4DXFA

Crystal structure of staphylococcal superantigen-like protein 4
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
194
structure length
194
Chain Sequence
b'EINPKFKDLRAYYTKPSLEFKNEIGIILKKWTTIRFMNVVPDYFIYKIALVGKDDKKYGEGVHRNVDVFVVLEENNYNLEKYSVGGITKSNSKKVDHKAGVRITKEDNKGTISHDVSEFKITKEQISLKELDFKLRKQLIEKNNLYGNVGSGKIVIKMKNGGKYTFELHKKLQENRMADVIDGTNIDNIEVNIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Staphylococcal enterotoxin-like toxin
publication title Structural and functional properties of staphylococcal superantigen-like protein 4
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Sugar binding protein
total genus 52
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4dxfA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4dxfA01
1SE3A 3BZDB 1PTOH 4DXFA 2AQ1B 4BWGB 1JCKB 1PTOD 5D3IB 3BVMA 1PRTD 1G8ZD 1AN8A 1LTAD 1SXTA 5TSSA 1ET9A 3OWEB 1CHPD 1SEBD 4NZLB 1EEID 1F77A 1S5CD 4ZYSA 1JWMD 1SJED 1PTOC 1B44D 1PZJD 1EU4A 4RFBA 1LTGD 1PRTC 2NTTA 1HTLD 1RDPD 1SJHD 3MC0B 3TSSA 4RHSA 4RHRA 1LT6D 2R61A 1DYQA 1LTRD 1KTKA 1KLGD 1JWSD 1CK1A 4RH6A 1BCPD 1EU3A 4Z9CB 1TY2A 5I4DA 1HXYD 1MD2D 3R8BA 1GOZA 1S5ED 1LTSD 1TS2A 1BXTA 1SBBB 1TS5A 2TSSA 1ET6A 2CHBD 2O2LD 4O1NA 1PZKD 5ELCA 1BCPC 3GP7A 2AQ2B 4TSSA 5ELDA 1T5XD 2ICIA 1I4QA 1SE4A 3KLSX 4OHJA 1SE2A 2WV6D 1TY0A 5D3DA 2NTSA 1D5XC 1DJRD 3SEBA 4C56C 1CHQD 1LTID 2J4XA 1CT1D 3O13A 3DWQA 2SEBD 1JWUD 1AW7A 1D5MC 3EFXD 3R2TA 1RD9D 4RGMA 4RGOS 2AQ3B 1L0YB 1LT3D 3URYA 1LLRD 3BYTB 5FKAC 3CHBD 1CQVA 2XRQD 1L0XB 4K6LA 2G9HD 1QILA 1FNVA 1HQRD 1LT4D 1STEA 2Z8LA 1YN5A 1B1ZA 2IJ0A 1M4VA 3MFGA 1LT5D 1FGBD 1FNUA 1PTOF 3BYYB 4UDUC 1PRTF 2QILA 4RGTA 1TS3A 1V1PA 5ELBA 1D5ZC 2XN9C 4L63B 1V1PB 1RCVD 3DWPA 1TS4A 1UNSA 1XXGA 4RCOA 1PZID 1HA5A 2QEJC 1UUPA 1EFID 1LTBD 4L6TB 1I4PA 1PTOB 1D6EC 1PRTB 1JR0D 1ESFA 3W2DA 3BVZA 1EEFD 1I4XA 1LTTD 1YN4A 1XTCD 1FD7D 1BCPF 1FNWA 5ELFA 1JQYD 1ENFA 1V1OA 3V05A 1I4RA 3EA6A 3BVGA 1S5DD 1I4GA 1LO5D 4RGNA 2XRSD 1PYWD 3R2IA 1RF2D 3DWAA 4DXGA 5FK9C 2IPKD 1YN3A 1S5BD 1BCPB 2RDHA 1EWCA 1KLUD 2RDGA 1S5FD 1I4HA 5ELEA 2XNAC
chains in the Genus database with same CATH superfamily
3KVFB 1SE3A 4IUMB 4MN3A 1WJNA 2ACZB 3GTOH 1PTOD 1WJ4A 2PE6B 3AE7B 1UEBA 1QZEA 2KWCA 4XGAB 5EBDA 5LMNW 2O5JC 2V9HA 1FJGQ 4A6QA 3A5UA 3GTKB 1HNWQ 3DM3A 4GMVA 3NK9A 4M0WB 2E5LL 5FO8B 4IOCA 1QOHA 4DR5Q 3BK1A 2HT1A 4DV2L 1VQFA 3PHWB 3L2PA 1BF4A 2BB6A 3QCAA 2LGDA 4LDTD 2NVQB 3PUZA 4A3FG 3FAHA 1LT6D 1M90C 1QT9A 2EOTA 3M4QA 3P4QB 2YYZA 1PFSA 1PH1A 2Y5PA 4Z9CB 3K5MA 5LL6S 3FKIH 4BBSB 5KYIA 2JWUA 4GN3B 1VQPA 3ZXRA 1QCBD 1Q3LA 5IOIA 3R7RA 1N32L 3UIPB 1JOKA 3OG5A 2CWAA 2CHWA 3UF8A 2EYLA 4CKCA 1RRBA 1YJJA 1CQFA 3ZO5B 3AU7A 3DBHB 4ZDVA 2K5VA 4HMJA 3D0FA 2KT7A 5BYSA 2KN5A 4MGKE 3AE5B 1NE3A 1XX8A 5JVG3 5D3DA 3VYSA 1PA6A 3QOJA 3M3JA 2IO1B 4MH8A 1XWEA 1TKEA 1I94L 4KIKB 4N6EB 3E9SA 2AYOB 1IW7D 1LFDA 4LF9Q 5AUKA 3CQZB 4MM3B 1P9DU 1HZCA 3EUB2 3BYTB 1Q1BA 2MCNB 4WJNA 1L0XB 1TKWB 3DEOA 5FO9B 3PF5A 4DAVA 4B0EA 2Z8LA 5C0XJ 1P7EA 1EY8A 4EZJA 2MNAA 1MKHA 1VQJA 1JT8A 1V2YA 4RMFA 2M0AA 3Q69A 2I2YA 2G9DA 1Z47A 2A6ED 2MRPA 4DR2L 2MHJA 1PRTF 4IPGA 4RGTA 1EUVB 1HCZA 2BH8A 2K1BA 4YCUA 2ZW1A 3Q8CA 1V1PB 1GUTA 2EJGC 1J5EQ 1Y69U 3CCQA 4C00A 2K1FA 3FDTA 4BBRG 4MGZE 5AZHA 1FIQA 4NQLB 1C48A 3K8AA 4LFBL 4QCLA 1K8AC 3ZJTA 2L0CA 2QEJC 4HEDA 3MHSD 4M8NA 1GAQB 2PEAA 3I4NH 1DXMA 5IWAQ 1PTOB 1NUCA 2E2JB 4K0KL 3HKZE 1SNPA 3KFUA 1B9NA 4ILWA 4A3KG 1LTTD 4BBNC 1GUOA 4DK0A 4X66Q 1FNWA 3S1NB 4ZRJA 1HJPA 3U2SC 3KJOA 3R3MA 2F0QA 4AYBB 2F0NA 1FFVA 1CZPA 1K8GA 4II2B 1EYGA 5EPKA 3TS0A 3J81i 4CKBA 4HIMA 4LNIA 5CHWA 4YSZB 4ID6A 1PFDA 3Q8EA 5M5YB 5BMIA 2F0DA 2XRSD 3VVWB 3QIJA 4ULLA 3TJPA 2NB0A 1UGMA 1NI3A 1HTQA 1Y8OB 3H0GG 4KKIA 2VW9A 4KD4A 3H91A 4ANXA 1JQ4A 1NTGA 4BY1G 2PO4A 2MHVA 5HY6A 4LF5L 4IJHA 4GOPC 3EROA 1VJKA 1X6OA 1I6HH 3JAMc 4BWGB 5AUIA 2JA8H 2PE9A 3T4AC 5C3WA 5JEAJ 4NB3A 2F4VL 5NUCA 3U52E 1TQOA 4HTHA 2JEAI 3CMMB 4CDEC 4DPGA 4RM8A 2VQFL 4USAA 3N6RA 3CCSA 1OXTA 2WXMA 3UINB 1SN8A 1WYGA 5C3JB 1WX9A 3B1LX 2Y5CA 5I9PA 5KGUA 4A9AA 2D2QA 4QQBX 1C77A 2MA9B 2N49A 1NSNS 3TMEA 1W2BA 2R92G 4CJ2C 4IC7B 1N33L 1HUMA 4K6DA 1V8CA 3A8JE 1BUIC 2Q8IB 2MBHA 5K36H 1YX5B 2DLBA 3A5ZB 3IG3A 1R4PB 4HJ5A 4V0BA 3T1HQ 2JA6G 4OZCA 4ZRKA 5I9OA 5HG2A 1A3VA 4DV4L 2K75A 1JWSD 2IX0A 3NEMA 3OIQA 2LVPA 4KK7A 3B2GA 1CKMA 1EYCA 1MD2D 1MGSA 3QIAA 1A6XA 3NG0A 1WOCA 2F1MA 1XMOQ 2L83A 1W3SA 2Q2TA 1E8XA 2DZJA 1PDQA 1SBBB 4B3TL 3RULA 3VR3A 3D31A 4PZ8A 2MWSB 3MHBA 3GTGB 4X3SA 4IWOA 2DYMA 1EUJA 2LGSA 4XYCA 3RFZB 1KF6B 3Q24A 5DEHA 3S2DB 1X9NA 3S1MH 1F52A 2G45B 1WCMB 3KLSX 1CKOA 4JOIC 1EF1A 4KN7C 2B2WC 1DJRD 2I5HA 3SEBA 2FUHB 3QJZA 4CKEA 3VDZA 5L83A 2WAQB 2J4XA 1XF5L 4A3IB 1L4DB 3ZUNA 1JWUD 1X3EA 2MP1A 1HZBA 4ZUJA 3L13A 4CGYB 1Z9FA 1Y1WB 3T16A 5L37A 3BZCA 4Y7NH 2XVSA 2L4NA 2XRQD 4RKBA 1EQVA 4DAYA 1L5PA 3U4VA 4PMWA 2WDQB 3NVZA 4EZLA 2E5LQ 4GXBA 1K73C 2MX2A 3TMPB 3Q0AA 1JE5A 1FGBD 2QEXA 4JVZA 4DV2Q 4OWWB 4UAIA 1T0SC 4K3CA 1MG4A 4N8FA 3P4RB 2X6GA 2VB3X 4DA2A 3QQ8B 4NY0A 3LYYA 2AWTA 4WH4A 3RZDB 1DONA 2DN8A 1QZHA 5D65A 1UE7A 2A8VA 2L1AA 2UWQA 5AZGA 2EJMA 3DEPA 3VA7A 2ZNVC 4R4CA 4FF4A 2Q2HA 5IGEA 3NTKA 2L0TA 2LHDA 1XMQL 3L0OA 2LGIA 1TWCH 3FPPA 1N32Q 5DPRA 4KDIC 4DV1L 2K05A 1H95A 4G0NB 4DHJD 3PCOB 1C79A 1P98A 2HTHA 1VQMA 3MC8A 4LNKA 3WA0A 1Q86C 2BS3B 4WAFA 5FLXc 1BCPF 1VQNA 3VH3B 3MXNA 4HPPA 1HRJA 2SNMA 4C3IH 1DOYA 4C3JH 3M4PA 1PVOA 1STAA 2DZKA 4GB9A 4J3OD 3BVGA 3K80C 3I57A 3ZNID 3RN2A 3DHIC 2J0TD 4JI2L 1PYWD 2CFMA 1I94Q 3G48A 1LGRA 2KO3A 2YU9B 2L52A 4G7OC 5H8YE 4NJCA 4I7ZC 5CV4A 5E6OA 1CJEA 3HOUG 3OTOL 4IM0A 1H9SA 1PYSB 3D4DA 2JQRB 1AEXA 5EE9A 3MEHA 2EZVA 4CJ0B 3JSVA 3M4OB 4FHJA 3SD5A 1ASYA 3I63C 4I6NB 1Q46A 3ULPA 2JYTA 2K28A 2HJ1A 3I8ZA 4LNFA 1AE2A 1PRTD 3GV3A 1E0ZA 2GMIC 2ZXRA 4DV5L 1G8ZD 4A3OA 4QF4A 2AWOA 1SYGA 4DR2Q 2NS5A 3I4MH 2JN4A 1Y14B 1ET9A 1Q8KA 3PO3G 2UXCL 3CWIA 1MBYA 4CDFC 3J80i 2WXNA 5E6PA 2E2HB 1F77A 2DJFC 4A3CG 5HKHA 4LFBQ 3HM3A 3P63A 4OVVA 2LVOA 2DJGC 4LF4L 2WXFA 4ZYNA 3WANA 2ZPYA 1LQBA 5J1ZA 1K52A 1LTRD 2KVRA 1G291 4K0KQ 3V61A 2RVLA 3T56B 1JWAD 3DMUA 4O2DA 2PZTA 4H7BA 4A3JB 2EVBA 2F3IA 2BYEA 2BE5C 1AYFA 3BDCA 3W5UB 1GJXA 4Q2JA 1BXTA 3PIP3 1E2ZA 4DAYB 1WD1A 4ME3A 1LXDA 2O6VD 1OO9B 1U4LA 2KHIA 2MJDA 4FLHA 1YI2A 3DXJC 5GXGB 3PSIA 3B0AA 1B3QA 2DNEA 3CCLA 1PH6A 1X56A 2R7FA 3CF5A 3F8TA 3GTQB 3GQBA 1N62A 2GBKA 2M4NA 3FKIG 1V5OA 3I3TB 4LF5Q 2K14A 4N59A 1EOTA 2EMSA 3W1SA 1D5MC 1WTOA 2KHSA 2F4VQ 5GROA 4B9WA 2EIFA 2JA8B 3QK0A 2F0UA 2FIDA 2VQFQ 1E9MA 3M62B 1HZAA 3M3YH 4DN4M 1VQAA 4K3BA 3V62A 1UGJA 1FNVA 1QVCA 1XNQL 4K8JA 4B3RL 3EFUA 1M4VA 3MXNB 1YIWA 3MFGA 1N33Q 4JE3B 4IN3A 4GLXA 4AOFA 3CCJA 5EE1A 1J19A 3CU7A 5ELBA 2QF7A 5FLMH 2M19A 5DM73 1SR3A 2PI2E 4KJOA 1VQHA 4PYZA 4DV4Q 2JA5B 3RCZA 2R2OA 4LNNA 4QUCA 3HKSA 3CC2A 3PF4A 4A3GB 2EY2A 2CW0D 1CI3M 1H9SB 1DD2A 3J7YW 1SE9A 3JSVB 5I6WA 4A3BB 1KFYB 1N8RC 4HCPB 4HIOA 2JT4B 3IHPC 3U4ZA 5A2QE 1NYQA 3PUWA 4NAWA 4B3TQ 5BYRA 5IA7A 1PRTB 3T9LA 2GI9A 5C44H 1EEFD 1PGAA 1EY5A 5C5MA 1YN4A 1XEEA 2IX1A 2JSOA 3IFWB 3ONSA 5IYCH 3VRBB 4GLSC 1HR0L 4DR4L 4MZ9A 3AE6B 3PSEB 4D2KA 3FP9A 3HS0C 2LEKA 4B9KA 3H3VC 2KWUB 3PPAA 1HEZE 4BKSD 1V80A 3T8MA 4ZRPA 2D3BA 4L5TA 5D7GA 4I6PA 1LV9A 3VYRA 2EKEC 4FHKA 3D3RA 3I4NG 1R4MB 3J81E 1M94A 4JYAL 3HOVG 1OXXK 4US8A 5J2RA 2K33A 2LXCA 2X6LA 4C3HH 2HHHL 3C2PA 5CHVC 4P72A 5C4ZA 4Y7NB 3AEDB 2FUG1 4JLCA 4HJ8A 2ZXPA 3JVZX 2X38A 2AUKA 2E74C 2EPBA 3HHMA 1UWMA 3DBHI 4BVUC 1OXUA 4YL8A 4B3ML 4A3EG 2DZMA 2W82A 4KLKA 4J6HA 3SK4A 3HOWH 2VQEL 3NHEB 1CHPD 4CYEA 4ZYSA 4OIKA 3P7JA 2BS2B 2F0MA 4RFBA 5JPMC 2DWQA 2O4XA 4XDCA 3QOLA 3ZVVA 1HTLD 2PPBC 1SJHD 1EF5A 1XMQQ 3PIO3 3A1QA 2YEPB 3HZXA 4DV1Q 3ZQ4A 4KZ0A 1BCPD 3K7UC 5EPLA 1WGGA 3VDYA 1X3PA 4DAPA 1LTSD 1TS2A 4ACFA 2FCSA 4JG2A 4DV7L 5J17A 2KDMA 1TS5A 1IL2A 3NVWA 2OT2A 3Q8DA 4C3IB 1Q81C 2J0JA 4H44C 2QMTA 2CJOA 1PZKD 2VH2A 3RNGC 1XLQA 5LXIB 5ELDA 4JI2Q 1T5XD 1I6VC 3J7AF 5K36G 1WXAA 3M95A 1OQRA 2KUMA 1PMRA 1TWHH 2IGDA 1Z6HA 2F4IA 3OTOQ 3MVVA 2UXDL 2BWFA 1FCCC 1N5XA 2KMAA 5L95C 3S14H 3PO0A 2WXQA 4ZRIA 3W1YA 1B9MA 2GA4B 1SGHA 3KK7A 3R2TA 2NR2A 1PH9A 4DUYL 3DVGY 4ODGA 2NMQA 1G6PA 4DV5Q 2F0FA 1FRRA 4NAWB 4IUQA 1HFNA 4C7ZA 4AUQC 1E7ZA 4KSLC 4BAXA 3HOXB 3JAML 2KJRA 2UXCQ 4PS7A 3I4MB 3ZIMA 2WXLA 1B1ZA 3IAM1 4LFCQ 4ICUA 1MI2A 2E75C 2K5QA 5HGTA 4LF4Q 1ZKHA 1FXIA 3NBIA 2K6QA 5E6JA 3U7ZA 4WQMA 1J6QA 5C3EH 2WNMA 3C1FA 1RJTA 2M0XA 1SNQA 1F2ZA 3P42A 4XWWA 5CORA 1MJEA 4MDKE 1TKGA 2D07B 2E6XA 1NNXA 4KHPL 1QE6A 2EELA 2PQEA 2A69D 3GTPH 3R93A 3TUOA 3IAYA 1WJUA 1ESFA 3ZXVA 3HOZG 1VQEA 3QG1A 2JZ3B 4WWMA 2RQXA 3X0WA 1QOAA 1LM0A 4OONA 3LX0A 1PH2A 1SAPA 3KLWA 2N1VA 3UQAA 1Q8IA 4XTCS 3EA6A 3F2BA 3VTVA 4A20A 2FMMA 2A68C 3ZKJC 1NMFA 3GO5A 3Q22A 4JWUC 1XPOA 1WXMA 1SMYC 1K83B 4J1MA 2KBNA 4DXGA 2D5GA 4EOYA 4A4IA 4DWFA 5GAGC 3A1QB 3LJ3A 1C4CA 1BCPB 3KWLA 3WWVA 3I73A 2VUMB 3HOYB 3HFZB 3NTHA 2RDGA 3L7ZC 2H88B 2JSVX 1WXSA 1SDFA 1WTVA 4AQ7A 2LS01 1VS0A 3CD6A 2JRHA 5CX3A 4BKTA 4IPDA 1P16A 3C46A 1XNQQ 2F03A 4B3RQ 3DBSA 1ZKOA 4MACA 1HE8A 1A8VA 4C3JG 4HJKA 4KGSA 4MEMA 2PMVA 1B53A 4P2CB 4HIKA 2WP8J 1SSOA 1ZDXA 1YIJA 3PV0A 1F2RC 1CM9A 5IT9E 4MTNA 2K5NA 2F52A 2CH4A 4X64L 3TP7A 3AULA 3DWGC 2ZEQA 1PTOC 4G11A 2MPMA 3HP3A 2C5LC 1D4BA 1TWGH 3D8GA 3J80E 1ZDVA 2HIVA 2OEDA 5IOCA 3ICEA 3DLLA 3V60A 3W5VB 2R61A 1DYQA 2I46A 1WSPA 1I50B 1VLBA 4DHZE 4YTNB 2IBIB 1VQ7A 3HK0A 4NXMQ 3RZFA 5IGGA 4YSXB 4JI5L 2MW5A 4XIGS 3U9OA 3RMKC 1GNUA 1S5ED 1HR0Q 4DR4Q 3H7SA 1L0VB 2R93B 3NJTA 3PGEA 3TEWA 2L12A 1HA6A 5BYQA 2CHBD 5EGTA 3F1ZA 1UAPA 2B8FA 5FLXL 1SYCA 4OWXB 4A93H 3HUIA 1XLNA 4ICVA 2KJ6A 2RPQA 3C1EA 3CAMA 4DR3L 1K53A 3W1BA 2W54A 1IYUA 4JYAQ 1D5XC 3IL8A 1CHQD 3VQIA 2HHHQ 3RN9C 3J7ZC 4GGQA 2K8CA 2BKRB 3NY5A 1GHJA 3TIXA 4C80A 4IDIA 2JVCA 1IBML 2PPHA 1WX7A 2WLBA 2KLGA 4KTAA 4GNXA 2ALYB 2AQ3B 2HCIA 3D4WA 3S24A 3BS1A 3GTMB 3URYA 3GDEA 1ZXHA 4B3MQ 3IVFA 3TEYA 4WJWA 2LFIA 4C7YA 5C4JB 2EMTA 2G1EA 2A19A 3ZTCA 3CC4A 2VQEQ 1UWVA 4YWMA 1VQ6A 4S3SA 4O0AA 2HUGA 3GZNI 3KBXA 4C2MB 2XN9C 3AE2B 1G6JA 4AJYB 3A4RA 4UP9A 1TS4A 4FXDA 5K5PA 3NZUA 1YJIA 4CBVA 1PQSA 2DY7A 3MZ5A 2WXOA 1TWAB 3K0XA 2A5UA 4IURA 3NVVA 4A3FB 1LTBD 2CQOA 4L6TB 2DX5B 4DV7Q 3I56A 1E5WA 2FCNA 2Q2UA 1RAXA 4HCNB 3M85A 4HWIB 1W6KA 3OOCA 3NS8A 3FVQA 4DQOC 1GVPA 1QG7A 1EL0A 1NMGA 3Q8FA 4W9IA 2JK8A 1V6EA 3NTIA 1WYWB 4UHVA 4K5WA 2UXDQ 1RWSA 5C23A 1KNAA 2P5ZX 2ONQA 4H02A 4BZAA 3JYUA 3PLUA 5M5WH 3Q3MC 1ZUD2 1B7YB 4R8NA 2BWES 1XCQL 3LDZE 4LJPB 1RF2D 4A3MH 1SYBA 5HFYA 1UEAB 3AE9B 1YNJD 1ZGUB 5C4XH 4DUYQ 4A3LH 2KMCA 3ERQA 3PMFA 2UU7A 5ELNA 4KKJA 1SLJA 5KNDA 1GUGA 5C44G 3IAS1 1S5FD 1YOVB 2OHFA 3I91A 4F87A 4EUTA 4RCNA 3RNEC 3BZDB 3KJPA 1Q7YC 1E8WA 3H15A 5C2TB 5E3FA 1SIJA 2KK8A 4RAUC 1VQ8A 2DAJA 4XZ4A 1PFMA 3NENA 2F0KA 3SR1A 1MVKA 2IZVB 2WWZA 3PRZA 4KX6B 2JQOA 2KCNA 4XYQA 2EYHA 2JY6A 2XSCA 2NVTB 2DBYA 2JE6I 1NCVA 3NQTA 1B2TA 4QIWB 2VZAA 1EM7A 4X65L 2K6DB 2W3SA 1E0BA 1VDZA 1R9TB 1B8AA 3DVNU 3P4SB 3X23A 1LTGD 3NHHA 1RLFA 4BOSC 1FYCA 3HGBA 4C3HG 2FCMA 2DGYA 4RG1A 1CSPA 4RHRA 3PGZA 4Q0FA 2EY6A 4KHPQ 3IXSA 5JHAA 2F0HA 2XGTA 2EY1A 3E6ZX 4RH6A 4BBRB 2MBOA 3WIMA 4KY7A 4X3KA 2KHWB 3GE3C 4GNXB 5FJ8H 5KIXA 1SB3C 2Q5WD 2AMCB 3R8BA 1D3ZA 2N55A 3KOJA 2IGGA 2LJIA 2EYPA 1GHKA 3HOWG 3L08A 2INNE 4KKSA 3AU4A 2UXBL 3QC8B 3UDFA 4CDCC 2NPTA 4HDQA 5DLQE 4EVOA 1NI2A 2KDBA 3QAQA 2DENB 1P7FA 4O1NA 2R7ZH 1KABA 4A3KB 5HURA 3DBRB 4FA6A 2F0JA 3KYCD 3CRKC 1N9WA 3I3CA 3CPWA 3V6EB 5JJKA 3T51B 1JORA 1STYA 4QMGA 2K03A 3C19A 5JPNC 3I55A 2I5MX 2B63H 1QOFA 4HCSA 3K5NA 2KQSA 1WZ3A 2N7EA 2V1YA 3PZ7A 4MELA 1YNND 3OWFA 3OPOA 2Z0SA 1SIFA 2K04A 2K22A 4NNJB 2RPVA 2KECA 3H0GB 3K81C 3Q3JA 3HKZG 5CGKA 4W9JA 3CHBD 1T9HA 5A35A 3DHQA 4BY1B 4K6LA 2XWBB 4TUUA 4X64Q 1BMLC 2DZIA 1F9RA 2J42A 3A7LA 3S1QB 1G91A 1YD8U 3PHXB 2L32A 3TBLD 3SFDB 3A4SC 3KW5B 4L5SA 3FILA 1BQQT 1D5ZC 4RCOA 5IYBH 4EQPA 2R92B 1E6EB 3AEAB 3L10B 3P2BA 4HJGE 2ENBA 1GO3E 1EQRA 4JI5Q 2BW2A 1V86A 2IO0B 4PZ6A 2H4OA 2FIFA 2V3NA 4IG7B 4K7UA 2JA6B 4MSMB 2HQLA 5IODA 3VXWA 4WAAA 5IN7A 2L9HA 1JR0D 3CCEA 3ECIA 2DNCA 3R7QA 3BVZA 1AE3A 3RYTA 2JA7H 1XQQA 3CSFA 1ILPA 5CYUA 4RA8A 4DR3Q 4HAEA 3ZW3A 1KNEA 3QJYA 1EZ6A 5C3EG 1ENFA 3PT2B 1MHWC 1O78A 2KFKA 2RDBC 2AEHA 1QVGA 4XYOA 4HROA 2NN6I 4KV6A 2HIXA 1EQQA 4RGNA 2NVXB 4OO1I 1ENAA 4HR7B 2CHXA 1GXDC 2Y0SE 1IBMQ 2IPKD 3S16B 1YN3A 3IT6B 3EFCA 1S5BD 2F0GA 1HUNA 1ILQA 4R1JA 3N1XC 4J15A 4M1UB 4LF6L 5ISRA 2WINB 3PO2H 3TREA 3MP9A 1A3UA 2K32A 2XNAC 3N52A 3K58A 1N60A 4G7HC 3KWVA 2AQ1B 3HOVH 3DM1A 2NPTB 4PMBA 2D9UA 4HK2A 2EYJA 3CW2C 4KD3A 4EFOA 4DGZA 2KCTA 4DR6L 1JROA 2BVCA 2GOWA 2BPSA 2RCFA 2ZTEA 1FD6A 4JWSC 2LXKA 5CV9A 1DOXA 1JWMD 4A3EH 5IGDA 2UUCL 4YHHL 1PRTC 2A1AA 1X55A 2AKWB 4LDTB 1GUNA 4PMCA 3L17A 1J7CA 3SU8X 2UU9L 4BS9A 2VNUD 1EQTA 1L1OA 2D5DA 4HJ9A 5C0XI 3U30A 1V8QA 2KEEA 1YHQA 1EIFA 1L7YA 3DBLB 1W6JA 3OLMD 2NUCA 3I4LA 4YXDB 3IFTA 4LTUA 4FXKC 4RKLA 2PMZB 2G3QB 1FL0A 1HPCA 3PUVA 3A9JA 1JC7A 3NVYA 4C1NI 4JI0L 4QAYA 3M7NA 1F2MA 2B2VA 4IJLA 1L0WA 1VQGA 1KDBA 2KACA 2Z0EB 2E2IB 3MEFA 2PW9A 4XDDA 2QA4A 1UZXB 2QW7A 3EHVA 3FILB 4OHJA 3K5LA 2KKCA 2F0PA 3NSWA 3J81c 4X57B 2NZHA 3NRZA 1K28A 4QGUA 3G6EA 2OQKA 5C4XB 5CV6A 4IFDH 1CT1D 2JZZA 3RNBC 2A74C 2VB2X 3O13A 1OEYA 3ZNZB 1H9RA 1ASZA 3BZKA 3GTLH 3HOUB 4WQOB 5DNFA 1WX8A 2NBWB 1LLRD 2KANA 4KY5A 4HJ7A 2LZ6A 4P1BC 1WFQA 4A93G 3WAOA 2FCQA 3OMCA 4HLEA 1OGWA 2R2QA 2V1CC 2IJ0A 4X65Q 2Z6BA 3QWZB 3W1SC 2K5WA 3SGIA 1A0IA 1CSQA 3E56A 1IYVA 5IP7H 2Y3AA 1V1QA 1DGJA 3DVGX 1N61A 3PO3B 2ZCBA 1YBYA 3MA2B 4HSPA 1JOQA 3PRPB 1XXGA 5IE8A 3KQ4A 2N8NA 1WM3A 2K39A 5DPTA 2WFWA 1IBXA 4FF2A 3OSOA 3A7AB 5M5XH 2WXKA 4KGRA 3ML8A 2UXBQ 3E5SA 1A2TA 2BYFA 1HZ5A 1SROA 3GTOB 3RUZA 4B08A 2K0PA 4ZLTF 3Q2AC 3RUIB 3ZTDA 2CW0C 2FFKB 2WXHA 3Q6BA 5HI1A 2NVUI 3ZJYC 2JP1A 4FXGC 1P3QU 2V4IB 4FN2A 3HOZH 4FDBA 4K5XA 1ESRA 2DAFA 3EVQA 3B08A 1UF0A 3DQVA 1PFNA 2QSDA 1A15A 2PJHA 5D94A 4MIUA 1BKBA 3H7PA 4ANVA 3X3NA 3UI2A 1XJVA 2GBNA 1L1OB 3FKIB 3KBGA 1V5TA 1WGHA 3K59A 2Z1CA 2K7VA 1T0YA 2F3VA 3A8KE 2WYQA 4A76A 4MNOA 4CJ1B 4GKKL 1E90A 4PS8A 3F2UA 3CF6E 2GRIA 4OVUA 1E2WA 2L76A 3A9JB 2KJHB 3AB5A 3CXCA 3RMHA 3AV8A 3TBIB 3N9YC 1STBA 5LXHA 1KRSA 1YHBA 4A3MG 1SEBD 2CU1A 4OX9L 4P16A 3QR8A 5C4XG 2KTFA 4A3LG 2W3RA 4J6IA 1K3BC 2PNRC 2IO2B 3WALA 3L3OC 3C8YA 1F9SA 2NN6H 1JMLA 1KTKA 4OO1H 4F7XA 3TS2A 1CK1A 2BA0A 2OCEA 3ERSX 1R4NI 1WXVA 5I4DA 3S15H 4W9HA 4WIPA 4L5RC 4REZA 1HXYD 1F1HA 2KD0A 3ML9A 2EJFC 4MT5A 3VYTA 4PZ7A 5KEEA 3MAQA 3K7AH 1C3TA 1BCPC 2ZJQA 3F2CA 4ZAIA 1KM7A 2WXPA 2AQ2B 4E6IA 5LHY1 3VUXA 3SK6A 2K5DA 1Y1VH 1KL9A 4JX1C 4YTPB 4DK6C 1IPGA 2J0MA 3H3VI 5JH5C 1TT2A 1RYJA 2LXAA 2R6GA 4LF6Q 4DDID 2LWPA 1S4ZA 5FJ8G 3RLFA 1GUAB 1RFAA 3P1HA 3I4NB 1DOIA 1H9KA 3EFXD 1IBXB 1DCZA 2IGHA 1TIFA 3HOVB 4TV3A 3V96A 3VTUA 3VR6A 4GU2A 1CA6A 2R7ZG 4A3DH 4DR6Q 4DK3C 3EQLC 4AYBE 2C9WB 2O6VA 4NKLA 2G9HD 5C0XH 4X6AH 5TR5A 4DBGA 2GB1A 1V97A 3A9KA 1OQYA 1RIPA 2WXJA 1H8CA 2UUCQ 2A6HC 1LT5D 1WJJA 1FNUA 4YIJA 4YHHQ 4A3EB 2C60A 3DCGA 2B63G 1JJGA 4B95A 2JJQA 4QUFA 4OXPA 3J80c 5IGBA 4L63B 4K7SA 1KJTA 1UNSA 3RZOH 1IZ6A 4XWTA 2UU9Q 1EY6A 3L9AX 2PTLA 4JW0A 3AU5A 3H7PB 2WKCA 4K14A 5DCNA 1C9OA 3CCMA 4HXDA 4DV0L 2MJ3A 1I4PA 4DHJB 1I6HB 1X3GA 3W1GA 4DK1A 4ZCKA 1SNMA 4JI0Q 3NE5B 2O2VA 4TQ1A 1EWYC 1IYJB 2Z6KA 4H0LC 3EJIA 3UDIA 2K52A 5CTRC 3KLRA 4RWSC 3V05A 1S3SG 1PGXA 5IYBG 1RM6C 4IPCA 1HR0W 2J7ZA 3KLSA 3PUXA 4L1BA 2IY5B 1Q0WB 5AJ3L 4YCWA 2LKVA 2N9PC 3J7AV 4DAMA 2IX3A 5C3XA 4HMIA 3PTFC 1EWCA 4XT3B 3MJ5A 1MIUA 3C0RB 2QDBA 2JA7G 2RGFA 5IYDH 2QJLA 2Q8RE 5JEAH 4OVZA 2CHZA 3BVMA 2RR9A 2B76B 4JI4L 2BYTA 3Q8BA 4R4TA 3NUCA 5D2MB 1K8MA 2MO0A 5H1SE 2ZVNA 3EECA 3WAMA 3S1MB 5CHFA 4BKSA 3G7LA 2WU5B 1EEID 3T53B 1JW9D 1B44D 2K01A 2WAQE 4K5VA 1YJ9A 4ME5A 1YVCA 2B2UA 4FNFA 3PO2G 2DHZA 3NUHB 4RHSA 1C7YA 4YSYB 3VR2A 3A0JA 1KC8C 5LMUL 2LVQA 3CRLC 1SE8A 4JI1L 3UGBB 4N9F4 4I65A 4MH0E 1XNRL 3N1YC 4POFA 4IW0A 1HTPA 3NZSA 1WTRA 2KWVB 1BUVT 1HZ9A 2O6VB 1VQKA 2XK5A 5BMGA 3D6WA 2YV5A 3BWUD 5CV7A 3A9KB 5ELCA 4WJOA 1TJEA 3HOZB 1PH3A 3A74A 2ASQA 4BY7G 1ZPSA 4JI3L 2QKIC 1KRHA 4MGIE 1SE2A 4P74A 1PH7A 2VL6A 4XDXA 2FMCA 5M3MH 3TEZA 1D1IA 4WJQA 3Q3FA 1XO3A 1U4AA 4RM9A 3OJ4B 2OJWA 3APCA 3DWQA 3UE0A 5HGQA 3QA8A 2H89B 1TWCB 1OTCA 2KDFB 2MJEA 2F0VA 2Z59B 3ZYYX 4GKKQ 1E8YA 4RGOS 1RODA 2C9OA 1VRAB 1NVID 2B2YA 1NBWA 2O2VB 4OL7A 3TN2A 1STEA 4NPNA 3GOEA 4OX9Q 1CTMA 1N6ZA 4P1CC 2F0EA 2FBWB 5CC4A 4W9FA 4C3JB 1A63A 3VR5A 1MI0A 1WGDA 4LWCA 4GNXC 4IFDG 1SYFA 4HRSA 4A3PA 3DWPA 4JIOU 2K8BA 3EN2A 1F2RI 3H09A 3SDLC 1PYBA 3ALBA 2ASBA 3B9JA 3DUZA 3OHXC 4JV5L 2DUDA 1JICA 3ENEA 1AARA 5FR3A 4NAMA 2JUOA 3MHZA 1MSHA 3H3VH 4NPSA 1XT9B 5A2QL 1GC7A 2BOSA 1N34L 3VR8B 4WFN3 2L0FA 4W9DA 1KAWA 2M00A 1K50A 1Y8PB 1Y8RC 1QQRA 3TL5A 4ANUA 3GTJH 2W9NA 3K7AB 1Y56A 1YQ3B 4P7IA 5IP7G 4LK0M 2JYOA 4IKGA 4B3SL 2PZWA 1JALA 2AHOB 3N20C 1F9QA 5I6YA 1G2TA 1Q82C 1MHHE 2WB1G 3UI3A 2M1MA 4GDLA 3J81L 3AH7A 4KGTA 3MWYW 3NELA 2K50A 2HE7A 3DOWA 4IUUA 1CZGA 4QJFA 3LB8C 2ON8A 4AQYL 1S72A 2XBBC 4AS1A 4P71A 3ULJA 4NJ7A 4NMZA 1WH3A 4DNTB 2XK5B 1BO0A 4R8IA 5JXVA 1AN8A 4JL9A 1L2FA 1P1AA 2MLBA 1BT0A 2L3ZA 1O7IA 5FLXE 1ENCA 4DF7A 1Q5WB 1STHA 2WQYB 2L5TA 4IOIE 3AE1B 1DOMA 1IBKL 2KWDA 2LUEA 3QB3A 3AE4B 2R7DA 4DV0Q 3STBC 4YT0B 1M1KC 4EX5A 2C5CA 3N32A 4BA1I 4BXXH 1Q10A 1XPRA 3GB1A 4OZBA 4HCEA 4CDDC 1EY4A 4IUTA 1BOSA 2BKFA 5LNK1 3M3YB 1SMXA 4QL5A 4DKAC 2L7RA 2BB5A 4ZRZA 1ZYRD 2HDEA 2A73B 1EIHA 3AQQA 4JI7L 3GTKH 1GD7A 5AJ3Q 1GB1A 2I07B 1I4QA 1SE4A 4YY3L 2B3AA 5EKIA 2NN6G 4K1RB 4POGA 1LABA 3H6NA 4OO1G 5DPSA 3U50C 2WXIA 3CCRA 1SYEA 4IWPA 4JGHB 3A56A 1U4PA 2CR5A 4PG3A 1E10A 3RD4A 4ZOHC 4HJAA 5EE0A 2V0GA 1RL2A 3BU2A 3SHLA 1OEYJ 2KZRA 4EQNA 3RPFC 4P75A 4RGMA 1JJ2A 2KCCA 1K51A 2J53A 3AEEB 5C44B 1ICFB 4JI4Q 2KN4A 4NP5A 3AEVA 1CQVA 5BO4B 3K9PB 3Q14C 1VMCA 4X3UA 4KY6A 1YNNC 1SNDA 1Y1VG 2KC1A 2N0SB 4QB4A 5JOBA 1YQ4B 3SDZA 4LF7L 4WWPA 2RCNA 1NEKB 2BGFA 1PH8A 2H5XA 2HD3A 2QILA 4TKOB 3AFQA 2MJ8A 5C4HA 1C4AA 4GDLB 4R4QA 1V9JA 4BOZB 2KTRA 5LMUQ 2VS1A 3AEBB 4JI1Q 3H94A 3T3OA 1XNRQ 3KYHC 1YX6B 4C3HB 1EFID 4A3DG 3RLOA 2V3SA 3MFYA 5C0XG 1BBUA 4KMUC 3MXUA 4M8AA 3CQZH 1YQBA 1GKHA 2L55A 2L05A 4XT1B 4DUZL 3AE8B 1XTCD 1A5RA 1NJIC 5BN4A 3AECB 2HDLA 4JI3Q 1AP0A 2RBMA 3HOWB 1E7PB 1X32A 1VQOA 3S2HH 2LRUA 2AUJD 1TU2B 3W9CB 5MPOA 1ZW7A 1IW7C 2K5PA 2JPHA 2E3TA 4LNQA 1WGKA 1FM0D 1A62A 4K2LA 1VF5C 5G3LF 1E7VA 4EQOA 2RSNA 4PQXA 1Q90A 2LJ5A 1X65A 1NR4A 1TR5A 3R2IA 4O42A 1U4MA 2KQ7A 4XC2A 2PCFB 4MTKA 3TQYA 5M3FH 3OW7A 4H13C 4N58A 3V6CB 2G4DB 2BTEA 2A6EC 4RMAA 1F2YA 1TGZB 4I7AA 1I5FA 4OELB 1DOKA 1PTOH 3TCAA 3UQBA 1K0RA 3M7GA 2E2JH 2E2DC 2O5IC 3UE1A 2MUYA 4CHTB 4F8MA 3A54A 1MHXA 3CMAA 3VFKA 4CQNA 1SYDA 3HKZB 4IALA 3BDLA 3UDXA 2Z0DB 2D0OA 5EBCA 3S1NH 1JWBD 2BT6A 2D3CA 1CKNA 2KXJA 1AZQA 1M8AA 5AFWA 4JI6L 1WTWA 1TWHB 2LRWA 1TIID 1K9MC 1BNZA 1SJED 5CR3A 3UDGA 4JV5Q 2KC2A 2N1WA 2RDFA 2RF4A 1WGRA 4K7WA 4ARCA 4HDOA 2NTTA 5M5YH 3J80L 3N1ZC 1L6VA 4ZK9B 2QCPX 1ONLA 1V9PA 1KRTA 4AH6A 3S14B 1RFKA 3I9V1 5IYDG 1N34Q 4ANWA 4J8QA 2SAKA 5JAVA 1PFBA 5JEAG 2HTME 4AJWA 4LUZA 3PUYA 3KUPA 1C1YB 2AL3A 1K3RA 1IUEA 2KOLA 2L1BA 4BKGA 1XCTL 3DWMA 4P6VF 5JHBA 4B3SQ 4LCDE 2TSSA 1YZ6A 2O2LD 2N78A 2LGYA 4DDGD 4AWJA 2Y5BB 3RZWC 1L1OC 1GG3A 1HNZL 5C3EB 2PYKA 3G6JB 1HNXL 2WV6D 2BS4B 4WJ3M 1KAAA 2FNJB 2NTSA 4S0RA 4U68A 5J39A 4G50A 3Q6SA 5EKKA 2KTRB 4AQYQ 4OZAA 1PDXA 4AIMA 2SEBD 3A55A 3JW0X 4OGQC 2I1JA 2B2VC 2RSUA 4YWKA 1E22A 4B6WA 3ULLA 3GTPB 2FINB 1E2VA 2H1EA 3E3XA 2F0WA 2ZT9C 1SMYD 1TZ1A 1B50A 1LT4D 1NDDA 3W5OA 2CS4A 4W9GA 2RHQB 3AFPA 4ABNA 4EKUA 3TP8A 2F0TA 5M3MG 2Z4HA 3ZJVA 3I2ZA 1O7YA 1IBKQ 1QKZA 3L4PA 4Q5VA 1V1PA 3S2DH 3QO2A 5EPJA 1UH6A 3GD7A 1WCMH 1IHZA 1RCVD 5ELOA 4LAAA 5GAEC 2UUAL 2KVZA 4KDLB 2OEOA 1B4OA 4JBKA 2VRRB 2Y0SG 2WP9B 4W9CA 4N9PA 1R7SA 3ND9A 2LHEA 4IOAA 3PRMB 2KVMA 4A3IH 3IBEA 1UELA 2CQAA 1BBWA 4HKQA 3S9WA 1CFMA 1Y1WH 1CMXB 5E7NA 5I2XA 3NBHA 3W2DA 4WWNA 3AI5A 4JI7Q 1XYIA 5T1IA 3R3OA 2NZOA 4GS3A 5CBAE 1NR2A 2BBCA 2WX0A 1JJCB 1JQYD 4YY3Q 2MGSA 1CKNB 4BFRA 4GN4B 3RI7C 1WXQA 3J81j 1II3A 3TP5A 1D8LA 3IFDA 1R4MI 2IY1B 1I4GA 1LO5D 5BN5A 1TWGB 1EYDA 2M9VA 1TBEA 2KX3A 3O65B 3DWAA 4IO9A 2K9XA 2Z4IA 3RZDH 2RDHA 3HG9A 3MTNB 1KLVA 2EKIA 1A70A 2JZPA 1YNTE 1N36L 3L0WB 5ELEA 2BF8B 1KHIA 3FHWA 3P4PB 5LMNL 5LLIA 4WJPA 4TRDA 1JCKB 1VF7A 4TVAB 3SE0A 3NOBA 1Z7TA 4LF7Q 1WD0A 4GKJL 5AZFA 1VQIA 3ZDMC 2V4LA 5JVH3 1CA5A 4A93B 2PQAA 2OTJA 3KUDB 3V3XA 3FRPB 3AEFB 1NYRA 3K6OA 4B9XA 3X3MA 1EU4A 1J7BA 4K8IA 1ZP0B 3IRBA 1F0ZA 2M8SA 1WMHA 3MC0B 3MJWA 4M02A 2YU9H 3APDA 1SFOH 2ZW0A 2NWGA 3VH4B 2PI2A 4EGVA 2A5HA 3I90A 1PV4A 2ID0A 4AP4C 5CV5A 3NWTA 1KLGD 5KNBA 3M4OH 4DU9A 2MSED 1TY2A 4DUZQ 1GB4A 4PK1A 3KF6A 1MSGA 1WYDA 4BBNF 2ZJRA 4G3XB 4E74A 5G3LD 3AMZA 3S2HB 2FAZA 2UUBL 1J8IA 1ZXTA 4QY7A 1FFUA 2N9EB 1UBIA 2IDYA 1IL8A 2ATWA 2B39A 2NBUA 3VUWA 2B2TA 2E2HH 3PZDA 1MFWA 1PH5A 2VH1A 1TY0A 2IYDB 2R3ZA 4LFAL 1U9RA 2Z9HA 3FMCA 4BXXG 5M3FB 4BY7H 2I5LX 1WI0A 1G6ZA 3NWSA 1WRIA 3AXCA 3VRAB 5J18A 2EXZA 2YTXA 1HQMC 4OWTB 1WTHA 1IKMA 1ZE3D 1AW7A 3S17H 1RD9D 3JAMi 1F9JA 3U8ZA 2D10A 4IPHA 4YTMB 5D14A 5BR8L 3NBHB 4A3JH 4GIVA 1WR6E 1UE1A 2WX1A 3IT4B 4GDKA 1YN5A 2K6AA 2MO1A 4JI6Q 4R9WA 2NYZD 2NCNA 1J7AA 2WS3B 1L4ZB 1I42A 5FR6A 1XLOA 2YLMA 2MQHA 5M5WB 1BBXC 3BY4B 5IKCM 1VZ7A 2Q8TA 3NXWA 3MXPA 2VY3A 1WJ6A 4A3MB 1WTQA 1RKNA 4XE0A 3GTQH 4NW2A 2B3GA 4BBSG 2WIIB 3BJUA 2WDVB 3WAPA 1YJ1A 1C78A 4EE2A 2X8XX 1UUPA 2HD5B 1CUKA 1QZGA 4GLAC 4W9KA 4F8CB 2ZJDA 1EIYB 4E3CA 1WTPA 1TKYA 2JF5A 1O7LA 3SVMA 3NPPA 4FF1A 4ZRQA 4FJZA 3CC7A 2YEPF 2YVCA 1SSNA 1ZEQX 1ROEA 4FO2A 4JCVE 2LUMA 1FRDA 3LWUA 3FC4A 2K8HA 4WWOA 4QIWE 3SFEB 3E9HA 2IL8A 3S1RH 1HNZQ 5BMHA 1HNXQ 2IY0B 2PQAB 3AYHB 1I4RA 1PXUA 4JPBW 3TEHB 3PLVA 2KFKB 4X62L 5F2DA 4ASWC 1E7UA 2XIWA 2CH4W 2JWZA 4N8X1 1AFPA 1PGBA 3EIVA 4JQWC 1RHPA 1WMHB 4FVMA 2JA5H 2F0SA 2Z6KC 4XQJA 1VZ8A 5IGCA 4A3GH 2KA7A 2VXWA 1KLUD 2ZCCA 2IW3A 4WRDA 4DR1L 4A3BH 1XD3B 4NDXA 4IUPA 4FP5D 3KF6B 1MPEA 2WXRA 4YCVA 3ZDTA 1T0RC 3I4OA 1XTDA 1VQ5A 2WXGA 3QHTA 1YITA 1GPXA 2BDOA 5GQOA 5BN3A 2EYFA 5EKLA 2LMCA 3APFA 1LTAD 1SXTA 2R7ZB 5TSSA 1T3QA 2UYZB 1D7QA 1TXYA 4F88A 2UUAQ 3QX1A 4R3DA 4NZLB 4W9EA 1F2LA 5M3FG 2K3UA 2KMMA 3E0EA 3FEWX 3PIPA 2N4FA 1N5WA 1I7HA 3TDQA 2PKOA 2B63B 5GADC 2TMPA 4Y52H 1WWTA 2D62A 4EQ5A 4P73A 3AE3B 2M2LA 1A3TA 1LACA 2CVRA 1UD7A 2D0PA 1E1OA 4UP7A 2B8GA 1HHVA 1ZOYB 2RA4A 4R4OA 4US9A 2JX5A 1STNA 2W55A 4DV3L 3T13A 2M17A 4AYBG 2I38A 3VTWA 1DGSA 3S2AA 4GDKB 2B2UC 2J52A 2QHOA 2MEKA 2RMMA 1VCIA 2E8GA 1WZ0A 3B2FA 1Q12A 4TMAB 1CZWA 3H1UA 5D6JB 4KHZA 4TSSA 1WVLA 3N3KB 2ICIA 4LF8L 4OEMB 1JB7A 3T1YL 4DR7L 4ZHPA 1WE6A 4C56C 3V2TA 1N36Q 2ZZPB 2JXTA 5LMNQ 1K8OA 4DXAB 5E1FA 2KEDA 3WOFA 5JJIA 3WCQA 1L0YB 2NVYH 5FKAC 4GKJQ 2KQ4X 3OIPA 3ZJUA 1UE5A 4KVGB 2JA7B 1FXTB 3LXFA 1IKLA 1ISNA 3CP0A 4NJ6A 3MC9A 3KF8A 4JK1C 2PW5A 1XLPA 1WI5A 2INPE 2EY5A 4UDUC 3PV1A 3B6YA 1T6BX 1E24A 1KH0A 1NY4A 3G71A 1FXAA 3TZUA 3GZNB 1Y8NB 2BDNA 2B2YC 1SFOB 1PLFA 5IIFA 4K81A 3CIRB 2OXPA 2J0KA 2WHIA 4FYDA 5EJWA 5E6NA 1HA5A 3CSTA 2JXMB 4WORA 3PO2B 3DVNV 4JBMA 2F0OA 2XEWA 1VQCA 2D3AA 1KIXA 4IM3A 1WF9A 3FPUB 2UUBQ 3GE8C 1UE6A 4UP8A 1XPUA 4DV6L 3QARA 1J8CA 2DYOA 1UBQA 2LMCB 2WDTB 3HOXH 5ELFA 1ACCA 4LJZC 1A2UA 3ZNHB 1L2NA 2V3PA 1QJOA 3ETRA 5IT9c 5KHOA 1WCMG 2MBQA 2JYEA 4G4KA 4JC0A 4DFAA 4LFAQ 4GOPA 4ARIA 1EFWA 4LFCL 3G4SA 1EWHA 3VUYA 2WAQG 4BY7B 5KRUA 4TQUS 4A3IG 3A33B 3ZRCA 1D2BA 2PLPA 2BA1A 3N30A 1Y1WG 3S17B 4V190 1FEHA 5JZEB 1S3OA 4N9TA 3TZDA 5BR8Q 3ER0A 1ICWA 5DPWA 1NAPA 4CHKA 3VA5A 5CBEE 2PMZE 4DXFA 1IGDA 3AM9A 3T3NA 5D3IB 3PIOA 1KD1C 2N9LA 2EXDA 5IP9H 1U4RA 1KXLA 1C9FA 4RF0A 2GBJA 2QIEB 1WE7A 1FR3A 1EIGA 3K0YA 3J9CA 1BR9A 2A69C 1H9JA 1PHJA 1PZJD 2CCZA 2PVGC 3RNCC 1AWDA 4GOCA 4L5QA 1X3QA 3AMUA 1RDPD 2JXXA 1K83H 1VMPA 3D4RA 4IWQA 3SK8A 5C5LA 2VUMH 3PREA 3I72A 3GTLB 3HOYH 1LYLA 3RNFC 2L15A 2PZUA 1X54A 2EDGA 4JOIA 1L6UA 2LI5A 2B2WA 2RD0A 2HCCA 4HVBA 3SHQA 4YWLA 2CJNA 2ES2A 2BH2A 3DBRI 4IUNA 3S1RB 4KV2A 3BK2A 3HIZA 1U0LA 2YTYA 2WU2B 4X62Q 1IP9A 3KF8B 1GUWA 1EOVA 3GP7A 4FBJB 1VCBA 1GM5A 3HVDA 3R66C 3SR6A 1LUZA 3EBEA 3HVZA 1KDCA 2KQ3A 3HEJA 4A55A 1SRUA 4KKUA 4LMQD 1TTNA 3RT3B 5IY0A 1B70B 4RF1A 3U9SA 1ZYRC 2WB1B 2EQSA 1TWFH 5T1GA 1IBLL 4DR1Q 3EGRA 4FULA 4HKZE 1P0RA 3PQIA 2HJ8A 3CKIB 5M5XB 2ZM6L 1I50H 2JEBI 2NBFA 4JI8L 2IO3B 2INCC 1O80A 1LT3D 5IGFA 1GC6A 3K9OB 4NXML 4IZ8A 4DHZB 2Q2IA 3F2DA 4F7ZA 4YWGG 4LJOB 1QILA 3H6MA 3JAME 2R93H 4L8JA 3UIOB 2CU3A 2CKHB 4EZKA 5HHDG 3I70A 3ZNGC 1DM0B 1JB3A 5EAYA 4GOPB 5J22A 2LXJA 5FO7B 4FADA 2OF1A 1X1MA 3E9IA 1DZ1A 1N63A 5I2YA 1WY8A 2QDFA 1DOLA 4LK1C 3WOEA 2BCOA 3H9DA 3IKJA 5G55A 1PZID 2KJXA 2DY8A 3MTSA 1C4QA 2KYWA 2FXQA 4A3JG 4ZUIA 1VR9A 4DV3Q 3KUZA 3GTMH 1IXRA 4NXNL 1WFYA 3RLNA 4RNAA 2LFNA 4C1NK 2NZ1D 5C4JH 1FD7D 4FF3A 4WURA 1EWIA 2KLCA 4LF8Q 3VR4A 1E3PA 4GLVB 3H8HA 2ICEC 2OJRA 4LUOA 1NENB 3T1YQ 4DR7Q 3RD2A 2OWOA 3AEGB 2ZTDA 4ZKBB 1ZXIA 2EYOA 1S5DD 1QUQA 3A8IE 1EO6A 4PS3A 2MQJA 4C2MH 1V81A 1HH2P 5FOBB 4A90A 5E4XA 3K57A 1YJNA 1OFFA 1PUTA 2WDRB 3DHGC 4DK5A 4JBWA 5JJLA 2EYMA 2K5HA 2RSOA 2LD9A 5T8IA 2JA8G 3ABVB 3C3LA 4JPSA 4PV1C 5E4WC 1BDOA 1HTOA 1TWAH 2NVYB 3S15B 4GN5A 3KDFA 1WR1A 4I6LB 4A3FH 1GUSA 2WACA 1FVIA 2LGXA 2J7QB 3GS2A 2SNSA 1YJWA 4TKNA 3ZRFA 3KUCB 1SNOA 4DNIA 1I3QH 2JRIB 1RTOA 1P8LA 2N88A 1WTXA 1E1TA 2WKDA 2PVOD 4MJSA 5IP4D 3HRZC 2EE1A 3OWEB 1GJZA 1Y1VB 2KHJA 3E0JA 1EZ8A 5G2NA 3LNNA 2JA5G 1QF6A 2ZTCA 1S1QB 4OIJA 2AL6A 2D11A 1HFGA 1VQLA 4A3GG 3P20A 2GBRA 1G51A 4A75A 2BE5D 3TSSA 1LM8B 1QOBA 3D6CA 4A3BG 1T0QC 2K25A 2KDIA 3DBLI 1HZ6A 4HPLB 2GN5A 2D2CC 2F3WA 2LSSA 2QDLA 1K8RB 2IWHA 4X3TA 2A6HD 1C8CA 1EU3A 2A4ZA 4DV6Q 2NBVB 1ML0D 4HN7A 2SOBA 1KDAA 1UWXA 2I0QA 4A3DB 4TQ0A 5COYA 1MG8A 1YMHE 4ZQ3A 1TYGB 1G2SA 1WM2A 2GBMA 1YNJC 2ZNVB 3U7DA 4IUVA 3NP8A 1C76A 4B0MA 2NVTH 4HSVA 1Z5SB 1H9MA 2OOBB 1AZPA 4C4VA 5KHQA 4HPMB 4WJ4A 4M01A 3WDNA 3CCUA 3M4YA 2L8JA 3RZOB 1R9TH 1VQDA 4GZYC 2INDC 5LL6X 1AH9A 2KOXA 4CO7A 1MJCA 5CMDA 3L16A 5H92C 5DM63 4KJNA 1J0GA 2KENA 3LWEA 2G4SA 3OJ3A 1JOOA 1TVXA 4BBRH 4FXCA 1QOGA 4KN4C 2L00B 1B9RA 4MGYE 4M8MA 2HDMA 1VQ9A 1QNKA 3RNUA 1Q1EA 1C4PA 3PZ8A 4M00A 1JRPA 1H4RA 5DAUA 3BG3A 3Q3OC 4PT5A 5IAAC 2C35B 2LY7A 4MHEA 1HQRD 1QVFA 4FJVB 1TZOA 3J7A5 3D32A 2C7MB 4BA2I 4XQNA 1U5KA 4A3KH 1PH4A 3NZ3A 1PTOF 1FJGL 1TS3A 2RHSB 2KAJA 1QUQB 3RN5A 1JMCA 1HNWL 3I5JC 4XQQA 4ITKA 4DR5L 4UY8C 4DNRB 3AN1A 5AEKB 1FMAD 1FGUA 4XX5A 4KKTA 4APVA 2NVQH 3M63B 3KDFB 1JRUA 3OYYA 3H0GH 5M9OA 2I1KA 2MH7A 4BBSH 2AX5A 2ZVOA 4KSKC 4C3IG 3U4EG 4A8XC 1J9OA 3SXHA 1Z2MA 3NQIA 2F0IA 4BY1H 5G5GA 2KDEB 2MP2A 4LUVA 3KH0A 4LNOA 4KZCA 4MJSB 3JC66 3VHTC 3S1QH 1EY0A 2WB1E 2MFIA 5GMVA 2OQ0A 4L23A 3Q8AA 4HIDA 1IBLQ 3L54A 1TWFB 1MJDA 3M9BA 1FPYA 1OQQA 1SF0A 2QCZA 3HRDD 1IGCA 3Q3NC 5JJZA 2ZM6Q 4JI8Q 3AB9A 4KI0A 2R92H 1WRDB 2KFJA 2N7JA 2N7DA 3ZLZA 3P75A 5EDSA 5GAHC 4URKA 4U673 1QWYA 2JA6H 3ND8A 2G5DA 3HOXG 5J3BA 2C7HA 1S40A 2REXA 3I4MG 3TRZA 1YNXA 1VD2A 4LF9L 2BYVE 2WGSA 2CWPA 2K4KA 1YHAA 2IT1A 3TP6A 3SK5A 1E8ZA 2VZKD 2AWNA 1QNUA 1D1KA 2B29A 1FCLA 4S17A 3ONAB 4OW0A 4EEWA 4C4VB 1S5CD 2C7NB 1TT5B 3VYUA 1QLBB 5M3MB 4R4IA 1VDVA 2KNBA 2KX0A 2NVXH 1R4QB 2XTIA 4GSWA 1J5EL 4IM2A 3S16H 1WIAA 2IHFA 3CCVA 3I7FA 2Y0SB 3QWNA 4NXNQ 1B3AA 1OXSC 3VAWA 5IP9G 2OTLA 1GOZA 3OAWA 1OTRB 2FJ2A 1R4NB 5IO9A 3CPFA 5IWAL 1ET6A 2DNFA 3P1MA 4IQZA 1BVSA 3BIID 5KNCA 4X66L 2PIAA 1KOTA 4M0WA 2KCMA 5IT9L 2QC8A 4W9LA 3RNAC 2FE8A 2DYBA 2VUMG 4XXEA 1RTNA 3OW2A 3HOYG 4MSQB 1LTID 3CMEA 2N9KA 3DDCB 3ZGZA 2GVAA 1VQBA 2L11A 3W3AA 4IFDJ 3OMGA 1C0AA 5KYLA 2GLSA 2N9XA 2CKZB 2QGQA 1OXVA 3Q23A 3VR9B 5G5HA 2PW7A 4PNYA 1I35A 3NS1A 2B2TC 2XWJB 3TEXA 3GTJB 1VZ6A 2RKSA 1I3QB 2GVBA 2M56B 4F1SA 3DPDA 4FJYA 1JE4A 3BDOA 1V49A 2MP2B 5FLMG 1EYAA 3BINA 3FKYA 2LASA 1IYFA 1NBFC 3BYYB 4UPAA 4K2KA 2X69A 1T5EA 2E2IH 2F0LA 4NQKE 4LLGM 4G57A 3GV6A 3LGJA 1SNCA 2SDFA 2ZPNA 1EY7A 5EQ0A 5C6AA 2E76C 4LW1A 3DHHC 1Q1OA 1O7ZA 4KIKA 1LTLA 3ITPA 2JA9A 4ZHOA 1F9PA 3T1HL 1X3FA 2V4DA 2YTVA 1WGYA 5IYCG 1V43A 3HOUH 1EY9A 2R93G 3PS6A 2BQQA 4MM3A 1D6EC 3EC8A 4KHVA 4ZKCB 2A68D 4JBJA 1I4XA 2MBEA 2VZKB 2IHEA 1VQ4A 1KQSA 5EE3A 3STBD 1XMOL 3K5OA 2HQEA 5CV8A 2PNHA 4L2YA 1V1OA 3KYDD 3MXGA 2FHTA 1STGA 4H2AA 2ZXOA 1FO4A 3GTGH 4IFDI 3HM6X 3U58A 4GN1A 2JU6X 4II3B 4E71A 1QB5D 2ZJPA 4G7ZC 3PO3H 5FK9C 2MBBB 4HEA1 4A3CH 1K0SA 3RR5A 2D3GA 5C1ZA 2N3SA 4PYUA 3PVLA 1I4HA 4ALPA 1YEZA
chains in the Genus database with same CATH topology
1SE3A 4MN3A 2ACZB 1PTOD 3AE7B 5EBDA 2O5JC 4A6QA 3GTKB 3NK9A 5FO8B 1QOHA 3BK1A 1BF4A 2BB6A 2NVQB 3PUZA 3FAHA 1LT6D 1QT9A 2EOTA 3P4QB 2YYZA 2Y5PA 4Z9CB 3K5MA 5LL6S 4BBSB 5KYIA 2JWUA 1QCBD 1Q3LA 1JOKA 2EYLA 4CKCA 1YJJA 1CQFA 3AU7A 4HMJA 5BYSA 3AE5B 1XX8A 5JVG3 5D3DA 3VYSA 3QOJA 4MH8A 1XWEA 1TKEA 4N6EB 3E9SA 1IW7D 5AUKA 3CQZB 4MM3B 3EUB2 3BYTB 1Q1BA 1L0XB 1TKWB 3DEOA 5FO9B 4DAVA 4B0EA 2Z8LA 5C0XJ 1P7EA 1EY8A 2M0AA 3Q69A 2I2YA 2G9DA 1Z47A 2A6ED 1PRTF 4RGTA 1HCZA 2ZW1A 2K1BA 3Q8CA 1V1PB 1GUTA 2EJGC 1Y69U 3FDTA 1FIQA 1C48A 4QCLA 3ZJTA 2L0CA 2QEJC 4HEDA 1GAQB 1DXMA 1PTOB 1NUCA 2E2JB 1SNPA 1B9NA 4ILWA 1LTTD 1GUOA 4DK0A 1FNWA 3S1NB 3U2SC 2F0QA 4AYBB 2F0NA 1FFVA 1CZPA 5EPKA 4YSZB 4CKBA 4ID6A 1PFDA 3Q8EA 5M5YB 5BMIA 2F0DA 2XRSD 4ULLA 2NB0A 1NI3A 1Y8OB 4KKIA 4KD4A 3H91A 1JQ4A 2PO4A 2MHVA 3EROA 1VJKA 4BWGB 5AUIA 3T4AC 5C3WA 5JEAJ 5NUCA 3U52E 1TQOA 4HTHA 2JEAI 4USAA 3N6RA 1OXTA 2WXMA 1WYGA 5C3JB 2Y5CA 5I9PA 5KGUA 4A9AA 1C77A 1NSNS 3TMEA 4CJ2C 1HUMA 4K6DA 1V8CA 3A8JE 1BUIC 2Q8IB 5K36H 2DLBA 5H92C 1R4PB 4V0BA 4OZCA 5HG2A 5I9OA 1A3VA 1JWSD 2IX0A 3OIQA 3B2GA 4KK7A 1EYCA 1MD2D 1MGSA 3QIAA 1A6XA 2F1MA 2L83A 1PDQA 1SBBB 3VR3A 3D31A 3MHBA 3GTGB 4X3SA 3RFZB 2DYMA 1KF6B 3Q24A 5DEHA 3S2DB 1WCMB 3KLSX 4KN7C 2B2WC 1DJRD 3SEBA 4CKEA 2WAQB 2J4XA 1XF5L 4A3IB 1L4DB 1JWUD 2MP1A 4ZUJA 4CGYB 1Y1WB 3T16A 2XVSA 2L4NA 2XRQD 4RKBA 1EQVA 4DAYA 1L5PA 3NVZA 4PMWA 2WDQB 3Q0AA 1FGBD 4UAIA 3P4RB 2X6GA 2VB3X 4DA2A 3LYYA 4WH4A 3RZDB 1DONA 2DN8A 5D65A 2L1AA 2EJMA 3DEPA 3VA7A 4FF4A 5IGEA 3NTKA 2LHDA 2LGIA 3FPPA 2K05A 1C79A 2BS3B 4WAFA 1BCPF 3MXNA 1HRJA 2SNMA 1DOYA 1STAA 4J3OD 3BVGA 3I57A 2J0TD 2L52A 1PYWD 2YU9B 4G7OC 5H8YE 4NJCA 4I7ZC 5CV4A 1CJEA 1H9SA 3D4DA 2JQRB 1AEXA 5EE9A 3MEHA 2EZVA 4CJ0B 3M4OB 2JYTA 2K28A 3I8ZA 1PRTD 3GV3A 1E0ZA 2ZXRA 1G8ZD 4QF4A 2AWOA 1SYGA 1ET9A 3CWIA 1MBYA 2WXNA 2E2HB 1F77A 3P63A 2WXFA 5J1ZA 1K52A 1LTRD 1G291 2RVLA 3T56B 1JWAD 3DMUA 2PZTA 4H7BA 4A3JB 2EVBA 2BE5C 1AYFA 3BDCA 3W5UB 1GJXA 4Q2JA 1BXTA 3PIP3 1E2ZA 1WD1A 1OO9B 1U4LA 2MJDA 3DXJC 5GXGB 2DNEA 3GTQB 3GQBA 1N62A 4N59A 1EOTA 3W1SA 1D5MC 1WTOA 2KHSA 4B9WA 2JA8B 2F0UA 1E9MA 4DN4M 1UGJA 1FNVA 4K8JA 1M4VA 3MFGA 4JE3B 4IN3A 5EE1A 3CU7A 5ELBA 2QF7A 2M19A 5DM73 4KJOA 2JA5B 4QUCA 4A3GB 2EY2A 2CW0D 1CI3M 1H9SB 1DD2A 3J7YW 5I6WA 4A3BB 1KFYB 5A2QE 1NYQA 5BYRA 3PUWA 1PRTB 2GI9A 1EEFD 1PGAA 1EY5A 5C5MA 1YN4A 1XEEA 2IX1A 2JSOA 3VRBB 4GLSC 3AE6B 4D2KA 3HS0C 2LEKA 3H3VC 1HEZE 4ZRPA 5D7GA 1LV9A 3VYRA 3D3RA 3J81E 1OXXK 4US8A 2K33A 2X6LA 3C2PA 5C4ZA 4Y7NB 3AEDB 2FUG1 2ZXPA 2X38A 2AUKA 2E74C 2EPBA 1UWMA 1OXUA 2W82A 4J6HA 3SK4A 1CHPD 4ZYSA 4OIKA 3P7JA 2BS2B 2F0MA 4RFBA 5JPMC 2DWQA 2O4XA 4XDCA 3QOLA 1HTLD 2PPBC 1SJHD 3PIO3 2YEPB 3HZXA 3ZQ4A 1BCPD 5EPLA 1X3PA 4DAPA 1LTSD 1TS2A 2KDMA 1TS5A 3NVWA 2OT2A 2QMTA 4C3IB 4H44C 2CJOA 1PZKD 1XLQA 5ELDA 1T5XD 1I6VC 3J7AF 5K36G 1OQRA 2KUMA 1PMRA 2IGDA 1Z6HA 2F4IA 3MVVA 1FCCC 1N5XA 3PO0A 2WXQA 1B9MA 2GA4B 3KK7A 3R2TA 4ODGA 2NMQA 4NAWB 1FRRA 2F0FA 4IUQA 1HFNA 4C7ZA 3HOXB 3JAML 3I4MB 2WXLA 1B1ZA 3IAM1 1MI2A 2E75C 2K5QA 5HGTA 4EE2A 1FXIA 3NBIA 5E6JA 3U7ZA 4WQMA 2WNMA 3C1FA 1RJTA 1SNQA 1F2ZA 3P42A 4XWWA 5CORA 1TKGA 2E6XA 1QE6A 2EELA 2PQEA 2A69D 3R93A 3TUOA 3IAYA 1ESFA 4WWMA 3QG1A 2RQXA 1QOAA 3LX0A 1SAPA 1Q8IA 4XTCS 3EA6A 2FMMA 2A68C 3GO5A 3Q22A 4JWUC 1SMYC 1K83B 4J1MA 4DXGA 2D5GA 1C4CA 1BCPB 3KWLA 3I73A 2VUMB 3HOYB 3NTHA 2RDGA 3L7ZC 2H88B 2JSVX 1SDFA 1WTVA 4AQ7A 2LS01 3C46A 2F03A 1ZKOA 4MACA 4C3JG 4KGSA 2PMVA 1B53A 4P2CB 2WP8J 1SSOA 1ZDXA 3PV0A 1F2RC 1CM9A 5IT9E 3TP7A 3DWGC 1PTOC 2MPMA 3HP3A 1D4BA 3D8GA 3J80E 1ZDVA 2OEDA 5IOCA 3W5VB 2R61A 1DYQA 2I46A 1WSPA 1I50B 1VLBA 4YTNB 5IGGA 4YSXB 4XIGS 3U9OA 1S5ED 3TEWA 1L0VB 2R93B 2L12A 1HA6A 5BYQA 2CHBD 5EGTA 1UAPA 2B8FA 5FLXL 1SYCA 3HUIA 1XLNA 3C1EA 1K53A 2W54A 1IYUA 1D5XC 3IL8A 1CHQD 3VQIA 1GHJA 4C80A 4IDIA 2WLBA 4KTAA 2AQ3B 2HCIA 3D4WA 3BS1A 3GTMB 1ZXHA 3URYA 3TEYA 4WJWA 2LFIA 4C7YA 5C4JB 2G1EA 4S3SA 2HUGA 3KBXA 4C2MB 2XN9C 3AE2B 1TS4A 4FXDA 5K5PA 1YJIA 4CBVA 2DY7A 3MZ5A 2WXOA 1TWAB 3NVVA 4IURA 4A3FB 1LTBD 4L6TB 3M85A 1W6KA 3OOCA 3FVQA 4DQOC 1EL0A 1QG7A 3Q8FA 3NTIA 4K5WA 1RWSA 1KNAA 2ONQA 1ZUD2 5HFYA 4R8NA 1XCQL 1RF2D 1SYBA 1UEAB 3AE9B 1YNJD 3ERQA 3PMFA 4KKJA 5KNDA 1GUGA 3IAS1 1S5FD 2OHFA 3I91A 4F87A 4RCNA 3BZDB 5C2TB 5E3FA 1SIJA 4RAUC 1PFMA 1MVKA 2F0KA 3SR1A 4KX6B 2KCNA 4XYQA 2EYHA 2XSCA 2NVTB 2DBYA 2JE6I 1NCVA 3NQTA 1B2TA 4QIWB 1EM7A 2W3SA 1E0BA 1VDZA 1R9TB 3P4SB 1LTGD 3NHHA 1FYCA 3HGBA 4C3HG 4RHRA 4Q0FA 2EY6A 3IXSA 2F0HA 2EY1A 3E6ZX 4RH6A 4BBRB 4KY7A 4X3KA 1SB3C 5KIXA 2Q5WD 3R8BA 2N55A 2LJIA 2IGGA 2EYPA 1GHKA 2INNE 4KKSA 4EVOA 1P7FA 4O1NA 1KABA 4A3KB 5HURA 2F0JA 3CRKC 3I3CA 3T51B 1JORA 1STYA 4QMGA 2K03A 5JPNC 1QOFA 3PZ7A 4HCSA 3K5NA 1YNND 3OWFA 3OPOA 2K04A 2K22A 2RPVA 2KECA 3H0GB 5CGKA 3CHBD 4BY1B 5A35A 3DHQA 4K6LA 2XWBB 1BMLC 1F9RA 2J42A 3A7LA 3S1QB 1G91A 2L32A 3SFDB 3FILA 1BQQT 1D5ZC 4RCOA 4EQPA 2R92B 1E6EB 3AEAB 4HJGE 2ENBA 2BW2A 2H4OA 2V3NA 2JA6B 5IODA 2L9HA 1JR0D 2DNCA 3BVZA 1ILPA 5CYUA 4RA8A 4HAEA 1KNEA 3QJYA 1EZ6A 1ENFA 1O78A 4XYOA 4HROA 2NN6I 4KV6A 4RGNA 2NVXB 4OO1I 1ENAA 4HR7B 1GXDC 2IPKD 3S16B 1YN3A 3IT6B 1S5BD 2F0GA 1HUNA 1ILQA 4M1UB 5ISRA 2WINB 3MP9A 1A3UA 2K32A 2XNAC 3N52A 3K58A 1N60A 4G7HC 3KWVA 2AQ1B 3DM1A 4PMBA 2D9UA 2EYJA 4KD3A 4DGZA 1JROA 1FD6A 4JWSC 5CV9A 1DOXA 1JWMD 5IGDA 1PRTC 1GUNA 4PMCA 1J7CA 4BS9A 2VNUD 1EQTA 2D5DA 5C0XI 1V8QA 2KEEA 1W6JA 4YXDB 2NUCA 3I4LA 3IFTA 4LTUA 4FXKC 4RKLA 2PMZB 1HPCA 3PUVA 1JC7A 3NVYA 4C1NI 3M7NA 1F2MA 2B2VA 2KACA 1KDBA 2E2IB 2PW9A 4XDDA 3FILB 4OHJA 3K5LA 2F0PA 3NSWA 3NRZA 5C4XB 5CV6A 4IFDH 1CT1D 2A74C 2VB2X 3O13A 1H9RA 3HOUB 5DNFA 1LLRD 4KY5A 3OMCA 2IJ0A 2K5WA 3E56A 1IYVA 2Y3AA 1DGJA 1N61A 3PO3B 3MA2B 4HSPA 1JOQA 1XXGA 3KQ4A 1IBXA 4FF2A 3OSOA 3A7AB 2WXKA 4KGRA 3E5SA 1A2TA 1HZ5A 3GTOB 3RUZA 4B08A 2K0PA 4ZLTF 2CW0C 2FFKB 2WXHA 5HI1A 2JP1A 4FXGC 2V4IB 4K5XA 1ESRA 3EVQA 1PFNA 2QSDA 1A15A 4MIUA 3X3NA 3UI2A 3FKIB 3KBGA 3K59A 2Z1CA 2K7VA 2F3VA 3A8KE 4CJ1B 3F2UA 2GRIA 1E2WA 3AB5A 3RMHA 3AV8A 3TBIB 3N9YC 1STBA 1SEBD 4P16A 2W3RA 2PNRC 3L3OC 3C8YA 1F9SA 2NN6H 1JMLA 1KTKA 4OO1H 4F7XA 1CK1A 2BA0A 5I4DA 4WIPA 4REZA 1HXYD 2EJFC 4MT5A 3VYTA 5KEEA 3MAQA 1BCPC 4ZAIA 2WXPA 2AQ2B 4E6IA 5LHY1 3SK6A 2K5DA 4JX1C 4YTPB 1TT2A 1RYJA 2R6GA 1S4ZA 3RLFA 3P1HA 3I4NB 1DOIA 1H9KA 3EFXD 1IBXB 1DCZA 2IGHA 3HOVB 3V96A 3VR6A 1CA6A 3EQLC 4NKLA 2G9HD 5C0XH 2GB1A 1V97A 2WXJA 2A6HC 1LT5D 4YIJA 1FNUA 4A3EB 4QUFA 5IGBA 4L63B 1UNSA 4XWTA 1EY6A 3L9AX 2PTLA 2WKCA 4K14A 2MJ3A 1I4PA 1I6HB 4DK1A 1SNMA 3NE5B 4TQ1A 1EWYC 4H0LC 3EJIA 3KLRA 4RWSC 3V05A 1PGXA 1RM6C 2J7ZA 3KLSA 3PUXA 4L1BA 2LKVA 3J7AV 2IX3A 5C3XA 4HMIA 1EWCA 4XT3B 3MJ5A 2QDBA 2QJLA 2Q8RE 5JEAH 4OVZA 3BVMA 2B76B 2BYTA 3Q8BA 3NUCA 1K8MA 3S1MB 3G7LA 2WU5B 1EEID 3T53B 1JW9D 1B44D 2K01A 4K5VA 4ME5A 2B2UA 4FNFA 3NUHB 4RHSA 4YSYB 3VR2A 3CRLC 4I65A 1HTPA 1WTRA 5BMGA 1BUVT 3D6WA 3BWUD 5CV7A 5ELCA 1TJEA 3HOZB 1ZPSA 2QKIC 1KRHA 1SE2A 4XDXA 2FMCA 3TEZA 1D1IA 1XO3A 3DWQA 2H89B 1TWCB 2MJEA 2F0VA 3ZYYX 4RGOS 1RODA 2C9OA 1VRAB 1NVID 2B2YA 4OL7A 3TN2A 1STEA 1CTMA 2F0EA 2FBWB 5CC4A 4C3JB 3VR5A 1MI0A 4IFDG 1SYFA 4HRSA 3DWPA 1F2RI 3H09A 3B9JA 3DUZA 3OHXC 1JICA 5FR3A 4NAMA 3MHZA 1MSHA 5A2QL 2BOSA 3VR8B 4WFN3 2M00A 1K50A 1Y8PB 1QQRA 3K7AB 1Y56A 1YQ3B 4LK0M 2JYOA 4IKGA 2PZWA 1JALA 1F9QA 5I6YA 1G2TA 1MHHE 3UI3A 3J81L 3AH7A 4KGTA 3MWYW 4IUUA 1CZGA 3LB8C 2ON8A 4AS1A 4NMZA 4DNTB 1BO0A 4R8IA 5JXVA 1AN8A 4DF7A 5FLXE 1ENCA 1STHA 2WQYB 2L5TA 4IOIE 3AE1B 1DOMA 2KWDA 3QB3A 3AE4B 4YT0B 2C5CA 4BA1I 1Q10A 3GB1A 4OZBA 4HCEA 1EY4A 4IUTA 1BOSA 5LNK1 3M3YB 2BB5A 4ZRZA 1ZYRD 2HDEA 2A73B 1EIHA 1GB1A 2I07B 1I4QA 1SE4A 5EKIA 2NN6G 1LABA 4OO1G 2WXIA 1SYEA 3A56A 1U4PA 1E10A 3RD4A 4ZOHC 5EE0A 2V0GA 3SHLA 3RPFC 4EQNA 4RGMA 1K51A 2KCCA 2J53A 3AEEB 5C44B 2KN4A 4NP5A 1CQVA 1VMCA 4X3UA 4KY6A 1YNNC 1SNDA 2N0SB 4QB4A 5JOBA 1YQ4B 3SDZA 1NEKB 2QILA 4TKOB 2MJ8A 5C4HA 1C4AA 4GDLB 3AEBB 3H94A 3T3OA 4C3HB 1EFID 3MFYA 5C0XG 4KMUC 3MXUA 4M8AA 2L55A 4XT1B 3AE8B 1XTCD 5BN4A 3AECB 2HDLA 1AP0A 2RBMA 3HOWB 1E7PB 1X32A 2AUJD 1TU2B 5MPOA 1IW7C 2K5PA 2E3TA 1WGKA 1FM0D 5G3LF 4K2LA 1VF5C 4EQOA 2RSNA 4PQXA 1Q90A 1NR4A 1TR5A 3R2IA 4O42A 1U4MA 2PCFB 4N58A 3OW7A 4H13C 2BTEA 2A6EC 1F2YA 1DOKA 1PTOH 3M7GA 2E2DC 2O5IC 2MUYA 4CHTB 4F8MA 3A54A 1MHXA 4CQNA 1SYDA 3HKZB 4IALA 3BDLA 5EBCA 2BT6A 1JWBD 1AZQA 1M8AA 5AFWA 1WTWA 1TWHB 1TIID 1BNZA 1SJED 5CR3A 4ARCA 2RDFA 2NTTA 3J80L 1L6VA 4ZK9B 2QCPX 1ONLA 3S14B 1RFKA 3I9V1 4J8QA 2SAKA 5JAVA 1PFBA 5JEAG 2HTME 3KUPA 3PUYA 1IUEA 2KOLA 2L1BA 1XCTL 3DWMA 4P6VF 2TSSA 2O2LD 5C3EB 2PYKA 3G6JB 2WV6D 2BS4B 1KAAA 2NTSA 4U68A 5J39A 3Q6SA 5EKKA 4OZAA 1PDXA 2SEBD 3A55A 4OGQC 2B2VC 3GTPB 2FINB 1E2VA 2H1EA 2F0WA 2ZT9C 1SMYD 1B50A 1LT4D 4ABNA 3TP8A 2F0TA 2Z4HA 3ZJVA 1QKZA 1O7YA 3L4PA 4Q5VA 1V1PA 3QO2A 5EPJA 3GD7A 1IHZA 1RCVD 4LAAA 2OEOA 1B4OA 2WP9B 4N9PA 1R7SA 3ND9A 2LHEA 2KVMA 2CQAA 4HKQA 3S9WA 1CFMA 5I2XA 3NBHA 3W2DA 1XYIA 5T1IA 3R3OA 5CBAE 1NR2A 2BBCA 1JQYD 2MGSA 1WXQA 1II3A 3TP5A 3IFDA 1I4GA 1LO5D 5BN5A 1TWGB 1EYDA 2M9VA 3DWAA 2K9XA 2Z4IA 2RDHA 3HG9A 2EKIA 1A70A 2JZPA 1YNTE 5ELEA 3P4PB 4TRDA 1JCKB 1VF7A 3SE0A 1Z7TA 1WD0A 5JVH3 1CA5A 4A93B 3V3XA 3FRPB 3AEFB 1NYRA 3K6OA 4B9XA 3X3MA 1EU4A 1J7BA 4K8IA 1ZP0B 1F0ZA 3MC0B 2ZW0A 2NWGA 4EGVA 2A5HA 3I90A 2ID0A 5CV5A 3NWTA 1KLGD 5KNBA 1GB4A 4DU9A 1TY2A 1MSGA 5G3LD 3AMZA 3S2HB 1J8IA 1ZXTA 1FFUA 2IDYA 1IL8A 2B39A 2B2TA 1TY0A 2R3ZA 1U9RA 3FMCA 5M3FB 3VRAB 1G6ZA 3NWSA 1WRIA 2EXZA 1HQMC 1IKMA 1ZE3D 1AW7A 1RD9D 4YTMB 5D14A 3IT4B 1YN5A 2K6AA 4R9WA 2NYZD 1J7AA 2WS3B 1L4ZB 1XLOA 5M5WB 1BBXC 1VZ7A 2Q8TA 3NXWA 3MXPA 4A3MB 1WTQA 1RKNA 4XE0A 4NW2A 2WIIB 2WDVB 1C78A 1UUPA 1WTPA 1TKYA 1O7LA 3SVMA 3NPPA 4FF1A 4ZRQA 2YEPF 3W9CB 1SSNA 1ZEQX 1ROEA 4FO2A 3FC4A 2LUMA 1FRDA 3LWUA 3SFEB 5BMHA 2IL8A 1I4RA 1PXUA 5F2DA 2XIWA 1AFPA 1PGBA 1RHPA 4FVMA 2F0SA 4XQJA 1VZ8A 5IGCA 2KA7A 2VXWA 1KLUD 2IW3A 4WRDA 4NDXA 4IUPA 4FP5D 1MPEA 2WXRA 2WXGA 1GPXA 2BDOA 5BN3A 2LMCA 2EYFA 5EKLA 1LTAD 1SXTA 2R7ZB 5TSSA 1T3QA 4F88A 4R3DA 4NZLB 1F2LA 2K3UA 2KMMA 3FEWX 1N5WA 1I7HA 3TDQA 2PKOA 2B63B 2TMPA 1WWTA 2D62A 3AE3B 2M2LA 1A3TA 1LACA 2CVRA 2B8GA 1HHVA 1ZOYB 2RA4A 4US9A 2JX5A 1STNA 2W55A 3T13A 2I38A 4GDKB 2B2UC 2J52A 2MEKA 2RMMA 1VCIA 3B2FA 1Q12A 4TMAB 1CZWA 4KHZA 4TSSA 1WVLA 2ICIA 4ZHPA 4C56C 3V2TA 2JXTA 1K8OA 5E1FA 2KEDA 3WOFA 3WCQA 1L0YB 5FKAC 2KQ4X 3OIPA 3ZJUA 2JA7B 3LXFA 1IKLA 3KF8A 4JK1C 2PW5A 1XLPA 2INPE 2EY5A 4UDUC 1T6BX 1KH0A 1FXAA 3TZUA 1Y8NB 2BDNA 2B2YC 1SFOB 1PLFA 5IIFA 3CIRB 2OXPA 4FYDA 5EJWA 1HA5A 2JXMB 4WORA 3PO2B 2F0OA 3FPUB 2DYOA 2LMCB 1ACCA 5ELFA 4LJZC 1A2UA 2V3PA 1QJOA 3ETRA 2JYEA 4G4KA 4DFAA 4ARIA 1EWHA 4BY7B 5KRUA 4TQUS 1D2BA 2PLPA 2BA1A 3S17B 4V190 1FEHA 4N9TA 3TZDA 1ICWA 1NAPA 3VA5A 5CBEE 4DXFA 1IGDA 3AM9A 3T3NA 5D3IB 2N9LA 1U4RA 1C9FA 4RF0A 2QIEB 1FR3A 1EIGA 3K0YA 3J9CA 1BR9A 2A69C 1H9JA 1PZJD 2PVGC 1AWDA 3AMUA 1X3QA 1RDPD 1VMPA 3D4RA 3SK8A 5C5LA 3I72A 3GTLB 2PZUA 2EDGA 1L6UA 2B2WA 2HCCA 2CJNA 4IUNA 3S1RB 3BK2A 2WU2B 1GUWA 3GP7A 3HVDA 3SR6A 3HVZA 1KDCA 2KQ3A 3HEJA 4A55A 4KKUA 4LMQD 4RF1A 3U9SA 1ZYRC 2WB1B 5T1GA 3EGRA 4HKZE 3CKIB 5M5XB 2NBFA 2JEBI 1O80A 1LT3D 5IGFA 4IZ8A 4YWGG 1QILA 3H6MA 3JAME 4L8JA 2CU3A 5HHDG 3I70A 1DM0B 1JB3A 5J22A 5FO7B 2OF1A 1DZ1A 1N63A 5I2YA 1DOLA 4LK1C 3WOEA 2BCOA 3IKJA 1PZID 2KJXA 2DY8A 3MTSA 1C4QA 4ZUIA 1VR9A 4RNAA 2LFNA 4C1NK 2NZ1D 1FD7D 4FF3A 4WURA 3VR4A 3H8HA 2ICEC 1NENB 3AEGB 4ZKBB 1ZXIA 2EYOA 1S5DD 3A8IE 5FOBB 4A90A 5E4XA 3K57A 1PUTA 1OFFA 2WDRB 4JBWA 2EYMA 2RSOA 5T8IA 3ABVB 3C3LA 4JPSA 4PV1C 5E4WC 1BDOA 2NVYB 3S15B 1GUSA 2WACA 3GS2A 2SNSA 1SNOA 1RTOA 2N88A 1WTXA 2WKDA 2PVOD 3HRZC 2EE1A 3OWEB 1Y1VB 3E0JA 1EZ8A 3LNNA 1QF6A 4OIJA 1HFGA 3P20A 2BE5D 3TSSA 1QOBA 3D6CA 1HZ6A 2D2CC 2F3WA 2IWHA 4X3TA 2A6HD 1C8CA 1EU3A 1ML0D 4HN7A 2SOBA 1KDAA 1UWXA 4A3DB 4TQ0A 5COYA 1YMHE 4ZQ3A 1TYGB 1G2SA 1YNJC 4IUVA 3NP8A 1C76A 4B0MA 4HSVA 1H9MA 1AZPA 3WDNA 3M4YA 3RZOB 4GZYC 5LL6X 5CMDA 5DM63 4KJNA 3LWEA 4FXCA 1JOOA 1TVXA 1B9RA 1QOGA 4KN4C 2HDMA 1QNKA 1C4PA 1Q1EA 3PZ8A 1JRPA 5DAUA 3BG3A 4PT5A 2LY7A 4MHEA 1HQRD 1TZOA 4BA2I 4XQNA 3NZ3A 1PTOF 1TS3A 2KAJA 4ITKA 4XQQA 4DNRB 3AN1A 1FMAD 4KKTA 5M9OA 2MH7A 2AX5A 4A8XC 4C3IG 3U4EG 1J9OA 3SXHA 3NQIA 2F0IA 5G5GA 1EY0A 4L23A 3Q8AA 1TWFB 1SF0A 3HRDD 1OQQA 1IGCA 5JJZA 3AB9A 4KI0A 2N7JA 3P75A 4U673 1QWYA 3ND8A 2IT1A 3TP6A 3SK5A 2VZKD 2AWNA 1QNUA 1D1KA 1FCLA 3ONAB 4OW0A 1S5CD 3VYUA 1QLBB 5M3MB 1VDVA 1R4QB 2Y0SB 3QWNA 1B3AA 1OXSC 1GOZA 2FJ2A 1ET6A 3P1MA 4IQZA 3BIID 5KNCA 2PIAA 4M0WA 5IT9L 2FE8A 4XXEA 1RTNA 1LTID 2N9KA