOSA 4NBSA 3TX6A 4YY3B 4JI0B 2XAUA 3ODGA 3OQ6A 1KI3A 1AS3A 3B1FA 4FHDA 2UZ0A 4R5MA 4ARUA 5G4UC 1S96A 5FPQA 1M2KA 3WWYA 5ELXA 4D4MA 2P4QA 5DHRA 3GP3A 4JCCA 3IBGA 1TZ2A 3QSYA 3GUVA 3G2NA 3BMCB 4G41A 4TRJA 3VZCA 1G20E 2RGCA 3CX4A 3G8AA 1UANA 3HB4X 4P38A 4JU9A 3UV3A 1AQUA 1R3DA 4HGYA 1E61A 4FYIA 3KKNA 1ONNA 1TKCA 5FD8A 1NNI1 2ZDQA 3AOGA 3BEDA 3WMXA 4KQCA 5FBWB 3QEMB 4YCSA 4YAIA 5JARA 1BG6A 2KJQA 5JOQA 3OPYA 2V54A 4R1TA 5BNWA 5KOHB 2F9LA 3T80A 1B6TA 1OV6A 2NZ8A 3FVQA 4IEFB 2VYVA 1VQ1A 4X3CA 1FRVA 4B5LA 5AW1A 3GUYA 1Q82H 1HWYA 1ZLXA 5GGYA 1PBNA 3HA2A 3BH0A 4JXXA 4DR5B 4RUKA 4N3BA 2P7HA 4JLKA 4B75A 5F52A 2WYVA 2IWHA 2CVZA 3ASYA 5DRYA 2IOQA 2X0KA 3U62A 4CTJA 2DC1A 4UXIA 3EOZA 4C7XA 2O6LA 5A3SA 4DILA 1KYIA 2XUJA 2BZSA 2AXNA 3ZCQA 1PR4A 1VSTA 4WCFC 4WSOA 3IP8A 2RH5A 5KSWB 3CUUA 3IHLA 3WIBA 1QF6A 2FW0A 4BQIA 5CA0F 1ODTC 2Q2NA 3L7JA 4AO7A 1XCPA 1IB6A 2VAPA 4DR2B 5SY4A 3ZI7A 4NG4A 2TS1A 4JD5A 1JHOA 2PR2A 3E23A 4PG5A 4UZSA 4W8OA 3RVKA 2R84A 1OZHA 4MV1A 5JH7A 4LX0A 4MI1A 1LV7A 1YDHA 1B8PA 2YHBA 2XBLA 4GVLA 4CMJA 3SZ3A 5L3QB 4JS0A 3OQNA 3U60B 5B7QA 3KEFA 4FLFA 4BUJA 4C4PA 4O2BF 5CHYA 3GRVA 4QFDA 1V1MB 2OZEA 1RYDA 2YRFA 5D1HA 3M1YA 3VPDA 4B3MB 4RZHA 1JXAA 1XV2A 3FTDA 3LBIA 4X8MA 4D8VA 4UTPA 1G5HA 5DBGA 2MSCB 3SF8B 1MV5A 2GH1A 4EJFA 4YX9A 1VE6A 3BJMA 3CF4G 3DMYA 1FNBA 2I87A 4M8SA 2JGDB 1J1IA 4E4TA 5HNKA 1YB2A 4ASUD 3HO1A 1M8PA 1ZGGA 2R7NA 3EGWA 3LWOC 4JVSB 2XDWA 3MTQA 2W90A 5A9TA 4MB2A 3L0IB 5BNZA 2CHVA 4QQRA 3OCYA 3LT1A 3O3CA 2VXBA 4I19A 3MWFA 2MYNA 4D97A 1JSLA 4RIFA 2JH3A 1MENA 1U28A 3PQ2A 4Q02A 2G83A 3PFWO 4XIGS 1W85A 3ENNA 4FDUA 2JASA 5IEJA 5K3FB 1ECJA 1KNJA 3QUSA 4J03A 2FPMA 1FYFA 1SUAA 3O1HB 4MYTA 5GVSA 4G1BA 1EXVA 3Q0TA 2D74A 5LB4A 4DLVA 1C9EA 2FP3A 2VSFA 2ZJ2A 4I5EA 2YFKA 1PS0A 1RXUA 5H82A 4KDRA 4LZPA 4D80A 1AUPA 3W8FA 2RIRA 5IKOA 4RKFA 4YT2A 1YFJA 3G8CA 2QLTA 1EVIA 3LWQC 5JSQA 2XBMA 3A1WA 3NOVA 1EDBA 4P34A 3B48A 4QHYA 5B1HA 1JXOA 1GKKA 4KW7A 1YQNA 1KYTA 1R9MA 2OFOA 5GINE 2E6UX 2XKKA 2POCA 4F5WA 4DV0B 3K6KA 2Q9BA 4TXJA 5FUYA 3VR2D 3A6FA 3A4LA 5IX8A 1TJ4A 2JBAA 2REBA 2YBEA 3O9MA 3ZWNA 5JU6A 4ESEA 3FHOA 1K97A 4H77A 4JL8A 1QTRA 4BE7B 2R6HA 3UPTA 4RV9A 2YJ5A 1D8AA 1S2NA 4J2OA 2PCLA 1Y33E 4ZK7A 1ZY2A 1DLIA 3UJBA 3LLCA 4ZMRA 3ZQ6A 4ZEMA 2X42A 3HYNA 1QRDA 4G4SO 1X8XA 4LE2A 4JUFA 4WKCA 4JYPA 4MTCA 1FS6A 3P9PA 3ESDA 3RR2A 4XVQA 1ZH0A 1L5HA 3T9CA 4GPEA 2QF7A 1RQLA 2X22A 4HN2A 5K05A 1KIAA 3QFCA 5JSYA 3BA1A 1Q7TA 2AEEA 1BAPA 2UUBB 4WZAE 6YASA 2WF5A 3BBPA 3LDGA 5FADA 3A1VA 4JT2A 1EUZA 2XI4A 3BOSA 5AJUA 2VOEA 5TQJA 2RHJA 2ZYRA 5JSKA 4DRZA 4JYZA 5F7JA 1I8TA 1EHCA 4HXYA 1SBZA 3FNRA 3NB0A 1BX3A 1Z73A 2V7WA 3CW2A 3OZVA 1AKYA 3MBKA 4LGMA 1WXIA 3RS7A 3I4FA 5DBIA 4C7KA 5THQA 2RB5A 2VJAA 3AFNA 3PTAA 4HYYA 2E4ZA 3KOXA 3TE7A 3R3SA 2JNWA 2JLCA 4H1TA 3ZCRA 3X3HA 2JI8A 3MW8A 2HD4A 3GROA 4XJVA 3ZCXA 3PA6A 4FEYA 3WZMA 1L5FA 4P4LA 4DDKA 3FVWA 2R6DA 1PGNA 3D0RA 4IUBS 4J0JA 5JY6A 5CT9A 3R20A 4XRGA 2NLOA 1MHTA 1ZD9A 1DKLA 4C4XA 2WF6A 1UIRA 3DE3X 5ALSA 3HN2A 2DU8A 1IAVA 1H6BA 5HR5A 1M8GA 5I48A 1GTSA 3VUFA 2CLKB 3OD5A 1THZA 1WVGA 1CFJA 4Y2QA 4Y2YA 4M7WA 3VYWA 3QYJA 1YVPA 4CG0A 1W1UA 2AK2A 5KX5A 2WTNA 5FFMA 1LPOA 4IQ8A 2PKRA 2YQ5A 4KOAA 2G07A 4AN4A 2X86A 4E3ZA 4B0OA 1XFDA 1V6AA 1P31A 5B4UA 4FJ0A 4Q3LA 5LN1A 5A5VA 2Q0HA 5CEJA 3RRJA 1XQYA 4OFWA 3U3RA 3ZLTA 4DDUA 1SD5A 1R6XA 2VI5A 4LNUA 3W6ZA 4R8MA 4D9FA 4WXHA 3C3PA 3WLSA 3WBBA 4MCJA 4F8YA 3ETLA 2O0HA 3NVIB 4CU2A 2QYOA 5KIAA 1NFRA 1M6VB 2PX2A 3I5UA 1V4NA 2WE7A 3BRWD 4J9UE 1H4TA 2ES4A 3S68A 3ZDAA 1UKAA 1NURA 3F3MA 1VSQA 4MS4A 1U6IA 2OO5C 4UEKA 5JFGA 1YDMA 3RRFA 1K27A 1U5CA 2DPMA 4CMHA 4JODA 1XQXA 4DCJA 1R8YA 2C4TA 1Z15A 5ESDA 4DUZB 1B93A 5EB0A 2EP8A 5EXPA 5IT5A 2ZQ5A 1GQ2A 2CSLA 2B4KA 1ACLA 1F0KA 2RC6A 4CLXA 3WBFA 1HC7A 2XUAA 3W8RA 2IELA 3LAWA 3CR7A 1YGYA 1E9VA 2D8AA 3DEFA 3DS8A 4MGEA 1Q7EA 4PFJA 3IQHX 4RK5A 4I8XA 3ZR4B 2P9TA 2WVHA 2C00A 5IT9A 4GDFA 4LF7B 3V7EA 1VA4A 1CB0A 2G8LA 4CGYA 2DHQA 2V4UA 3GPCA 1D1QA 3DTTA 1ZMRA 2WU0A 3FAKA 1Z0IA 1Z18A 2H4YA 1P60A 1U5BA 4G5SA 5CH3A 3W77A 4D0NA 2CNBA 1IBLB 3CFYA 1Y8CA 3AR8A 4DW8A 2GZLA 4K28A 3JQGA 3UK7A 3JQBC 5CYOA 2PKEA 3ZBQA 3BILA 1M1NA 3D5EA 3RTCA 4AKTA 1RWVA 1KQGA 2GLXA 3VPFA 3GLFB 4ND7A 1EG2A 2E85A 1W40A 3TIXB 2Y1XA 3EMKA 2J5RA 2K87A 3G13A 3GARA 3W5SA 1JAZA 4U6SA 3PENA 5DB4A 3KQHA 3AEKA 4HX2A 4DLXA 4X20A 4IGAA 1YXMA 3D8UA 4EOGA 4FJ2A 3U5ZB 4MVJI 5CCEA 3JAMM 1CLUA 3TQSA 5G4VC 1N8KA 4NDZA 3R7SA 3SC3A 4C8IA 1KC1A 4LCKA 2D13A 5AO9A 3VSCA 3TFQA 4BIMA 3I5MA 2P3QA 1XCGB 4DM7A 2ZDHA 2XOXA 5CX4A 4BKQA 1S4MA 2EL7A 2O5EA 4FX5A 2YWCA 3DEKA 2X0FA 1U3FA 3C3AA 5MGNA 1IPHA 1EFTA 2QWXA 2VP6A 3N0TA 4JA2A 2HBZA 3GC6A 4M87A 4YJ2F 1B8VA 4HDOB 1E2JA 2QI9C 2IHZA 4R51A 3UB2A 2EJWA 2MYUA 3N2EA 4O63O 1XLUA 3C3YA 3OQPA 4ND1A 3PDIA 4BLOA 1WZ2A 2I80A 1H7MA 4RPJA 3A3PA 4JSYA 4MP6A 2J87A 4JI3B 2GMWA 1MD9A 3QUAA 1E18A 1S0UA 1GU7A 2QLLA 3WV4A 2ZSJA 4CDMA 3PR1A 2LDXA 4X00A 4CEHB 2JGJA 3ERCA 1OXSC 1W6RA 1Y5RA 3O2QB 1IXSB 1M2EA 1SCKA 2HYDA 3V8VA 2HXSA 3WQHA 4DAEA 4GX1A 3THYA 4B3SB 3IE1A 1ZINA 4FN4A 4XPIA 1K63A 1VYTA 1DINA 1T2CA 1K89A 1TF5A 3ZKWB 2F8MA 1OIXA 3OH8A 3TQOA 3Q8HA 1J25A 1XEAA 1LNQA 4L4YA 4M21A 5LYJB 2IYZA 3EZLA 3J81k 1DJMA 1YKGA 4FYJA 4P2BA 4FQ7A 4DIMA 4MUYA 3A25A 2OUKA 2KW5A 4WASA 2GN4A 1HA3A 2H8EA 1MN6A 3N05A 4MVJF 1B00A 2WVAA 1YJXA 4CW7A 5HWEA 3JZFA 3OJCA 4BQPA 5KOIA 3AHHA 3QXHA 2VQFB 1GL6A 2X2PA 1UP4A 1MUUA 1IM2A 1PJAA 2QSZA 4QEDA 4N65A 1FP2A 1NI4A 3SQDA 3BGWA 5DNVA 4C1NA 1DBIA 1QLHA 3EZYA 1AQ6A 3JVEA 4LI3X 4O0MA 4BYMA 5HOEA 2BFFB 3A11A 1WBDA 4G5GA 3CPJB 3PQ4A 4AS2A 2AXQA 2FPPA 4PF1A 1A9QA 1T1EA 3UMGA 4G9BA 2F8SA 1X15A 3HVHA 1SVNA 1P33A 3CZ5A 4QBIA 4XKJA 3V1LA 1XPRA 1JN1A 1YL7A 2WM2A 4OVKA 2HMAA 3UK2A 2H5EA 3K09C 3BMQB 1GPJA 3UMFA 1KJQA 1QDEA 4ZC1A 4NTZA 3WLMA 4QQ8A 4RTSA 2PEYA 2X4LA 1E1NA 2Q2OA 2AV6A 2QV7A 3AERA 4BQQA 5F1PA 5DGCA 3OPQA 1ANKA 1I14A 4HWTA 4KLNA 5G0WA 4CKBB 2WB2A 1RC8A 2AG0A 5A3JA 2H5JA 5AT1A 1A82A 1KO1A 3FLEA 3DV9A 4JYCA 1H05A 4Y1FA 2BF7A 2DBRA 1VG0B 4WLVA 1RQNA 2AIFA 3C24A 3PS9A 5F7OA 3VQTA 3FM9A 3JQRA 4Z99A 2H54A 3V32A 1HEUA 3F6MA 2O19A 3QKRA 5J63A 5AYVA 1FDIA 3DOFA 5KQMA 3U3JA 2I3GA 5T7BA 3HXLA 1O57A 2XITA 3GAAA 1VG9B 2ZRFA 3BMNA 3TNYA 1BD4A 5HIMA 1KXJA 2HF7A 1WCXA 4QXMA 3IKEA 3O21A 2HA4A 4ODIA 4GKBA 4UOEA 2VBCA 4B3TB 2V98A 1J06A 2PX0A 1KO7A 4BASA 1NG1A 2FE1A 4F4HA 3SAJA 3WWPA 4IG4A 4EQ6B 1J22A 4HNTA 3UA4A 3ASZA 3JQBA 4UOZA 3ABSB 2QENA 3CNBA 3C1AA 3DMRA 2D0DA 3MA0A 3C8ZA 4G56A 4MKGA 4FILA 4EVRA 5BN3A 2IYFA 1B6SA 1NJGA 3MWKA 2Z43A 3G02A 1NG9A 3KXDA 2VTEA 2JIDA 3VPSA 4Z4CA 3IMCA 3MMXA 2C9MA 3H7AA 1QKIA 3OJWA 4HQ6A 3D4IA 4P53A 5E2IA 1TM7E 4A6PA 1Y5IA 3MCZA 2J3IA 3TZBA 1X1QA 3A6DA 4U7DA 4G85A 3LLVA 1Y8RB 3PKIA 3T8YA 2P6MA 2GETA 3VC2A 1OA0A 5EZYA 2A35A 4LYAA 4S1WA 5AKYA 4BO8A 1KTIA 1W4RA 1L3CA 4KWEA 2JAXA 2OZVA 3D6NB 3K3PA 1TVEA 4PLCA 3KYDB 2ZODA 3WGTA 3OT5A 4TLEA 3GPLA 3IUSA 1QYCA 1N0IA 3PQ3A 4MK4A 1P72A 3TBFA 1DXYA 4UNQA 1JG1A 1KMHA 2QXTA 1GTJ1 1YA8A 2II6A 4D44A 1UXHA 4G1CA 3TR0A 3VU1A 3O4VA 5BUQA 1QH1A 1SUSA 2PY6A 4IHAA 4LBWA 3SJCA 5MDHA 3QFRA 3NI2A 3SX2A 3ELWA 1K2WA 1U0NA 1V4BA 2BCJQ 2W0SA 3KQLA 3NVDA 3SYLA 1RLOA 1WW3A 4URFA 1SUCA 4ZYWA 1TYBE 1CTQA 3ELUA 4KFCA 3LMKA 5KDLA 2DBVO 4E1AA 3O94A 2I6GA 5GM1A 1SULA 2J7PA 1E6EA 2GZRA 5JUWA 3ORQA 3FCUB 1RAAA 3EGOA 2NUAB 1K06A 5DOZA 4W4TA 5G2OA 6REQA 3BE6A 4L2IA 1SUPA 1AK9A 3IFSA 3GK3A 4XVCA 5KREA 2ZBEA 3EZGA 1CETA 4I4CA 5JYDA 1DCFA 2WPNA 4XWGA 1VSUA 6GPBA 2HX0A 5MN6A 2HEGA 2RGDA 3K9FC 1ZIDA 2L26A 3CMCO 1OGYA 2ZYHA 5JT1A 4QGAA 5IVDA 3VYTC 3A4NA 3ZVNA 2I9PA 3BYZA 3Q1KA 4BO4A 4M89A 4KR6A 3FOBA 4K6HA 4ZV4A 5K0CA 4K40A 1S1MA 2QA4F 2J33A 3BERA 4IG9A 1X25A 3FOEC 3GUHA 1DIHA 2XVAA 3BCRA 3RSQA 3G7NA 1QR6A 2J0SA 3F0EA 4P4TA 3EAQA 3OZWA 5DVZA 5BO5A 5DRTA 2PBRA 1A7KA 3BM5A 3LPNA 4IGKA 1QO9A 4NBNA 3W2EA 3I3OA 1L5ZA 2VPWA 2ZVJA 3K96A 4CQMB 3G1UA 1M75A 4POAA 2CWJA 3S0JA 1AA9A 3AY6A 5JMTA 5DM70 3FFAA 1GTMA 4EY3A 4PC7A 1RRVA 4IO1A 1SZQA 2O8EB 4MCIA 4RF3A 5I7AA 1EDZA 3HWWA 3I8XA 1M2VB 1KAHA 4HDKB 1ZRMA 1NYLA 3GJXC 2V7XA 2XGOA 4TXHA 5U4QA 3CB2A 4PQRA 3U4AA 1QIKA 3W8DA 4XYEA 5E6UA 5JVDA 1SQ5A 4IIXA 4UULA 3UKDA 4E5NA 1T4BA 1HQKA 1YC2A 2QR2A 4ZI7B 5BWBA 1YZTA 2FDCA 3INTA 3TN7A 1T9AA 4JBGA 3PFGA 4ZVUA 2VPYA 1Y9EA 3JD4A 3OZDA 5L9AA 3MQ4A 5FP0A 2PGDA 3FI0A 2DY1A 2I6SA 2P7IA 5F1YA 2BMFA 3SNHA 3TWOA 4DLNA 3T7AA 4LECA 2GEBA 1REQB 4HDAA 3FCAA 4JC0A 4NYMQ 1YQDA 2CUZA 5TR9A 1QG2A 4U2DA 2ZSUA 2GEVA 3FNEA 1FMCA 1VBFA 1P1JA 3DYVA 5ERXA 3TIGA 3ZQUA 3KC2A 4J7CA 3VGJA 1PJ2A 1KY2A 3L6OO 3ZXYA 3IVCA 2ZUBA 4UW9A 3DDOA 4OJTA 5DH9A 4BRSA 4EB8A 2GZSA 1FFSA 2JGMA 3PZBA 1JGTA 2DE0X 3ZYCA 1SEVA 2UAGA 2WR8A 2VNSA 4UMFA 4F2DA 2FAXA 1FK8A 3FF4A 1M6HA 2VDKB 3DLPX 4AU1A 1QPGA 2F67A 4S35A 4WADA 5FTJA 4LQDA 2QZ4A 1VJ1A 4DCTA 5BW4A 1QJCA 4HS4A 3HVKA 5FWDA 3ANTA 3WGLA 1AXGA 4U7WA 2WFLA 2REOA 4QOFA 1ARZA 1OXMA 4UU1A 2CKDA 4L9SA 4RKYA 4JLDA 3CW9A 3FJYA 4HWOA 3TO5A 4EHLA 3A27A 3H65A 1SBTA 4Z53A 1JIIA 1O2DA 4OQ4A 5DCLA 3HADA 1C4XA 4EMBA 1GCUA 1Z38A 3KQUA 4P3KA 1G21E 1T3SA 1V6SA 4HN9A 5EKXA 1THTA 1YJAA 4BO1A 5EWJA 4EMSA 4NP6A 1HFKA 2OUIA 4DIBA 3AX6A 2Z9CA 4QO8A 4G1VA 2NIPA 1RYNA 2EX0A 2Q27A 2XRZA 3GELA 3LC7O 4YPFA 1YVDA 4NESA 3FZEA 1NFQA 3H0CA 1X7GA 1H3FA 1ISGA 2E7ZA 2R8YA 3A2LA 3GF4A 4L57A 4QARA 4IRXA 1DBWA 2FMHA 2FF5A 4ZK2A 4CQMD 1E9SA 4HLDA 2BGJA 3NP9A 2F1OA 4KXQA 2VJYA 3KDAA 4Q9HA 4XJSA 3VPGA 1JI3A 4EMTA 1R6AA 2CHEA 3IAAA 1ZUNB 4K7JA 3P10A 1P4GA 4E6EA 2HLDD 2ZBVA 3GBPA 4PRYA 1UEXC 1UBOS 3F5DA 3PUZA 4L5JA 1QGZA 1R7RA 4P9NA 4M1OA 3NXSA 4ZCQA 3UN1A 5HXAA 5BW6B 3SXUA 2G1AA 3PHJA 1IUPA 4HVTA 3IRVA 4YXWA 1FFXA 3V4OA 1LZLA 3RWMB 4J49A 2IUFA 4C4AA 3KZVA 2YJ4A 3AIKA 1L5RA 1ZK3A 2JIBA 5L3ZA 4KODA 1HZZC 4JC5A 4CJXA 2QEQA 4O2BA 3UTDA 3AHDA 2H2IA 1J1UA 2QRNA 1HK7A 4HFRA 3TQRA 4TLAA 1E4EA 3VR5A 4N01A 1INLA 1ORRA 2PCJA 4JLOA 2YR0A 2IUSA 4FBGA 1TJ3A 2GYWA 4KFSA 1DKMA 5G53C 5B53A 4BP1A 4DB2A 4KX3A 2A78A 3UB3A 3TSAA 5DHFA 4P3OA 3ZCTA 5TX7A 5K5EA 2Z08A 3ENWA 1IOZA 1XZAA 3KLMX 2MYTA 3U9LA 1RADA 2R1ZA 2ZJ4A 2HWUA 1PR6A 1YVUA 3VBEA 1KF0A 3NK6A 4IXTA 4QDKA 2XDQB 3E8XA 4HBGA 4IHQA 1JMKC 4MA0A 4RLSA 3V9AA 4CGZA 3V8BA 5BV0A 3FYHA 4PCAA 2JG3A 5G4KA 2IDJA 2WSSA 4ER7A 4AI6A 3X1YA 4C5CA 1P8JA 2NYRA 4J4TA 4ETWA 1Z12A 2WD7B 4A0QA 4D8YA 2DHDA 2X9VA 5HGJA 4N6OA 4ZIRA 1RT9A 1A2OA 4G84A 2OM6A 1P2VA 1QU9A 5CLGA 3U7EB 3WKCA 2F55A 2EKBA 3RE3A 1OYYA 3GLRA 1E1QD 3A3KA 2HEIA 2DBYA 2LXNA 2Q4DA 2V7QA 4LJ9A 4GI5A 1DBVO 2WAXA 4UJ3A 3QKSB 2YJTD 3V3KA 2HRDA 2VYND 3FIUA 2GEUA 2D2EA 1XA4A 3ACDA 3DV0A 3M6WA 3OLQA 4LCBA 2P68A 1JTFA 1HE5A 4JOSA 4KQMA 1VPWA 2XAAA 1U7OA 1T1IA 5DNEA 1G66A 2W00A 4ESHA 3ZJ4A 1F6WA 2V6BA 2G3YA 1CUWA 2AJBA 1H2YA 3CO5A 1HG0A 4KVFA 4QTTB 4N0EA 3B6NA 2BKLA 4LW8A 3RU7A 7REQB 2XMDA 2P6YA 4IQ4A 3X1WA 2B4QA 3IC5A 3OZGA 3N2NA 4V0SA 4ZTZB 4DQXA 2V4MA 3PE3A 3S2UA 3JQ9C 1TA0A 1DPGA 5C7YA 3UMVA 3RIXA 5KJEA 1CBUA 3DZIA 4NAHA 5U1PA 4I1IA 1U7ZA 1GRQA 4YUVA 5EJ5A 5FEUA 1JKFA 1J97A 3IMFA 2K1SA 1HOXA 2BR5A 3KQQA 2WU8A 2FKNA 4PRLA 3TM5A 4DQUA 5KSZA 4GM4A 4LWPA 2D4HA 4L8YA 1J6UA 1E4YA 1XF9A 2VJQA 3AIOA 4O4IA 4PAOA 5AJHA 1NQ5A 2YHIA 3O1IC 3TW4A 2ZVYA 3PXCX 4MKZA 4RJLA 1IUOA 3REGA 4DG9A 1Z7WA 2GD1O 4ZVOA 5EJEA 1RXSA 4KR3A 2BM0A 1UOPA 1MOSA 1Q3KA 1UP6A 3OCXA 1RM5A 4HQLA 1WCIB 5DK6A 1PJ3A 1XCOA 3VGPA 1VSBA 3ZZ0A 1SUFA 1RQ7A 1W9HA 1K6EA 5EWLA 1E3DA 4EB6B 3T0GA 1A27A 1P6UA 3K9WA 2Q1XA 1TQ4A 1NQOA 2UVDA 2A1TS 1TF7A 3EQZA 4E5VA 3N87A 3RYHB 2OGTA 1Z6TA 3NTOA 1A97A 1CZHA 1R4ZA 1X74A 4RS4A 4DV5B 3MGKA 4RA6B 3VI4B 4ZHWA 4TL9A 2JL1A 1DTSA 1JDUA 4FMPA 3WK9A 4YACA 2WP8J 2XQIA 1ZXXA 4QHSA 3KD2A 3CNOA 4V02A 3S06A 1II8B 3A06A 3S4YA 1K08A 2L42A 1KJIA 2YNMD 1PVVA 5IAAA 4XYLA 4LRWA 4FZ5A 4DA9A 3HJHA 2KM1A 4JZKA 5KC9A 3GLIB 3QP9A 4X6XA 1LS1A 4J0FA 4HQFA 5ESXA 3NHFA 4MKHA 3TRFA 4C7JA 1QCYA 4EK9A 5BVGA 3KXIA 1JDZA 3OM8A 3AIIA 4FQ8A 4J16C 3ZDYB 5BWCA 3CVWA 4LVUA 5IKXA 1LKZA 1JR3E 2Y1GA 1FMLA 4QHTA 3O1LA 3JCZA 3FRHA 5BY2A 1M7HA 1S89A 1EE9A 2ZRBA 2CB0A 4D02A 1XQ1A 4ATNA 3F3SA 1D07A 1JIQA 3R4VA 4REOA 2C8LA 4O3MA 1HE8B 2JATA 2UZAA 4RHFA 3TQHA 1N2HA 1TD1A 1YBAA 4B46A 4MGZR 5FL7D 4NVRA 4DMFA 3RSLA 1J7HA 1BQEA 1L4GA 2I03A 4B3GA 3QKWA 1ECGA 4PANA 4ZEWA 5AVKA 1HZZA 2DKNA 3F5MA 3LCRA 4B87A 5IXJA 2VP5A 1SIWA 4XUCA 3PIRA 5J4LA 4I4LA 2COUA 4J6FA 3MJVA 5HGXA 1YB1A 1U7PA 2RGWA 2CNDA 5GGXA 1IQPA 4PPQA 3VFDA 3LY5A 5EZSA 2HW8A 4BO2A 3DLAA 2I7DA 2VCEA 3AGKA 2KWIA 4EYKA 4WN3A 1JUDA 3RF6A 2BP7B 4CL3A 1Y3DE 4YR9A 5KINB 1F8GA 3P96A 3WAKA 1CY1A 4OPMA 3V2HA 1FPQA 3WL7A 4BZPA 2A6PA 5KYYA 3F96A 4AWBA 2YYSA 4TYYA 1MT3A 5T67A 5K45A 3WPXA 5J2TB 4Q12A 1OILA 2Z58A 2DCUA 3N6VA 3PWSA 2BHNA 1BJKA 1Y42X 5AJTA 1COWA 2C99A 4FZRA 4R81A 1H4QA 2XYPA 2OT3B 4CZ2A 1MABB 1GDDA 1IQUA 4B40A 1OLUB 1NLMA 3PZRA 1D6SA 3G7UA 1A71A 4C89A 2FCAA 3NHZA 4GEGA 3CONA 7MHTA 3U7FB 4MMXB 4LY3A 3U9TA 3VH3A 5I8PA 1EFHA 3N6XA 2DECA 3HLYA 2GVIA 3ROMA 2D54A 3RA5A 4YHHB 3L07A 1II9A 4IMJB 4IDFA 3OJEA 2AOUA 3X1KA 4LSMA 3QVMA 2C03A 1KZYC 1BQ4A 1NSFA 2ZB3A 2ZRIA 2O2HA 5HG0A 3N53A 5CB4F 1OROA 1WHSA 2GJ8A 2HPHA 4BATA 3WA7A 4KSCA 3ZZUA 3OKAA 1A5AB 3LUKA 1UBTS 4RADA 1H66A 4TUYB 1PBTA 3OICA 3NV7A 1VPLA 4REQB 3ESXA 1IN6A 5CFMA 1SY7A 1UOOA 3ZP4A 3LY9A 2FG7C 3IULA 5LOVB 3IERA 3UHJA 3VBCA 2ZSBA 5F4BA 5A4IS 3ME5A 4X60A 3MN1A 5KJCA 3DZCA 4QU8A 3NFRA 4DZRA 3GN1A 3E1SA 4CQLA 5WRFA 2J6CA 2GD6A 2PZJA 2WZDA 2IYTA 3P0EA 5A1TA 3P9YA 5EZQA 2XOKD 5I5EA 4P7JA 3TZ6A 4YRBA 3HBJA 1CP3A 2GN6A 3O93A 2W6NA 1EQAA 4Y2PA 1RXWA 1DO0A 1C8BA 1D2HA 1UMDB 3HGTA 4UPVA 3U2QA 4YCCA 3M6FA 1WJGA 1B8UA 1IWBB 1OE0A 3KXPA 1P0QA 3AB8A 2NNWB 3KOOA 1N3BA 2HQSA 4WZBA 2EIHA 4CMGA 4DABA 2R79A 4E3WA 5F21A 4ZZ0A 3W8EA 4AUEA 4YT5A 3GDFA 2BEKA 4BNGA 3AETB 3KFXA 3BF7A 5BR8B 3EHDA 2H1VA 4QYWA 1YS1X 1I2CA 1UPCA 4B45A 2R7MA 1HETA 2WSIA 1WY7A 3D8RA 3E2PA 1JE0A 4MVJA 4MEBA 5EIOA 5KAMA 3GYBA 4JI1B 1ZOOA 1A5ZA 2B98A 1A4IA 4AM8A 1UODA 5TGDA 2RGUA 2VQDA 3M4YA 3MS7A 2GCGA 2DXIA 3I52A 4QBFA 4BP8A 2CW5A 1MX1A 4DIOA 3ZV6A 3PXEA 2I4OA 4YJGB 1MB3A 2Q1YA 3WWZA 3WIVA 2JJ2A 2JANA 2HRYA 2HJVA 3LCVB 4NBUA 3RFVA 3ZV7A 2CXXA 3FHTA 2A88A 2PQ0A 3LUHA 4Q5IA 3LUCA 4ZO6A 2RGYA 1OBCA 3WI7A 1T5DX 2WZBA 3KR9A 3H9GA 1A1SA 4ZYUA 2JARA 3KJKA 1I5OA 1ND6A 3CRMA 4YRLA 2QT9A 4TWBA 2Y3IA 5G40A 3RVRA 3M9XA 3FWHA 4LWQA 4AKGA 2YCLA 4RK0A 4KPUA 2AFVA 4IFIA 4XQCA 1ESMA 4KE8A 3I61A 4OFXA 1LI5A 4I08A 4LG1A 1IN5A 1BWPA 1GAJA 2C31A 1PZNA 1RI3A 5CAEA 2V7BA 3USCS 8LDHA 4ZVRA 4IJWA 1EFKA 2WOJA 3SM9A 3RYIB 1M73E 1O5TA 1T9CA 1BX1A 1FS4A 1E7YA 4FSHA 4HGNA 5FTKA 5EKDA 2HNAA 2JC3A 4G0XA 4D8WA 4V0RA 1KH2A 2HYIC 3ER9A 1EWQA 1ESEA 2HNKA 3C6KA 2VT7A 4RIHA 4RCZA 4ENUA 3ZD6A 4NXNB 1I2DA 1S72F 5A6SA 1VKNA 3SZRA 3NT5A 1OI2A 1QRAA 1UBMS 4DJ5X 5K4GA 3OY7A 2BGLA 4FGZA 4Z54A 3S8YA 1W9MA 1HLDA 2ODBA 4J07A 3E1GA 2R6JA 1PGJA 5DTIA 4IKOA 4AJLA 2VTBA 1OVMA 3M4JA 3SEAA 1UBGA 4X7RA 1UUFA 1PL0A 1QG0A 1JBKA 3K0EA 5JXIA 1ZK1A 1Y4SA 2OA0A 2CNNA 5LLSA 3M3HA 4LX8A 4W9NC 3DP9A 1RPNA 4TYMA 5KQLA 3GT4A 1QQTA 4MWGA 4GGOA 3ZW9A 3TKAA 5EP2A 4PGGA 3EBLA 4MLCA 3VO8A 4COKA 2O4CA 2QIOA 1Z56C 1MJGA 3FUTA 1O96A 3WMEA 3OOYA 5K6AA 5JCJA 4B2YA 3FJ1A 2IH2A 3WA6A 4EJ2A 3GQBB 3GT7A 4BFSA 5AKEA 4C43A 4RTLA 3RHZA 1JL3A 2ARKA 1T5OA 2GD0A 4U8HA 3D2CA 5EB1B 4B81A 3LFUA 3EORA 1C8KA 1X13A 6AT1A 3LRTA 1OB5A 2QPLA 1NYQA 2HA5A 4R6XA 5T8KA 3GLVA 5FOSA 1MW9X 1X19A 2EX1A 3G8DA 2XKBA 2Q9AA 3L40A 3W7BA 2RHTA 3OLWA 4F3RA 3AT1A 4D4HA 2V97A 4KR0A 1L1QA 4M9QA 4AWXA 2NO4A 1J00A 4QEZA 3TKLA 1BXRA 1N2CA 1AZTA 2FFRA 4PXSA 2W58A 221PA 1J8MF 3LT2A 3GLGE 4W5NA 2R97A 5CIQA 2FVXA 2P9YA 1ATZA 1Z0KA 2ZYTX 4KQ9A 2JRCA 3EQ9A 4GXQA 1UBNA 3UPUA 3HYTA 5KTPA 1GGEA 2V03A 5EPEA 1KGDA 3IUYA 1YHNA 3T5BA 1Q8RA 1SC6A 2VVTA 1DBSA 2GGSA 3QFTA 4WBNF 2BDEA 2IYVA 2OCGA 3Q7PA 3RVBA 2WJHA 3QWIA 2BEUB 1YB4A 2GTPA 3CBGA 1DTWB 3W2HA 3MGCA 2C2HA 2PZLA 4BTVA 1H22A 3AINA 1L2TA 5AOVA 2E89A 4K9KA 5AXDA 4E46A 3I39X 4DA8A 3RBVA 4TM7A 1T9HA 2QYTA 2LGJA 4JT9A 2ZI5A 3JWEA 5G0SA 3GLHB 1IMOA 1Q7GA 4QT4A 5IJZA 4Q9NA 4IF6A 2EOAA 1PR5A 1FNCA 2LV8A 1P2FA 1N5RA 2HC9A 2QLMA 4FEEA 3O85A 1E98A 3UG6A 1RPTA 2XDYA 1V5FA 2P69A 4CKCA 4EVSA 3CCMF 3HDVA 2AF3C 5F9FA 5LZ4A 3FNGA 4O2AB 4ZCLA 4XIYA 5HKOA 4LHVA 2V9CA 1H0HA 3AR4A 3FGNA 3PLRA 3G17A 4UOQA 3CJQA 4K6OA 1KEKA 2BONA 2GM4A 2ZPAA 3H1BA 2WU3A 3ZTYA 1CYEA 3BIOA 3H11A 5CR9A 1WBBA 5AQ1A 4ZHQA 4DR4B 1G8JA 4G0YA 2B4TO 3OO0A 5ALRA 2RGGA 2UZ4A 1FP7A 1BN6A 3V97A 3DZDA 2QR3A 3KFVA 3ELBA 5T4FA 3N2KB 3OO1A 2PYIA 3BK7A 1SCNE 3F7NA 3WHLA 2X5XA 4RETA 4DLWA 5A4AA 1X7YA 2I22A 1QRUA 4FLMA 1W29A 5AI6A 2YUIA 2VYQA 3IAS6 5AJVB 4AX8A 2UYOA 4KE6A 1Z83A 3U1TA 1PSDA 4ZQCB 4ARCA 1A8UA 2ZS9A 2WAAA 3DC7A 3IKVA 4P84A 5CK5A 5D8DA 3WQQA 1NUQA 3EGDA 3HFRA 4KNYA 1XMPA 3HPRA 1GKYA 1XVUA 2FI1A 4XD2A 2DR2A 4IIHA 4A9AA 2YZNA 4OJKA 4AUKA 2FMFA 3A32A 1P5JA 3CZAA 3FFBA 4CV2A 2A5JA 4NENA 3SOZA 3F3YA 3RG8A 1RFGE 4ETIA 5MN4A 3DO8A 2XB8A 4Y0AA 3DTNA 3TW6A 3Q72A 3LDHA 1H0KA 1M67A 4G0MA 5DBHX 3Q5EA 4RZ3A 3BB4A 2WNHA 3KKKA 3LC1O 3P2KA 1GZUA 5D01A 1BTOA 3ZWVA 4BBAA 1OGIA 2RAFA 5BN5A 4CEIB 3C39A 2JKVA 4CM9D 3JVDA 4QNMA 4R40A 1WOMA 5AD1A 5E2AA 4KX5A 4B47A 3F6RA 3ETGA 1RP1A 2HV9A 4IP0A 4X64B 3LVQE 3E3MA 3WDKA 2NU8A 3FTFA 3KJGA 1ISRA 5I5GA 3LMEA 2ZZKA 4BE4A 4AVYA 5KHOC 3VVLA 4RCVA 2ZZNA 3B7WA 1TK9A 4W9NA 4UAGA 4CDGA 5JNLA 2GJAA 2Z8YA 2JLQA 4NYJR 1C80A 2SCUA 4D3SA 4FYMA 4O33A 4YUAA 4KPFC 1QGYA 2R7KA 3H8WA 4HZUA 3GRPA 5JWRA 3SHQA 2VDJA 2D59A 3Q8KA 4HNRA 5CB4A 3LHKA 4Q0MA 4C0XA 4EKIA 4ZJYA 3G0CA 1MGOA 3CYPB 2IDZA 1P81A 3BFXA 3P71T 3LLMA 1F0PA 2PZFA 1O94D 4PZLA 4RHTA 3X1ZA 3SU8A 5A04A 2ALEA 1GSOA 3K1YA 3TXAA 2VP0A 3OEWA 1M2GA 4G1FA 3D9QX 2CMDA 2YFHA 4CR6A 5REQB 1LDGA 2OAQ1 3RODA 2Y71A 1FFAA 1H8EA 2FHPA 2H4FA 2X15A 2ZB8A 2B8NA 2TYSB 3N0WA 3QVKA 4H0CA 4PZUA 5EERA 3QWHA 1C1XA 5BWLA 5CIYA 1E2LA 2O7SA 8OHMA 1CUXA 4ZZIA 4ZTUB 1JX6A 4NMXB 4NJMA 4RMNA 2OV4A 2VDWB 3A26A 2Z57A 4BJHB 5JXGA 3QTYA 1V3VA 3PE6A 4CUJA 5LZ2A 3F6PA 3SWWA 2CZQA 3HQ4O 3PXUA 5FKJA 3UMMA 3DMHA 2JIQA 3EGXB 4RSGA 2HHHB 1R00A 3O03A 4PSVA 1FQOA 2GO7A 16PKA 2F1KA 4NYIQ 3GNQA 2W48A 3DTVD 2W2QA 5AK0A 1TTPB 4MB6A 1EXDA 3CLSD 2XB6A 4JDUA 2ZTMA 1S3FA 3R5XA 1W73A 3NVKI 3UT5A 5F64A 2VAVA 1LWNA 5IH7A 1RWOA 3WQBA 1GAEO 1RSZA 3IAS1 3JU3A 3RBZA 1UJ6A 1MB9A 2CLOB 1XLTC 4PM4A 1X7PA 3OZTA 2Z56A 1E1MA 2BLNA 2AGVA 3C8DA 3ZWYA 3MWDB 3L7DA 5FLKA 4OP3A 4UFPA 5LBUA 1K8ZB 3AEXA 4DT1B 1Y98A 1MO4A 2ST1A 3B8EA 2YVKA 3SHTA 1GNRA 5EAIA 4DLUA 4XD7D 1PS8A 3PUJA 4QU5A 1PX2A 3PNPA 1JKXA 5J5CA 3AI3A 4ZDJA 3F5SA 4C0KA 4QREA 4FYPA 2WSYB 1HDYA 5IXYA 1N2BA 4AZ3B 2ZJ6A 1DBFA 4KFUA 3PITA 4DMRA 2Q6OA 1FSFA 4IZOA 3ZVRA 3I72A 3QQPA 4WQMA 2C9ZA 4Q9DA 1ES9A 4KG7A 2A14A 2DFLA 1Q50A 3JQ6A 3NBAA 3WYNA 1PJLA 4MHSA 5A3RA 4WLNA 3LUAA 3CZ4A 3ACCA 1DEKA 2B2CA 1V7PC 1W42A 5FPYA 5BSMA 1NVVR 5CT4A 1CHDA 3PNOA 4FFDA 2V9YA 2ZRNA 2O5VA 5H1YA 1KORA 5CXQA 5D6OA 2QV0A 2WWTA 4W5WA 1MZPA 3VNVA 3EDRA 3ZHZA 5JMWA 1V8DA 4IUDS 4NDAA 3PXGA 1UM9B 1X7WB 1XD2A 2YVUA 5I47A 2ZUVA 2WHQA 2I4MA 3D8SA 2EFDB 2JLAA 2ODAA 3B1WA 5D6NA 3ZH2A 4DA0A 5J58A 4YBRA 2F48A 4R8RA 4MDFA 3OT1B 1GUDA 2GM9A 4L08A 2R1VA 3S2FA 4NNOA 1CHNA 1U7XA 4PLHA 4BMCA 5LP6B 3FCSB 5ICMA 1T24A 1TZCA 1A9ZA 1S2DA 3HKEA 2C9BA 4YCBA 2VP9A 4ZQIA 3VO9A 5LL6P 2M6RA 2KHZA 4MYCA 3R76A 2ZCUA 1C2YA 2PZBA 1XK7A 4CT5A 1S4QA 2ZJYA 3DSRA 8AT1A 1JEQB 1FLAA 3OQMA 5TS3A 2J4DA 2KBFA 3CWZA 2VNKA 4MKXA 2PMWB 3WKDA 1ZICA 4RZXA 4R31A 1OOEA 3KT6A 1T0KB 1KBOA 4OXQA 2DPXA 1MFPA 2I1QA 1WSAA 2ANBA 4BVQA 1JHXA 2FUG1 5GPBA 3KIZA 1PGOA 1OI4A 2DWUA 1G20B 1Q1EA 1Z82A 2FEXA 2FXIA 2OCKA 4QT0A 4BVRA 5AI5A 3CTMA 2QXUA 3G2KA 1HDRA 2Z2XA 3A9TA 1TQ6A 1VKJA 4J0IA 1UK9A 4JI2B 1QUFA 2EW8A 4TT3D 1T35A 4WFQA 5BWOA 3ENVA 1HDEA 3GVPA 2PSEA 2BGIA 2YJGA 3BWCA 1KFEB 2JD1A 3D2BA 5EIAA 1UWCA 4RM3A 3T5MA 2WALA 3TZCA 3ORHA 4RDHA 2VDRB 3KZNA 5K0FA 1VJCA 1JZSA 1XDZA 3FPGA 3SJAA 5L53A 3A6GA 1M3SA 2FQXA 4CNQA 5JQGB 3N3BC 1KAEA 3EBPA 4XSVA 2XCTB 1FSPA 3PRHA 5J2UA 4LJ6A 3KTFA 5BOSB 2AC4A 3GEIA 1E96A 4TQAA 2IVZA 4O8CA 4RH1A 2FX2A 4QPDA 1U0FA 2QMYA 1MAUA 5HMLA 2X58A 2BM9A 1XZDA 4GPD1 3EEFA 3OBBA 2XUGA 4EKNB 3ZUGA 4E1VA 2ZVQX 1OT5A 2E4XA 4DSTA 5CUQA 2VDLB 3IOYA 1YRBA 3R9IA 2HR1A 4LEIA 3EAFA 3A6LA 3UWOA 5AVXA 1H8HD 4JBXA 4RHCA 4LDAA 1RLUA 2GBLA 1C14A 2ORIA 3EZ9A 1XVIA 4UEQA 4OMUA 4UVIA 4QU9A 1XGKA 1A9OA 3FXAA 3C8MA 3BIJA 4HGRA 3IESA 4EX7A 2RCYA 5SZHB 2QN8A 1QHXA 1ULAA 1MIHA 1AHNA 2P65A 4H7KA 4PU0A 1D9XA 4KO8A 2JIZD 1IHOA 3L7QA 1VYHA 4N3AA 1DC6A 3NGXA 3VPCA 3UJAA 3FKQA 1DKRA 5ICSA 3D00A 2ZRLA 4YK7A 3UUEA 2P79A 1I2ZA 3MYRA 3BEOA 4IGFA 4DR1B 5THKA 2RGRA 4KOEC 4C88A 3SZMA 4ZMSA 1F06A 2XNSA 1JAHA 1RIFA 3IQGX 1W19A 3QG5A 4AURA 4YCNA 1YMVA 4AB1A 3R9WA 1C50A 3CT4A 3QX8A 3TF5A 2WJPA 4N7BA 1SEPA 3HSSA 4N76A 3UWPA 4UBMA 1J8DA 3HVUA 1FTYA 4L5YA 1D2NA 4IDAA 1HDGO 4DQVA 3R77A 1ZESA 1U1EA 2PD6A 4KHZA 3SEZA 3WJQA 4C20A 1C9NA 4X24A 4CEJB 1TCBA 2NTYC 2JFHA 3H3FA 4X6YA 2CZCA 1ZH4A 3AHCA 3KZCA 3A3NA 3KSAC 1PNVA 1PHRA 3ND7A 4ZAZA 3PQCA 2CNLA 1ZGBA 2OHVA 2G17A 2VDUE 2ZWOA 3OIGA 3ONFA 1X0VA 3ZIAA 3ROGA 3K92A 1SDSA 1GQYA 1PSZA 1DV1A 2FPIA 2PGOA 3AP1A 3FLBA 3CCJF 3HSYA 4OL9A 3BDVA 4YRFA 421PA 1F2UA 1LRJA 4QUEA 1NP7A 3FUUA 4U0KA 4Z0NA 4PHCA 3EFOA 3WWEA 2EJVA 2C4KA 1NX6A 2NV6A 3VTZA 3HCCA 1U9IA 5DFAA 1WIWA 3RUCA 3UW1A 1XPUA 5E9QA 2O57A 1VLZA 5EWRA 1XTQA 4Q1EA 5ALWA 5LA6B 3OFND 1EB8A 2VRWA 3VDMA 2W83A 3S55A 3QFHA 4MXDA 3STVA 5EJ9A 1IZ9A 4TKUB 4DUGA 1PQPA 3B3GA 3DOUA 4BNMA 2W5UA 2HVYD 5KSYA 2DQYA 3C3DA 3DM9B 4HMQA 1FEZA 2NV2B 4RNCA 2YJ3A 2YJ6A 3X1MA 2L18A 4AULA 3QOXA 4PZEA 1GO0A 1IHDA 3WGOA 4LXIA 4CG1A 4E4YA 2BH9A 3W4KA 4X54A 3ET4A 3L41A 3EA0A 3SJUA 2LNDA 5FWXA 3U40A 3N0RA 1PIWA 4MUAA 4MW7A 4TZTA 1T4GA 1T10A 4ZREA 3Q0IA 3VAZA 4EO9A 5C1BA 1XN1A 3OF5A 2CEKA 4V24A 2ZCJA 3V80A 4I1RA 3CRZA 2QL6A 1CQZA 2GB4A 2O0LA 4XCVA 1SBNE 2JCVA 3VYSC 1U0RA 2ZYWX 3WADA 3QSGA 1HTBA 4WZAB 5HA5A 4ITRC 3IVMA 1K7SN 2KB0A 4B6OA 4H3HB 2OQRA 3ENZA 3BWVA 2DVMA 2SNIE 2Z9BA 1CJTC 1WCV1 2PKYX 5G1PA 4BKRA 1K8QA 2YW9A 2HA7A 2Z1DA 4RL6A 5JADA 3K94A 3P1JA 3O3OB 5LFAA 1QC5B 5LPNA 4DKJA 1M1UA 4IDGA 3FSEA 3PJEA 3AZPA 3BRCA 4ZT6A 1D6MA 2H57A 3UAYA 2PL5A 3T1NA 1RTTA 3GGOA 1EE1A 4ENSA 1UFKA 2EWWA 3HCFA 4YMIA 5EAZA 3PT5A 1X42A 1CQXA 2WINI 4I1OA 1FVXA 4HQNA 1XLWA 2WAYA 4M6WB 3TNDA 3HKDB 4NSNA 5DMXA 4CYMA 1QAQA 3H75A 4K26A 4IR7A 5DBOA 4RH0A 5HIJA 2Q41A 4EARA 4O2LA 5BSVA 2OENG 3CCCA 5BWMA 1AGNA 4FI3C 3ZZNA 3GB9A 3PR3A 4HAYA 4J4HA 4K6KA 1N8TA 4QJIA 4U9IS 4E4RA 1QJ4A 5ULLA 1UMBA 5LYJF 1A9XB 3AUUA 4WY2A 3OG9A 4PSDA 3PEUA 4Z9XA 1CQJB 1WCYA 4TKVA 2Z4RA 4FT2A 1N9GA 2DETA 1R4MB 1I4DD 1NUUA 1TKRA 4ZU6X 2GPWA 3JWPA 5IJ0B 3KPWA 2L19A 3DCJA 5JLJA 5BN4B 3TUZC 5CTJA 2BMVA 2GZMA 2W11A 2ZJBA 2G7ZA 3C7TA 2PAFA 3D1JA 4WJZA 5I4CA 4IUCS 5JQWA 1A4UA 1BFUA 3NWEA 3LSTA 1EGHA 4V0OA 2VGNA 4HFMA 3H1AA 1AN9A 1WW2A 1CU1A 3DDHA 2F3RA 3BH7A 1W75A 1VZ2A 4EKDA 3LXMA 2EBWA 1XDWA 3EZFA 3P26A 5EZ6B 1T3TA 1ZIPA 3GP5A 4US2R 3TD3A 3C7DB 4NE2A 3THRA 1PEAA 3LPDA 3K0AA 3F6EX 4E2FA 3WLNA 3K20A 3NVMB 5F9HA 1GG9A 2YINC 5T6MA 4HI0E 4CWAA 1DG9A 2TMGA 3TSWA 3PBKA 3K2IA 2C5LA 1XTJA 2WHXA 4HTAA 1L8OA 5F1KA 3CUEF 4KQKA 5ELMA 1G6Q1 5IJWA 5AVOA 2OD2A 1A5SB 1K8RA 1W1WA 5MHTA 2E6KA 5K0NA 4EI7A 1C81A 1J23A 1OZGA 2QMUA 3K1AA 4Y1GA 3GDOA 4EJSB 4PIMA 1I4LD 2H63A 4I2VA 1I13A 1KEWA 4DQ0A 4W9MC 4DWVA 1SNYA 2IU0A 5A1JA 1FC0A 3D6JA 3OAAA 3WDMA 2C1EA 3QBEA 1ZI9A 4GMDA 2HN9A 2OV3A 3R6GA 3EZ6A 3RC7A 3UYLA 2RFLA 1UKCA 2XGGA 3MS2A 4L15A 2XXAA 3WNQA 2FWNA 2RK4A 5K0GA 2JGFA 3B6KA 2H5LA 3DXXA 3PI7A 2UVPB 4ED9A 2AFIA 3VR4D 1DWPA 1X39A 1LV8A 3T5AA 2WTUA 1W30A 3TSZA 1DQZA 1DIOB 2B5OA 2OB1A 1W0JD 2I2FA 4O5OA 4PYQA 1B4DA 3D0QA 5ITZB 1UZAA 2MSKA 2WUFA 3I0MA 4WUVA 5HHTA 1F4VA 3FSGD 2V0CA 2H7CA 3HBNA 1JR2A 1N6LA 5DEIA 1L1FA 2H00A 2V9PA 5ALQA 2UV8A 1BFKA 1MB2A 4HUJA 4PYIA 2XEDA 2Q7DA 1YA6A 2ICAA 1E63A 1SHLA 2AXPA 1DIBA 2HREA 1MX5A 2ZDGA 1W1IA 1G5TA 3M34A 3OX4A 4FZJA 3LDAA 4I1YA 4IOK