4DXDA

Staphylococcal aureus ftsz in complex with 723
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
307
structure length
307
Chain Sequence
b'ATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVSGEVNLDFADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLETSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPELQDEIVVTVIATGFDDK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division protein FtsZ
publication title Restoring methicillin-resistant Staphylococcus aureus susceptibility to beta-lactam antibiotics.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Cell cycle/inhibitor
total genus 108
structure length 307
sequence length 307
ec nomenclature
pdb deposition date 2012-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
A PF12327 FtsZ_C FtsZ family, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4dxdA02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4dxdA01
5KX5A 1Z5VA 3M89A 4I50A 5EZYA 2VAMA 4DRXA 5LOVA 4TV8A 3RYCB 1Z5WA 4TV9B 3JARA 3R4VA 4ZI7A 4HNAB 3HKDA 3VO9A 5ITZA 5LA6B 1RQ2A 5IYZA 5JCOA 3VOAA 3JALB 4X1YB 3UT5B 5J2UA 5GONA 3RYIA 4YJ3A 3RYFA 5KMGA 1SA0B 2R6R1 4IHJB 4O4IA 2VXYA 4LNUB 4XCQA 4EI8A 5IJ9A 5LP6A 3HKCB 2VAPA 3VPAA 3JASB 4TUYA 4ZOLA 5EYPB 2RHOA 5C8YA 3VOBA 4B46A 4ZHQA 4WBNB 4EB6A 1W5AA 4X1KB 3RB8A 4M8IA 5LYJA 1W581 4IIJB 3HKEA 3HKBB 5EIBC 4I55B 3JAWA 1JFFA 1FFXA 4O4JA 4TV9A 3RYHB 2VAWA 4HNAA 1TVKA 4FFBB 4U3JB 5LXTB 5LA6A 5JQGA 2RHLA 1RQ7A 3JATB 5CA0B 1W5EA 3JALA 4X1YA 3UT5A 4O2AB 4YJ2B 4IHJA 3VO8A 1OFUA 2R751 5CB4B 3HKCA 5EYPA 5J2TA 4F6RB 1FSZA 5KX5B 3ZIDA 5EZYB 4DRXB 4WBNA 5BMVB 4U39A 3WGLA 3N2GB 4ZI7B 5IJ0B 3JAKB 4DXDA 5ITZB 5IYZB 5CA1A 5JVDA 4O4LB 2RHHA 4O4HA 4X20B 5JH7B 4I4TB 5KMGB 3RYCA 1RLUA 4O2BB 4I55A 5EIBD 4EI9A 4B45A 2BTQB 4ZOLB 1TUBB 5LXTA 3ZBQA 5CA0A 3C8LA 1SA0A 4LNUA 4X1IB 5FNVB 3N2KB 4O2AA 3WGJA 3JASA 3E22B 3HKEB 1W5BA 4I50B 5LOVB 3JAWB 4TV8B 2Q1YA 4F6RA 3JARB 3M8KA 5BMVA 1JFFB 3HKDB 1FFXB 4O4JB 4X1KA 5MN6A 5MN4A 3N2GA 5IJ0A 1TVKB 4EI7A 3JAKA 5M7EA 4IIJA 5JQGB 5J2UB 5GONB 3RYIB 4YJ3B 3RYFB 4E6EA 4O4IB 4O4LA 5JCOC 1W59A 5JH7A 3HKBA 4X20A 3WGMA 5IJ9B 4I4TA 2Q1XA 3WGKA 5LP6B 2XKAA 4O2BA 4TUYB 3WGNA 5C8YB 3V3TA 2BTOA 3RYHA 4ZHQB 1W5FA 5LP6C 2BTQA 5J2TB 4FFBA 1TUBA 4KWEA 4U3JA 2XKBA 4EB6B 5MN5A 3JATA 2GVIA 2RHJA 5LYJB 4YJ2A 4X1IA 5FNVA 5CA1B 3N2KA 5JVDB 3ZBPA 5CB4A 4O4HB 3E22A 3CB2A
chains in the Genus database with same CATH superfamily
3B1YA 4BO8A 4F4HA 3K16A 5JJLA 1UXKA 1BE8A 2AZDA 2ZUVA 3K9CA 4RK5A 3TBHA 3UV7A 4RY9A 1J4AA 1QIHA 1OJ7A 2AQKA 2ZI3A 1K6JA 1M2WA 1UCFA 2EKZA 3IPLA 3KT8A 2FHPA 4GI1A 1T5LA 1ZH8A 4UU7A 4EFNA 3ZHXA 2SBTA 4DR5B 2R6R1 4KZPA 4EFDA 4IEIA 3WJRA 1ISPA 2BLLA 4Z49A 1G6HA 5LP6A 1QQTA 3IVGA 3NOOA 4RHTA 4RIIA 1E62A 3ICCA 3K35A 3PVZA 5E6UA 3T9FA 3U17A 1NOJA 2VDUE 3BMOB 3GA5A 1SU7A 4H6XA 2WTXA 5C3UA 1E64A 4H7EA 1KJZA 3IJEB 4LC0A 4P4SB 4Q1FA 2PSDA 3CE9A 4WFIA 3HEAA 1FDOA 2AZ4A 2XCOA 3ER8A 2OBBA 3O8RA 1Z39A 3C5CA 4LZOA 1GV1A 2BFWA 2ECFA 4BDTA 3KB6A 2KJQA 3I30X 2VSQA 3NAQA 4MQBA 3EEOA 1H8HA 2YMPA 1TECE 1V16A 2OB1A 3PIDA 4G1CA 4AUKA 5AI6A 5JASA 3PQ4A 1WW2A 3M1XA 5IBPA 4DQDA 2YJ5A 3GROA 1EK2A 1K6EA 4KPGA 5ARCA 2MOKA 3HCDA 2PT6A 5GQSA 2P35A 1M7GA 1LWOA 3AWIA 1JQBA 1GM5A 2JLVA 1L7EA 2IF0A 2Q45A 4RMHA 5CB0A 2A9KA 3ZLTA 4N3GA 3G5TA 3SJ7A 5F9HA 1U2ZA 5EE1A 3T9AA 3L01A 2RC5A 4B6RA 3SIRA 5A0TA 1WZIA 3HBLA 5BWCA 3KEGA 4IGAA 4WZAE 1WS6A 5CYPA 1ELOA 4Q48A 3TQRA 5LA6F 4TLMB 1RNLA 1O1YA 3K0CA 4PLVA 4O2LA 3NDJA 3VPBA 5JVDA 3W6UA 2PZBA 2VO1A 3C8DA 3TD9A 4MROA 2OCDA 2SECE 2JEYA 1S02A 3D2LA 1RQLA 4BE9A 5M29A 5LWHA 3S0JA 3B5IA 7YASA 3U4QA 3DP9A 2R47A 4YUXA 1R27A 4ENSA 3OY7A 2V6FA 3IMPA 2PIDA 4IUDS 4K6CA 4L0MA 3I1JA 1V6SA 1GFZA 2LW7A 1DO2A 3JRWA 4L6CA 4RD1A 2FP4B 1EJBA 1E2GA 1VSUA 5ALVA 1QU3A 5J5AA 4DA9A 4KQIA 1NKVA 2XI4A 4JT4A 3C98A 3CGWA 1QE0A 4MVWA 4OGLA 4KB5A 4MB6A 4RORA 1R9GA 3ZGZA 3TLMA 1ZCZA 3GGGA 2B4KA 2BM1A 2Q6TA 4PZ9A 3V2UA 2W2TA 3HEBA 3CLSD 1ZICA 4N65A 1MX3A 4KI0A 4DA7A 1W4RA 3DTTA 4QXRA 2GBPA 5I7HA 5J23A 3DNPA 2ZODA 4MEBA 5JQGB 3H5LA 4LXTA 4JLPA 3KXDA 1ZIOA 4NYMQ 4U9UA 5DEIA 4C3OB 4O4IB 4ETMA 6LDHA 1PTKA 1JG2A 1DEAA 2PRIA 4K2AA 2GEBA 1FQWA 3X1KA 4H59A 4YP5A 1AMNA 3KSZO 3PPWA 3VSDA 5IDQA 1QBKC 4J1SA 4ND5A 1KEZA 1I2DA 3BIXA 4G0PA 1W5FA 1CVLA 1E4EB 1MMFB 5MDHA 4LNHA 2B61A 3W8NA 2WALA 3MMSA 4KNWA 5HIMA 3R7BA 4UUNA 4CGZA 3EFBA 4PS0A 4NUTA 1CNFA 4ZTZB 4ZYTA 1QQBA 2FSIA 2XEDA 1ZIDA 3BDAA 2ZJBA 4N8EA 4ZO9A 3UPDA 1U63A 3SQDA 1PV2A 3VTFA 1WKVA 5HF9A 2O8EA 2NTNA 1ZL0A 3WAGA 1P3DA 4C7KA 5KTPA 4JI0B 3WJ7A 1XRNA 4OTZA 1H47A 4UCQA 2WI8A 3LKBA 5G4UC 3BHNA 3AUYA 3JVUA 3ND5A 2XIJA 5ALKA 1N4DA 1YGPA 3JVVA 4QUBA 2HSJA 2YXNA 3LSYA 4Q4JA 5TEVA 3ZV3A 4A6XA 4BNHA 3WBJA 4TKVA 1LW7A 3H6HA 5CGZA 5HRUA 3COSA 3QIVA 5KMGA 2DBYA 3C24A 2NZUG 4LMPA 1R8YA 2QLMA 1B8VA 3ICWA 2D2FA 3TGPA 4IDHA 4DDUA 5LCXA 4RY2A 1YB5A 4R7ZA 5CXSA 4B2PA 4I66A 4ZK6A 5AQEA 2R66A 3AM4A 2OZLB 2YVAA 1D9XA 1Z16A 2HZ7A 2RK3A 2ZSFA 1HT3A 1L8OA 1M2OB 2XNKA 3N7UA 4QOSA 5HA5A 8GPBA 5K3OA 1ZC3A 1L4HA 1ZMOA 4UM9D 3F2IA 1U0JA 1VM6A 4BAUA 2EFDB 3RT9A 4E1VA 4O8CA 4AO7A 1OY1A 2ORYA 2G72A 4Q4HA 4WMLA 2M6LA 3H11A 4HNAA 5AKGA 4Z9YA 2ZE7A 2KBEA 5IX8A 2NUAB 1R0XA 1X9GA 2ZDHA 4HEQA 2CDCA 4MRSA 2FMXA 1O7JA 1XLTC 3NIWA 1NG1A 3G1UA 3NS7A 2VKTA 2HRYA 3QNUA 5H9VA 2OCAA 3PUKA 1DO8A 1FX0B 1XCJA 2BFEA 2GQ0A 4D98A 1L4EA 3DOCA 4AMYA 1EX7A 1HYQA 1RM3A 3MTQA 1TZMA 3JD1A 5B5SA 1CX9B 3QSGA 13PKA 2XTMA 1Z7BA 4MGEA 4BFCA 3U7IA 5LKRA 4WBXC 1RBMA 3N5KA 5EQJB 2FPPB 1V7ZA 3LDTA 4CLXA 1L7NA 3LL4A 4LHWA 2AKAB 1T8YA 3LCMA 4Y30A 2UUAB 1WABA 5EHZA 5KJ1A 5KQLA 1QK4A 1IXZA 1AHNA 1KSFX 2IUFA 2RCNA 2PUDA 1RVDA 4M21A 1PAUA 3ZHYA 1DEHA 1YL7A 2OC9A 3WBFA 1XHEA 2IODA 5HHTA 1MDFA 1X7XA 4RO0A 1PKXA 4XIGS 1ZEMA 1C7RA 1VKJA 3CNNA 4L0QA 2OPBA 4ND1A 4F71A 2HGSA 4BKUA 4CM8A 3WK4A 4ND8B 3ZYZA 4GZ5A 2V4MA 4ARUA 2ZR7A 3JQ9A 1YQNA 5J1SB 2WA1A 3VUEA 1DRKA 4YRKA 1N1EA 3GW8A 4R9RA 5LZ8A 4GYWA 4EYOA 4BVBA 2XUKA 1JZSA 1UK6A 3QYFA 4JT2A 4OQPA 1CD5A 1ZUWA 5EWMB 1Z35A 1JIUA 4AWAA 1YL6A 2PT9A 4MS1B 3EZ7A 3SNKA 1PBTA 1YR8A 2XCQA 4NBNA 5DHQA 1RKBA 3M2PA 4M9RA 1JDPA 4IDNA 1FP4A 3L7MA 4EJFA 3NHSA 3K71B 1GUBA 1RS0A 2FEKA 3HGTA 1VJRA 1F2VA 4GMXA 1Y6RA 3K4QA 2ZBEA 2AD1A 2N9UA 3RM3A 4DM4A 4QKQA 3EPRA 4X54A 4A2CA 2XRMA 2OM6A 4ZCSA 1GZ4A 4RIFA 2O5CA 2OCLA 4AL4A 2GLTA 3KUKA 3ZKWB 2UYNA 4G4XA 4FN5A 3P7MA 2JA1A 3PIRA 4N03A 4WD3A 2X41A 3B7WA 1V5EA 1XVVA 3BTSA 1NIJA 1TYEB 3R3HA 4I19A 3LO5A 5FI0B 2BI7A 1JVNA 4TV9B 1XD2B 2WZCA 4UASA 1MVLA 1K5DA 2OKGA 2X22A 5GP1A 3QVKA 1NWHA 3WJPA 5DM0A 5BV2P 1HE8B 2CMHA 1W57A 2FX2A 3DCNA 4M87A 3L7OA 2GJ9A 2JFYA 4QWWA 2X1MA 4UBNA 3P0ZA 1T3ZA 3MCUA 4ZA2A 4F4DA 4ZOLA 3D6UA 4HDNB 4HK4A 3SP1A 3SX4A 5JRZA 2QT0A 4ZOEA 3DZCA 1DX9A 4UAGA 5J4LA 2QYOA 2HH9A 1U11A 2B21A 2GX6A 2WMYA 5FUVA 4BAZA 4YRZA 1P0FA 4HN2A 4N54A 4PSDA 4PSAA 1VBKA 1OLXA 5C4GB 3ZCPA 4J0JA 3EG9A 4C0XA 3PAFA 1K8QA 4IRUB 3UA3A 1KZ6A 5JSQA 2RGNA 4TT8A 2XD9A 1X1DA 2PKQP 4Z53A 1M8PA 1PEDA 1QSGA 3OUZA 1FMJA 4XJSA 3MWLA 4WCVA 3CCUF 4JK3A 1YHZA 1U3VA 2C54A 1B8PA 1E2BA 1U90A 3K9GA 5A2QM 4Q9AA 3GLIB 3L1HA 1Z8NA 3UT5A 3LRPA 1XV5A 1H2ZA 2FW0A 3B2EA 4RETA 1E1QA 1NKTA 2FRXA 2OBLA 2SKDA 4JENA 1WVMA 4F4UA 2NG1A 1YA4A 1AKWA 3S40A 3K1ZA 1W9HA 3ORYA 3TQFA 2PHZA 4KGVA 4P0TA 2CL5A 3ABSB 4UHCA 5DOVA 4HQ0A 1EFAA 5CLLA 4C0JA 3S0WA 3EVDA 1UDXA 4QTXA 3VKHA 4V0NA 2EAUA 2WJAA 2AMLA 2PUGA 1SWVA 2EIHA 1SVWA 1SQFA 2R8OA 4ZHWA 2TMYA 4XGRA 5DK4A 3QEBZ 1GD1O 5LIPA 2QD3A 2VH5R 2EFEB 3GLSA 4MDHA 3SNHA 3TWOA 1G9SA 1NN3A 1H5UA 1ZGJA 5A4IS 2UZIR 1IHOA 4BMCA 5FFNA 1DPGA 2WWGA 1OAAA 3V5NA 3R5JA 4OI1A 1CE8A 1H2AS 1Q0HA 3M5CA 3HMKA 3R0ZA 5H80A 1X7YB 4P3PA 5AR1A 4JEUA 1CUBA 1CQJB 2GT1A 3EXG1 1NASA 2R84A 2W6NA 1CETA 1NPYA 4URXR 1X7WB 4C0WA 2Q3CA 4RIHA 4LWZA 3GELA 1DDIA 3GRUA 4CYMA 3J81A 1AA9A 1MOQA 3BJZA 3L0CA 3PU6A 4CKCB 3GPLA 1ICIA 3QZUA 2ACKA 1I6WA 1RI3A 2ERXA 3GPDG 4DXAA 2IHZA 1TJ4A 3WTCA 2DGDA 3P8ZA 4GRDA 4PG5A 4O4LA 3HDYA 4K6HA 4ZYWA 3K9LA 5ALFA 1GPBA 2GBIA 1ZRNA 2YW9A 5FBHA 1CY0A 1HWYA 4OHYA 2O8CA 3R6GA 1UWVA 5ESRA 1UQRA 1C29B 2CLOB 2BI8A 3N3AC 1AK2A 1JLLA 1Y4DE 2P78A 3MC1A 3Q9NA 3P2KA 5ALMA 3SHVA 3TRKA 3TG2A 3NMUF 2Q1WA 1VP3A 1FNSA 3TSAA 4NULA 5BSVA 4R40B 3FUUA 1KRWA 4XFJA 1CZKA 3KHSA 4LY6A 1E6CA 5JO9A 3C85A 5IAGA 4LKOA 1FRNA 1ZGZA 3DKKA 1G21A 1TM4E 4NH4A 1MO2A 4RH1A 5DKFA 3V97A 5JSHA 3A0RB 2O2IA 4DYVA 5E2IA 2AC7A 2PU7A 1ZH2A 5JCXA 5I7SA 2E82A 2WIFA 5DSZA 3HYTA 1FFAA 3OQVA 1F2UA 4YPFA 4K1LA 5B1IA 5FA8A 4RYLA 5K1ZA 1Y5IA 5LA6B 3LQRA 5IEJA 3MAAC 3CR7A 1HKUA 3BTVA 4QXAA 1FNBA 1UJ6A 4W1QA 2XQKA 3OQBA 5EY5B 1RADA 4LK2A 4YMSA 3UXYA 4BC1A 1RRFA 1VHDA 2IYZA 1E7MA 1W87A 3P97A 4X84A 4XR4A 2VNAA 4DWVA 5JZ9A 2W42A 1Z2CA 1ZK2A 2QL9A 3OPXA 1CQXA 1HRDA 4M1EA 4BASA 3NP9A 3SR3A 5DBHX 3NOVA 3BTUA 1GLVA 1VLZA 4FW9A 1ZW1A 5JLAA 4C21A 5BSMA 2C83A 1QHFA 4X85A 4TN1A 3WY9A 1YIAA 4WERA 1G1MA 1A5SB 3EE6A 3HKEA 2XZLA 1ZL2A 3L8GA 3T7DA 3R3WA 3B9QA 4IIDA 4P4UA 4ZOAA 1E5TA 2WPNA 3ORRA 4LZPA 1Z7WA 3C5WP 1S01A 1F4PA 2IYFA 2UYKA 2ZETA 5DH9A 1DCMA 1H8HD 2H9YA 5T4FA 5BUCA 2CB9A 3LWDA 1T43A 4GZMA 1AHIA 1A5ZA 1U8XX 2D54A 2JATA 4KN9S 4PTLA 3U7HB 4CV2A 1HL3A 3GLHA 3OO1A 1XN4A 4OHWA 1FFEA 3KS9A 3PWTA 3RCBA 4QATA 1DAPA 5IS2A 1DSSG 4MI6A 4DQKA 4BN5A 3BCRA 2WG1A 1QAHA 4PN3A 3BJMA 1ECCA 1D6NA 3DA8A 3TEMA 1YZUA 4WZAB 1DIOB 1QK5A 4WN3A 5EI5A 3HJFA 4OHMA 2BEUB 3PR3A 1UDBA 1I9GA 2HMTA 1FVFA 3CSSA 2AMFA 1AGNA 4L7VA 1LV8A 5DSTA 2BFPA 1R1MA 3AETA 3IXLA 3RVOA 2R6DA 1QFYA 1KWKA 1NBME 2AZMA 3ESYA 4G9GA 4HGZA 1LPAB 4Z4HA 3CLRD 1ZR2A 3DD1A 3GQBB 3ET5A 3FLBA 5K0EA 2JL1A 1T9ZA 2J59A 4HQLA 4YASA 4DIOA 2VDRB 2YXZA 1TGVA 1J0EA 2H11A 2AF4C 1M34E 1SD2A 3GGOA 4O4HF 5CCEA 3VCZA 3SVZA 4AJOA 2CFCA 4CIXA 4PNEA 4JI4B 3OZSA 5CM8B 2EBFX 2PLNA 1NHGA 1R6XA 1BHSA 4GT1A 4OH1A 2VYFA 3H2HA 4EMUA 1JR4A 2BCEA 3F3KA 3PGVA 4TSKA 2ZYAA 4IFBA 2VWHA 2I6TA 4UBKA 2JKYA 3UVEA 4KO3S 2V0CA 1ZHOA 1J2JA 2X0IA 5B1DA 2RB4A 3TLGA 2VRCA 3WP1B 4XASA 3EXHB 1MXHA 3KL4A 2I7TA 4YJKA 4RTQA 1FJXA 3EVGA 3PLAE 5KREA 5ICCA 3F6YA 3EVZA 1N1GA 3SQXA 1RQNA 3IHWA 4K2HA 2B8WA 3AHHA 4BU0A 1N75A 1D6SA 5HSGA 2BUBA 2X2PA 1E0AA 4IJUA 1K5GA 2Q0QA 4LDJA 4UTOA 2XYGA 2EX1A 5HILA 5TLSA 2EWVA 1LDMA 4G1UC 3S1AA 2P79A 4UPDA 2QMHA 3BSSA 4N3NA 3WDMA 4EPXA 4RPKA 1T1SA 1PFUA 3NHZA 2ODTX 2ATCA 2P6RA 1R64A 1Z0SA 3PRHA 4MPTA 4W5TA 1R8JA 5A4FS 4ARCA 1ZK3A 2BMWA 5DX0A 3KQUA 2O2ZA 4JR0A 2V6MA 3RBAA 1S2OA 1Z18A 2G9ZA 3DO8A 5TQVA 3VJRA 5CDGA 3LGAA 1RM0A 1U0LA 1WP4A 4FLFA 4ZQBA 1E0DA 3O3MB 5BYAA 2HW8A 1GA4A 4QM6A 1HDOA 2BEWB 3NK6A 4P86A 1SY7A 5EJ2A 5CNMA 1YO6A 2R9VA 1J90A 4Z2YA 4LWPA 4PX2A 2B1QA 2E4XA 1RIIA 4RK7A 1IAVA 1IXKA 1W52X 3S68A 1PLLA 5K0NA 3SAJA 3T5DA 2WHQA 2PH5A 2PUVA 3HBAA 3I05A 4FPXA 4FZJA 4KWIA 2EWCA 4F97A 2RGEA 4K1XA 4MLPA 4XWYA 2G82A 4KW7A 3ZWMA 4Y2GA 3QMWA 4JKOA 4HH0A 4RZQA 3AJ9A 5IH3A 2QG4A 4EJ6A 3DWGA 1KEVA 1RJGA 3D3WB 3CCLF 3B70A 4TVKA 4G2TA 2BZGA 4RFLA 4KQWA 2PS9A 4R1QA 2Z30A 3V7QA 2ENUA 1J25A 4XCXA 4ZQGA 5J4YA 3G7NA 3A4IA 1NXSA 2DR0A 1GADO 3IR7A 4JS0A 3RVLA 4C4YA 1E8MA 2C8JA 4PR3A 4X7RA 2HBRA 2QN9A 1IWOA 1KI9A 3A36A 4CIVA 5LYYA 4BX0A 3JATB 1W2BF 3DMRA 2HNBA 3M4YA 1GZSA 3PNSA 4FYVA 4NF2A 2O59A 2PXAA 5EQFA 3NETA 2IKQA 5AT1A 1RZVA 3YASA 3NVIB 1B3BA 2HLHA 2IXBA 2QNBA 1IVYA 3AI3A 4F4IA 1A71A 4CKEB 4RWZA 3UK6A 2PSFA 2PLWA 4RK6A 1FNJA 2R8RA 3KJZA 2VOJA 1CHNA 4B75A 5JDCC 2J3EA 5K3FB 2PXCA 4LRUA 4POOA 4XIJA 1NUQA 3W90A 3CNEA 4NBWA 1Y5LA 3MJHA 2EZ8A 2DHRA 5LB4A 1PV4A 4PC3A 1HLGA 1ZIPA 4JEHA 5F1KA 3UMVA 1YZHA 1KKMA 2YC4C 5K5EA 2VPTA 4O0LA 1Q3TA 3ND9A 2GBCA 5LXTA 1LNQA 4BLWA 3PP8A 5JC1A 3NBYC 1H65A 2DFVA 3HWX1 5KYXB 1P19A 1HNZB 2HWXA 3E2PA 4FHEA 4X1IB 2XBUA 1KY2A 1BRTA 2JLAA 1ENPA 2WUWE 4BGVA 1O77A 4LPSA 4Q34A 2JGJA 3TD6A 4FB5A 3C3BA 3DBOB 4V0MA 4X6XA 2LTAA 2Q8PA 2CHQA 4LVOA 4BGUA 1GPWB 3SYLA 2CLMB 2XMQA 1E0JA 4FFSA 3PA8A 3MUFA 1UBRS 5T3YA 3ZHUA 2AC4A 4L6AA 1K68A 2G67A 5AD1A 2E48A 1QFSA 2WTMA 4B7CA 2HD4A 2AHOA 5A2GA 2ZSHA 3D6TB 5IANA 2D7CA 3VOTA 4Q3BA 4RK0A 3OZCA 3L82B 3P0RA 1OLOA 2V03A 2IPAB 3PXBA 4MWEA 5CHYA 5FWYB 5BQ5A 4P3OA 1RYEA 3VTKA 4BRZA 4LKRA 1SUIA 2ZW9A 1EUZA 3UT0A 4B3FX 1PN3A 3WQHA 1DI0A 2OE2A 2QE7A 2WW8A 2O8NA 3OUUA 3ZE8A 5IARA 4RAQA 4OXIA 1KP2A 3GCDA 4QUDA 3W5JA 3MGBA 3L6OO 3WMEA 1AS0A 1TTPB 1MAVA 1D1PA 2DPGA 5K3CA 3F73A 1EK5A 3V00A 4A2PA 1B6SA 3ND8A 3V1LA 3RW9A 4BVAA 3O9MA 4U0JA 3TK1A 3NH6A 3O38A 2AR7A 3I6ZA 4IFIA 1WZUA 2FSFA 1ODIA 3SZMA 4Q37A 3IPRA 5K7SA 1PNOA 3A4MA 5AW7A 4EBFA 1WBDA 2ZRPA 4MMZB 1K8AH 3GUZA 4YP1A 4C30A 4BX9A 2QLBA 1YJWF 1OAKA 2MR5A 4QPNA 4Q1EA 4WN9A 2VBCA 2BMVA 1JZQA 2PX6A 1DLIA 1P8AA 1TA9A 3IIEA 3UF0A 3CPWF 2CYCA 2R3SA 4AJIA 1WB6A 3U9TA 2ZRDA 1HDXA 1VGVA 1Q0TA 3HKBB 3MS7A 2GN6A 4DW8A 2EWMA 1RWOA 2NQ8A 4HAIA 2G28A 2QA5A 2V7BA 1O0SA 3R3JA 1N5LA 3R6TA 1K4KA 5AM0A 1C81A 4N8DA 4GU5A 1NULA 2OO7A 3AL0C 5EKXA 2ZTLA 2GCOB 2JGKA 4FCCA 1CKEA 2CVZA 2B98A 1SCAA 3RK1A 4X3MA 3GLGE 2FZKA 3U61B 3QNMA 2BD0A 1RAHA 3BXZA 4AZWA 3JXEA 4K3VA 3THXA 1E1QD 3KPUA 4CMBA 2PWYA 3U4MA 1XAJA 1XBTA 1M1UA 2C3UA 3I7TA 2BOVA 3I2KA 5SYAA 4U9HS 1W36B 1RDFA 1XZ8A 2VJAA 4OXKA 1TLTA 4FE7A 1RWXA 2FYTA 1YSCA 2ZJ7A 4QFCA 1TF5A 3NIFB 1VL1A 4WSOA 2YCLA 2PFSA 2VUTA 3R3XA 1P9RA 2VH2A 4HZIA 3VR2A 1MG0A 2YR0A 4MI9A 2WSIA 2HDOA 2X23A 1JXOA 1M1NA 5ALLA 1SC3A 1C4XA 1OLUB 4FSDA 5AVUA 2NQTA 1J2TA 2PGDA 1APBA 2B20A 4ZRNA 4A0SA 2ZRIA 1P1FA 3F6BX 3OT1A 2H4HA 5CFRA 2HM7A 1SA0A 2GF0A 3OPYB 5FL7A 4LVNA 4G4ZA 4NZPA 4DYHA 4KL8S 5DASA 1DFHA 5FUMA 3BC1A 1G1AA 2GN9A 2QROA 3DPIA 3HP4A 4XX0A 3VHRA 2I1VB 1T6ZA 4DHEA 1L5NA 3M4JA 5BNWA 1NU8A 1FDIA 2Y4OA 3A9VA 3AGPA 1TVKB 2X8LA 2BZSA 3DBLA 3GDGA 3INRA 4X92A 3WS7A 2OGZA 5CUQA 3WE7A 1L8XA 3EODA 2R7LA 2VA9A 3AIOA 3O4FA 3QELA 5JCOC 1YS7A 2P2DA 2PGNA 4B8YA 2VK2A 3WLKX 4BCBA 4Z3OA 1SHTX 4LJ4A 1LKZA 5BY2A 2GM3A 1AF7A 2IYWA 3HA2A 3ZXIA 2CLKB 3P4XA 5F4BA 2IBMA 4Z4IA 4ARSA 1EGVB 4EYGA 1QQ7A 1CG6A 1T9GS 2OCKA 3HO6A 2HPZA 4AFNA 3ZW9A 2H3HA 4B2YA 1Z62A 3QUBA 2GTHA 4NATA 3I4FA 4EUFA 1XQ9A 4UQLA 3DOIA 3DF9A 3JZIA 1NMZA 4WOCA 2P4HX 5FUXA 4QELA 2HR1A 1VHQA 2W90A 3LQKA 4YAJA 1R2QA 1XIVA 4JIGA 3KJKA 5HXZA 1FJ2A 3DEFA 4Q7LA 2Y1DA 1XDDA 5SZJA 4B9AA 1Z5WA 1H5QA 1V5GA 4JWKA 2CXUA 2GHRA 2XA1A 4AIIA 5B58C 3PENA 1KTIA 1WB9A 3PTZA 3DE0X 3TIXB 4HX9A 4KXMA 4PV7A 1D4OA 5T4HA 3UFBA 4RSRA 4KKVA 4XSHA 5BV1A 3Q3CA 3ROTA 4OSEA 2V7UA 3PHHA 2HLPA 4FFMA 2DTXA 2QXYA 1ZHFA 2BHTA 4TUYA 1Z2PX 1D1SA 4X61A 3VPXA 1RXUA 1XKQA 4CCSA 1MQ8B 4YP7A 3RIXA 3WNQA 1M0EA 1WY5A 5I7RA 2JHCA 2FSUA 1YTLA 1ZYUA 3IIIA 1IG0A 4HZGA 1C3OB 3T3EA 1SMKA 2GARA 3QPUA 3K0KA 4P7BA 5D7BA 5H70A 4CLEA 4EJ0A 4YLYA 1T3GA 4RTRA 4PG6A 2H52A 4IEEA 5AJWA 1G5IA 2I2CA 4IS3A 1QWSA 3UXHA 1J21A 1KU0A 3R8XA 2L69A 1BEEA 4FOSA 5JDIC 1NYTA 1Y1PA 2O48X 4N39A 5F73A 4AQDA 1WDMA 3ZTWA 1YZKA 4QOIA 4LTDA 4B6SA 3KSMA 3ZJ4A 2P68A 3NONA 1JFSA 3EZNA 4YAGA 4WXEA 3IPXA 3ECCA 3KJJA 5JPDA 1N0IA 6PFKA 4XPIB 1U8AA 4B3MB 1ZD2P 2Q4TA 2I6GA 2YWHA 4CMIA 1ZVJA 3RUFA 4XUGB 4DXHA 3T12A 4EG7A 5A4MS 5KJFA 3REFA 5A5EA 1GQ2A 1LPMA 1QG6A 2CF5A 1WDTA 5TB5A 2F9ZC 1YT5A 4DWOA 1TQ4A 5AW9A 2VH1A 4V0RA 4J9VA 1RBZA 3HV2A 5KSPA 3SHFA 1SUDA 1WPXA 1PGNA 3CINA 1OASA 4ECAA 4F85A 1F38A 1PK9A 4CDMA 4A2QA 2FWMX 4GPEA 1SKYE 2J0UB 1CK4A 1QVGF 1YCGA 1SELA 1ONNA 2BONA 4I55A 2OMKA 4A6PA 2J8ZA 1P9WA 2GASA 3IE0A 1DKQA 3TZQA 2H4ZA 4LBZA 1M2HA 4EY7A 3Q3EA 5B57C 1MJGM 3WJ1A 5KVVA 4RTKA 1IUPA 3WRYA 1A82A 4H2DA 3EY9A 3ZIUA 1LBSA 5JROA 4I1SA 4X5OA 3SZGA 4HDKB 4YV2A 3G9QA 4LNUA 2W4IA 4O2AA 4MLCA 4M0DA 2WZBA 1E5XA 1M34B 2IIQA 5B4TA 2JIZA 3KDPA 3FOWA 3NKFA 3A3YA 3HPRA 5EMHA 1SVNA 1R4MA 5EQTA 1IE3A 4RNDB 1F2DA 2BC9A 4CTJA 2SKEA 2XQFA 2AD5A 4Z0HO 5I9SA 3PGMA 3KSBC 4R51A 1W7AA 2ZBGA 5HY4A 1IL0A 3MCVA 4IIBA 3OOHA 1MV8A 5BYKA 4UZEA 4J7XA 3JQFC 2XUGA 3X1XA 3BJEA 4RA9B 2V6GA 3D6VA 5ALYA 4MR7A 4DZTA 2R62A 3PGXA 1TK9A 1JNXX 1KFKB 3B1ZA 2W11A 3AY0A 3CRNA 3VSCA 3BL5A 4E1BA 2JLWA 3MWDA 3S1LA 2I2AA 3CC8A 4KJZA 4G4VA 1TRHA 1ESCA 3WHIA 2UYHA 2AB0A 3FMOB 3VAYA 2HQRA 3C7TA 3E70C 4X63A 3VDRA 3K31A 5ERGB 4C6RA 4QRDA 3KE1A 1FYDA 5D5PA 3EEYA 4MS3B 4O0MA 3VKFA 3GRVA 2HSWA 2ZYIA 1E9AA 2FUKA 2YHIB 3DEKA 5LB2A 4XWOA 1RLTA 4LG1A 5H4HA 1QGAA 1U3WA 1FYFA 4GP7A 1CZNA 4MB0A 5TQ0A 4DNQA 3AW8A 3ISVA 1W6RA 1Z0UA 2CXRA 5KX5F 4G5RA 4YCLA 1ZNZA 5ECGC 1GDHA 1NBEA 3H4TA 1WP9A 2XRFA 3EZFA 1G0OA 1W0KA 4KSBA 5J2UA 3R44A 1BH2A 1KPHA 2OILA 4QBHA 3DEYX 4E13A 2ACVA 3K0HA 3QFSA 2VSXA 4OUDA 4EPRA 4RESA 1U6KA 4PY2A 3S2EA 1YB1A 3V55A 2CMDA 4DQVA 4FLMA 2VWPA 4EB6A 1NQTA 3AKYA 1GTMA 5ENVA 3VZPA 1E5DA 3AJDA 3PYMA 3VR3A 4JUFA 2QMQA 2G5GX 4KO4S 4F21A 2Y6VA 4DMHA 4GZLA 4G37A 4XDGA 4BEBA 1BXRA 2O3SA 2B33A 4I46A 1OTHA 1VE9A 3RANA 1L0BA 1GV0A 5FB3A 1P1RA 5FIUA 2O6LA 2YHUA 3IQXA 4O4JA 2GCEA 3IIMA 3KTFA 4LHEA 4XD2A 3HBMA 4FFOA 5AOCA 3S8MA 1U9CA 3ETHA 4G5YA 3R7SA 4HDSA 1OV4A 2RHDA 3F97A 5A4AA 1X7HA 1KMIY 2RDMA 4RGVA 5CDFE 2NZWA 2XNSA 3IRUA 4P4GA 3FAZA 1ZRMA 3LLUA 4PTZA 1NYRA 3VNUA 1PFGA 3CPSA 5AICA 2IYAA 4C4XA 4B62A 3T8YA 3N87A 1BCSA 1PJCA 2XXBA 4EHHA 1W8IA 2AVNA 2NXEA 4KWTA 4JBYA 1G8SA 3UKDA 3E1SA 1Y8ZA 1Z25A 2HZBA 4COKA 1W94A 2HCRA 2VJQA 4C5AA 1V2HE 3ADOA 2CWJA 1N9KA 4IIVA 3ZIAD 3SF8A 5KSZA 4ND3A 1SVUA 3ESRA 3QE0A 3USCS 3PJGA 5B6IA 1D03A 2EW8A 2A1UA 3BILA 3AUJB 2I76A 2AK2A 4UNNA 2Q0HA 2JARA 5E9QA 3ZTTA 5IKPA 4C81A 4PO8A 2QMYA 1KFBB 3LHDA 3UWPA 1P5HA 1Q91A 5DGXA 1ADJA 4DLKA 3HJBA 2ZF8A 1JYFA 2GJKA 4OHFA 1G5QA 3IEWA 3OURA 4BBPA 3PPVA 4FM9A 1H9BA 5HEKA 5K8IA 4ADSG 1U0FA 4YRFA 2DZDA 1FFCA 2WJYA 4MVJA 5F7XA 3I9OA 1C3VA 1E2QA 4GM1A 5JXHA 3HKDB 5GINC 2IYSA 1FNCA 5C37A 1V95A 4IJWA 3RC3A 4CTNA 2YIJA 3I2YX 4H6WA 1XNGA 1RVV1 4NTZA 4JB8A 5F2OA 5K8TA 3BGIA 3DMHA 3CKKA 2VR1A 4GP6A 1TEXA 5FOVA 4TL7A 3E6AA 1GEEA 2QTWB 4OSOA 4TWRA 5AKIA 3T9DA 5C8ZA 3NC1C 3RYHA 2XE6A 1Y1LA 1KL7A 1L6RA 1YIOA 3BICA 3AR4A 3KYDA 4KWEA 1Y9DA 1OBCA 3CVJA 3NBFA 5LQAA 1PDOA 3IDQA 1FNDA 1RKQA 1XJCA 3NGXA 1M6HA 2IXTA 5KI6A 3ZGOA 1Y3CE 4NNPA 2W6OA 1VIYA 4D8TA 4CIWA 1AB5A 3FA2A 4M4SA 3NHFA 1L5KA 3BRWA 1SXJC 2LIVA 2QQ5A 3KDAA 4MKHA 1OREA 2ZSBA 3QMMA 4M1YA 4EEZA 5FPTA 3T34A 3ZJTA 3OFNA 4GMDA 1EX9A 1MEEA 1UZNA 2VAMA 2CXSA 2BJWA 2E55A 5FTMA 1JKIA 4UJ3A 1ETUA 2JAPA 1WU7A 4OIMA 2QE7D 3K0TA 1TFRA 1XTSA 2YCBA 1H2HA 1V11A 3C5EA 4MRAA 1CY6A 1PNQA 1NJ1A 2PSJA 4OYRA 3PXAA 4P36A 4QARA 3EDRA 3HJRA 4ITRC 4DV4B 1Z12A 1JKJB 3W5UA 2FLVA 3N7AA 3ZDQA 4EPYA 1FS4A 3OQJA 5JZBA 3VOBA 5EHNA 3UJDA 4L75A 2LRHA 4B46A 4UAUA 2VPQA 1HA3A 2IJGX 3FVQA 4YCNA 2D7DA 2RARA 4LBVA 1GQFA 2FW8A 4UFNA 5H02A 3A4TA 4DUGA 3FUWA 3EWSA 4ZVKA 1CUAA 4BMNA 2JRCA 1CUDA 4LUCA 3EXEB 3GRFA 1VYVA 4ARZA 1XZGA 2EG5A 3BWBA 4LYFA 4ALIA 4FKZA 2NU9A 2RI6A 4KXYA 4PYMA 1RRGA 3RGGA 1OW3B 1TC2A 5KYWA 4WLFA 1VYTA 4LDZA 2QN3A 4KAJA 3AF0A 2JFPA 4Y6PA 5FI3A 1ULSA 1QCDA 2AR0A 4ZO8A 2JLUA 4JI7B 1H3NA 2QJRA 1W48A 4D3ZA 2FTKE 1YMUA 1N1MA 2R6JA 3QU2A 1II0A 3DL2A 2JCYA 3VFDA 1H2BA 5K8VA 4R2LA 2Q3LA 4PICA 5BNIA 2V3CC 2SHKA 2R5NA 4LHSA 3GN2A 5DHPA 3VC3A 2OHHA 3GLGB 2R751 2IUUA 3UUWA 2F67A 1CF2O 3W5SA 1JQDA 2DWOA 5AH0A 5EIWA 4F4FA 5KX5B 1VP9A 1XCBA 3BMOA 5K03A 1K1EA 4MLDA 4XLLA 4P4SA 2Q7DA 4URZR 3N2GB 5GIPC 1MW8X 4G67A 1QTQA 1POXA 3TOVA 4YAKA 1JIIA 3BWDD 3BZBA 4ZMSA 2V7TA 5E7IA 1IN4A 4J07A 1CR0A 3HL4A 3M82A 4AP5A 3TEFA 5JISA 2HHJA 4HUTA 1LJ8A 4J0FA 3R4CA 1NAHA 2JLBA 2ZAUA 1E20A 4E5VA 3VR2D 2V59A 1UMCB 2BFFB 1CQZA 4P7JA 1H2FA 2MYTA 2YOFA 1KY3A 2HWWA 1VJDA 3WGQA 1SUEA 4ZV7A 5GV8A 3ORQA 3ESJA 1G19A 1XRLA 4CM3A 3REQA 2XMSA 1A8UA 1NXWA 2HBYA 1GU7A 4G0WA 3WV4A 4DAEA 3R5KA 4BGDA 2XR1A 1GVNB 3EMKA 5CVEA 1AKTA 4DZRA 3OBYA 3R7LA 5FL7D 4V3CA 1Z6YA 3I56F 3UJPA 2XD4A 4MVJH 1BWPA 1ZMXA 2IDJA 3E81A 5LDGA 1YGYA 5KQSA 4IVPA 1S2GA 1C3LA 1NQXA 4HUQB 1J56A 2WEKA 5KWJA 4D5EA 3KSAC 1ZX1A 4IUBS 1PJBA 3M34A 1RW4A 1GNQA 3OJFA 2BFMA 3QUCA 1RYBA 2BYTA 2GH1A 2C3YA 1LH0A 4MWBA 4ESEA 2FP4A 2PKRA 3LZDA 4HWTA 1QGOA 2FEWB 1RI2A 3CCCA 3GHYA 3LZCA 2Y68A 4EGFA 3IT2A 3KKMA 3THWA 1NQUA 4WKNA 2DLCX 3CMAF 3IJRA 2XGSA 2CDBA 1AS3A 2J3MA 3IQZA 3IR6A 4NBUA 4WGFA 3QXJA 3R6LA 5AI4A 5KVQA 4M0PA 4BMZA 3W79A 5AW4A 4JAVC 1B3RA 4FTWA 4EABA 2FJPA 4M98A 1RQ2A 1G8MA 3WV5A 2YOGA 3VNAA 1AQYA 4D45A 1OE0A 1PR6A 2HJWA 2Z2IA 3ENVA 4J0HA 1T2AA 3LY8A 4L4SA 4O4IA 4M49A 5LLTA 1WD5A 3TTSA 3O9VA 1A9PA 2OV6A 1W46A 2DSNA 2FNAA 2FSSA 2UKDA 1BDMA 3ENWA 1UPBA 4EA7A 1ZVVA 2YWBA 2ZZKA 5C1IA 5TMDA 2YQ5A 1U1CA 3PNQA 2QXUA 1XQVA 4P54A 4E22A 3QHQA 3EC2A 2AG1A 3C3CA 3RB8A 2CXQA 3UM9A 1ZRSA 3K2IA 2W8ZA 3O4GA 3DLCA 3O3NB 3WKDA 1UIRA 16PKA 4DQXA 4B34A 1UINA 3I12A 4Q21A 1C41A 5KOYA 5EIBC 1JFTA 4BYGA 3ICVA 4QXPA 4UVEA 4EB0A 1OXSC 3L8HA 3RO7A 1FUUA 3K53A 1GQRA 1NUPA 2GN8A 2WKSA 1A27A 4ITUA 5T8KA 2QRGA 1XZMA 2YL2A 1TTHA 1AKYA 3P32A 1LBQA 4G4JA 4N12A 5FR2A 4KR6A 1NKSA 4HTAA 3ND6A 4NDNE 1Q82H 1XZCA 3C3YA 5CB4B 2WKWA 1DVRA 3L6RA 1JQJC 4EFMA 1ENZA 1TJ3A 2BEVA 3P9YA 1RHJA 1Y82A 4DPLA 2A5FA 3KT0A 4RTMA 1L4MA 2OZLA 3RPEA 1UJ2A 5B7PA 3RA6A 2HRRA 4C8EA 4NG5A 4LOIA 2AR9A 1E1DA 1FS5A 2VTVA 4AI6A 2JHAA 4MCHA 2KW5A 3CZ5A 4BO1A 2GWRA 3UWOA 3C5VA 4YRTA 4D5GA 5C18A 3AF4A 1TAGA 3D4BA 4O1MA 5L3SB 1SKYB 4C2AA 2Z6VA 4NMLA 1EWTA 2HQOA 2QGNA 3TGLA 1O94C 3LUFA 3IUSA 3ZHZA 3OLCX 4LHVA 2VBGA 2CLHB 1GRQA 1TIKA 3HCRA 3F5MA 1FDSA 5E9JA 3VZCA 3ZBQA 4Y3UA 2NUAA 4CL3A 4D0NA 1JLHA 4X66B 5J59A 5AHWA 5FFMA 5EOVA 5K3DA 2WTEA 3KQHA 2X19A 2P7IA 3PD7A 1FX0A 3JQBC 3UB2A 2J9FB 3EW7A 4N5NA 1D0VA 1MA0A 3E23A 4I6GA 4L8WB 2JIZD 3S1SA 3CN9A 1TZ2A 3B7PA 2P27A 4YT4A 2X5JO 3QE9Y 1X14A 1EZZA 1GFWA 1C1XB 3DWEX 3OM8A 4MP3A 4N40A 1UKYA 1VKNA 2JRLA 3E1GA 3FCUB 5EWLA 3WYFA 5F3WB 4NYJQ 2DR2A 2NSHA 5U4XA 3P96A 4E31A 1TKAA 3EEFA 4ABTA 3ZWDA 4BPBA 2P4UA 1NURA 4E5UA 3Q11A 4PYRA 1SQSA 3HO8A 2FW7A 1LDBA 4K9SA 1B23P 4YREA 3RJTA 3ZWXA 3KAQA 4MB2A 1NRWA 3K09C 3RF7A 1FTSA 4BGIA 3ZU3A 1HFKA 4ZOCA 1U7HA 1CDZA 4MGKR 2RAFA 3LGXA 4XGNA 1JAZA 3QUTA 4BT5A 4FDLA 5K9ZA 2C7OA 1O0BA 4ZVUA 2GPNA 1YRWA 3H5IA 4HH1A 1FFYA 2ZUDA 3IJ5A 4KV9A 1UXJA 5PGMA 1X6VA 3N58A 3K2XA 3N0VA 4HKTA 4MV0A 4ND8A 5JARA 2FFBA 2XOKA 4MUXA 4AN4A 3FH0A 4CETA 4RZIA 1ZOLA 4OAPA 1NMUB 4B48A 3JYQA 5BSGA 4M99A 1G42A 5EWMA 3EF3A 1EX1A 2ZSAA 1W0KD 4MS1A 2HF8A 4FUTA 5HGJA 3LIIA 3ZHCA 3C48A 3AYZB 1HOXA 3TTYA 4B44A 1L3BA 2I6UA 4DMGA 3OEWA 3AY7A 3QXHA 5TARA 1Z56C 3BB3A 1E9EA 2B9EA 2C2XA 4RHEA 5A6SB 4QDTA 1ABEA 1KI8A 5TPZA 2IX3A 2AKEA 3IO3A 2PZEA 4GL4A 1JG7A 4JN6B 5GAJA 5LR6A 1T36A 1RTTA 2B6HA 3ZKWA 3SEAA 2F55A 1TCVA 3WJ2A 3VR3D 2VSYA 3K30A 4BS9A 3G3EA 2I2BA 2VIIA 3UJAA 3HK2A 1Y48E 3K8QA 3UJ7A 4S05A 3DC7A 4TV9A 2JH3A 1H0HA 2ZAIA 3NEPX 2FUNB 1A8PA 1G16A 2IHBA 2LP4Y 2NT3A 2PKXA 3PFFA 1D7OA 4HEA6 3WWZA 1U2GA 1UXGA 2RHLA 2XVXA 4ICIA 1DAFA 1V7PC 4LIPD 1XZDA 2AJDA 3WB1A 3LC0A 4C05A 4LA4A 7MDHA 4IM7A 2VHUA 4S1WA 4FNAA 4YP6A 4HDNA 1N0HA 3WO1A 3CT6A 4JQOA 2OECA 1M6WA 5A1TA 4N3BA 3AUSA 4HAWA 5JW6A 3NP7A 1IQPA 3GT4A 4DLSA 4ML3A 2XA9A 5F35A 3UJ6A 1OZHA 1VIAA 1S6YA 3P4YA 4XWKA 2P3SA 3BSYA 4XQ0A 5A0FA 4JL6A 2LDXA 2XJ4A 3IP9A 3NWEA 4BNUA 4KDFA 3M49A 4L4UA 2J0EA 1VLVA 2Q6OA 1VE3A 1ZUNB 3FMFA 4J7UA 4XD7D 3T1QA 3PT5A 1AF4A 1V6AA 5IT9A 1GILA 4KREA 2ST1A 1N2CE 2VHQA 1U2DA 1HR0B 2WKQA 2EDAA 3ROQA 2JJYA 3GLIA 3CURA 2VJOA 1UT5A 3BK7A 1KC8H 3AMVA 1NJGA 3FX2A 2W98A 3QKTA 1Z8FA 1Q16A 4GSYA 3AT1A 1PJTA 3QRWA 2XCSB 5F5NA 2ENWA 2JDIA 3GZNB 4V0OA 1H23A 5CK5A 3EIXA 4B1FA 4FYIA 5H3CA 4ARIA 4MVJD 2CN1A 4ESOA 1A9YA 3HVHA 4E2YA 1YZGA 3ZD9A 5HVNA 3CV3A 5BR7A 2W6MA 1XPUA 2QRQA 3RYFB 2PZLA 4OFXA 4XFDA 3CEAA 4P33A 3ADCA 1E9RA 1FSGA 2HU8A 2JAQA 1YR7A 1F8YA 2WDZA 4IVRA 3MFYA 2D5AA 2I29A 4PCUA 4RZ3A 4ZDWA 4EOGA 4AF7A 3OU2A 1P0PA 1T25A 5IWCA 3CNHA 3L6CA 5K6AA 1HDIA 3T52A 3IVRA 4W5WA 4P0QB 1K86A 5I7OA 1G0NA 2J09A 2NNLD 1P2DA 3CHYA 1OZ0A 4RYDA 4EKIA 4YMHA 3GHZA 1S9DA 3ET4A 1T6YA 3HJTA 1QO7A 2G5CA 2N0SA 3OAAA 5BN5A 2O8DB 1USUA 3AM3A 2XDQA 3ACBA 1CQJA 2VHXA 2ZOVA 2PWPA 4FJ0A 4WW0A 3AU8A 1B74A 1B76A 1Z5VA 2WSLA 1HQKA 1X7WA 3M89A 3TW8B 1XA3A 1XZAA 4WNYA 1Y7TA 3OCYA 2ZJFA 5DDIP 1C1DB 3L41A 1JR3A 3MXOA 2D1RA 1G60A 4RSMA 2XUFA 5DX8A 4EELA 1QOZA 3TNDA 2IOYA 3PNOA 4YNBA 3FOEC 3ABQB 3CCJF 3PF8A 2PMEA 1EWVA 1TZBA 1S4MA 2JFWA 2VEOA 3GUVA 3WIBA 1QGUB 2JI4A 4H31A 1B7GO 2R2GA 2N47A 3SC3A 4QASA 2KTUA 1TTQB 3PTAA 2AJLI 2DFTA 2HIMA 3F8TA 3ILHA 2DTEA 5HZKA 4DUGD 3NQ41 2QY9A 3IEQA 4EH1A 2H2FA 2BGGA 1NZDA 4OJYA 1JFRA 1HURA 1P31A 1XAHA 2DWCA 4WZBA 1E1NA 3KPWA 4BCCA 5HZMA 2B5VA 1KI7A 3PEFA 2ZIZA 3CUYA 4URYR 3WL3A 4B3IA 1PGQA 1IY9A 3LXRA 4JOCA 4D3FA 1XKXA 2GZ2A 3HXKA 4PF1A 5LA6A 5K4GA 1KR5A 3LPAA 4CR6A 4L5JA 2QL6A 1CP3A 4IGFA 2ZUTA 2FI1A 2QVXX 4D82A 5D51S 5G4KB 1UBKS 4CT4B 4ZMBA 3DLHA 5ELMA 1T2CA 5AUQA 3L77A 2K2QB 2PK3A 5EWJA 3V4VB 1FZQA 1GZDA 2ZPTX 1Z68A 1JWBB 2XGMA 3LPLA 3MT7A 4UDXX 3QEKA 4DV1B 3BQNB 3C3MA 1PG0A 2XHZA 4QGFA 1MIOB 1MRSA 1C2TA 5C1OA 2RB9A 3W3AA 3WGOA 4IGEA 4GI3A 1YZVA 1GAWA 1TAUA 4EQ6B 1EGQA 4B8WA 3MT8A 1RAIA 4URFA 1WMEA 2QT9A 3DOFA 4BU1A 2DHDA 2QAJA 3OE4A 3S03A 1ZJYA 1JA0A 3O3OB 4RVDA 2BEJA 5AO9A 3CM0A 3D4OA 3UKOA 2PSEA 1CIPA 3K92A 5BNTA 5A4JA 2AA3A 2R60A 1IM8A 4PQEA 3GLFE 3NBXX 3KUXA 1T3LA 2A30A 5TGZA 3TW6A 3DLBA 2XB2A 3K9BA 2VDJA 1SBQA 1RMQA 4XVRA 3IBGA 2NYVA 1WUIS 2AIRA 1E7KA 3FGOA 4GYJA 5KYNA 1SXHA 3LRXA 2PVSA 3R7WB 5L45A 3WGIA 5DYIA 2Q5OA 3E9CA 4E5MA 4EP1A 4C4WC 1OCEA 5FF9A 3N2YA 3F4LA 2CFTA 5FPPA 1Q95A 3DAOA 3MPUA 3HMQA 3DZIA 1YQ9A 1II8A 3IELA 1FTQA 2Z9BA 3KKOA 3ETEA 5DGTA 3WSVA 1ATZA 5AVSA 1KHHA 5HKBA 1EUCB 1FYXA 5I3ZA 4NKRA 4FWBA 1Z47A 4R2IA 1PR0A 4G0VA 3F49S 4L4YA 3OCVA 5FPYA 5GANK 3NHBA 1B2RA 4OJNA 2QVGA 4XJTA 2ZCJA 1MVNA 1DT9A 3BE5A 3RRYA 2CZGA 2GEFA 3KJHA 5C80A 5C5IA 1YDGA 3CTMA 1T2UA 2GO1A 3UEOA 1U3CA 3MWGA 1EBBA 4F2DA 4OXQA 4RHUA 5CCDA 2FHSA 3KSDO 3LFOA 2NMUA 5GGXA 1K8RA 1T4CB 2HMSA 5BXQC 2Q9AA 3FY4A 3IKTA 4R8VA 3W04A 4B6FA 3DFIA 3JCZA 4KAFA 1YL5A 2WAAA 4C5BA 5FH9A 1GPLA 4KK3A 5IKEA 4BVQA 3AILA 3FM9A 4UTZA 1NVTA 4LGMA 4YA6A 5BT9A 4YX9A 2QU7A 1DQRA 3EXHA 4I5IA 2G40A 2O50A 3FCSB 1IBCA 5DULA 1EP1B 3STWA 3NRCA 5EP2A 4NFHA 3HN6A 2ZQ5A 2W0MA 2X7XA 5LD2B 2NAFA 4Z4QA 1AGRA 2W4MA 3FFBA 2H5IA 1Y7LA 2A7XA 2YV3A 2FEXA 2H1VA 4KNYA 3RC2A 4GWLA 3ROZA 3DOJA 1ESMA 5FWDA 4LRYA 3U19A 2WK1A 3DVAB 3BXFA 4FGZA 3UJ9A 2BPOA 3P9PA 4RL6A 5FJ4C 1F9EA 1XCPA 4DCPA 5GV7A 4F8EA 3I58A 3RAPR 5JATA 2P91A 4HGOA 5FPHA 1BHO1 3GEMA 1T34A 4H3KB 2PUHA 3QOFA 3PYLA 5TX7A 4Z3KA 4G5QA 5JQWA 3GZJA 3GYQA 4NQZA 5JYEA 3VJLA 1QP7A 4UE6A 3NIDB 3P1JA 3KALA 3VIUA 3L4JA 2JGMA 4IGIA 2BO1A 2XW6A 1NA5A 2L17A 3V7NA 4G26A 1EAMA 1JIQA 2KPOA 2ZRFA 3HY4A 3L06A 4ND2A 4QPCA 4UNIA 5FP0A 1E96A 2IELA 2QRUA 1UQTA 1YJCA 2R6AA 2EZUA 1NVWQ 2NUTB 3C8UA 5CITA 3A9CA 3TCNA 1RCFA 4YUVA 1P6UA 1L7BA 2VPXA 1V0JA 4CG0A 3ANMA 3EFOB 3D3WA 3M6LA 4DSAA 3PEVA 3DDHA 2X14A 4JJFA 3W3AH 1KZHA 2O06A 3K4PA 2XNJA 1U0GA 2H4WA 2AZXA 3ZOZA 4IJMA 3DDNA 4P81A 5IDVA 3AXSA 4G41A 5DBOA 1OWOA 2JGEA 3OZDA 2J4CA 4CWAA 1VDMA 1N8SA 4AU1A 1XJ0A 4ASUD 1A97A 4I5GA 2V8OA 5HDBB 2AF3C 3OIUA 1W2WB 2B25A 1KTVA 1PFWA 4PAOA 1B26A 1X2EA 1QYCA 2Z9CA 4KFRA 3U6KA 1PZFA 3IXQA 2P9BA 5EMJA 2C82A 2B1JA 4UZFA 3TIIA 2GM5A 2PJUA 4J0EA 3WWEA 5JJCA 1NBIA 2ZI4A 1JFFB 5D6OA 2I66A 1FMFA 1VOTA 2J31A 3AVQA 2Q5HA 3L8CA 2PX0A 5AKKA 1ZUHA 3NYRA 1QH1B 1T5OA 2G1KA 2GF9A 3GJTA 3C6ZA 3RU9A 3VAAA 3N3BC 2W6CX 2X86A 2BSQA 3PC7A 5CH3A 3ANXA 3DCYA 4JC0A 4XVCA 1M1YE 1XALA 2GBLC 2O20A 2XKAA 3H8SA 1BVHA 1LBHA 1XI2A 1E8NA 1TIBA 1VL5A 2QTAA 5ERYA 3GZ4A 3MELA 4PQYA 4DBZA 2YBDA 4HH3C 3D4NA 4PBTA 5B3KA 2GYUA 4DAOA 2FPGB 1G20A 5CB8A 2CMGA 5JD4A 2HT6A 2ZTUA 1SZPA 1KR2A 4X1IA 2AQHA 3ZE9A 1JQEA 1X52A 4NBRA 5ALZA 1PS9A 4UOZA 2AG5A 3T5MA 5A03A 3CB2A 1JDTA 4OXRA 4ZJUA 1HNXB 1P5ZB 4RWEA 1MB0A 2R8XA 3CF4G 2PL5A 4N7MA 4OFZA 4Y9TA 1KIAA 2XOKD 2A1TS 2FWRA 2O7RA 1ODSA 4K9QA 5CXXA 3T61A 3TOCA 2GPSA 5BN1A 1DAHA 3SZLA 2C7VA 2HCTA 3G2KA 3PR1A 1P60A 4OPMA 4ZVNA 1DC4A 5ICMA 4JUBA 1TC1A 4RE6A 3EOBI 1WR8A 4Z3DA 3QE3A 1CV2A 3QF4B 2HV8A 3R0PA 4M8LA 3ZD6A 4QTZA 3LQYA 1P17A 1PR3A 1ZGCA 4RY8A 3AR6A 3CZRA 421PA 4E70A 5FWYA 1GYPA 5AW0A 1OZFA 4PX3A 3SM9A 3ZZNA 4EITA 3MW8A 1SKQA 2O1EA 4R2KA 3ZEAA 4LTMA 1L5LA 5BR4A 4PSVA 1L3CA 3B89A 3D3JA 1EVYA 5TPZD 2W2XA 3EUEA 2I54A 4HNHA 2LKDA 1JT9A 4XEHA 5CT8A 2WIGA 1PFKA 4ED9A 5MHTA 5DMXA 1UP6A 3RFVA 3GX1A 3EW9A 4L8YA 5I47A 5AW3A 3GJ8A 2EF1A 1A5TA 4FDMA 3T0FA 1WXQA 4JVOA 5DO9A 5JNTA 1LA2A 1IN8A 1M76A 2X1LA 5DYNA 3E5MA 5JNUA 3DE5X 1E5QA 1CPYA 1WZEA 1HYGA 2JH9A 1Q1QA 2DUUA 4XCVA 1LD3A 2WIDA 2OAQ1 4V24A 2C0QA 1QP4A 1LI5A 1OI4A 4HWPA 4JROA 1DADA 2ZXFA 4QDZA 3PCXA 4BVEA 2OXEA 4HEA1 4OBBA 2ODWA 4OXNA 5DP2A 4D97A 1BJKA 5HQJA 1RA4A 3GNQA 2C1EA 2PUCA 1M1ZA 1ODCA 2NU7B 3F4BA 1MT3A 3OZGA 4NYIR 3W1EA 1SBCA 2AN4A 2P41A 1R8QA 2I0FA 2ZQZA 3A4LA 1G2QA 1KNJA 1JHPA 3L05A 4K6MA 4CU5A 4D3DA 5JS7A 2V3VA 1SGWA 2Q3MA 2BGIA 2HK9A 4H08A 1TF7A 2ZRBA 3JYLA 1PYGA 5IU6A 1SIBE 2GNOA 2GXAA 4FHFA 5HKLA 2C88A 3D4IA 3HCBA 1EUQA 1N2CB 5D1NA 1L8QA 1R18A 1GU1A 1O6BA 4GBJA 5CNKA 3PX7A 5D5QA 1ADCA 1PJZA 5JALA 5E7JA 5JJ5A 1ULBA 4UMEA 4W8OA 4BQQA 3BMNB 1RKUA 5A9RA 1GITA 4FQ7A 4GKAA 1KJWA 2HIGA 4GXNA 2OENG 4N5HX 5T6MA 4EUNA 4MKXA 5JZSA 5LFAA 4TXHA 4J2OA 3KAPA 2MJLA 4L02A 4IY1A 1RRPA 4M1KA 4A6DA 3DAHA 3WGGA 1LQTA 3RU2A 2X3UA 1U0HC 3AG5A 2JDID 1QCZA 4MKIA 2HRDA 2QAIA 4FDAA 2I8AA 4FVTA 2OHIA 3QVMA 5KCZA 1J1ZA 4CR8A 2KTVA 2LCFA 2P4QA 2RGWA 3TQQA 4C4AA 3T7EA 4R0MA 4JI1B 3W5DA 2GVNA 4DS3A 4LFAB 1OLUA 4MQEA 5AW1A 4PHTA 1N34B 4YRMA 3MNFA 4M0KA 1Q8RA 5J40A 3C9RA 3TVYA 4N5IX 4F84A 3FVVA 3JWEA 1VTKA 1JHQA 1UKCA 2FQ1A 3WGHA 4YONB 1ZSNA 1JQLB 2VCEA 2FPIB 4ND4A 4WKOA 4A0FA 1KZ9A 2RGDA 3HI4A 2GZDA 3HVUA 3MS4A 3OPYA 2Z43A 4G65A 5A3JA 2MT9A 2LIPA 2HOQA 4HVAA 5BUSA 3C6MA 3NWBA 5IBRA 3W6ZA 4B73A 5IG2A 1IY0A 4FMBB 3BWYA 4D96A 1SZJG 1XD8A 1MBZA 3OAAD 3AL3A 3TW0A 3WYEA 3B6EA 1T2FA 3EZ2A 2RJOA 5KYUA 4X7PA 3MJ4A 1USKA 1Z4MA 4ISCA 5IM4F 4QEZA 4DCGA 1P0QA 4I8DA 5EFOA 3DDWA 3GCZA 4AZVA 4C4TA 4DG9A 3TBFA 5K01A 1BSVA 4D25A 2C9BA 5HJ5A 1JR3D 1S2LA 1VMKA 3NGLA 4YRJA 2F3QA 4QHYA 3MJCA 1NY5A 3FKSA 4YCCA 4AKHA 2D13A 1GTZA 3QKIA 5IXJA 1SVSA 3CXRA 4LRWA 1Z3IX 4TVOA 4QLAA 2CXTA 2H2AA 4GNRA 4F96A 1ONOA 2WU3A 4W6ZA 3LXXA 3DHYA 3U2QA 2XAUA 4GKVA 4N0PA 1NTRA 1N9GB 2F17A 2WHRA 3MRTA 1JBQA 1GL3A 4JUDX 4LRSB 1E2JA 1COMA 4FGUA 3OD1A 3RODA 3TTVA 1QS0A 4X6LA 4FBLA 3I34X 2RJ3A 3RRBA 2CBXA 2Z8YA 1VCHA 1K6MA 2COKA 1UDWA 2A0WA 1PG5A 1Q3KA 1KDZA 4PGGA 1JJAA 2K7FA 1Y3BE 3QKUA 3DZGA 4V0KA 2D5CA 2NNWB 4FYKA 1VHTA 1YHNA 4E6PA 5K6RA 2VHEA 4LYEA 1Q44A 4IZIA 3M7IA 3F0GA 1NJSA 1MX9A 1OWNA 4YDHB 3C97A 4FFPA 3RVSA 2RI1A 3DMTA 5B6PA 1QG4A 3LUPA 5F4ZA 5LQRA 4JP1A 4NXNB 3GZTB 2ZUFA 1RRVA 4P3YA 4OP3A 2B69A 2OZPA 3TM4A 4F60A 2J3KA 2QLTA 3IVMA 2QPAA 1BQ4A 4K40A 4P4TA 4QNNA 4RDCA 2PGAA 1C3OA 2FFRA 2WLSA 3IPCA 3FDFA 3QUQA 4M1SA 3KOUA 3VYUB 5JS8A 2H65A 2HREA 3A28A 2CT8A 1FDUA 2ZUCA 2D2IA 4O4HA 1J06A 1D2HA 1K89A 1MXFA 3G8BA 4YQYA 4GM0A 5HBRA 1T91A 4I5DA 3OM9A 4JZKA 5DISB 5F64A 3BT7A 4YAEA 2QP4A 3LUAA 1A2KC 1Q7BA 4C8IA 3PUXA 3CCBA 2H07A 5B58T 4JQCA 1PYDA 2IU4A 2JLCA 5JHGB 3LF1A 1F14A 1EJ0A 2IHUA 2AH5A 2CVOA 1AV7A 4GGMX 3N8DA 3IBTA 4Z1OA 3GLFB 4PNZA 4G8CA 4DGSA 5DLPA 3WB9A 2YJ6A 1U02A 2C8KA 3G5UA 2C4NA 3HBFA 4FSHA 1X87A 4L9WA 2ZVDA 4OJTA 3C6YA 3CZPA 4RQTA 5BYJA 2RAPA 1SBIA 4XVUA 3L04A 1REQB 1I4WA 2Z2KA 1JDBC 3EDOA 3GUHA 3I6YA 4YJHA 3WLEA 1SD1A 4K6FA 5LJIA 4TTVA 4KG7A 4ZCLA 4D2IA 3O1JC 1B16A 4PZPA 3L7LA 3QVTA 2C0CA 4QX6A 2E6UX 1WHSB 3I2GA 3NR2A 2AGVA 1Z4OA 2VUIB 1CTQA 5C8XA 3MBIA 4PLZA 1NBMA 2IPNA 4YROA 3LYLA 1RWPA 3UG6A 4O25A 1F4VA 3BKWA 3QWIA 1D4ZA 3QVGB 1MHTA 3FNIA 1TRKA 3CUWA 1O4VA 3ABOB 4A8HA 5KOJB 4OL9A 3M9LA 4HDKA 2H8CA 3E03A 3O92A 5HTOA 3HNOA 3PLRA 9LDTA 1M34A 3AFHA 1XEWX 1A9RA 2AEJA 1YJXA 1QOPB 1MABB 5L7WA 4W5QA 1UWKA 1YVPA 1D4FA 5THKA 7REQA 3GDOA 5CDTA 5MGNA 2WJZB 4X3CA 5ITSA 1KI1A 1KFCB 3GUYA 5H1YA 1PX2A 3R5TA 5CAEA 1ZLXA 1D2AA 2XA2A 3FWHA 3FPBA 3CY6A 1I2AA 3NBKA 2IUSA 3W8RA 4GMGA 5K6TA 3I9KA 1U2SA 4IIHA 3RS5A 4QT4A 1ABFA 2ATXA 3JSAA 4GI7A 4NC9A 1YCFA 2PKYX 2AJTA 1K4MA 2BDEA 2WRZA 2ZSIA 3FFXA 4RHFA 3U5ZB 1SHJA 3RUEA 4KCGA 4CEIB 5CVDA 3JVIA 2Z83A 4CL8A 1B2LA 4X90A 1GRNA 1RABA 1XSEA 5A1JA 3ULKA 2ZM5A 3GR6A 2QSJA 5I9MA 2AK3A 4ETNA 1GTVA 2RE8A 3BXPA 4FCTA 4N8SA 3H3JA 4BMSA 5K20A 2YHIA 2NW6A 2QJOA 4B6EA 4ZAFA 2X9QA 4DDWA 1X1RA 3DVQX 2XUZA 1J7JA 4UAVA 1FS6A 1OFTA 5ALXA 4MQUA 3ZZUA 2B99A 1WNTA 4Z0TA 4EKGA 4ZVVA 2ZDQA 1F8UA 4TLDA 3T4UA 3HEMA 2C4UA 3DFZA 3KQTA 3QEOA 1ONPA 5K0FA 3NT2A 3D54A 1EWYA 1DJOA 1QXSA 1VLJA 2OHGA 3ZVMA 1QIGA 4ZEWA 1PF7E 3GPIA 2ZT7A 4WKPA 1SCBA 2MU1A 2BMFA 2V45A 3AUUA 3ZQ6A 1EDDA 1ZUD1 2FPXA 1VMIA 2DBVO 3NJRA 1PT6A 3MTIA 4MV3A 1INLA 3F3YA 2G70A 5G3YA 4KMSA 1LI7A 4PZEA 4DREA 1PJLA 2Q4DA 2HCBA 1D04A 3MRVA 1YQQA 1ZISA 3Q85A 3FKJA 2J0VA 4GOND 5C81A 4AY5A 1YI8A 1GJRA 2QD2A 3JPWA 4AZ3A 5H9WA 1NJFA 2HJVA 1UEIA 4R1UA 4URUR 4W63A 2GMWA 4QLOA 4PC2A 4XIIA 1KH2A 4KSCA 1QAMA 2VNIA 4P6VF 4RW0A 1LPPA 2H5EA 1VQ8F 5GJWC 1J23A 3F6PA 4EO4A 3ICEA 3FI0A 2JGRA 3A06A 1RZRA 3MWEB 3IS3A 2JK1A 4MP8A 1P1JA 1W4BA 5CU7A 2VHYA 2DT8A 1RM4A 4QDOA 4QQ8A 1IZ9A 4WXRA 1GN9A 4L07A 1RWKA 4LMAA 4EHKA 5JNRA 3E0XA 5DGIA 3AGKA 3QFHA 4JC4A 4WX2B 5GOTA 3F7MA 3M6UA 4C2BA 3W9UA 1IN5A 4L8GA 4EVSA 3ASVA 1EU1A 5A02A 1R1DA 2ZUSA 5IW8A 3ZQUA 4YPOA 4YAIA 1NMXA 2BCJQ 2QTPA 5JJKA 5I9TA 4Y1EA 5CFLA 2XITA 4YR7A 3FNEA 4KR2A 1J2YA 1NGSA 3OX1A 2O3TA 3BUSA 2VNJA 2IKSA 1E2IA 1HOTA 2DLNA 2X5KO 3HSSA 3MMNA 3LBAA 1EDEA 1M1YB 2VXCA 2XRYA 3MB8A 2IEBA 2CUNA 2PYDA 3V33A 3FDXA 2ZJ2A 5IK2D 1Z9BA 1VPDA 2Q2QA 4ZQIA 4Y0VA 5DHTA 2GEUA 3RABA 3ZBPA 1WO8A 2F43B 3A3NA 4A8TA 3A1FA 1XXHA 1T6BY 1JXMA 1SCIA 2R7AA 2ZBVA 5T7BA 4KQ1A 2C5FA 3TNJA 3RIGA 2XIQA 4RMNA 3THYA 1UP7A 1VJ5A 1XD9A 1OC4A 3HVKA 3L7CA 1W42A 3HKDA 2PMKA 1IQ0A 3I92A 4YCDA 4FOTA 4YMTA 1GT6A 2C4MA 3PHBE 1S2MA 3UCEA 3GD5A 3I9V6 4UJ5A 5JDCA 2YASA 3TJMA 1GLNA 1KD1H 1SVMA 5JMPA 2B2XA 3A05A 3G2LA 3QWBA 5BV0A 1L4KA 1RMTA 3V8PA 3WL8A 3ECSA 3Q72A 2H9AA 2O2EA 3C5HA 3FPEA 3RD5A 2CE7A 1E3IA 5B1HA 3TLJA 1U1DA 4UC0A 5JUWA 5SV2A 1EGMB 5AIAA 2ODAA 4B2IA 4MJ7A 4FGLA 4KQMA 4F8JA 1ST3A 3LBIA 4GC5A 4C7JA 1RJDA 1XZLA 4TXMA 1M6NA 2ZLBA 3FF4A 1AKUA 2HQBA 1NN0A 3FROA 3HRIA 2PWZA 2ZWIA 3H83A 3CH7A 3OBWA 4PAQA 2HQSA 3HR8A 4A4DA 2QUZA 2CL7X 3GT7A 3TUIC 2DPYA 2WJPA 3ZR4B 1T9BA 3JVEA 4I3GA 5E9AA 3UHPA 3RE3A 2VYVD 2W2LA 2VAWA 1QV9A 3FPCA 4UREA 1OB2A 4Q9JA 4S0XA 1K5HA 1JJBA 1GPH1 1TQDA 1WBJB 3BN3A 3IP6A 4C4ZA 6ABPA 1N6HA 3EASA 3IVXA 2OSBA 4FGKA 1Q0LA 4OU5A 2FF7A 4ZQEA 5C8DA 1UFOA 1OIVA 4N3AA 2X4IA 4V2IA 3W06A 2W71A 2HP0A 3DZDA 3ESDA 4QGBA 3S8EA 2WF7A 1AXEA 1Q86H 1VHAA 2Y99A 2IHTA 1AN0A 2Y2UA 2GKOA 3R3UA 2WE8A 5CT9A 4O59O 4PBSA 4E3ZA 4I99A 1P73A 2ISSD 4HQ6A 1I6MA 1AO3A 1NM5A 1P18A 4XKJA 4OQNA 1L5QA 1CT9A 4QODA 5ALTA 1JXAA 4C03A 1UKBA 3JAKB 2DU8A 2PX5A 1ILWA 1LXCA 3NH9A 5IYZB 4P5EA 2WD9A 4GSLA 4KPUA 4KACA 3KQYA 3LMEA 3FDZA 1XTBA 3GAZA 3E05A 3KYBA 4L85A 4HLDA 4ZCPA 4AY3A 4FDVA 4AUNA 3E3OA 2WP0A 4XWTA 4BYMA 3EZGA 3HXQA 1HQDA 3IV6A 1NVEA 1FFDA 2WMDA 1E7YA 2Z58A 5CHEA 3D7MA 4X9XA 2QDKA 3ITKA 2XUQA 1E61A 1IAQA 3WLMA 4UM9B 2OLKA 1N36B 3CUUA 1ADGA 1O3YA 4N3CA 1R5NA 1LNZA 5AJZA 3Q3IA 1IOVA 1G3QA 3JAMM 5FUBA 3E3AA 3FVWA 4K46A 1W76A 1WDLA 2I22A 4NE7A 2UV8A 2WT4A 2ZI6A 5AM4A 2ADOA 2NZXA 1OILA 1JDZA 1CK2A 2H16A 3N2GA 3CN7A 2Z04A 3EGWA 4P2BA 1Q1ZA 3TQHA 1FX1A 1Z0JA 1IOZA 3F7TA 1T1IA 3CLVA 4Q18A 3U7GA 4YB8A 4H1WA 3HGQA 2W2KB 3FMPB 4TMZA 4H77A 1TMOA 5JEEA 2R6CA 3RVDA 3S2ZA 4OL0A 3ZQJA 1FJGB 4NJMA 4OKIA 2G0TA 4OQDA 3C3JA 2BFFA 5FA6A 1QMGA 3SOZA 1GTRA 3EMDA 5ALJA 1VKRA 2KYRA 3I01A 4FYPA 1GCGA 2ZBQA 4GZ3A 5ICFA 3SQNA 4G25A 1Q7CA 2ZUUA 5B7NA 4H7DA 2UAGA 4YP9A 1PWXA 3KIPA 2OLJA 4O2BF 2O57A 2HF2A 1RCUA 2HMAA 1T0HB 3PSAA 1W75A 1MAAA 3JV7A 2NTVA 5SICE 2QMOA 4D8YA 1E6UA 4OP1A 2LPMA 4RJ2A 1M5RA 3A2LA 3OP1A 3I53A 4PFQA 5LBTA 4A8JB 4DEVA 1GY8A 4UW9A 2Q0XA 1W35A 1IJBA 4U2DA 1FIUA 3FB4A 4B5CA 4QUIA 4HUQA 4WJZA 1YI2F 1IZ0A 1ODTC 3UBMA 2PANA 2Y71A 4TM8A 3MCTA 1C4OA 2A9VA 2AW5A 3FKSD 1LX7A 4TVBA 5FO1A 5AJVB 4NENA 1GO2A 2BKXA 5DCLA 2A4KA 3SZRA 4EARA 1OAOA 2HA2A 1UC4B 1PE0A 4GXRA 3S2YA 2EGHA 3O90A 5HP4A 1X1AA 3PBKA 2WMNB 1KKLA 2M9MA 4GICA 4PPQA 4RE5A 1C8BA 4WADA 4UEOA 3KHNA 2ZTVA 3KWFA 4YJ3F 4HFRA 4DIEA 1FLNA 4YRNA 4IJQA 3X2SA 1YIDA 2IZ6A 2W43A 4JLBA 4OHUA 2H18A 3SBDA 1JL3A 1OFIA 4IX1A 3RV4A 2GCGA 3F9RA 3LKZA 4Q01A 1NUHA 1NXPA 3FSJX 5A7GA 3SQWA 3Q1KA 1PEYA 1JN0A 2IXGA 1SULA 2W8BC 3BB4A 5F1PA 1C80A 1Z28A 3S27A 1GU0A 3W5VA 5JYBA 2C5AA 1NG9A 3C6BA 1LY1A 3CH6A 4I1UA 4XI9A 5B1SA 1D5WA 1NDUA 3T06B 4JXZA 5AK5A 3VRHA 1GAEO 1R74A 3DDUA 4ATNA 1M2NA 1YMVA 3QWFA 4ZKEA 3RBZA 1RXSA 5ANRB 4CUKA 2QK4A 2BBOA 1L5HB 2WG2A 2ZPAA 4MVJI 5F9MA 5EJ5A 1EFVB 4MV9A 4LE0A 4E11A 3FXAA 4Q00A 2WABA 1B14A 1UODA 2C9DA 2QTHA 2NZYA 1EVKA 2HS4A 1WAMA 3PI6A 2BUAA 4RX1A 1TKRA 3CC4F 1XMSA 3ICQB 3TLEA 2QMUA 4NEQA 3KD3A 4F72A 2UXBB 3P0JA 1YFZA 1H9CA 1NR7A 1Z0KA 2W37A 4IDFA 2UVQA 2WF9A 4U6SA 4L50A 3RAJA 1CUEA 1VDZA 3O8NA 3BF7A 2HIHA 5AK4A 1DKUA 1O89A 3CJRA 4X8MA 4F92B 1ZP6A 4HHEA 5HKAA 3KHKA 3LH5A 2B78A 5K3AA 3DLAA 3TZLA 1QG0A 2YJTD 4N76A 4LBYA 4J2TA 1SOVA 4U8HA 4UHEA 3QXSA 3TLKA 2YKGA 3M8KA 2QSZA 3NDPA 5C7YA 3Q8LA 1W4ZA 3JRNA 4CIBA 3VR1A 4EG4A 1GRVA 2WYUA 3B6IA 2FAXA 2OLEA 3QVWA 1O9GA 4DR6B 3NC4A 1YC5A 2E0IA 1GZ3A 4I2VA 2H2HA 2FJUA 3E7XA 2QBYB 2DT4A 1E59A 3H2JA 3OQOA 2EV9A 3NVDA 4J16A 1SKAA 4ZQCB 1FU8A 1U4NA 2ZYGA 3MWFA 1ULUA 1YZ3A 1NI4A 3TINA 4HX5A 5KOHA 4FGWA 3SI7A 3CCQF 1XP5A 5DP1A 2GZLA 1QUEA 1V47A 5AJYA 3UA4A 1NBMD 1GTL1 3AP1A 3SJUA 5GJCA 1Z5OA 2H63A 4FX2A 1DS6A 1SEVA 1RP7A 1UFYA 1VRVA 2XCLA 2ZYTX 3H1FA 1Y1RA 4HRAA 2VT7A 4KV7A 5EKDA 1GPUA 1K8YB 2E87A 3U0OA 2IIBA 3BF8A 2J9FA 5HF5A 1Q57A 2G25A 5EJGA 1V2GA 2BFDB 1YJAA 4ZOLF 3G8YA 4R54A 4IRMA 2NVBA 3PWSA 2YJ4A 4LGYA 4BB5A 4ETIA 2HA6A 1C1XA 1AQIA 4ZAGA 4RS3A 5F1YA 3M6VA 3TL6A 1L4FA 4BLUA 4NYMR 3HLYA 4RV5A 5JTTA 1H2YA 5ICEA 3KPYA 1QC5A 1F8GA 4UATA 5DHAA 1MHPA 2D5LA 5FBQB 2QOEA 1C3XA 3WLRA 2BGKA 4TV8F 2CFRA 2Z2JA 3JQ7B 4PBRA 4CTKA 1TUGA 2H1RA 3MTJA 4FZRA 4EL5A 1IFXA 2G4LA 5KSYA 3R2JA 2UUBB 2XLBA 4OOEA 3K0EA 2WHEA 5IXSA 3ZYCA 1Z38A 1OTYA 4GAEA 5GONF 4AG5A 2BF7A 1IBMB 3HCCA 4D4LA 4DT1B 5F23A 3D6NB 4EG3A 5L7YA 1XO1A 3OHMA 4WOJA 2NZVG 1HLFA 1ILEA 4J6FA 3RG8A 5FQOA 3W78A 4BFWA 1L4BA 4P2GA 3VO2A 1CLUA 1YU6A 2GBFA 2YNMA 4N6GA 3ENQA 5KQMA 3H2GA 2GJ4A 3IPAA 4UE2A 5K0TA 1OX4B 4D9HA 2GDZA 2PMFA 4M3NA 1YJ8A 4ECEA 5J9FA 4S35A 3EA0A 2QG6A 4HXFB 3L7BA 4MV4A 3QEMA 4P7FA 4PX9A 1KOJA 3ZGNA 2F00A 5FULA 3PWKA 1JJ7A 4DC9A 1E0KA 1EM8A 4FHZA 3RF6A 2KLHA 4EPTA 3KXPA 1NVDA 3OPVA 4F11A 3CF2A 1D07A 3SFZA 1Y42X 4ZI3A 4MKFA 3HUTA 1QX3A 2G1UA 4CF5A 1VHLA 4S24A 4M9CA 4CF6A 5KYGA 3VNVA 1HPLA 1VG1A 2K6GA 1P77A 1T5BA 2PIAA 3BREA 4YRGA 1VQMF 4DBVO 4ZKDA 1TUBB 1Z34A 5AKYA 4IPTA 4ER5A 3AHIA 2JD2A 2ZCUA 3EH1A 1HT0A 4CR7A 4J0DA 3VNQA 5EE9A 4N82A 3FSGA 3A7EA 2DWQA 1RZRD 5CDFA 3OJXA 1QH9A 1V7CA 3D2CA 4J49A 5HY0A 4MQMA 4DIDA 3I6IA 3MSXA 8ADHA 3O84A 3Q0TA 3WBKA 1DB3A 1V16B 1JN1A 1KJ9A 1IXRC 4FJ2A 4IJ6A 1BWRA 3T5CA 4EF5A 2E4YA 2GK7A 5B7GA 4CKXA 1GYQA 4KVFA 5CA0F 5CVTA 4E6EA 1A76A 5A06A 3GLHE 4HBGA 3A14A 3NBMA 5GAPK 4JMPA 1DO0A 2D74A 2IK8A 4RKQA 4AZSA 2XT0A 2XV1A 2BTOA 2YZKA 2PR7A 4R3UC 1XP8A 1T6NA 4Q9KA 3VJMA 3RVMA 1EQ2A 1YFKA 4NU6A 1Q0ZA 3IE1A 3R0XA 4G1VA 4ZQFA 3BIFA 2CHGA 4F5ZA 2GJAA 2DRIA 2Q41A 1RE0A 2V0GA 1BWSA 5C34B 2HN9A 2XT6A 2QW1A 2UUCB 5JVDB 4EMTA 3PYXA 4LCBA 3WJAA 1RIFA 2PSHA 3OETA 3N0TA 1GL9B 1P1CA 3SKXA 3SJBA 3GZNA 2JJ2A 2ZIVB 3O94A 3TRJA 4MUEA 4L73A 4OMUA 1O03A 1YQXA 2FN4A 4HAVA 1T5HX 3QEAZ 3JQRA 2VQFB 2WB4A 1XWIA 2HUNA 2VPYA 3L3BA 2DJ5A 1CVRA 5DLYA 3R9WA 3OLVA 4A27A 4YP0A 5ALRA 3RYFA 2P9TA 1FNNA 1N2BA 2IHKA 1JB9A 2Z8XA 3PPYA 4GOXA 5BQ3A 4PQGA 1G4UR 4BEVA 3ZZ0A 4ENWA 1GUFA 4PLGA 3WAKA 1W2GA 4DNXA 3HUFA 5JPIA 3K0FB 2AEEA 5CURA 2ZTHA 3FNGA 5EZQA 3PC4A 4PZAA 4MA0A 1I7PA 4L3VA 3UKJA 3I9V1 4B82A 3HUDA 1U8FO 1YJNF 4DMKA 3W1WA 2R4TA 2BE7A 3N5CA 2P5YA 4L8FA 2FLWA 4OB7A 3LL7A 4OY3A 4AYTA 4CODB 3J7AC 3WX0A 2O8DA 4BT2A 4JVMA 1M7BA 2COEA 4YRQA 2EJCA 1VKHA 1KYXA 3TW8A 3ZDBA 4GPZA 5DEOA 1C1DA 1OU4A 4PRLA 5J1TB 4JMLA 4H7HA 4CKBB 1IY1A 2P6UA 2CNWA 1PZGA 3F6SA 4FC7A 4P4NA 2B4TO 2W2LD 1YITF 1GZHB 1XRPA 3ST7A 1Z6PA 4B79A 3SKVA 3AVWA 4UEQA 4LECA 1QZ3A 2MYNA 2DAPA 2ODPA 1NNLA 2EP8A 4S0ZA 5I7FA 3DTVA 4HDMA 1QHSA 1QGUA 5H82A 2Z57A 1J07A 5ALEA 5ED0A 4F9TA 5AW6A 1I7QB 2Z1EA 1EDBA 2QD4A 4Q93A 5TDHA 3LTNC 5IH7A 2Q5EA 1YQWA 3KVYA 2WVHA 4MNTA 3E9MA 1MTZA 4C0LA 5IABA 2C58A 2YJ3A 2GAIA 4ACBA 5CDUA 1K9VF 3L9XA 5KMGB 3DAGA 3O47A 2J6HA 4FYXA 1WY7A 4KIUA 3IQHX 1YBMA 4O2BB 5FJJA 4A0RA 3ABRB 3SFVA 3AIMA 2LD4A 2C99A 4OUKX 4PWTA 1G5TA 1I6LA 4HB3A 3MJDA 5TGDA 1TZKA 4ZYZA 1NVVQ 2I3GA 3G0GA 4FE3A 2H1SA 3GFOA 3JQQA 1DC5A 4PZ0A 4D1YA 1Q0UA 2AJ8A 2BIFA 1PUIA 1JEDA 3DEZA 4L76A 2O2YA 5GM1A 3VPSA 4BNMA 3OG9A 1VK3A 1AXGA 3ORSA 1G2OA 3G71F 1XVUA 4IXTA 2G88A 2FDXA 4LQLA 4MUGA 4Q9DA 3OLXA 4YV7A 2WIBA 4W5JA 3L8FA 4KTVE 2YZ2A 1CRWG 1A1SA 1KZ1A 4B43A 1FMCA 1E2FA 3HG7A 3SZUA 5B4VA 1SKMA 1IDOA 4C82A 1JQ5A 1MIOA 1MOPA 1P4JA 1THTA 2ID4A 2R97A 3BIJA 3D6HA 4WCFC 5AKXA 3SYKA 4YJ3B 1YKGA 3U40A 3VPHA 1JBKA 4HF7A 4F9GA 3OX2A 5IJAA 1IPEA 2YYSA 3W9BA 5AVXA 2PMWB 3O4IA 2PJZA 2BFEB 2Z8ZA 2XB6A 2ZJAA 2WU4A 1VLLA 2QUKA 3HC7A 4J0GA 3RFCA 4MHTA 1BIFA 3G2NA 2BKUA 3QPDA 3CEPB 3PE3A 2PNJA 1B6TA 3QBJA 2RHJA 4ZVTA 2PVCA 5LQSA 4FN4A 5KOIA 3O74A 1S89A 3ZVKA 3N4YA 1VE5A 2WD7B 2ZVJA 3E0QA 2TMDA 4FB4A 3A1UA 3CXUA 4PZLA 3V1NA 1KYWA 4HAOA 3U44A 3ZP7A