4DXDA

Staphylococcal aureus ftsz in complex with 723
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
307
structure length
307
Chain Sequence
b'ATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVSGEVNLDFADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLETSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPELQDEIVVTVIATGFDDK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division protein FtsZ
molecule tags Cell cycle/inhibitor
source organism Staphylococcus aureus
publication title Restoring methicillin-resistant Staphylococcus aureus susceptibility to beta-lactam antibiotics.
pubmed doi rcsb
total genus 108
structure length 307
sequence length 307
ec nomenclature
pdb deposition date 2012-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
A PF12327 FtsZ_C FtsZ family, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4dxdA02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4dxdA01
3ZBQA 4O2BB 4ZHQB 3JALA 5LXTA 1FSZA 1SA0A 1SA0B 5FNVB 4X1KA 4I4TB 3ZIDA 2R751 2XKBA 2RHLA 5BMVA 3RYHB 4EI9A 4B45A 5LYJA 2VXYA 3WGJA 4B46A 5IJ9B 4WBNA 4E6EA 5CA0A 3HKCA 2BTQB 3N2KA 4LNUA 5JQGB 2RHHA 1TVKB 1TVKA 3E22A 3E22B 4IHJB 3VO8A 3HKCB 5J2UA 3N2KB 2VAPA 4LNUB 4ZOLB 4EB6A 5JQGA 2BTQA 3N2GA 2RHOA 5LA6B 5EZYB 4I55A 5ITZB 5CA1A 4X20B 2GVIA 4X20A 3M89A 5M7EA 3HKDB 1W5AA 5LA6A 3N2GB 5J2UB 4X1KB 5MN6A 3JATB 2RHJA 4O2BA 3JALB 5LXTB 4ZHQA 4DXDA 3JASA 5EYPB 5CA0B 3CB2A 5CB4B 4YJ2A 3WGKA 3WGNA 3C8LA 5JVDA 5LP6C 1FFXB 3VPAA 4X1IA 4FFBB 5JCOA 5BMVB 1RQ2A 5CB4A 4I50B 5KMGB 4EI8A 1TUBB 5MN4A 2Q1YA 4F6RB 5FNVA 1OFUA 2VAMA 3VOAA 5LOVB 4O4LA 3HKEB 5EIBC 3VOBA 4O2AA 4O4HB 4YJ3B 5GONA 4X1YA 3JARB 1Z5VA 5IYZB 3WGMA 5EZYA 2R6R1 4HNAA 4I55B 1W5FA 5GONB 3HKBA 4EB6B 1W59A 3HKEA 4TUYA 3RYFB 3UT5A 4IHJA 1W5EA 2Q1XA 4F6RA 5JH7B 4EI7A 4HNAB 5IJ9A 4X1IB 1W5BA 4KWEA 5IJ0B 5KX5B 3RYHA 5JVDB 4O4IB 4U3JA 3JAKA 3RYCB 4I4TA 5LOVA 4O4LB 1W581 4I50A 5KMGA 1RLUA 3HKDA 1JFFB 4TV9A 3RB8A 1FFXA 5CA1B 4FFBA 5C8YB 5IJ0A 5C8YA 5KX5A 4YJ2B 4IIJA 1JFFA 4TV9B 3JAWB 3R4VA 4TV8B 3JASB 5EYPA 5JH7A 2VAWA 3JATA 3UT5B 4TUYB 3RYFA 4ZI7A 5LP6B 4XCQA 3M8KA 3JAKB 3RYIB 3RYCA 5LYJB 2BTOA 4U3JB 1Z5WA 4O4IA 4O4JB 5J2TA 4O4JA 4DRXA 5J2TB 4DRXB 5ITZA 4X1YB 3JARA 3RYIA 2XKAA 4ZOLA 4O2AB 4O4HA 4YJ3A 4ZI7B 5LP6A 3ZBPA 5EIBD 5JCOC 3V3TA 5MN5A 1TUBA 3JAWA 4WBNB 4TV8A 3HKBB 4IIJB 3WGLA 3VO9A 4M8IA 5IYZA 1RQ7A 4U39A
chains in the Genus database with same CATH superfamily
4MR9B 2IU3A 3P0EA 3HVJA 1NOJA 4G88A 3T1QA 3B3GA 3MT0A 5AO9A 1NOIA 3NWPA 1NY5A 5JAOA 1GG9A 1ONPA 2OZVA 1W29A 3F6CA 5K0LA 4RHUA 5A04A 3NDPA 1AGNA 2VDLB 1ZD3A 1YIAA 3K09A 1UKVY 1P62B 3BZWA 1SOMA 3QE2A 4W9NA 1XLVA 1VCOA 3PUWA 2P3OA 1NM5A 2HTFA 4LBZA 2JJ1A 2MSDB 4RKFA 1PD0A 1E4EB 3H4MA 3MTGA 4EJSB 3KP1A 4M0EA 2UXDB 4L1KA 1YZUA 4Q9JA 2LTAA 1ONBA 4ZOLB 4RVSA 2YJ5A 2XTAA 2X8BA 2ZXEA 1B1CA 2ATVA 4HYTA 2JD2A 3TW8A 3JYOA 3IQWA 3UC5A 4NU6A 2JKYA 5D1NA 1XRNA 4X8MA 5FAKA 2DX7A 4DGSA 5A4MS 5DM60 4NZMA 4RZ3A 2FMTA 1BKSB 4RWZA 1E7SA 1TAQA 4DJ5X 2O8EA 4ZHQA 1KYYA 5JXJA 2X0RA 3BFJA 3FMVA 3INGA 4FFNA 2CFOA 4QT0A 3WL7A 3DOJA 2P9FA 4HDKA 5FTLA 2QDKA 2XB6A 3QVJA 2AZDA 4GOXA 3VZPA 3B7PA 4IFEA 1JVSA 2PWPA 2E4YA 1KZ1A 2AIZP 1PD1A 1RRPA 5IULC 2JGDB 4KDCA 5HMMA 1C9MA 1P6XA 5A4JA 2HEIA 4DJTA 5ARBA 1K6XA 3CC7F 2VDVE 3G88A 3IAUA 4BO3A 2QX6A 3CPEA 4HVLA 1QVWA 4EJFA 1FE8A 4HGOA 5H7XA 5IH3A 3A05A 2IOYA 4LGYA 6ADHA 4RKQA 2BM9A 2CFTA 5BVHB 4L85A 1KL7A 4WZBB 3ZU3A 4OPMA 1NV8A 4K6CA 1IMJA 1DFHA 4U2CA 3THWB 4L2IB 1KR5A 5J5CA 4OLHA 5CT5A 5CYOA 3L1IA 2QBYB 4BBJA 1XMPA 2VJDA 1Y3FE 3UCEA 1A0OA 3DE5X 4TQGA 1POXA 3TBHA 4EBFA 1CYDA 4XX1A 3O84A 4MR8A 3Q88A 3OWHA 4K87A 1K8YB 1SWWA 2IUYA 3H13A 4NZZA 5CGZA 2OFPA 3GLHB 4WN3A 3S0YA 3TX6A 4HQFA 5I7UA 2AJBA 4N5HX 5AHWA 3R3VA 2JIZD 1I32A 5DM2A 1YBFA 3TJMA 4F5EA 3KUDA 2M1ZA 4IUYA 4PQGA 3WLAA 3K0HA 1KE1A 1Y5NA 5I8WA 1H9CA 2RGUA 3PPIA 2A57A 4E46A 4BVFA 3DE4X 2VBFA 2W6PA 1PJQA 3AUXA 4AJIA 2W2VA 1AXRA 4X7MA 1W2WB 3NP7A 2CLHB 3OCUA 3FMIA 1R6AA 3NU1A 1TA0A 4K3VA 5E9WA 4O4IA 1HDIA 1LC3A 2IZ5A 4Z4EA 2J33A 4CU5A 1K7CA 2POQX 2VYCA 3IDAA 3HUTA 4ZI7B 3MB8A 4NEHB 3FFAA 2I6QA 4B1FA 4YI3A 3PUKA 4WAUA 1AXGA 1B26A 3IPYA 4AJNA 5B1IA 4G8BA 3PNBA 4HS4A 4JFRA 3ZIAD 4DB2A 3PE4A 1L4BA 3AG6A 3J80M 3SLGA 4M8IA 4L07A 4ZKDA 5DX8A 1RWMA 4Q37A 4R5MA 2PSSA 2F3UA 3WHLA 1ECPA 3THRA 4BMXA 5DLYA 1YZHA 3EVCA 5A3RA 5AVTA 2RARA 3PNLA 1RSZA 1DADA 2XZOA 2EHDA 2ZSKA 3W5JA 2FPGA 1JL3A 3BREA 2DQYA 2RH9B 4LJ8A 4U2EA 3K9HA 3UVEA 4B3IA 1SZCA 2CVHA 1G59A 3GCZA 2Z57A 1JHUA 1AK1A 4LFAB 1S5PA 3KOWA 1H94A 4PQRA 2PMPA 5FI0B 1X7WA 3Q6MA 2P1ZA 3VOSA 4D8WA 3ND9A 2B1IA 1XEXA 3FZQA 3PEUA 4ZDJA 1AK9A 3U0OA 4D3FA 3TQCA 4UNIA 1Z17A 3H8JA 1N2CB 4OI2A 2TRSB 3SHVA 1CR2A 1H5QA 4QEDA 4DA7A 4Y6OA 5IU6A 5GIPE 4FSXA 3JD4A 2B98A 3W5VA 4FC6A 4FVTA 4MS1B 3RLIA 1WM1A 1VCNA 5EJ8A 4C3OB 4DBVO 9MHTA 2ZAMA 1CP3A 1NPYA 2D1YA 2DPYA 2P9HA 2WIGA 2VHXA 4WLUA 1LLUA 2XDQB 4KZKA 2ZYIA 3AGPA 4DUPA 1F4LA 2C2ZA 3C6MA 4HGQA 3TRDA 2XNCA 3BGOS 4MAAA 4P3PA 4E3WA 3Q7PA 3IT3A 1AM4D 1RXSA 3CO5A 3K1AB 3NXSA 4JB3A 3M4SA 1W75A 4URFA 5CNMA 4M46A 3F0EA 4TT3A 4TVSA 2I2XB 3K94A 3OE7D 2G36A 5CDHA 1GQQA 5K4HA 3UGJA 2VSXA 4BBAA 1CJTC 4EFNA 3KEFA 4TZ0A 1KH2A 1AKWA 1Y3BE 4KVGA 4KODA 4B5CA 1SCUB 4ZALA 3ZS8A 2BGIA 3GGDA 2BELA 3BWEA 1VE1A 1N57A 3KE9A 3RHZA 1EI9A 4IVQA 4I55B 1WMBA 2FUG6 1A9XA 3GBVA 3ED5A 1ZAKA 2ZJ8A 3IXMA 3OTHA 4RIIA 4S0XA 5AHOA 3BRSA 2IELA 3LBHA 2UDPA 3G7UA 4EO4A 3KHTA 3EXHB 3HXMA 1ADFA 3OQJA 2FFJA 1GT6A 2HJSA 2O4UX 2R44A 1Q1EA 3EHEA 4C7JA 4EY5A 4F46A 3RFTA 3FNBA 3CR3C 5CAEB 1L4HA 4NC9A 3UGTA 1SPXA 4U3JA 2IIPA 2PRIA 1I0LA 3ENKA 3LQ1A 3R3SA 4RY2A 4W82A 4E88A 4YRIA 1GTJ1 3V2UA 5BN3B 2JLQA 1N34B 4FNMA 4IJ6A 3AR4A 1W2BF 1AKYA 2ECQA 3W9YA 3AFOA 2GEVA 3PWKA 4XVHA 1NW5A 1XL0A 4JGBA 3OOJA 3PF8A 2ZCVA 1X1RA 4TTIA 2JA2A 1Z4NA 3I9JA 3ZWVA 2X77A 1W57A 4NENB 2NQTA 4QUJA 3TE7A 5BWBA 2FEMA 3C15C 4XJXA 4WMLA 3OTWA 2AF3C 4K88A 3PHGA 3I64A 3WLHA 3AJ9A 3I6QA 1IUOA 3L0CA 2UVPB 3E1SA 2OO3A 4HEJA 5ILOA 3NBKA 4IIYA 1MAHA 3FTDA 5BV0A 5KTPA 1QQBA 2F9FA 3F98A 4HQKA 4JYCA 5BWOA 1RZVA 2UYPA 3O8DA 1WXXA 1WETA 5LQSA 3R9XA 1SCUA 1XZPA 1YB4A 2VDOB 4UEQA 3WWZA 4B7XA 2EJVA 4YJ3A 3CMMA 4ZVVA 3TOSA 4B6JA 1YTLA 5JCOC 1XQWA 3M1XA 2AG0A 2ODTX 3K4PA 3PEVA 2MQEA 4J29A 1NQOA 1P6UA 2AOTB 3E9RA 4MW7A 4J16C 4WBNB 1ONNA 1C1DA 2PRJA 1Z74A 2ZJZA 3FGNA 3NHBA 3OFNA 4KV9A 4OHPA 3H1PA 1OX5A 1QCYA 2C7VA 2EF1A 3D7LA 1YJWF 1KTVA 5F1OA 1NMSA 4JN6B 4BO4A 3C1AA 1YZNA 1WY5A 2PZAA 1ZMOA 2FJ0A 3E7XA 2WJGA 3NHKA 3PBKA 5AT1A 3V32A 1THMA 2GH1A 2Y99A 1CUDA 2QP3A 2JAQA 2HV9A 3NAQA 3Q8KA 3LK7A 4WBXC 3GU3A 2QRVB 4M88A 4WUTA 4Z7OB 2I6DA 2INGX 4LZOA 5JATA 2D13A 1J7KA 4WN9B 4DCOA 1GV0A 3ZGVA 3A2LA 3CWZA 1V1RB 1B7GO 1HSOA 1ESEA 3HKCB 1NJ8A 1MU0A 2FUEA 2QUHA 3FCCA 3NVDA 3EG9A 4I19A 3WFIA 2OB1A 2QIPA 3AEUB 5LU9A 1PZFA 1XIVA 3V1UA 1X74A 2WHEA 1D1QA 5FO0A 5JFGA 4U2BA 1MAWA 3F4KA 1CP2A 1WG8A 4MKFA 3WY9A 3T5AA 3GDFA 2NXNA 2DPMA 1X15A 1QX4A 2LNDA 2QUKA 4DRYA 3IIIA 4K9KA 2A4KA 3R7NA 2HMYB 1GPKA 2EFCB 1Y7LA 2BHNA 1JA9A 2UZ3A 4R9RA 4CLEA 1Q0RA 4Z7NB 1GR1A 2Z04A 4FGJA 1X52A 1W5SA 1WB5A 1Y81A 4EJ6A 1YF3A 6CHYA 4Q03A 3SIRA 4LZAA 5AVXA 1QANA 1NU6A 4WESB 2PXHA 3RS2A 2QZ4A 5F33A 4QYXA 1OW3B 2PT6A 5C4MA 2BDEA 1K98A 5IZCA 2C29D 4JLPA 2Q2WA 4D80A 2PSFA 5ELXA 3T5GA 3BT7A 1T3ZA 3HJNA 4H15A 3OZWA 4PSKA 2DY0A 4PX9A 1YKFA 2RC6A 5K0SA 3IP3A 1P2FA 4LJ4A 4HXYA 4MVJE 1ISJA 1KERA 1V35A 4S1VA 5FLKA 3Q3JB 4EI7A 2V96A 1X3LA 2WYWA 3PYLA 3I12A 1YJXA 1IEVA 2R65A 3R3JA 4FD3A 2IS6A 1E1DA 1PZGA 3D6FA 4PAWA 2VEOA 3IEKA 4HDRB 2OB2A 1E9SA 3CZ5A 2JCYA 3PC7A 3IR6A 1KDZA 3LUGA 2FQWA 2ZVZA 1QHFA 4Q1AA 3HB9A 3RG8A 1QF6A 3EVZA 5KYVA 2PGIA 1I2DA 1LX7A 3PKIA 4J75A 4MJLA 4X9XA 5KYUA 3U0BA 4YRJA 4EY4A 4JXXA 1Z4JA 2F2TA 4MS3B 5CXXA 1K6JA 3DMFA 5AOBA 4B0OA 2CZGA 1NPDA 3MXTA 4JC4A 4NXMB 1RIFA 1JJBA 5ADWA 5TDHA 1YZYA 3N6VA 5I45A 1GA1A 4IIBA 4Q34A 2W83A 5CIQA 4ZC1A 1FQJA 4Y1GA 1H2BA 2R1UA 3GT7A 4LSZA 1JDJA 2C5LA 1X1QA 2ZKLA 3HYCA 4JA2A 3RUDA 1WUTA 3SC2B 4L4RA 3R3YA 3LOUA 1XALA 5JS7A 3WJAA 1ZMBA 4KPEC 5D3MA 3LUCA 1G2QA 3M5CA 1KO7A 1SK8A 2O7RA 2V7XA 2G67A 2ZK7A 3DFUA 3LLVA 1N7JA 3O03A 4XB2A 1IHOA 3CN7A 5E7MA 3G6KA 3P9IA 3QU4A 3BMCB 3I9NA 3PVSA 5EFOA 1B74A 4JT9A 3PRJA 4LDQA 4ER5A 5C7YA 1GZDA 5KNLA 3JALA 3S2SA 2IP4A 3ZU6A 3GRZA 4KOAA 1DAMA 3DOEA 1P5JA 4JJ7A 2W8ZA 4C4WC 2GN4A 4L6CA 3B9PA 1ZGJA 1TYBE 2RHLA 2C9MA 2PLWA 3QVGB 2WTAA 1CW2B 2AEJA 4K46A 4K9DA 1IPFA 1VLZA 2NZYA 3ZU4A 2F4VB 3KEOA 4F3KA 4YACA 1Y7TA 3VA7A 1XWWA 2Q6TA 2QR5A 3KR2A 4IMRA 2O2DA 1QRAA 3CEPB 2XZTA 2Y9MB 4MCHA 2V0GA 2L26A 3F73A 5CB0A 3T5DA 5IC4A 4DMMA 4DV4B 1K0FA 5ITZB 1D2RA 1A7KA 2R8EA 4U8GA 3JVHA 1CUIA 1H3NA 5ICMA 4LHYA 2RH8A 4ZHWA 2WD9A 4KFTA 1U1EA 1E3WA 2YWRA 4FMBB 4B4KA 4G5HA 3IEMA 4MV3A 1SUDA 2Q4RA 1NVEA 4BNIA 1DKMA 3DZKA 4ZCRA 5EYPB 4PYIA 5JAMA 2FWJA 4JHXA 1Z4QA 3COYA 4WK2B 2VPQA 3JRWA 1VJTA 4FFBB 2QZZA 2FB9A 3IP5A 3PB3A 4IOJA 5BSHA 1E9FA 4MQLA 4TT8A 1U65A 1ZIXA 3FMGA 2D0PB 3ZXSA 2JFWA 2P4SA 2QMYA 5WRFA 3ZV5A 3NOOA 4L0CA 1I10A 1NBEA 2JVJA 3HKEB 2PSJA 5KYKA 3LXXA 5SYNA 4TYYA 4B3CA 2ZRFA 2HJGA 3T3HA 1J56A 4KXYA 4FHDA 1RIIA 1ULZA 2GUGA 1U5CA 4YMUA 3FF1A 5EZSA 3H87A 4QM7A 5DM4A 1W59A 3SMQA 3QJ5A 2VRCA 4K6HA 4QAJA 2NPOA 2YOHA 3I72A 1KQGA 4AJ2A 3EORA 2P2YA 3B6IA 3NUZA 3NYWA 3Q6NA 3NJ4A 4QODA 1UEIA 1KC8H 3CF2A 1QGED 3WYGA 4MITA 1G0OA 3N4ZA 3ZOPA 1U7UA 1O7JA 4JUFA 1MR3F 3O7MA 3EFBA 5DT2A 3RC9A 1OB5A 2YNMD 4P36A 3ETCA 4BVEA 1Y3CE 2YN2A 4LWPA 4YECA 4EYSA 3S70A 2WUWE 1ZOOA 3I6MA 4F5DA 2ROQA 3TR5A 1VG1A 4JIGA 3F2VA 3FNEA 3WIBA 1TQ4A 4CIXA 4MAMA 3O8CA 3QUBA 3GFOA 3H42B 3ER9A 4G23A 2IOFK 4ZQIA 5CJPA 4WNYA 1QLHA 3TJRA 2NZWA 1PZEA 3JV7A 1UPUA 1JIIA 1H9AA 3DCYA 3KKPA 3M84A 1H2HA 1NF9A 2XYHA 1E8NA 4YRZA 4XYEA 1CZKA 1Z2EA 4NBWA 1H8ED 1ODTC 1BH2A 3HWX1 4BQFA 2NT3A 3S8YA 3IPCA 4FDVA 1L4LA 3IAS6 3WLMA 1RPZA 1PG2A 4KRGA 4X1YB 2I9PA 4DAEA 1Z0KA 3CRQA 5BMOA 2QN6A 1EBBA 1B8VA 1SVMA 1FFHA 2P11A 2X5NA 3EIUA 4DG8A 1IIRA 1BEZA 4UMFA 1DIBA 3BE8A 4J3NA 1MFPA 4XQ9A 3OPNA 2EYQA 5ALMA 4GW3A 2HRUA 1KY2A 3A6LA 1BKYA 5JJLA 1J7JA 1TYDE 2GD0A 1FFEA 1ESZA 1IJFA 1R74A 2AKEA 5HK8A 1NVVQ 4J03A 1KSJA 5GY7A 1GFSA 3BEOA 3BZUA 1XBIA 3C4QA 3GRPA 4LECA 4P2BA 1KE2A 2ZVQX 2JBHA 3OQPA 1T6ZA 2HHCA 4OUDA 3LPDA 4QYSA 1N1MA 7MHTA 1UDBA 3BEDA 4QDUA 4AP5A 4CEHA 1WVIA 1QV9A 5KU7A 3D8BA 4N0DA 3S03A 1G18A 4X6UA 1UJ6A 1AMNA 3U09A 4OEHA 1C3OA 4NCNA 4N6OA 3V8BA 1VQMF 5C18A 1FOEB 1RQRA 4L5JA 3DLBA 3KLNA 4AY2A 1O97D 1TL7C 4AUKA 2MSNA 3X1YA 5BMVF 5JHGB 4NNJA 2XMDA 3LX6A 2BKVA 4NU8X 3DTVD 1VQVA 1CRZA 1IB0A 2WTBA 1CJCA 1ULUA 4RM2A 4XPZA 1K3UB 5CRIA 1QJCA 2FSIA 1QGOA 3VZCA 4JZYA 1HMYA 4WNAA 3CR8A 3SJZA 1SU6A 4L0MA 3WK4A 3F74A 5JVDA 3DB1A 4IMIB 2ERXA 1CVIA 1Q0HA 2WAAA 1M5UA 2B94A 4EO9A 3KC2A 1J9GA 1SFRA 2R84A 4B5LA 5K6AC 1A5AB 1EFDN 1FDVA 1MGOA 4R1PA 3PGVA 1F3LA 5DHRA 1V8DA 1XCLA 3CF6R 3F8SA 4O3MA 2BY4A 4MS1A 2UU9B 3GGOA 1KXZA 1FYFA 4JHLA 4ON9A 1U3DA 1SQFA 1H5UA 1BQ3A 3VJMA 1F4VA 3BVPA 4CL8A 3K1JA 2BMJA 4CQMD 4B6FA 4XGKA 4BUZA 2EIXA 2C96A 1XKQA 2ZETA 2IYPA 1IQRA 4FMCB 3DT8A 4QJ5A 3JQ6A 4NAHA 4MDEA 2XQFA 1I1HA 3WIEA 3K2EA 1X7YB 5GIOE 1YOVB 1O6GA 4UMEA 1IOZA 1WB4A 4KWEA 2GPSA 4DWOA 2VFAA 1JYSA 5C35A 2E18A 3O82A 1IXZA 2UV8A 1UAYA 3T8YA 1VXRA 1TQ6A 2BHTA 1EHCA 1NN1A 1RAIA 4LSMA 2MHCA 3GMIA 4PPGA 1H42A 4O4LB 4TXJA 5EWMA 4OX9Y 2GEUA 2C42A 1CVRA 1VCHA 2EX4A 4H9GA 4NDZA 2CL6X 3S1AB 3HEBA 4GUDA 4XIJA 4NEQA 3UAZA 1QR6A 2WM2A 3DZDA 4JVLA 4POAA 2Z56A 4BO9A 1EIZA 2HJ9A 3ZCSA 2QZPA 3TX2A 3FUUA 3IA7A 2VKTA 3H7IA 2B8TA 2MSEB 2WWFA 1P72A 5TX7A 4CMEA 5LQRA 4QKQA 5I9TA 1AURA 2GNAA 3RYFA 3PDUA 4ZI7A 1TC2A 3IMEA 2ZTMA 3LX8A 5H3CA 5SYAA 1QHGA 2D1QA 2JDID 1SVLA 2P0EA 1QYIA 1C9YA 2VPZA 4HDSA 4NK5A 4UBNA 2IPNA 4G5XA 4XWOA 1V5IA 1T5OA 3RVRA 5FLXM 3S29A 1Y3AA 2QAJA 3A6ZA 5CCXA 3WGQA 2JG3A 4PG5A 1EUCB 1Z0DA 2JH9A 4JX8A 4NWIA 2PVSA 4O02B 4PFSA 5E2BA 1DBPA 3UGKA 2BLLA 2E37A 2XSZD 4I2NA 4MJ3A 2JAUA 2EW1A 1DJQA 1CCWA 1WV0A 2GRAA 2X4DA 3N87A 3PPXA 3W4KA 1Q7EA 1OH8A 2GETA 1QG6A 2YY5A 4ER0A 3CGWA 4ZO8A 1W94A 2P3QA 3E0QA 1NDQA 4ME6A 5FI3A 1JSRA 4ZT4A 2RGAA 4PHHA 1FSZA 4QTZA 1TJPB 4YASA 4CEIB 3PXEA 3O3CA 3MJSA 3NHPA 2XKBA 1XAGA 4FUTA 1JXQA 4D41A 3G5LA 5HY2A 2XA1A 4G3XA 4UUPA 1L7AA 1J8QA 4IKOA 1E3SA 5KSPA 4ARVA 3KXLA 1ULAA 2JFHA 5LIPA 3AXSA 3NI2A 4O2RA 1JNXX 3AJAA 4CM4A 1UT6A 2CBGA 2V5VA 4MKGA 3FOCA 5FWDA 2JCSA 3JWJA 1TAGA 1XK6A 2OCDA 4KXUA 2CJWB 4WKGA 3VTIC 3HRIA 4BLVA 1A1VA 2IBMA 3ROKA 1R18A 2GA9A 3Q3HA 3CHYA 1LSJA 1ZAYA 1KBQA 3LHIA 2VJMA 1PFYA 3SIVA 3FY4A 1MA3A 2B4YA 3QMMA 3W0LB 3RFXA 4M7WA 1D5WA 5ICGA 5TEVA 5KYGA 1T8WA 3QMVA 1FPQA 3FOBA 4M8LA 3ZY6A 1H6BA 1RYNA 3T3DA 4TMFA 2ZUUA 1LJ8A 2BCEA 2PX6A 2V65A 5CB4B 2XB8A 2E6UX 1CUCA 4CM8B 2BTEA 1VG9B 1U7DA 5KJCA 3VPAA 4DIMA 4AJ1A 2K6GA 5EIOA 5B1HA 3GROA 3NBQA 4QPDA 3RS3A 2WU0A 3R3UA 3I5MA 4LW8A 4DKXA 1CY7A 1FBNA 3AFGA 3IAAA 4QL3A 3U1VA 4NATA 3GC6A 1IYZA 3QI7A 1IG3A 1IH8A 1A72A 3V1TC 1YJ9F 1GZUA 4BUCA 3TQIA 4KWTA 2LBTA 3P4YA 4G1CA 4FCVA 3EGIA 2ARKA 3FW1A 4NMWA 4OHXA 4E5UA 3U4IA 3O47A 4F12A 3RSCA 4NS4A 5LQDA 3TL6A 1EBUA 1FX0A 1QC5B 2BM1A 3I2KA 4GMKA 1K7SN 5H3LA 1PEDA 3BE6A 1OLUB 5TE9A 2MTBA 3Q8LA 3PXBA 1P9RA 5G4VC 3MCWA 3EPKA 3N2EA 1XMVA 2A35A 4OU4A 4A73A 2I2DA 4QGBA 2JFQA 4O25A 3UK0A 3R5TA 3WRVA 4E51A 3WQRA 1VA5A 3TG2A 4IZ6A 4DLTA 5U4QA 5JECA 2PLRA 4YK7A 3AEZA 3OEYA 2PYDA 5FEMA 4PLFA 4MQ4A 2EG5A 3FDFA 4QXAA 2O14A 4LJ6A 3HI4A 3K6RA 1OWMA 2WMYA 5EVJA 1E94E 1FMTA 2PJDA 3BFVA 3O8QB 3K4HA 2QTCA 2VBCA 1SQSA 1MG0A 3HRKA 2J5KA 5JNUA 1G5PA 3DFFA 2JGIA 3G23A 2FZLA 3H8VA 5E3IA 5AQEA 3T3PB 4C2AA 2ORED 3Q0TA 4EUFA 2VRBA 2BEKA 1QIMA 3MB5A 4ONEA 3FFXA 3NIBA 4NICA 1OZGA 5KVQA 4Y0NA 5HZKA 2QA4F 1M83A 5CLGA 1W6RA 2XGMA 1P4JA 3HI6A 5CH5A 3A3PA 3J7AR 3ZHZA 3EUEA 3NHSA 2CUZA 4BQPA 1W0KD 1GRVA 3P0ZA 3IESA 4MI9A 2QRVA 3SEZA 2WM8A 2Y6VA 4B79A 4E1BA 3PTAA 4HEQA 4UPDA 5LDHA 4RHFA 1BJRE 3CF0A 3PE6A 4J4TA 3G17A 2O5EA 3EIOA 3BHJA 5COQA 4LXXA 1P18A 3WTBA 4DR2B 5KI6A 5DSXA 5BYJA 1ADBA 3IVXA 4NQRA 2H06A 4HWTA 5INTA 3KTFA 1RHRA 2IL1A 2RDMA 1M10A 2A0KA 2HA0A 1LCIA 3ZV6A 1O6CA 1PN3A 5F21A 1DKNA 1GG2A 3PEEA 4G0YA 1VDMA 1LK7A 1KMCA 2W37A 4NSNA 4OYHA 1G291 1Z0ZA 3DP9A 1JMYA 4Q4LA 1CFZA 1U0HC 1HOTA 2YZNA 4KR3A 2Z9CA 3QVWA 2BFBB 2DUUA 5K03A 3KJKA 2QEXF 3QVVA 1QGAA 4RE6A 4R2KA 1LI4A 4GI7A 4JP8A 3LW8A 1HY3A 5ADUS 2X8JA 5BNTA 2R7KA 2O0JA 3E22B 4K9PA 4CM4B 4BRWA 5C1BA 3GBPA 4XAQA 3FSGA 1QIJA 1GGNA 5FD8A 1KEUA 3KQWA 3QW2A 1GGHA 2C2KA 3BS4A 3IIMA 3H3FA 2HX1A 3WNBA 3EDYA 4P4SB 4O08A 2FUNB 2N0SA 2W2OA 1W9MA 3INYA 4GBMA 3PRHA 2Y1KA 2YQ4A 3H2KA 4LOKA 2J46A 2FQ1A 2RKOA 3LCUA 4BZXA 4E70A 4DEXA 4X61A 5IT9M 4CKCA 5BXQC 3GLIE 1X6VA 2CC2A 4MLZA 2RFLA 3LS2A 3IIEA 3N5CA 3MMNA 1Y5RA 1H48A 5JCOA 1G16A 2O2ZA 2ADOA 1J90A 4EUNA 3TQOA 2Z98A 3L8GA 1KEPA 4FGWA 1Z12A 2WJIA 4HN2A 4J16A 4Q4AA 5C52B 1PVOA 1EFHA 1UAGA 2GRUA 1DJMA 5LP6F 2WIBA 3IMCA 4PX2A 1FRZA 3KLOA 3OCVA 3I09A 1SQ6A 3NK6A 1QNLA 2ZWPA 1R64A 2ZUSA 4GEKA 4RJLA 4L5YA 2ZVPX 3SJCA 3TLKA 1PX2A 1N5MA 2XQKA 1L4GA 4K6MA 3OLCX 3UWMA 4OLBA 4D4KA 4K26A 3GNQA 1E5VA 1M2WA 1Z6ZA 3RIXA 5NLLA 4BWVA 1XCMA 4DJFC 4DLAA 3T5PA 3MYRA 4NFYA 4ZRDA 1KJJA 1Y5LA 5K0ZA 3OFJA 1CJSA 3IVRA 5CGQB 5BV8A 1FS6A 1OFVA 1SC4A 1IM8A 1QJ4A 3IUNA 2HA7A 2YQZA 1SHUX 2CDAA 4RVGA 4RHEA 1QRTA 3DMTC 5JPDA 2Q3LA 4U00A 2WUFA 1TPYA 1ZRHA 1A88A 2NO7A 4BBPA 2WWXA 3T35A 3TRHA 4I4IA 4BVRA 1V39A 1B6RA 1C2TA 2HSWA 1Q1QA 1ZSYA 4HYEA 3Q87B 2FK7A 1Q0UA 2GPNA 3JYNA 4UUQA 1MC8A 2IHJA 3FHCB 5EERA 3WBBA 4AWBA 1YFZA 4QXOA 1L7XA 4AUEA 4V0SA 3O26A 4S24A 2C20A 1E9RA 1OXMA 4QVGA 2ZRMA 4EFMA 3KHNA 4NJEA 4EB8A 2ZIZA 3GOQA 2F17A 4UM9B 2BE9A 4HY3A 1RWBA 1TM2A 1AC5A 1YNSA 5TEWA 4ZI2A 2QUBA 2IV3A 2X0DA 3GHZA 1CZRA 3I73A 1KMQA 3HACA 4NBNA 3QYJA 1G2OA 3H7AA 2QX4A 1RHKA 4AO7A 1FVHA 3WRXA 3EQ9A 3BUSA 4HZGA 1O9HA 5FPSA 3ZJTA 1RFLA 4ADSG 4XTCS 5JXWA 4DSUA 1T10A 2PCJA 2PBZA 1KEVA 2MR5A 3NBZC 1A9XB 3ZY4A 5JMWA 2GBCA 4LBWA 4IZHA 2L42A 2G8LA 2HDHA 6LDHA 4BJ1A 4F4JA 2VHZA 5JT1A 3ZWQA 2IGTA 1T9GR 3KOXA 4N0EA 4P7KA 4MWCA 5IDXA 1H0SA 5A5FA 4AIIA 3R2JA 5KNDD 1YQTA 1Z6YA 3PZRA 1L1QA 4O33A 4RLSA 3HU3A 2R8OA 3EZGA 3ZWPA 4Q7MB 3WLKX 3SSOA 3B7WA 1PQWA 1R0KA 1GZ4A 2OZEA 4PZLA 3T4PA 3UN1A 4BV3A 2YIMA 1BQ4A 2ECKA 2QUJA 3DBOB 4QTYA 4ZGWA 1OH6A 4FM9A 5JC8A 4DSOA 4WLOA 3G8AA 5FHQA 4OFBA 3IELA 3MT9A 3TWOA 3TTWA 1PGJA 1NLFA 4MV9A 5K5EA 3OU2A 1ABFA 4NOLA 1QM5A 3BDAA 3CZMA 2FW6A 1P73A 3BZBA 1GIAA 1ATZA 4G1EB 1N5DA 1NLYA 3KYCA 3ENZA 4RZSA 2Y6UA 3D64A 3IQIX 1BOOA 4Q9DA 5FTMA 3D6TB 1B2RA 1K73H 1F0KA 2VDUE 3CLVA 3EGXA 5LBUA 4E33A 1F2UB 1Z6AA 1Z6PA 1ISRA 3KOYA 1QLJA 4XGIA 2ZG6A 2P5UA 3ZEIA 4AF8A 1LKZA 3BSWA 4BT5A 2BHSA 1DBRA 3K6JA 4KDEA 1KPHA 1H4SA 2FLKA 1G5QA 1FY2A 2V7QD 2EF0A 1O2DA 3NT4A 3VOBA 4ZCLA 1ZDMA 3L0SA 1JVNA 5REQB 5T6MA 3C3EA 1E1LA 2GN8A 2F90A 3GFSA 5E95A 3ZJVA 4HAWA 2E82A 3F49S 3GZ4A 4Q4JA 2HP0A 1CS4C 1UF9A 1ZPDA 3DAFA 4DIFA 2HUPA 3FI9A 4QDZA 1E2LA 4C7OB 2CFSA 3QLJA 3ER6A 2DFKB 4IW3B 4Q19A 2V4ZA 1KI6A 3VAAA 3WMFA 4LRXA 4JLBA 4QTUB 4YCAA 5JARA 2ZBPA 3CV3A 1MN6A 3FLBA 1X13A 4RGBA 4X92A 5BQOA 3UJAA 2B2CA 1AD2A 1U7ZA 4O4JF 4CKXA 4DDMA 1MA0A 1LK5A 1GFZA 2CGEA 1SVNA 5IC5A 1YBAA 4W7HA 1H2FA 1DAEA 3TL3A 4G0VA 1LLDA 4WFQA 1ZUNA 4MA5A 2YINC 3QBJA 2ZJ5A 3ZDXB 2D4HA 3DULA 3H1EA 1NQ5A 3AHGA 1EB8A 4A6PA 2V6JA 2Q5CA 1E60A 4G5GA 3UPDA 3TW8B 1OHHD 4JL5A 9LDTA 1E0SA 1YVDA 1IXKA 1GU0A 2YHIB 2ZJ2A 3OOYA 5JUWA 5KYYA 2WEKA 1Z4IA 1N5OX 1PJAA 2J48A 1ZGAA 3SJUA 1CQIA 2W8BA 1T36A 1WOMA 4IVNA 1BWQA 2ZZMA 2QXTA 4HB2A 1LUAA 3RYIB 2GMWA 4IINA 5GGXA 4TXMA 4QUGA 5P8WA 4C3VA 2E5LB 3UGQA 1SJ9A 1VI6A 3RSQA 4CWAA 3JARA 1H5NA 3BIWA 3CYQA 1AGRA 1M2KA 1N4DA 1N9KA 1XHFA 2QVGA 4E5SA 5IH7A 1BDHA 3CW9A 5FWYB 4N41A 3E4CA 4Y2VA 3O2JA 3MJRA 4M22A 4CEHB 1UBEA 1TUBA 4LF9B 1UKAA 5FTJA 2W70A 1U8AA 1YB1A 3IULA 5CBKA 2DR3A 1W76A 5ALLA 3KWJA 1REQB 3UKOA 1ESNA 4DQKA 2V5UA 4F1JA 2OSBA 3IKFA 4JP2A 4PV7A 5KHAA 3RG2A 4PG8A 2FFBA 3OZCA 4ZZIA 4YV2A 1BMDA 3NZEA 1I9GA 1SCIA 3FB4A 1KYZA 3JQRA 1QORA 2AMFA 1H22A 2FU5C 3PHJA 2IWHA 1C7ZA 1LNZA 1JDTA 1G5IA 3NYRA 2NYAA 4G2TA 1FUIA 1Z2CA 4TLMB 5EXDA 4BRUA 1U3VA 4YH1A 1H69A 1N2XA 2DHRA 4F96A 3EIEA 2XEXA 2I5PO 3MS4A 3WKAA 4LQ4A 2DQSA 2JVKA 4ALNA 4DEYA 2V74B 4LNUA 1CS0B 1M5TA 2D2VA 1U90A 1RYBA 3B2EA 3H6GA 4Q47A 1KGSA 1DJLA 1E3IA 3MK31 5AI8A 3CZPA 4LNUB 4EB6A 2IEAA 3MAGA 1UBMS 4CI9A 3ZCQA 2IODA 3U3OA 2X8AA 3UJ9A 5KDLA 1VIVA 3EGEA 4M87A 1FP6A 1UZLA 4F21A 4K9OA 4RNCA 4EPTA 1ZUHA 1KZ6A 3EG5A 1YCDA 3C1UA 3WYCA 3IILA 3U7EB 4LJ7A 4X1KB 3ZCUA 4ERXA 4BQRA 4U4AA 3AUUA 1KVUA 3IPRA 4IZIA 5JSYA 1R0ZA 2JFUA 4CUKA 1VL5A 4Y2PA 1RLMA 1M1KH 2XOXA 3BMCA 3BOSA 3UV7A 1F48A 4F45A 5KNBH 3G5AA 2GZDA 4OUKX 3RFVA 2K4MA 3U9LA 2J4DA 4N5IX 3VUFA 5MN4A 3E82A 3R5FA 1QIFA 3L7DA 1ZMXA 2IHZA 3NDIA 4DUZB 1X1TA 1VA4A 2B6HA 1KAQA 1PZHA 2REBA 4ZU3A 3R7DA 1QE3A 3WQQA 3FNRA 2GPYA 4GE3A 1P7YA 2H17A 3ENNA 4FQ8A 5H0IA 4BXOA 2J0QA 5E1BA 3KQHA 2A58A 3QXGA 1MB2A 1YOVA 1QKJA 4FFMA 4I7EA 3AVOA 3KSMA 4YB8A 5I01A 1C0KA 2P41A 1P4AA 2CJYA 1GDHA 1GL9B 2QI9F 1S2OA 2VT3A 3BXZA 3H5NA 2FZGA 3HA5A 3I2HA 1ZUD1 5AYVA 1CY0A 4XPIB 5GM1A 3ZZTA 4BIIA 1EU1A 3F1LA 3NRBA 3H5AA 2CBZA 3LL4A 4XTRA 1UEJA 1X80A 5B53A 1ECFA 2PD4A 1AIPA 2VXCA 4HLQB 4GXQA 1C9DB 1MO2A 2I33A 2QD3A 1R5OA 5AM0A 3T1YB 1YVEI 1XLWA 4JMLA 2PL5A 4S1NA 3B53X 1O1YA 2VDRB 3GELA 5H4HA 3M5PA 1VOTA 3CLUD 1UDCA 1RYZA 3KHSA 1KI1A 1OLSB 4ZVTA 4C5AA 2CBXA 3PYMA 4C03A 4WBNF 5BY2A 4D9HA 2ESRA 5GINC 5EYPA 2JGRA 2DJIA 2QTTA 1O8BA 2VZ9A 1PGNA 4UXIA 1GLGA 4BFUA 1I5OA 1HE8B 1Q3TA 3VZRA 1ZR2A 3SG0A 4ZQBA 4UU7A 5DGXA 1J5PA 2CZCA 3HB7A 3KVRA 4FLMA 3GGGA 1FDOA 3WLJA 5IKPA 3UM9A 3AVTA 2AQIA 3TEJA 3TRKA 5J2TB 5CJ2A 5K6AA 2E4ZA 3G2QA 2J0UB 2P7HA 1K86A 1AHNA 4ETNA 2Q3BA 1GQSA 1Z7GA 1FUUA 2FSFA 3KTDA 2A0FA 4FW9A 1XZHA 1Y8QA 1ZGCA 5TGTA 4BV8A 1LPBB 1JMKC 3E0XA 4NULA 3BB4A 4RAOA 2IXTA 3PD7A 3IBCA 5HUHA 4HVAA 1MGPA 4M1OA 2B8NA 3AUFA 3QVOA 4UMVA 5B3AA 2MOKA 1Y1PA 1XEWY 1Q1AA 1UP7A 5GVRA 4A26A 1TUEA 1XCPA 1PJLA 4IG9A 1BFUA 1HE1C 2Q9BA 4PHFA 4F85A 4DV6B 4JT4A 1MC5A 3DUWA 5IHXA 1NYLA 1QH1B 2Z5LA 5IM4A 3IURA 4KFRA 1S8NA 4B7ZA 3TE6A 3VI3B 1IN5A 3FPBA 5PGMA 5JCZA 4CHGA 4E2XA 4K2HA 5KWIA 1REQA 2VP2A 2YNMA 3I42A 1HURA 1DEKA 3U80A 2DY1A 1ZGBA 1YD7A 3AOEC 4TMKA 1G7SA 1VLVA 1XTRA 4N7BA 5EC8A 1ZNQO 1PFUA 2V58A 3W2EA 1RR6A 1X7OA 4GXRA 3VV2A 4EY7A 1HV8A 1LPSA 1QVAA 3A58B 3TN7A 4ETIA 1O08A 3KFLA 4OQPA 4RTKA 3SYLA 1A2BA 1FFWA 3PL1A 4UTPA 5HP4A 2LE0A 1K4YA 3MIZA 1M6WA 4KHZA 1TZ2A 1UBGA 1LY1A 2VOJA 4M1MA 5FOUA 3HU2A 4B82A 1TVCA 2WDZA 4IIUA 1QHNA 3R3ZA 1KMIY 2B5WA 2IRWA 3M2TA 3QVXA 3T0FA 3OKPA 2UUCB 1EK5A 3CB2A 1CY2A 5IBPA 4ZODA 5G3ZA 3SD7A 1OWPA 1XR3A 2VT7A 1P9NA 1GAQA 3A4NA 4HQRA 4Q24A 1WBJB 4CV2A 4WOPA 2VK1A 2XR1A 3O6VA 1S2GA 4L15A 1SCNE 3I9V6 3E20B 3IQGX 5G53C 3ORSA 1W4AA 2WOOA 3M82A 5BQ3A 3WJRA 3TLBA 2XD9A 2HH9A 3G1WA 4QJ4A 2B30A 4EKEA 3SC2A 1GRNA 1STOA 4BNDA 1J2JA 1B6SA 4B5KA 2N1MA 4OCZA 5JNLA 1RXCA 2Y1CA 1T5TA 3Q7RA 4PZ0A 4YHBA 2XNHA 1KORA 4OFXA 3GHHA 3FPSA 3RU2A 4ED9A 2AFVA 1AO3A 3G02A 2A5YB 4JMPA 3SZUA 4EP1A 1X25A 2WNSA 3A8TA 4GSYA 3PENA 5FPKA 1KZ4A 1QS0A 5AM5A 2HP0B 4N7JA 2FUCA 4EFDA 4P4LA 1KDYA 4A5OA 1HFWA 3A6JA 5J4KA 4BY9E 1ZCAA 1XAIA 3GARA 1ZNZA 4QARA 2DRIA 4WKCA 3FRIA 3TJZA 4ARZB 3KSUA 1DBVO 3AI3A 1GP2A 2DTXA 2QLLA 3RK0A 3C8DA 4HATA 1MV8A 1V5WA 3KUCA 3IAS1 1H1LB 5E1DA 3OFVA 3K0CA 1MOPA 1XOIA 2GN9A 2QYTA 2XMZA 3E3MA 3F6SA 4ITRC 4LXTA 1A2OA 2OZLA 3EY4A 4R3WA 3EISA 3LC2O 4JSYA 3QIAA 3NBMA 4PWZA 4TKMA 4XR4A 4D8XA 2OV4A 1FS5A 4XXHA 3PPVA 4IDPA 5GV8A 4I08A 5JS8A 2F1JA 5EAZA 1T4CA 2MJLA 3ZJUA 2R1VA 1VBFA 3U37A 4WFJA 1WXDA 1JT2A 2F48A 1XE3A 4TKUA 2HHHB 3LUKA 1JIXA 1PT8A 3EXG2 2H7YA 1OYWA 1N1GA 2HFJA 3HCDA 5I4CA 4B3DA 3BSYA 2C3OA 3UJNA 3S68A 4OSEA 1A71A 2WYIA 5K8LA 3MWJA 4WIAA 2BFCA 2HWXA 3S28A 3PGLA 3TRIA 3W6OA 1A8HA 2KJQA 3BTVA 3RJMA 5C37A 2C03A 3PLRA 4FINA 4IDDA 4G36A 4QU0A 5EE3A 4N0MA 2XTZA 4YCCA 2O8DA 3OZBA 3PT9A 5MFZA 2FGYA 1GGFA 3I3SR 1O5IA 1E6EA 1QH8A 1RRGA 2QTBA 4PGGA 4EPRA 3FCEA 1QGYA 3D01A 1W8DA 4OKSA 5SY9A 3SJBA 3WBJA 3C3YA 4HUJA 3ELCA 3D6UA 2OKCA 2XAAA 1I7QB 2RBEA 1ZINA 4YUAA 1RE1A 2VT6A 4HVTA 4CM6A 3TO5A 4L27A 2CXPA 5J4YA 1P5ZB 5IXJA 4WKPA 1BAPA 1OFHA 4RCZA 2QU7A 3V3KA 3SHWA 2EFDB 4OIMA 2OXTA 1C29B 1D0IA 2UUPA 3M6MD 4CG2A 4M0MA 3L9WA 4US0R 3RNLA 3TGLA 2YHSA 3L8YA 4NAUA 4M1YA 1FFSA 1AN0A 2BMWA 2PX3A 5ENZA 4WGFA 5SY6A 1DHRA 3CC4F 3ROXA 5M7EA 4YONB 4CLOB 3U7FB 1KZGB 3R24A 4FXOA 3THXB 1OI2A 1W4LA 2V7VA 4HT3B 3RVMA 2GWHA 4XWKA 2AGVA 4KO3S 4YAUA 4G9EA 3SXUB 5EIEA 4MQFB 3HK2A 2R7LA 1X9GA 3KVNA 2IHVA 1GX1A 1VSUA 3REQA 3DFKA 5CLLA 4MWOA 5B2ZA 2FPRA 1FFXB 3CXUA 1L7EA 4QVKA 2E55A 1F9EA 2C5FA 2GEJA 1FP1D 1MPXA 4J3FA 5JDIA 2PLNA 1MUUA 3BK7A 2JGNA 1SEVA 3L7JA 4QFDA 4RGYA 4WZAE 1DT3A 5JI3E 4JI6B 4MQBA 2OP1A 5HWEA 2IXBA 4HNQA 4RIEA 4YLEA 5K9ZA 1X94A 4GI1A 3MS2A 3QM1A 3GRUA 4GR5A 4Q00A 2WJAA 3VV3A 4KITB 5KNBD 2IZ0A 3L49A 3FDIA 3JQAA 4F5ZA 1JFTA 3LG2A 4ZEMA 1VPEA 2G80A 1C1XA 1TLLA 2FRDC 3QPCA 1ABEA 1PYGA 3GWZA 1M33A 1ZGGA 3SYMA 5JY1A 5FLXA 2F3SA 3E5HA 4HAZA 4B6EA 1ZJZA 2HWWA 1KR2A 1N6OA 3HE3A 3TTTA 4DMUB 4ZYZA 4ARUA 5FPYA 4E7OA 5KS2A 4QM6A 3R3HA 2YJ3A 3LD9A 1CUJA 1ZOLA 1S2NA 4U7DA 1D4OA 1K63A 2QJOA 3IS3A 1HYQA 1WW8A 5CPBA 2ZJ3A 3VDQA 4BKOA 1EE9A 1Z5PA 1XTKA 3RVDA 4D92A 4E6PA 4LY0A 3HWRA 4GZLA 3GLGE 3FUWA 3KR9A 2IH5A 2BJHA 4LE2A 3UYKA 4MDYA 3T1HB 3OHSX 1PE0A 3LUPA 4Y98A 5DEIA 3QYFA 2ZAGA 3KX2A 3R23A 3MBMA 1QAHA 1R4NB 5EMMA 2O8CA 2CV0A 2E4UA 4O1MA 3JWEA 3HCFA 1X8XA 4G4WA 1P0PA 4O2AF 5DSTA 1L5GB 5AVQA 3D8UA 2I78A 1SXJD 2J4CA 3RRZA 4UCQA 4BVQA 4IH9A 4AWAA 4OYRA 2UYKA 3RWMB 4FMDF 3H97A 2P6NA 4NOMA 2AXEA 2B69A 2YJZA 3ON1A 5HXZA 2Q6OA 3A1TA 3GF4A 1SBTA 1QCZA 4TWBA 4MP8A 1VIYA 4P5DA 3AC0A 2BZGA 4JT2A 2I80A 4GZ6A 3C3DA 3H9EO 1VYHA 4Q82A 1PR3A 3D7NA 3C3CA 5EKXA 3T5MA 1IY2A 3TBFA 4UVEA 1CYEA 1L7QA 5K0TA 2A92A 1IC6A 1RM0A 3O8QA 4IGIA 5F3WB 4GKJB 4HDMA 1JEEA 4QJ3A 3T1NA 3WLNA 2H31A 3GMSA 3PFKA 3WYDA 4ZI5A 1U2TA 2P2LA 3CVXA 2BDUA 1MTZA 2HMTA 2QAGA 1K8AH 3FE2A 3G1UA 1I3CA 3H1BA 4IXDA 4MAFA 3W2HA 5AW0A 3PQFA 1VXOA 2DQKA 4GIBA 4IDCA 3DMTA 3HJGA 2OGZA 3IV9A 3CUSA 5K3DA 4WBNA 1RXEA 2AI1A 2BMEA 1F60A 2QRQA 3THOA 3I52A 1GGVA 3WHPA 2SICE 2VDQB 3Q3IA 4GNRA 4KXFB 3UUGA 2WU4A 2YIDA 2VAPA 1TQDA 4N5MA 1XDSA 4GMDA 4CVNA 3BF8A 1XKXA 3KZKA 4TX1A 1JE1A 4TTRA 3NATA 3SWWA 1EYZA 3ROTA 3AB7A 3W5UA 4GGMX 1YHQF 4QUKA 5JNRA 2GHIA 2A8YA 2Y76A 3VSDA 3H17A 3KEMA 1Z4OA 2W7TA 2IXGA 4L76A 4Q7LA 4LDAA 4D6YA 5JNVA 2BEJA 4R8LA 4KI7A 3M83A 1JIKA 4K6FA 2EVWX 4LZLA 2YMLA 3WA6A 5FDFA 1QU3A 4R40A 1ZD4A 2XUOA 3DO6A 5CB4A 1L4YA 1PAUA 1XWIA 3LZCA 2ZBVA 1F2TB 1QFZA 2EIHA 2UUOA 3BGDA 3P52A 5EJIA 2PS3A 1QQ6A 1RJEA 4QOIA 3L9XA 4QGFA 4Z5XA 2DP4E 5EINA 1NE2A 2HMSA 2XXJA 1R37A 1DDOA 4Q1DA 4U7GA 5IAGA 2RHRA 4OJYA 1JT9A 5I7HA 4XLZA 3G5MA 1VQ7F 4RVUA 1AKTA 1N32B 3J81k 1G98A 2QVCA 2AI3A 2H5EA 3B48A 2D1TA 1OY1A 3PCXA 2I99A 1MB9A 1OVMA 4J2HA 1XTVA 1XU7A 1RWKA 1NGSA 1XEXB 2OBXA 2YHAA 3L92A 3AF2A 1RU3A 4I1RA 1OLUA 1AS3A 3UB2A 3AYZB 2XE4A 3LQQA 1N2GA 4KE8A 4JI5B 1E2DA 3DTTA 5L7YA 3O2SB 2O5CA 1ZUWA 5EY5B 5P21A 4AXBA 2VR1A 1B3BA 1U1IA 1U0FA 3WGTA 2WALA 4LC1A 3R0XA 3HB5X 4ZI7F 3WGUA 3DVLA 1VQPF 3LY7A 2OHWA 4QNRA 3RTBA 1E1CB 3GFFA 3TTUA 4PPYA 2HA6A 4DADA 3ADBA 4OTZA 2PGAA 4QUDA 4BT7A 5FOQA 1SUPA 1IZ0A 2G4CA 1PL8A 2H63A 4ENVA 2GEDA 1DRWA 1IIBA 3CLUC 8ADHA 1XVAA 4GVPA 1Z2AA 3OIVA 3U5TA 4RELA 4HNTA 4CMKA 2IOFA 2O1XA 1E6UA 3K0FB 4BB6A 3PA8A 4EX6A 1GSHA 2IE8A 3E5RA 4F3CA 2XNDD 4DCUA 5EWMB 5H4GA 2XITA 4IUCS 3GJSA 3DLPX 4LVCA 3UA3A 1QTRA 1MENA 1RQNA 2GEKA 3R4CA 1DAOA 1XKTA 3AHFA 3O7WA 4ZYXA 2WHYA 2C3PA 3JQ9A 3QXHA 2G77B 4JQZA 4PQFA 4XB1A 4E5PA 1XTIA 5DGHA 3ZBPA 5EESA 3QSGA 4CKEA 1HL7A 6Q21A 3OWOA 5F3RA 3ODPA 4C78A 4NV1A 3DW1X 4ANFA 3V48A 3KOZA 3L8HA 2Q1WA 1T9HA 2NO9A 2QGZA 4G09A 3MN1A 3K5HA 2ZB3A 1J0XO 1EJ6A 1LPMA 1TX4B 4GFDA 2XECA 1THZA 3RC2A 3U4MA 2QPTA 3H75A 1PUXA 2FPLA 1KSHA 2ETXA 3AIKA 4I14A 5EZ6B 2YWDA 5E4JA 3D8NA 3WX0A 3PJFA 4AS2A 1Y48E 2RBGA 1HNWB 1YTUA 1DEAA 1UQTA 4YWJA 5TF0A 2AQHA 3O21A 4EI9A 4H6XA 5FP0A 2SBTA 1DDGA 3VJLA 1R3DA 4DIBA 5JQWA 1M1UA 4MMYB 3TNLA 4MI1A 4OXNA 4HO1X 2QVLA 3GA5A 1US8B 4HPJB 4F1WA 4NBTA 3RRFA 1BCSA 5CVVA 3BRCA 1ZQ1A 4EYOA 4G97A 5J2UA 1ZNWA 2BTQA 4INOA 1NF8A 1FJGB 1BDMA 1OA0A 2O1WA 1YDWA 2FG7C 2D4AA 2QNRA 3BQMB 3FR7A 3K53A 1K7EB 3LVRE 5FI1B 3Q0IA 2YVUA 4DS3A 3ZKAA 1E1RD 1TTTA 2JZOA 4JR0A 3WP1B 4HWRA 4MUJA 4XDGA 1NZFA 4BXOB 1JU4A 1V8OA 4Y1FA 3RK1A 1Q21A 4JOSA 4UBKA 1ENPA 3FB1A 1RHMA 3FGZA 3NBAA 4FX2A 3RTAA 5C3MA 3QLTA 3NUQA 4QU5A 5CFZA 2IYOA 5AKIA 2ENWA 4C05A 3MSXA 1O77A 3Q5EA 3C6BA 3E2MA 3PQ2A 3KXKA 5G4KB 1FYVA 2B92A 2ILVA 1OCEA 1SUIA 2A33A 2ZSUA 4PZUA 3ENQA 3LWOC 2I8CA 4HAXA 4BASA 1CEQA 3VUEA 2PGJA 1DKRA 3P9YA 2GZ3A 4LE0A 3VH4A 3DM9B 3CIOA 1U7OA 1QZTA 4I4NA 2XE6A 3PDIA 1NMUB 4FI3F 1NAHA 3UJ8A 5A0TA 4D0LB 1YR3A 5BN5B 3HN6A 4LWZA 5JSFA 3K3PA 4M1TA 5IWAB 2VYFA 3SDBA 4KN9S 3W5CA 5I7VA 4IO0A 4OHWA 1F4PA 3RYFB 1IOWA 1A2QA 2XF2A 4A1OA 1WXIA 3E70C 2VP5A 5B3JC 1WSBA 1O8CA 1Y9DA 5JH7B 4XJVA 2ODQA 3L84A 1VHAA 4HAYA 5K8JB 4C7XA 1SHJA 3V8EA 1WVMA 3RYHA 1V48A 1A4RA 3DKPA 4O63O 1PSDA 2Y0CA 1EFRA 2GSWA 3CLSC 4X3PA 1UKYA 5CURA 5ICCA 1U94A 4W7SA 4X3LA 1EP2B 2BONA 2UZ4A 4FBMA 5L4SA 1RC0A 2XZLA 2EG9A 3A4VA 3I6YA 5IKOA 4DSAA 2QN7A 3S2EA 4X64B 3NALA 4R41A 4JP5A 2DUNA 2Y3IA 3D7SA 1NURA 4CT4B 2HJWA 3ZK8A 3BFPA 2WWWA 3MGBA 1JNYA 2I76A 4JEIA 4P0PB 5JBQA 4DR6B 1E9VA 1ZS9A 4DLSA 4DLLA 4P8RA 3II6X 1T25A 4YALA 1Z8HA 3TXXA 1Q74A 3L5OA 4QRIA 1S8OA 4Y6PA 1JIVA 5K0FA 1D2GA 2BZSA 1GO2A 1MO3A 4RZIA 3SP1A 2Z1UA 3T4XA 2GTIA 4PZYA 3OO1A 5E8RA 1BE8A 1YUNA 1K4KA 4V0NA 1EVIA 3UFXA 3TMAA 1PEAA 2KW5A 1NXWA 2OBLA 3QPBA 4M1SA 2HZ7A 2C4KA 2VHEA 2ZZKA 4N6GA 3RVSA 2J9YB 4PBSA 2L69A 4D43A 1MW9X 1LNSA 3SS9X 1JEDA 1Z4LA 3I1JA 1IHDA 1RJGA 3EUWA 3HCRA 3I2YX 1QGUA 4I2VA 4RVOA 4BP9A 1ZX1A 5BPFA 1V45E 1YE5A 2A5GA 3COZA 4IIVA 1PK9A 1RI2A 1SXHA 3CCBA 1KO1A 4URWR 2NTJA 521PA 4UXJA 1KU6A 4DXHA 4RCYA 2HIMA 3WAKA 3M1AA 2I2WA 2ERCA 4ZVSA 5HOEA 3OZRA 3W9SA 3O75A 4BT6A 3RTDA 2WF6A 1PZNA 2GN0A 4KVZA 3GPBA 2JFPA 4A6DA 4DV2B 4M86A 4AJEA 3WZ2A 3EULA 5HXUA 2G83A 4NNOA 4QQFA 1B4DA 2O2EA 2P0YA 4RU1A 3N2KB 1FFCA 1U0OC 2OHXA 1E5LA 4PZPA 3KE1A 4ZOEA 1GSIA 1JV2B 5B1YA 3MXOA 2GN6A 2FHSA 1KNJA 3GLFB 2GBLA 2WINI 5IT9A 2GARA 3HUUA 2XQJA 1DFIA 1JEQB 1E89A 1W6UA 2FPUA 5AM4A 5B30A 2AE2A 3RA5A 5BR1A 1G3QA 2QSJA 4OXIA 1BCRB 1O3YA 2CNWD 3ZE7A 3ZVKA 1EUYA 3EODA 4HUQA 3ZHRA 1Z34A 2I2FA 3NIGB 5TV2A 1M7BA 5C53B 2VYNA 4RJTA 3NDBB 2E1PA 1WXFA 4U63A 1Q1NA 1MB4A 1E63A 1V5GA 3N59A 4JYBA 1JPNA 1SPBS 5KTRA 3GUYA 4YRRA 1PT6A 1M75A 3WGOA 4CKEB 2HU8A 2I7XA 3A9RA 2W4QA 1TOAA 1CUXA 3LTEA 4M38A 1OI7A 4OJMX 4MRRA 4OGKA 4F72A 4OMDA 3CB4A 4HSEA 2NNLD 4R8KA 1Z2PX 3X3HA 2Z1DA 4Q9HA 3C8UA 2VUIB 3PEYA 2JRLA 4OATA 4BX9A 4UHJA 1EAMA 4EB6B 1SIOA 1WW2A 2P2ZA 5E9QA 1D9XA 1SR8A 1YS9A 3G0CA 3K73O 1H23A 3MJ4A 1XJ0A 5I9IA 4EUEA 1U3LA 3C6YA 2HJHA 1U0JA 5IJ0B 1HDGO 1RRKA 3KQVA 5A9RA 1U3WA 3NNDA 3R9WA 3OC0A 3CT4A 4XQGA 3HJTA 5D86A 1JKFA 5KYUB 4X62B 4FNGA 2OHGA 5F2KA 1YMUA 5DX0A 1W36C 1KEWA 4MULA 5AI6A 2FKAA 1E62A 2H7VA 2K1SA 3PSAA 4Q15A 3UICA 4IGEA 5KYTA 5CA1B 4FFBA 1VG8A 4Y2JA 3M6UA 4RFLA 5EIFA 3BGWA 1C7EA 1QOQB 1U0TA 2WAXA 4FYMA 5KQRA 1VFNA 2FGKA 2FEXA 2GJAA 2ZI4A 5IAOA 3ZD7A 1SIWA 4H3HB 2Q29A 1KY5A 4XEHA 3ZKWA 1HX7A 1THTA 5KTNA 2YWFA 3GTZA 3VZDA 2GD2A 3QHQA 3UT6A 1P0FA 1LLFA 5JXIA 2GM4A 1NYRA 4FCTA 3KPJA 4O2AB 5LZ5A 3V3TA 4OA8A 3R75A 5AW8A 2PO5A 2QJRA 3U6BA 3WL4A 4IH1A 1OGIA 3ROMA 2HIAA 2ZROA 4PWTA 3K0AB 3I6BA 5K8TA 3JQEA 3P9CA 1DIAA 3DJFA 3L0YA 3RHSA 2ZWAA 3S8MA 2RH4A 3NNNA 1RZ3A 2VBGA 3NT2A 4QBTA 2XVXA 2I1LA 2PX0A 3WMGA 3VCZA 3C7AA 3SEQA 2YUIA 1QP0A 1WY7A 4OREX 4JK3A 5K8CA 4P0QB 3FX2A 2O8BA 1LRJA 1E3DA 4L8GA 4PPFA 4AZTA 1B73A 2LCFA 2IXAA 2C5EA 4OI0A 4WJZA 3CCFA 1ODSA 5BNZA 1VE9A 4K1LA 3WHIA 1T3HA 1XDWA 4EA9A 4ZZ2A 1TCCA 5ALSA 1OZ0A 3LRXA 1MAAA 1BA3A 1X38A 3GJ3A 5EI5A 1V6AA 1SOVA 3A1VA 4U9UA 3K6KA 4MQ5A 3VPHA 1AE1A 1W5AA 2QAGB 2X0JA 3BD6A 1NZDA 3OZTA 5CDFA 1YULA 2ES4A 3WDMA 1O4WA 3CT6A 2BZ0A 2J3DA 3DQPA 2PKYX 2NSHA 3A26A 3V97A 3OLYA 2QN1A 4WV3A 5D00A 3M6IA 4QT4A 1H0HA 4QWWA 4XARA 1KHHA 4YCDA 4S1TA 3WNZA 1A5BB 3MMPA 4ZT6A 5FT9A 4KK4A 1XZNA 3JU3A 3AY0A 1I01A 3ITDA 3G1TA 5SZKB 3WR5A 2TMDA 2EZ9A 2QS9A 2YZGA 3I83A 1NUUA 3JQAD 3H86A 5FIUA 4YJ3B 1QF7A 2UUBB 3D2LA 2JIZA 2WF7A 3LQFA 3WRXC 1B0PA 4L6IA 3AR2A 4V02A 4AP6A 2EWVA 3USCS 1LDMA 3AP1A 5AD1A 2JBWA 3C7CB 4RSHA 1X39A 4WJLA 3HV2A 3IKTA 1E2BA 3NOXA 2RSLA 3STHA 4EHKA 1E8MA 3FJ1A 4I5DA 4ACBA 5AW5A 1T5HX 2R6AA 3TFOA 4MVJI 2WWRA 2P0AA 3OURA 1GA4A 4CCYA 2FJPA 4OHUA 4AM8A 3FRJA 5C31A 3KETA 3W90A 3EGDB 3K8YA 3RC3A 4MRAA 2X6TA 1M34B 5I9BA 1EUQA 1U1GA 1CR0A 5KPDA 1T5DX 4V1CA 3AUAA 3WLFA 4PY2A 4PN3A 1QO7A 1RDFA 1NLZA 2J6HA 3IJEB 3L18A 4G1FA 5F51A 3ROZA 3E3AA 2A84A 4XWTA 4BKPA 4CMJA 5HCIA 1ISPA 4R69A 4PR0A 1FLAA 5JI2E 1GHTA 5KCZA 1VLMA 1SC1A 2C9ZA 1W1UA 2AJTA 1CDZA 4KPYA 2FUKA 3OZDA 4ER3A 3HU1A 2VHJA 1L5VA 2W2LA 5I8ZA 3RSGA 5CFPA 2VA8A 1FNCA 1P81A 3QLUA 2QYHA 2PUJA 4KO4S 4ZVQA 4UAUA 3VR2A 1GPLA 2WMDA 3DVAA 1U99A 5LMCA 3LWBA 4H7HA 2JIBA 3OLXA 1KD1H 2ZYRA 2XIJA 4JQSA 1QYRA 5AI4A 4OK3A 2R6ZA 3I23A 1T35A 1PR4A 1ZSNA 4O4HA 3RUEA 2J7KA 4FD2A 2ATEA 3AR8A 3RVQA 3O3MB 2HDNB 4OQYA 1SKUA 3HVKA 4MARA 3O4JA 4NH4A 4LX0A 3CEAA 3USES 4XM0A 4QBGB 2OA0A 3N8NA 3HHEA 2Z1MA 2O59A 3CZAA 2VH1A 1GPYA 3L06A 2VJLA 2HJVA 4ZMRA 3NIWA 5KSOA 1GG8A 2XBLA 1F20A 4NU5A 4MQFA 3NONA 4TYMA 4Z0TA 3VPSA 4F04A 5LLDA 4LVNA 5THKA 1YJ5A 2O3QA 2J9ZB 1EWYA 1XZMA 3OEEA 2ZJYA 5ELMA 1EFPA 1H4TA 2VHTA 4TTSA 3TNJA 4LC0A 4FN5A 2DOKA 1XZJA 3FYUB 5JPIA 4EVIA 1E58A 4LAFA 2X40A 1OFIA 4Z0HO 2W00A 3WRWA 3WXBA 1I2BA 4ER6A 1KOFA 4O59O 3C8MA 3SQDA 4ALLA 2YXNA 3M9XA 3O3NB 3EXHA 4Y67A 4Z8XA 5ECGC 4WXHA 1L5KA 4CKCB 1T4DA 4EVSA 3LWPC 3H8SA 2WV7A 3TKAA 1KIAA 4UHCA 2KG4A 1G21B 1WXGA 1K4MA 1VE7A 3EIWA 3STVA 2OAP1 4O1IA 3A9UA 1PF5A 3OZVA 5AVKA 2WFAA 3VKFA 1UZUA 2HQOA 3WLRA 3RTEA 4CCAA 3OJCA 3D3WB 4UDXX 4PCVA 4L4UA 3VOTA 4BVGA 4GKKB 2HMUA 1IBRA 2C94A 3OCXA 2V98A 4RANA 1SVIA 3JATB 4J7CA 1DWQA 1AZSC 2ZT7A 3IUPA 1I7NA 1GU1A 2J07A 3OICA 3PUIA 2ISQA 3VX3A 2GF9A 3GPIA 4DARA 3RF7A 2X9NA 3CS3A 5MGBA 4XVRA 3LY9A 5JJBA 2JCBA 2EC5A 2NACA 3KQPA 3UMMA 2F62A 1L8OA 3OQ1A 4ISBA 3ZD6A 4E2ZA 1QCDA 3RVJA 3LBYA 1BN7A 1E2QA 3GUVA 3LPCA 3BE5A 3OZUA 3UMBA 3WSWA 3GJXC 1L7NA 3R3XA 4P4SA 4O2LA 4PLWA 1X8JA 3R9XB 5HF9A 1G5RA 1TK3A 1W4BA 3P7MA 4Z3KA 2PRKA 4H1TA 4AAYA 3I4CA 5CX4A 3CZQA 3MCAB 1X7HA 3AHJA 3Q7EA 3SLRA 2D6FA 3N6RA 3PSHA 2OYRA 1FB5A 2OCGA 1UZMA 2FX5A 5DW0A 3GEGA 3HXTA 2IYEA 3W79A 1W4RA 5DDIP 1FX1A 1HETA 5DHAA 2IS4A 1T6YA 3B3JA 3BM5A 4OHZA 4CM9D 2V1UA 2VQDA 4TS1A 2R8YA 3PDCA 1Y9EA 1XRLA 4G0WA 2X0FA 5ARCA 3G9UA 1WTAA 1GNSA 2IIVA 3RC8A 2C1XA 1CB0A 5EHZA 2JW5A 1FU4A 3QU5A 5FUMA 1GWNA 2IQIA 4BMYA 4ETMA 1BZYA 4R98A 4X85A 3O85A 3RRBA 1IUPA 1DOAA 3IKLA 4D45A 4OX9B 1DP4A 4H6VA 1U1DA 1YZQA 3QH4A 4B2LA 3B7GA 4F7WA 4PAGA 3EXFB 2HQ1A 5BSFA 2OXIA 4DLBA 5BVGA 1XNHA 4JUCA 1FW6A 1R0CA 4LHEA 4MUNA 4PIMA 5F9MA 2DETA 4EGJA 1HDZA 4DCJA 3ZX5A 1JJAA 1NKVA 3M34A 5DN9A 4BMCA 5KNCA 1C7JA 1JR6A 1M9NA 1KIMA 4DRXB 4BNFA 1RTKA 2VK2A 3IT2A 4WADA 3GEPA 2W22A 1I94B 3UATA 1IAVA 1R88A 1ZJ5A 2AR7A 4BO1A 2C92A 2JHPA 3FWYA 5EIBD 3L0DA 3OQMA 1KMNA 1YI8A 1A27A 3GPDG 4QUEA 3O93A 1BN6A 1FDWA 1ZI9A 3OQIB 4OHOA 1AV6A 1UR5A 3ESZA 4XX0A 4ISCA 1J7HA 2BBTA 3I5AA 4G1MB 5A4AA 1NA5A 3IODA 2Z3ZA 3D59A 3OU6A 3SZRA 4MW9A 3PD0A 3PKJA 2VYVA 8AT1A 3D2AA 1RLIA 1ENZA 4CEIA 4EGAA 5F76A 4LDNA 4HRYA 4A0RA 1II8A 1SC3A 4MNTA 2B78A 1DO0A 1LPPA 1QTNA 3E18A 2O8DB 1SUEA 4KBYA 3BL8A 4KN6A 4Z1MA 3U17A 1T2NA 4AX8A 4P3KA 4XRGA 1HE2A 1BXGB 2HO4A 3MMZA 3WGZA 2BM8A 4FJ1A 3C48A 1CULC 1LBIA 2VF8A 2Y8EA 4HDKB 5B12A 1SB8A 2RGNC 4NQZA 3ZE1B 4YDHB 1Z0FA 4RD3A 1G8SA 4HDAA 4B3TB 3CCVF 4TWIA 1Z7EA 3AW9A 2BFPA 5DVZA 4G81A 1EH5A 3MAAC 4TN1A 3K0BA 1FVOA 1TQHA 2VJMB 3MQ4A 4MYRA 3SIXA 3TD9A 5JAUA 3L0BA 4X20A 2D00A 2NXEA 2Q28A 3ANXA 1I30A 1J33A 1GJRA 2IYVA 2OTLF 4PW0A 2P35A 2IPMA 2QQEA 1LQTA 2YWGA 5LUAA 5LXTB 5CH3A 3SQLA 2GS9A 2W42A 3JASA 4NJMA 1AF7A 4RK5A 2AG5A 4CTOA 1DRUA 4OHBA 3AI7A 4XOIA 5A2QA 2GN1A 1Z07A 2VF2A 2WFZA 3QMPA 1LS1A 2WQ6A 3A2KA 1YJBA 3NMUF 1OMOA 1T6NA 2XUPA 3MWKA 2ZR8A 2F43A 1YZGA 1T43A 3PICA 3RS9A 4A0FA 4F8YA 2YXLA 4UQLA 1AU9A 3TQTA 2LDBA 4GOMD 1NVGA 4UNSA 3NHRA 1Z82A 4DR1B 4DV0B 1SXJC 1W47A 5KBYA 1MDFA 2C59A 3UNXA 4Y3UA 1GCAA 4ABTA 3K72B 1WZIA 2QE7A 2E5WA 5TGDA 4K0KB 4Q7EA 1QBKC 2W2LD 5ESXA 4AMVA 2FR8A 4LPKA 4GLJA 1B14A 4GOLD 2OSVA 1D2NA 4I6GA 5IM5A 1GPUA 3UAGA 4EMSA 3HHPA 1N77A 1FFBA 5GZ1A 2WJZB 5A05A 2IYFA 5CVDA 1ADJA 3N0XA 1M6YA 1PLJA 3DOIA 3ZS9A 3TPFA 4IRXA 3LZDA 4ZCIA 4BO8A 1B8PA 1VRWA 4KHPB 2YCBA 3TECE 4OGWA 3OA0A 3INTA 1YKSA 5FYDA 5HF6A 4RA9B 1NLMA 4FGZA 3W3ZB 3CC8A 1NN5A 2EKBA 1FNJA 3WYAA 4DMKA 1E6WA 1I6WA 4C0XA 3WQSB 1V5EA 3HB1A 2VK8A 1L5LA 1AJEA 3QX3A 2J32A 2YFKA 2ETVA 3PTZA 3KWMA 3HZZA 4ZK7A 3DF7A 3RTCA 4CL0A 1X3SA 3IQXA 4L2IA 2RMKA 2O57A 2Q9UA 2E2WA 1AXEA 2VAWA 4QQRA 2NP7A 5EJ5A 1ZGZA 5CB6A 3SOZA 3TOVA 3MVEA 2O3RA 4GG1A 3F97A 4MB6A 4RPIA 4MUEA 3W5IA 1V6SA 2RAVA 1UJ5A 2QE6A 2WABA 3LFHA 1Z36A 4LGMA 4X94A 4QDOA 2LW7A 5B2EA 1SUWA 3LNCA 2R1TB 4DDTA 1Q7CA 3N4YA 5JY6A 1I7LA 4KWHA 3P20A 1GCOA 4X45A 1FYWA 1GG5A 3NHLA 5LBIA 3NEPX 4IVPA 3BXOA 3RFCA 1E8DA 2BUAA 2NUPB 2ZUWA 2KWIA 4P7BA 3I1YA 2PMDA 2IE0A 3L0IB 4OYYA 3ZBQA 3QE9Y 3I3FA 2PZFA 1PT7A 1C4KA 3PHLA 1PGOA 4ZMSA 5AXDA 3DS8A 2ZBFA 3KB2A 5E3HA 1CWUA 5LM3A 1UXKA 4DJJA 3EFOA 4KQIA 3HP1A 2ZUTA 1Y63A 5B6PA 3S7ZA 4PYOA 2OWEA 1O96A 4UNNA 2ZUFA 1ZGHA 2G08A 1F9AA 3KVVA 4L4ZA 2JLSA 2DLNA 2KQUA 3NWJA 4ID9A 5DNAA 2VQFB 1X7YA 1GXSB 4O4HF 2JFXA 2HS0A 1OROA 2D3TA 2QYSA 1DX6A 1DWPA 1UM9A 3DMGA 4FB5A 4HEHA 3P2YA 3T6KA 4F8JA 3BYQA 4KUEA 4BO7A 2FA9A 1RWQA 2ZYAA 1CEEA 1SC6A 4TPKA 2PSDA 2Z3VA 3ZV3A 5EMKA 1M2VA 4A0SA 1AN9A 2B7CA 1GO0A 1GPBA 2CNWA 1MX3A 1NQWA 3E35A 4PNZA 2HEGA 1URPA 1TKBA 1EIWA 2W2TA 3QKTA 4XLLA 2YZKA 3ZHSA 3K0CC 4YCSA 4JX9A 4RTLA 4YEDA 1N8NA 3V8PA 5K05A 1T0IA 1JKIA 3E6AA 3GZNA 3L8MA 5CIYA 1AQLA 5DK6A 1PU2A 2Q1SA 1RJ9A 2XUKA 1V95A 5KVAA 3AMVA 2BGKA 2WKQA 2C95A 2J9FA 4P34A 5F7XA 1LI5A 1V7PC 3NKLA 4TL8A 1XZIA 1CZUA 2X3FA 3ZBTA 4FFDA 2BI4A 2HSGA 4NBVA 4REMA 1YFLA 4KQXA 3WS7A 1VPWA 4CN8A 5CPFA 1TMYA 5AW6A 8LDHA 2PO7A 4NV3A 5EHNA 3HKBA 4C87A 2MYPA 3L6EA 3HKEA 2IDJA 4FT2A 2AVNA 3TRJA 3ZU5A 5FCDA 1TVMA 4Z1MD 5HZMA 1J1ZA 4QU8A 1WKVA 2H1CA 5J4VA 3V1YA 2CDCA 4C0JA 1JXMA 5TF4A 3ESRA 2MINB 4CIBA 3FFTA 4GRIA 3G2OA 4GPAA 4FEAA 3OIYA 2ZPTX 1IZ8A 1YJCA 1ZIYA 3UBTA 2HQBA 2AE1A 2BD0A 3PE3A 1Z45A 1NVUQ 2GBLC 4ZRNA 4EPYA 4EGCB 4ER7A 2VAXA 3B1WA 4JLAA 2O0LA 3M9WA 4MS4B 4CMIB 4LF6B 4FTWA 3ZCRA 3U61B 3K5WA 3ZWYA 2PD6A 1JZQA 4TV8B 3M1IA 5LBTA 4CL2A 1U2GC 1ZN2A 4OXKA 1ORDA 2EZ4A 4MVJM 4QFMA 3SXUA 4D2IA 1U11A 3K16A 4UQPA 1GYQA 4UU8A 4YAOA 4U7HA 4IKPA 4R2HA 4J6EA 3P9XA 1TU3A 2ZM5A 3P4UA 3OZEA 3QRWA 3RRMA 4HVCA 1ZJWA 1KNQA 1PDVA 2AX3A 4EAQA 1O0CA 3NVKE 4RD2A 1GL7A 1HR0B 2OBNA 3VNVA 2NU6A 4FWIB 5CVUA 1SVWA 3MCUA 5AKLA 5H9VA 4AX4A 5DP2A 1RE0A 3RHFA 2F3PA 1CS0A 1QLWA 2CL7X 4HBGA 1OQAA 2UZ1A 4XVQA 3VR5D 4F86A 1RXWA 4Y1RB 2IWRA 2NO4A 5G4UC 1M2HA 1BNCA 3PJGA 4DILA 4DA8A 5AVUA 5FUBA 2L2QA 3TTVA 2PYZA 1QDEA 4Y2RA 4ZVRA 4YYEA 3I01M 5M2QA 5D3MB 4V3BA 1IN6A 3VR4H 1CPYA 3VX4A 4YRDA 1XA0A 4HWSA 3H11A 3DZHA 4S1OA 3MTAA 4KPFC 4D0SA 2I2CA 2EL7A 1UQUA 2RI1A 3EOAI 3MW8A 1OREA 4R68A 3WMXA 3CGGA 2AYXA 1I2AA 3SZLA 1XROA 3CX4A 2XT9A 5IEJA 4G26A 3H2JA 1EHIA 5LNK6 1TD1A 5AOVA 2H1IA 3ZDZB 1VQ4F 3BORA 4BQQA 4CR8A 4D81A 3A37A 1SZJG 1CY6A 4H4DA 1J1UA 3TPZA 3K35A 3UANA 4A8JC 3IR5A 4EQ6A 2VQ3A 4ESVA 1W8IA 3QTBA 1DV1A 1XTSA 1M2OB 1OTHA 3GNTA 2ODBA 3V42A 2G5PA 1GA6A 5E6UB 4ZANA 3H9BA 3LWRC 1F0PA 2OUKA 3QIVA 5EJGA 4LRWA 4AF6A 5BW8A 5E4YA 1XJQA 1OLXA 2R8XA 2NSDA 4D3DA 1E6LA 1RAGA 1K7YA 4FW8A 2FMIA 5BYKA 1IDOA 3F7OA 2H9YA 2WTNA 2ZIXA 3CMCO 4B7AA 2DPHA 1U4SA 5B4UA 3FAKA 4MIKA 5JZBA 1ZUNB 5L53A 3JQFA 3D9QX 4P35A 3EVNA 2PIAA 3NRJA 1PR1A 4J0CA 1EA7A 1IPEA 4N65A 1JALA 4XEUA 2W6JD 2BFMA 1TM5E 4A3SA 3E53A 3DDZX 3FKQA 1G60A 1YDMA 2W6MA 4MH0R 5T67A 4EL0A 4I1VA 3SFTA 2HCRA 2IP1A 3FDXA 1PRYA 1L7RA 1BU8A 3KJHA 3TMKA 1GAEO 2OHHA 3FM9A 4HZIA 3ESJA 4Y1EA 4XQ0A 2DBYA 1Q7GA 4JI1B 5A06A 3FUXA 4MVXA 4JJEA 5KEIA 1HZZA 1L7MA 4W5HA 3AVXA 4FFSA 1YS6A 4WY8A 1VJ1A 2PS9A 3VDMA 5JFTA 4HHEA 1BROA 2I91A 3ZWKA 4RTMA 2J6CA 2AR0A 1ZZGA 3Q1KA 2I71A 3ASYA 3IOEA 4FOSA 2BBOA 3RVLA 3ZJYA 2PTHA 3KXIA 3L6BA 3OOWA 3BF7A 4HUQB 2UYCA 1J4AA 1GITA 1JR3A 1AKUA 3QELA 4CFYA 1JJ7A 1Z15A 4EZEA 1A7AA 4GPIB 3JQCA 3I9MA 5BO5A 3FBTA 1N6RA 4QSHA 5DT9A 3QE0A 4Y2YA 2NSLA 3NTXA 4JDPA 4LZWA 1Y1TA 1U4OA 2BFDA 4CF6A 2WWTA 4PC1A 3KCNA 4ZOBA 1GN8A 3DKRA 3NANA 4MV0A 1NJIH 3R0VA 3DMPA 4OI4A 2IFTA 4P3OA 5K0NA 4ZZ3A 4NOJA 2BGUA 3DZJA 5F7JA 2DBRA 5F5LA 5A03A 3WKBA 4YP5A 5CVEA 6NULA 2VDWA 4FDLA 3U16A 4K9RA 3DBVO 4DTCA 2R5NA 4AKIA 4J9UE 5HFNA 3T0IA 1JJIA 2ZRKA 4M6WB 3T0GA 3Q9SA 3I5UA 3PJEA 1V1RA 3G2IA 2JLZA 2V9CA 4BO6A 3X43A 3ELYA 4HX5A 4MRNA 3C9UA 3MHTA 2R6CA 3JAWA 1GUBA 4RZXA 2Y1LA 4RY8A 3PR2B 3VC7A 3HCCA 2CV2A 1PP4A 3GXBA 1VP9A 4GYYA 3HLTA 1P7WA 1K08A 2YWXA 3KZNA 3GA0A 5C8DA 2J08A 5F2OA 4ENRA 1UJ2A 3AL2A 4MWGA 3BXGA 3H11B 4R1QA 2AIRA 4W8OA 3N8HA 2GNOA 3HGMA 4JQYA 4PYMA 4WVLA 2QPAA 4DMHA 5KO2A 1W0CA 4ZO4A 4BPRA 3ZIDA 4RY0A 3TLGA 1EWTA 5BN3A 1ZG3A 2X42A 3MHPA 2UUAB 3HO8A 2OGUA 2ID7A 2HA3A 3A2MA 1QKKA 2YJNA 3B6KA 4IFTA 1FQWA 1JN1A 1IWPB 4REQB 2OQRA 3L6UA 5T6BA 3AVVA 1BGXT 1Q1GA 3DXZA 3EYAA 4HFNA 3UWPA 4BMZA 4GYJA 3W1EA 3WKEA 1BGVA 5K6TA 1F8XA 1LLCA 3AY7A 2BP7A 4EB0A 2BFEA 1ZISA 3AH8A 3WK7A 4HZUA 3N74A 3U56A 2P9BA 1O6BA 3F0FA 3ZP7A 1CZOA 3OQVA 1QFJA 2WHXA 2X4LA 4CV3A 4JBHA 4F4HA 1N2IA 4D6PA 2B20A 2Q41A 5AI5A 2BL4A 1BH6A 1EP3B 2MMCA 3NNSA 3PCTA 3VGJA 4EKIA 3RU7A 5DNVA 4ITVA 4JR2A 1ZCBA 1DS6A 3LVFO 3M6AA 3Q7TA 5AVRA 4DBZA 3G71F 3LRPA 1XU9A 4XLTA 4HD8A 2Y0PA 3DD5A 2PWBA 1JR3D 4QNMA 5KTKA 4FONA 4URUR 1IWBB 1QO0D 3WOHA 3FXAA 4ZV4A 2OM2A 3LU1A 2C8JA 4HX2A 3ULKA 3MT8A 1RA4A 2HREA 2P4EA 3FYDA 4M0LA 4KXQA 2FPPB 1S89A 1IZ7A 1QQTA 3L43A 2H92A 4ZV7A 3CX8A 4MPDA 3HZHA 4NFLA 2ZRAA 3RJTA 1ODCA 1W85B 4MVCA 5CK4A 4ALJA 2X2OA 4L74A 9GPBA 3RJ5A 4QOEA 4Y2SA 4TQAA 4UZSA 1CRPA 3SYKA 2F8LA 3JQPA 4CXMA 1DJPA 1K2VN 2JHGA 2ALJA 3HA7A 4L6AA 4LJSA 4XPIA 5DNEA 2Q2NA 1G7CA 4TQ9A 3T7JA 2CLFB 4BL5A 2QQ5A 2ORYA 1X7WB 1BVUA 2VDMB 4ENTA 1E5QA 2AN1A 4W7IA 2DTDA 1YQWA 2H7CA 2ZVJA 4ZHSA 1EG7A 3EXHC 1Q7BA 4NYIR 1P5FA 4Q1VA 3EPLA 1WEKA 2X2PA 5EQTA 1LW7A 1O58A 1U8CB 4B74A 2G40A 1P33A 1DG3A 1L3IA 4LFCB 1TIPA 4JWKA 4PAMA 3VFDA 3MMSA 4EG8A 3AOGA 4LY6A 3UHFA 1E6MA 2WUGA 3ACDA 4YFYA 1DAPA 3DJYA 5KOIA 4HEA6 5DH9A 1YAHA 3ZXIA 5G4LA 3VGPA 2XA2A 4KWIA 2XKJE 4GAEA 3P0HA 1N0WA 5K3AA 1GUAA 3B3AA 1T8TA 3ITEA 2CHFA 5K0EA 2Z5GA 5ADVA 1OBFO 4JT8A 2IV7A 3TOZA 3MPOA 3T3EA 3VIUA 2OTCA 4XD7D 3O73A 4TMVA 1PL0A 1DIRA 2OOSA 4LVOA 1QHHB 1YR2A 5AIBA 3WSVA 3L1UA 4N48A 4MX8A 1VDZA 2HQSC 4C8IA 2W2MA 4IHQA 3ZOKA 5CFNA 2VNKA 2PR2A 3PIRA 2IUEA 2ZYTX 3W6NA 5AVSA 1VIMA 3DO5A 3IE2A 3STXA 1GXSA 2PKWA 5DBFA 4ASUD 3FPKA 5IG2A 1IXRC 2Z9DA 2ZDGA 2I1WA 3FTPA 1UK9A 2YJTD 4DA6A 3F5MA 3ZE0B 3RA6A 3C3PA 4PANA 4L9AA 4PC2A 5HR5A 2G63A 1APBA 2B3DA 5FNVB 2XYQA 1COWD 4J8PA 5EGSA 4B3XA 5EWLB 1LDBA 3OP1A 1VBKA 2P68A 1EK6A 2QEQA 2J1LA 1C1YA 4KYUA 4TS3A 1PXWA 2IT1A 1YS4A 3PNOA