4DXFA

Crystal structure of staphylococcal superantigen-like protein 4
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
194
structure length
194
Chain Sequence
EINPKFKDLRAYYTKPSLEFKNEIGIILKKWTTIRFMNVVPDYFIYKIALVGKDDKKYGEGVHRNVDVFVVLEENNYNLEKYSVGGITKSNSKKVDHKAGVRITKEDNKGTISHDVSEFKITKEQISLKELDFKLRKQLIEKNNLYGNVGSGKIVIKMKNGGKYTFELHKKLQENRMADVIDGTNIDNIEVNIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional properties of staphylococcal superantigen-like protein 4
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Sugar binding protein
molecule keywords Staphylococcal enterotoxin-like toxin
total genus 52
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4dxfA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4dxfA01
3URYA 1LO5D 1PTOH 1KLGD 1EEID 1T5XD 1RCVD 2AQ3B 1UNSA 1CHPD 1S5BD 2J4XA 1HXYD 1QILA 4RCOA 1CT1D 2XRQD 3R2TA 3W2DA 1LT5D 2WV6D 1ET6A 1RD9D 2AQ1B 1LT6D 1YN5A 3OWEB 2Z8LA 2XRSD 1JR0D 4RGTA 1EEFD 1D5ZC 1I4RA 1SXTA 1EFID 1S5DD 2XN9C 4RHRA 1LTAD 1PRTC 1SBBB 1PZID 1JWUD 1UUPA 2R61A 1FNUA 2XNAC 3SEBA 1G8ZD 5ELEA 1EU4A 1JWMD 3BVZA 1PZJD 1ET9A 3BYTB 4RH6A 1YN4A 4RGMA 1BCPD 3BVGA 3MFGA 4OHJA 1HTLD 3BYYB 1GOZA 1TS5A 4RGNA 1F77A 1PRTD 4ZYSA 3EFXD 1AN8A 2ICIA 1XTCD 1JQYD 1EU3A 1STEA 1I4QA 3DWAA 5I4DA 1SE3A 2RDGA 4K6LA 1PTOC 1JCKB 1TY0A 1S5ED 4L63B 1L0XB 2TSSA 1RDPD 1LTSD 5D3IB 1RF2D 5ELBA 2CHBD 1PRTF 1S5FD 1LTBD 1FGBD 2G9HD 2SEBD 1DJRD 1PTOD 1D5XC 1FNWA 1YN3A 2RDHA 1CHQD 5ELCA 3CHBD 5TSSA 1ENFA 2QEJC 1TS4A 4BWGB 3DWPA 5FKAC 1PTOB 1V1OA 1D6EC 1TS2A 1HA5A 3V05A 4NZLB 3R8BA 1LTGD 4UDUC 1M4VA 1PTOF 5FK9C 1CK1A 5D3DA 1EWCA 2AQ2B 1D5MC 5ELDA 1I4HA 3TSSA 1BXTA 1B44D 1I4PA 1I4GA 1LTID 2IJ0A 2O2LD 1PYWD 1KTKA 1V1PB 1PRTB 1MD2D 3BZDB 1JWSD 1V1PA 3GP7A 4RGOS 4Z9CB 1BCPC 1BCPB 1FD7D 2NTTA 3MC0B 1ESFA 2IPKD 1TS3A 4DXFA 4O1NA 4TSSA 4DXGA 1CQVA 2QILA 1SE4A 1B1ZA 4C56C 3R2IA 1TY2A 4RFBA 1LT4D 1SJHD 3DWQA 1LT3D 1SE2A 1I4XA 3EA6A 3KLSX 1SJED 5ELFA 3BVMA 1LLRD 2NTSA 1XXGA 1BCPF 1LTTD 1S5CD 1FNVA 1HQRD 1AW7A 3O13A 1DYQA 1SEBD 1LTRD 1KLUD 1PZKD 4L6TB 1L0YB 4RHSA
chains in the Genus database with same CATH superfamily
2WXGA 3FKIG 1N60A 3CP0A 1KD1C 4PYZA 2JXXA 5LXIB 1BR9A 3W5UB 2HTME 4KKUA 5G55A 1E0BA 2OXPA 5A35A 1RCVD 2NBVB 5ELOA 1WTQA 1SYDA 4RG1A 2VQEL 4W9FA 2NVXH 4BKSA 5IGGA 5IT9E 1EY6A 4RCOA 2AHOB 2OJRA 2ZXRA 1FM0D 3W2DA 2SNMA 3MHSD 5BMGA 5FR3A 1O80A 3A8KE 1WTXA 2O5IC 2R7ZG 2BS3B 2L8JA 4DKAC 3GTOH 4WQMA 2WAQE 2C5CA 3Q3MC 1QVFA 1T3QA 1CM9A 2KMAA 5IWAL 1WTVA 1I4RA 4RHRA 2RHQB 3KF8A 5CGKA 1QUQA 4O2DA 3AMZA 2BB5A 4WWNA 4JI7L 4ZOHC 2M2LA 1XLQA 3A9JB 2R93H 3FVQA 5K36G 2N55A 1Y8PB 1WGKA 4RH6A 4KKTA 5CV9A 5TR5A 3A1QB 3AM9A 2YYZA 3D0FA 3DEPA 1JORA 3M7NA 3U4EG 2IW3A 5CV5A 1BKBA 3CPWA 3IFTA 1XPOA 1ASYA 1XMQQ 4ZYSA 3IHPC 4HIOA 2FNJB 3IAYA 2MSED 2XTIA 1T6BX 1GJZA 1VCIA 3NG0A 3T53B 2A5HA 1YVCA 1XNQL 5KHOA 5I4DA 2BKFA 2ZZPB 1WYGA 4A3MB 2JRIB 1DCZA 1CFMA 4ARCA 2C9OA 5D3IB 1SYCA 5H1SE 2KFJA 2OF1A 4ZK9B 2PCFB 4A3BB 2F4VQ 2EXZA 1F9PA 2CKZB 3DMUA 3EBEA 3HOYG 3M4PA 2RR9A 4P74A 4RA8A 3S16H 1H9KA 4YT0B 2KQSA 1N32L 2WXNA 3N30A 2JZ3B 5JPNC 2WU5B 2K14A 1K8RB 3PV0A 2D10A 3APDA 2O4XA 2F0QA 3ECIA 4ANUA 2WXOA 3TSSA 1LTID 4MJSB 4GN5A 3KDFB 3PUZA 1HR0Q 4OZBA 3UQAA 1SDFA 1TT5B 1B9RA 3BJUA 3PSIA 4W9HA 1K53A 1L1OB 3GP7A 2MP2A 1CZGA 2Z59B 1OXSC 1MJCA 2C35B 5GQOA 3ZJTA 2EPBA 2TMPA 3V96A 4EQOA 1BNZA 2QIEB 5C2TB 3MXNA 3X0WA 4XYQA 1CZPA 5G3LD 1IBXB 3DBSA 4BAXA 2KACA 4DR6Q 3D3RA 1C78A 3GOEA 3Q3NC 2M56B 3AU5A 5JVG3 1OXVA 1NSNS 5BYQA 2KA7A 3PIPA 2JA5B 5C0XJ 2N7EA 5IAAC 2YLMA 3U58A 5C3EG 5C5LA 2JA5H 1VQCA 1WY8A 2JEBI 3KLSX 1HPCA 3D6WA 2N78A 3A56A 2YEPF 2N1VA 2WAQG 4ZAIA 3NQIA 1E7ZA 3EGRA 4K5XA 3FAHA 2K3UA 1ESRA 5E3FA 4OGQC 2R7ZB 1BCPF 4YCUA 1X9NA 2NZHA 2IO0B 1HQRD 2JXMB 2VH1A 4M8AA 1TU2B 4OXPA 2ON8A 2A68D 1ZKHA 3MEFA 3OHXC 2B2VA 2ZPYA 2EVBA 2F0PA 3FPUB 4W9EA 5I6WA 3TP6A 1J6QA 4GS3A 4OIKA 3C19A 3FKIB 2RQXA 1Q7YC 4AJYB 4JPBW 5L83A 2JA7H 5IYBG 4A93H 4FNFA 2KMCA 1MI2A 2JA9A 1L2NA 3AE3B 1GB1A 3S1MH 2KWUB 3MHBA 3CQZB 1BUVT 4USAA 4KN4C 1P8LA 1UE7A 5JOBA 3K5MA 2B29A 2LJIA 4R9WA 1FR3A 5IE8A 1IZ6A 1SBBB 1QQRA 3MTNB 2RSOA 3AEEB 1X1MA 5JH5C 2LJ5A 1UUPA 3APFA 2HHHQ 5ELEA 1BO0A 5IGDA 3HFZB 2FBWB 2EY6A 2VB2X 3STBD 5JAVA 2JY6A 3DBLI 3IAM1 1QZHA 1Y1VG 2A1AA 4K14A 4DBGA 2J7QB 4DN4M 1VQJA 1EY9A 1L2FA 1WCMB 3K7AH 5IP9H 3S2HH 1U4PA 3EFXD 1E5WA 5J2RA 4LF6Q 2ICIA 2R2OA 4JV5Q 4G4KA 3AB5A 2BH2A 4TKOB 4CDEC 2CU3A 1TWCH 4IOCA 5J18A 3L9AX 2WX0A 3J7ZC 4HIMA 4MM3B 5DPRA 2V3SA 1LTSD 3KF6B 5C0XH 1H4RA 4KV2A 4IZ8A 4LF4Q 2PQAB 5JJKA 5FLMH 1ZXTA 1FNWA 5GMVA 4ZHPA 4EFOA 1RHPA 4ZYNA 3S14H 1J19A 4HMIA 3PO3B 5TSSA 1VRAB 1FEHA 4FF3A 3GTPH 3SK4A 1UE6A 3PO3H 4GKJQ 2E76C 4C3IH 5E6OA 4YSZB 1NBFC 4WQOB 1HA5A 1IHZA 4A3OA 4YY3Q 3AEAB 2FHTA 3CWIA 1OO9B 1TWGB 3V2TA 3M63B 2ZJRA 3I72A 4A3FB 4K0KQ 1WX7A 1B44D 4LMQD 2IJ0A 2L55A 5K5PA 3D8GA 4A3FH 5KRUA 3GTQB 4C3HG 3M4OH 1OEYA 4DK5A 5J1ZA 3HM3A 1SMYC 2AL6A 2D3AA 4ZLTF 1PRTB 4WORA 2EYOA 4X3KA 2KANA 3RULA 1V1PA 1P1AA 2WB1E 2UUCQ 5FLXE 2WXLA 4IO9A 2GVAA 1BCPC 2PMZB 4B9XA 1V86A 1FD7D 3V60A 2K25A 2CR5A 2BDNA 1SNCA 4H13C 4TSSA 4DHZE 4NXNQ 2QILA 1R4NI 4F7ZA 2EQSA 1B1ZA 2NVUI 2ZJDA 3R2IA 3VH4B 3ZTCA 1PFDA 1JICA 1I42A 5HI1A 4B3RL 4DR7L 4C00A 2L83A 1SJED 1EUVB 1UF0A 5G5GA 3QG1A 2AWTA 1SYEA 1HNXL 2DYOA 2RDBC 4LJZC 2D3BA 3BK2A 1X56A 4BY7H 5M5XB 3O13A 4UP9A 5FJ8H 3U4VA 3VTVA 2INPE 4LF5Q 3PO2H 5AUIA 4WAAA 4F1SA 3HVDA 3S1RH 3CCLA 4MSMB 5D7GA 1JRUA 3RN5A 1MJEA 4J15A 1PVOA 2ZXOA 1Y1WG 2KWCA 2QC8A 2VRRB 4OVZA 3RNCC 5C3WA 1V6EA 4WJ3M 2K1FA 3APCA 4GOPB 3DLLA 3R2TA 4C3HB 3F2CA 2MLBA 3RMHA 4A75A 2C9WB 4N58A 2JE6I 4UAIA 2JVCA 2NBWB 5EE3A 3J81E 2KEEA 2F1MA 3GZNB 1PGXA 1VZ8A 1D1KA 1YD8U 3ZXRA 3ZJUA 4IFDI 3ZRCA 2F0WA 1SXTA 1NE3A 1P16A 3K5NA 3P7JA 5CORA 2QJLA 4OIJA 4DAPA 1E8YA 5KHQA 4IC7B 4A3CH 2B39A 4A3GH 3A0JA 3S17H 1WGGA 3VA5A 3VDYA 2JA8G 3OLMD 1HCZA 3L2PA 2XWJB 1FO4A 1H9JA 2WXIA 2DNCA 1HTLD 3UIPB 5E7NA 1GNUA 1ZE3D 3S1QH 4PS3A 1K8AC 2NPTB 2FE8A 1PYSB 1XNQQ 3S1QB 3NK9A 3ZNID 1JC7A 1NR2A 5FR6A 2W54A 3KYDD 3W1YA 1JQYD 1A62A 1ZXIA 1MI0A 3VR8B 1I94Q 3N1YC 3EECA 1XD3B 3OYYA 4FADA 3NZUA 3QA8A 1MBYA 4YHHQ 1VDZA 3AE9B 2I2YA 2WXRA 2NN6H 3I4OA 2MJ3A 2EYFA 2K4KA 1VQ8A 2QSDA 1RL2A 3UINB 1DJRD 5JXVA 1VQ7A 1T9HA 4EVOA 2DZMA 3M3YH 4PQXA 1ZGUB 2LFNA 2BVCA 2BGFA 2SOBA 1F2YA 5DLQE 3HOZG 4B3SQ 1RTNA 3ERSX 4RKLA 4OO1H 2Z6KA 5C1ZA 1JMCA 5J22A 3A5UA 3GTOB 1IBMQ 5IYDH 2EXDA 3U52E 2B8GA 3QB3A 3RLOA 5DM63 1WD1A 1FMAD 3V61A 4DGZA 2J42A 3HOUG 3FRPB 2N88A 3L17A 2MBEA 4A3IB 1HA6A 1PH9A 1YNNC 2PZWA 1WFYA 1K8MA 5BMIA 2L52A 4X65L 1NEKB 5IP7H 2R93B 2EY1A 2MJDA 2RBMA 3IAS1 3HOZH 2JWUA 1XMOQ 4ACFA 1ENAA 1Y1WB 3DBHI 2B2TC 3NPPA 5M3MG 1ICFB 3F2DA 4HIDA 4GNXB 1G51A 2QMTA 2V4LA 3PZ8A 4OX9L 1FJGQ 1UH6A 3B2GA 4B0MA 4A55A 1Q82C 2SDFA 4GKJL 1SSNA 3HOUB 4JVZA 2ZNVB 1TY2A 4JI5L 3JYUA 2KT7A 5AUKA 1Z5SB 2Z1CA 1SE2A 2R92H 3GTKB 3SK5A 2LFIA 3MJWA 2XGTA 1ZKOA 1ENCA 2EKEC 3N1XC 3N52A 4GNXC 2F4VL 1EL0A 4LNIA 1TWFB 3HKZB 3P4RB 2F0EA 4DNRB 4HK2A 1MSGA 3NS8A 4NAWB 4ARIA 2UXBQ 3DM3A 5ISRA 2WDQB 3U2SC 5EQ0A 2MWSB 1YI2A 4PS8A 3URYA 3PTFC 5EBDA 3NUHB 3UE1A 1KNAA 3ONAB 2RVLA 5CV8A 3CCUA 4A3CG 1KLGD 1RFAA 4HCNB 4PS7A 2QCPX 3RNEC 5JHBA 2ZCBA 4BBNC 3UQBA 4U68A 2J4XA 4ME5A 1A3TA 1PQSA 3LXFA 3AFQA 5MPOA 2CW0C 4N9F4 5EBCA 4AP4C 4DV3Q 2Y5CA 2GI9A 3K5LA 1DM0B 3DUZA 2KDBA 5BR8L 3RZOB 3OMGA 4WH4A 4ZUIA 3AE2B 3K9PB 1D5ZC 1VLBA 1IKMA 4UPAA 1ONLA 3FILA 2Z6BA 4KVGB 3GQBA 1J7BA 1SE9A 1VQAA 1ZDVA 1WX9A 4RMFA 4LF9L 2UXDQ 1WXVA 4HWIB 4ZRPA 3T1HL 3B2FA 1L5PA 2LI5A 2MBHA 1LYLA 2O2VA 1GVPA 4KY6A 1JOQA 1N9WA 3U9SA 2L00B 2K01A 5FOBB 3BVGA 3MXNB 1UEAB 1AWDA 3RLNA 3IBEA 5KNDA 4ZKCB 3I73A 4BY7G 5HFYA 5COYA 1C4CA 2LVPA 4HR7B 3PIOA 3KJOA 4WWOA 4XGAB 3HOUH 1XTCD 4MJSA 5E6JA 2WKCA 1YNTE 2LY7A 3J81i 1Y69U 4BOSC 3OWFA 1KL9A 2RHSB 3U4ZA 5IYDG 1UELA 3V6EB 4AUQC 4JWUC 4MEMA 4B9KA 3VYUA 1LTBD 2G9HD 4N8X1 2LKVA 1DXMA 1HQMC 4ODGA 2M17A 5LMUL 1WTPA 3MZ5A 5M3FB 3HOVG 1C79A 2WKDA 2ZTEA 2G3QB 1HZAA 5M3FH 1ENFA 1VQ6A 1U4MA 1CTMA 2QEJC 2CKHB 3P42A 3DWPA 1QF6A 5EGTA 1V1OA 4FXGC 1XWEA 3CXCA 3K57A 2HQEA 4ANWA 2MO1A 4NXNL 2HDEA 3BDCA 2SNSA 1PTOF 1WGDA 3CCVA 4EZJA 4HEA1 3HEJA 3FC4A 1BOSA 1UE5A 1SNQA 2PQEA 1Q5WB 5JEAJ 2JZPA 1YNJC 1QOHA 4G57A 1WRDB 2Z0EB 5CR3A 1A6XA 2DZKA 3Q3JA 1J5EL 2KFKB 2WXKA 3D32A 3T1YQ 4A3BG 4K2KA 1RIPA 4IUTA 5M3FG 3Q6SA 3HOVB 5JJIA 1V8CA 2OQKA 1UEBA 2HE7A 3HOVH 1TR5A 2JA8H 1WJUA 3VYTA 5FLMG 1H9SA 3RD4A 4DUYL 1ZOYB 1FPYA 2BT6A 1VD2A 1U4RA 1DOMA 4IQZA 4L5TA 5AJ3L 2WAQB 3OW2A 1JJ2A 2F3IA 4II3B 4NPNA 2PZTA 2DY8A 2UUBL 4RFBA 5IIFA 4A9AA 1ZYRD 3J7YW 3GTLB 4TV3A 4I6NB 2JPHA 3TS0A 2NPTA 5ELFA 4IM3A 3TL5A 4LF5L 1B3AA 4K3CA 3LNNA 1P7FA 4OVVA 5IP9G 3VFKA 5EAYA 3KVFB 4QMGA 1FNVA 2JK8A 3PGZA 2DY7A 4GN3B 2LHEA 4FJZA 2IO3B 3CKIB 2KVMA 4L6TB 1WOCA 2KFKA 4XYOA 1K51A 4A8XC 3DEOA 4C3IB 1J7CA 4QL5A 3B6YA 4ULLA 4HJ8A 3DBLB 3A33B 3G6JB 4LLGM 2HD5B 4GNXA 4A3DB 2AQ3B 2A8VA 2ZW0A 4FXCA 3I3CA 2DYMA 4BXXG 4M1UB 2K8CA 3ONSA 4JOIC 4FHJA 3KJPA 5JJLA 3HS0C 3NHHA 2F0UA 3M4QA 4A93G 1HHVA 1EM7A 1STGA 5T1GA 5KIXA 1NY4A 1DOLA 2ENBA 5FO9B 4QIWE 1EFID 3NBHA 3H3VC 2B2TA 4B08A 1I94L 4G7OC 3H7SA 3ZW3A 3U7ZA 3K7UC 4H0LC 1S1QB 1HZ6A 2HD3A 4FJVB 2FINB 3IKJA 5GAHC 2DHZA 3HHMA 1EY0A 1WXMA 3BVZA 3BYTB 3OW7A 1RWSA 1Q8KA 2IL8A 2LUMA 1YN4A 4LF7Q 5HKHA 1JQ4A 1EIHA 1XCTL 2BWFA 2VQEQ 1EF5A 1J5EQ 2K5PA 4KK7A 4R1JA 1F77A 3S16B 1B2TA 1S72A 2WP9B 1G2SA 4JYAL 1CQFA 4ILWA 1U0LA 1WCMH 4US8A 4B3SL 5CYUA 2HCCA 1TZOA 1IW7D 4K6LA 4JI1L 2CQOA 4L63B 4EQNA 3PO3G 1I6HB 1N36L 4A3DG 4PV1C 2K39A 2W3RA 5JVH3 4MH0E 4C2MB 2YEPB 1PTOD 3QWNA 1PH4A 1K8OA 2HIVA 5M3MH 2J0JA 1XMOL 3WAMA 3P2BA 4BY1B 2INCC 3PS6A 3RN9C 5M9OA 3ZXVA 3H3VI 2HT1A 1YX5B 1RJTA 3DQVA 4JQWC 1JOKA 2QCZA 4E74A 4EZKA 4BBRB 2BE5D 1A15A 4KKIA 2N7DA 3I55A 3HM6X 1FXTB 3H3VH 3RNAC 1VQIA 2VQFQ 2QDBA 3WAPA 3CPFA 4LDTB 5JHAA 1N5WA 2Q5WD 1OXUA 2F52A 3C2PA 1I4PA 1FFVA 2I1JA 4HCSA 3SE0A 1TKYA 4YWLA 1EIFA 1L6VA 3O65B 2QW7A 3CW2C 3J80E 2I0QA 1KFYB 4WJQA 3SU8X 4YTMB 3A7AB 1PH6A 2YV5A 5E6PA 2Y0SB 4AIMA 4OX9Q 4WJWA 1FJGL 1HE8A 2K6DB 2WX1A 3DHHC 4GDKA 1XMQL 1AFPA 1H9RA 3TP7A 3W1SC 2ACZB 2KOXA 1S4ZA 3DVNV 3IT4B 4ALPA 1K73C 4P1BC 2H1EA 2VW9A 1L0WA 2PNRC 3MWYW 5KYIA 2OEOA 1C1YB 1E8XA 1VCBA 2GOWA 5KYLA 4A93B 1G2TA 1WE6A 4MGZE 4DV0L 1E3PA 4F88A 4CYEA 1J7AA 4ZRKA 4I6PA 2D0OA 1Y8RC 1L1OC 4YL8A 2J0TD 1PDXA 4G11A 2L76A 1X3FA 1SIFA 3NOBA 4DV4L 2K8BA 4IFDJ 2ZM6Q 4XQNA 3I7FA 4DUYQ 3Q22A 1A70A 1K52A 4DHJB 3PLVA 1W3SA 4A76A 5C4JB 1K50A 1KHIA 3H91A 2A6ED 2G4DB 3Q8BA 2N9KA 1XF5L 1ZW7A 1J8IA 1VQ5A 2K05A 4ME3A 5CV6A 3SHQA 1SLJA 2BOSA 4KSKC 3JAME 3HIZA 1N8RC 2QDFA 4IUQA 4P72A 4H02A 3UDFA 2R92G 5D94A 2G4SA 1BBWA 2K5NA 1ICWA 3EFCA 2X6GA 1CJEA 2KLCA 4XT3B 3NZ3A 1PRTC 2LUEA 3S15B 2JYEA 3QCAA 1XQQA 1F2MA 3GE8C 3LDZE 3GTJB 1SNOA 5C0XI 2GLSA 4PMWA 4DDGD 3U7DA 1O7LA 3DBRI 4RGMA 3NE5B 3CIRB 3H1UA 3MFGA 3PO2G 1E9MA 3ZNGC 3K81C 3IT6B 4XIGS 2AUJD 1NNXA 5D14A 2V4DA 3TQYA 3K59A 3KUDB 4IPHA 3M62B 1FGUA 2L4NA 3LB8C 4KGTA 2NB0A 1VQKA 1P0RA 4C7ZA 2A6EC 4MNOA 1YQBA 5JPMC 1BQQT 2B63H 1EWIA 2K33A 5CC4A 1DGJA 1QOBA 3ETRA 4QY7A 2B63B 3C8YA 3DWAA 3H0GB 3GTQH 2D2QA 3W3AA 1JCKB 1S5ED 2VZKB 2EE1A 1YIWA 2KJXA 4IWPA 3A7LA 4JCVE 4OO1G 2G5DA 2HCIA 4IN3A 4QUCA 1TKWB 2L11A 4DR1L 2OJWA 4C3JH 3E6ZX 4PNYA 2ALYB 1TKGA 2F0NA 3KLRA 1S3OA 3T3OA 3T1YL 2VZKD 2WDRB 4W9DA 5E4WC 4BWGB 2PE6B 3FDTA 2PW5A 3P63A 1FCCC 3ZIMA 1UWVA 4HROA 2A74C 4BKTA 2KCNA 3J7AF 1KAWA 4YWMA 1WJNA 3AH7A 1CKNB 2AQ2B 2F0IA 5LMNW 4POFA 2MBOA 3NBHB 4TMAB 1MHXA 3BINA 2AWNA 4CDCC 3VR6A 4ICUA 3CRLC 4C3IG 3BZDB 3PO2B 2WFWA 4X64Q 2E6XA 3PHXB 1Y1VB 4JE3B 4P1CC 4PT5A 3HOZB 1FFUA 1GUAB 1RLFA 2PJHA 2ZVNA 4NJ7A 3I9V1 3DHIC 4W9LA 4A3MG 2BA1A 3T4AC 1SFOH 1I7HA 2XIWA 4BBSB 3RMKC 1EQRA 4JI8L 1Q1OA 1E24A 2E8GA 4FLHA 4IWQA 1GUOA 4NPSA 2KMMA 2PTLA 5H92C 3IFDA 1PMRA 4URKA 5D6JB 3TS2A 2DZJA 4DPGA 4FHKA 2IHFA 4R8NA 3DWMA 3OTOL 2HIXA 1RKNA 5LMUQ 2VS1A 3GTMH 1IL2A 1STBA 3RLFA 4IDIA 3HOWG 4KD3A 4I6LB 2W82A 3S1NB 4MGIE 3KWVA 4MDKE 2WYQA 4GLSC 4XE0A 1XCQL 2JN4A 1CSQA 2XSCA 4TQ1A 1ML0D 4JI4L 5C4ZA 4GKKQ 5I9OA 3CCMA 2H5XA 1EUJA 1D2BA 5C44G 3K0YA 3SDLC 2YTXA 1CHPD 5FJ8G 3QHTA 3ZTDA 3G48A 1J0GA 3NXWA 5BN4A 4C7YA 1HXYD 2ZJQA 2I5LX 5JEAH 4GDLB 3PRZA 3HKSA 1ET6A 4YWKA 3K6OA 5IY0A 2BE5C 2Q2HA 1YN5A 2PI2E 4JYAQ 1UBIA 5IYBH 2Q2IA 4WJPA 2FMMA 2IY5B 3BZCA 3RZOH 2JA7G 2WDTB 4CO7A 2VB3X 4JWSC 1V81A 1KOTA 2RF4A 3L7ZC 4W9IA 4JI1Q 1VR9A 4MM3A 2XNAC 3Q24A 3BZKA 2J7ZA 3L0OA 4ZRQA 2VUMH 3ITPA 1EY4A 5C4XB 1OTRB 1YBYA 2KVZA 3WIMA 1H8CA 2PW9A 3K58A 4HJ9A 2BYTA 4TRDA 4RMAA 2WWZA 3CCSA 4A3FG 1LV9A 4X3UA 3ZNHB 4NP5A 4JV5L 5CX3A 2QF7A 2HJ1A 4PZ8A 2ATWA 5C3EH 2M4NA 2K52A 4ZRIA 1QNKA 1SE3A 2K5VA 1Z6HA 3K5OA 2CQAA 3RNBC 4JIOU 2WGSA 2IY1B 1O7IA 3VA7A 4K1RB 4BA1I 3RZDB 5DM73 4HJ5A 4XDDA 4HXDA 1LABA 5AZFA 4LUVA 1SIJA 1SE8A 2ASBA 1G91A 1KLVA 2XBBC 1CA6A 3OPOA 3TMEA 2E2DC 4YY3L 1AARA 2GRIA 3ULPA 3CU7A 2E5LQ 3B9JA 4L5RC 1GUWA 1DOXA 3TIXA 4F8MA 3TEZA 4R8IA 3GTKH 5IO9A 2WU2B 2VZAA 3R3OA 1YJNA 2LWPA 2MQHA 3QIAA 4P75A 3VUWA 4A90A 3G6EA 3MTSA 1TWFH 2JT4B 1SYBA 1J8CA 1L0VB 4IWOA 1YHBA 3SHLA 2WNMA 2V4IB 3CF5A 1TWAB 5C4XG 3UGBB 2RCFA 1D4BA 4NXMQ 1O78A 1TYGB 1XTDA 4WWMA 5CTRC 1KRHA 2WXQA 4LK1C 5C44B 1TGZB 3QX1A 2ZW1A 1VQLA 2Q2TA 1BDOA 2KJ6A 2YVCA 3DXJC 2Y0SE 2Z4IA 2ZJPA 1NDDA 3MHZA 4DR3Q 3MXUA 4JX1C 2VUMB 4YHHL 4M0WB 4L5QA 1N34L 4B6WA 4H7BA 1EQQA 1GD7A 2PYKA 1I4XA 4O0AA 4X6AH 1IPGA 1YJIA 4DV7Q 4HIKA 4LK0M 5D2MB 1LLRD 4UP7A 2QA4A 2ZNVC 1VQ4A 4YTPB 1B8AA 5CV4A 5M3MB 4IUPA 3GO5A 2LVOA 2F0SA 2H88B 4LUOA 3T51B 4X62L 1E1TA 4A3LG 3L10B 4HRSA 4ICVA 2L3ZA 5EJWA 1I5FA 4OWTB 3WA0A 1QCBD 3X23A 1XNRL 4DV2L 4E3CA 3FPPA 1EY8A 3AE7B 1C4AA 1WJ6A 3QAQA 3C1EA 3AULA 4E6IA 4KHVA 1GHJA 1HZBA 2Z4HA 1VQPA 1JROA 3SR6A 4KTAA 4DR2Q 1NUCA 2C5LC 2KC1A 1NYRA 4H2AA 3CRKC 1VMPA 2LASA 1A5RA 1E0ZA 3CF6E 2WLBA 1HFNA 1HNWQ 1WYDA 2MFIA 1QOGA 4NQKE 4YXDB 4WWPA 2NZ1D 3LX0A 4V190 4HLEA 3CC2A 2UUAL 5CBAE 2FAZA 3MC9A 4BS9A 5IGFA 3NTHA 4NNJB 2DJFC 4K7WA 4A3PA 2PMZE 4BKSD 4CKCA 2INDC 3ZJVA 5IOCA 1KH0A 2NMQA 2X8XX 3VVWB 1C3TA 3A9KB 4GOCA 5M5WH 3FKIH 1KM7A 3DHGC 3UDXA 3UDIA 1BCPD 1GO3E 1SYFA 2K5DA 1C9FA 2KDFB 4OHJA 2A69D 2Z0SA 5KEEA 4DV1Q 4EGVA 2OCEA 2L0FA 1KJTA 4JLCA 2N0SB 4RF1A 4XWWA 2MGSA 2A19A 4DR4L 2IBIB 1HNZL 2NVQB 4DAYA 3OJ4B 1V1QA 4DXAB 4EX5A 2DN8A 5HGTA 5C44H 1NCVA 2B3GA 4A3EG 1NR4A 4OWWB 4XQJA 2PPBC 1I4QA 2FCSA 4DAMA 1CI3M 1A3UA 1EY5A 2KDMA 3KYCD 1YJWA 1TWHH 3WDNA 5EPJA 4KKSA 4IUVA 4IKGA 2JSVX 4L8JA 2CHBD 1PRTF 3B0AA 1TIID 1Q90A 2VY3A 2NS5A 3I5JC 2F0VA 4ZRJA 1PFSA 1HZ5A 1VQOA 2KQ3A 2D3GA 2O6VA 4B3ML 3VR9B 4X64L 3R7QA 4BOZB 1QE6A 5E1FA 3HG9A 2WXJA 2DUDA 2X69A 1D6EC 2KVRA 1VF7A 3CAMA 1NBWA 2UU7A 2YU9B 4AH6A 5A2QE 5I6YA 1FYCA 1WR1A 5D3DA 3X3NA 4DV2Q 3DBRB 5ELDA 3AECB 1FXIA 2K8HA 2O2LD 1TBEA 3MAQA 1D1IA 3KUPA 2K04A 2D07B 4LNKA 1JB7A 3EJIA 4QCLA 3QARA 4PMCA 3RN2A 1LQBA 2HJ8A 1WGHA 3A9JA 3RZWC 2J0MA 4RGOS 1P98A 4C3JG 3KWLA 2N3SA 4LW1A 2JRHA 3WAOA 1KNEA 4JI5Q 3NTIA 3WWVA 4K7SA 5EE1A 1A2UA 1SNPA 4O1NA 3DPDA 3KUZA 4DXGA 4NY0A 4F8CB 4QJFA 4A3EB 2K50A 1FRRA 3KYHC 4BFRA 2I1KA 1TWGH 4G7HC 4OZAA 4GKKL 2I5MX 2I46A 1N61A 2C60A 5HG2A 1WSPA 3Q14C 4FO2A 1HZ9A 2JA7B 4REZA 2MRPA 1KF6B 1VQNA 2DWQA 3HGBA 5DPSA 1GC7A 4YWGG 3NWSA 1VS0A 3CQZH 1STNA 4DK6C 4IUUA 2N8NA 2CWPA 1SGHA 4C3JB 3KQ4A 1MGSA 4OZCA 2EYMA 2CJOA 4LF8Q 4BA2I 1ZPSA 4KX6B 4FA6A 2GBKA 2G45B 2EJMA 5L37A 1GB4A 2IX3A 2BS2B 3TZUA 4DR5L 1RRBA 1TT2A 2IX1A 5EKIA 2KDEB 3VR3A 3ABVB 4HSVA 4IURA 3H9DA 3RPFC 3ZNZB 2KTRA 1UNSA 5C4JH 1KAAA 1M94A 3AE4B 3I63C 3NVYA 2MEKA 3W1SA 1EOVA 5C3XA 1T0RC 1MFWA 5BR8Q 3QWZB 2F3VA 2MUYA 1IYVA 2XK5A 3HVZA 4QIWB 1JE4A 3OWEB 4KHPQ 3UE0A 2PZUA 4AYBB 2KN4A 3NWTA 3S1RB 2JWZA 1ZP0B 2KZRA 1F9QA 4JI3Q 1ZUD2 1JWUD 1JALA 4WIPA 2NBUA 3SEBA 2ZCCA 1EU4A 3C1FA 2BQQA 2M8SA 5CMDA 1C9OA 1LM0A 4J1MA 3U30A 4KI0A 2QGQA 2E5LL 4A3IG 4GOPA 3VXWA 3RUZA 1E7UA 2F0GA 4F87A 3P1HA 4PG3A 1QLBB 1K3BC 4DAYB 1UZXB 2EELA 2Q8TA 5FO7B 1R9TH 3ZGZA 1XT9B 3A8IE 1QZGA 4ASWC 1GG3A 2PO4A 4A20A 1BVSA 4R3DA 2TSSA 3S17B 1PH3A 1IKLA 3RNUA 3A9KA 5IT9c 2K9XA 2EJFC 2O5JC 4N9PA 4XXEA 1GKHA 2F0TA 3KLSA 1YJ9A 2JA6G 2A4ZA 2G1EA 1S40A 3DBHB 3NY5A 3CC4A 1TS2A 2MQJA 4X3SA 3PUYA 1F52A 4L2YA 1C77A 1Q1BA 3TCAA 5IGEA 4M8NA 1M4VA 1SMXA 4M0WA 2B63G 4WJOA 1SROA 2CW0D 1EIYB 1VQBA 3CSFA 3JSVA 3OMCA 1WGRA 4IOIE 2CU1A 2BWES 5G3LF 1W6JA 2BA0A 3GDEA 3VR5A 5IYCG 4UHVA 4JI6Q 2W55A 5C5MA 3VTUA 3J7AV 3PRPB 5IKCM 1SAPA 2WHIA 3TBLD 4PZ6A 2KCCA 4NKLA 1V1PB 2LRWA 4BBSG 1HR0L 3HOYB 1OQQA 4RWSC 3JC66 2ASQA 4NQLB 3TEWA 2FIFA 4K8IA 5M5XH 2WXPA 5BYRA 3H94A 4Z9CB 1QUQB 2NUCA 4MIUA 2LGIA 2ZPNA 2JXTA 1WTRA 3JW0X 3ZO5B 2NTTA 2UUBQ 4X62Q 1SFOB 2KX0A 1YQ4B 4LUZA 4C56C 2DNFA 2OHFA 3E9IA 3VYRA 3A55A 1LT3D 2NVTB 3UIOB 4B0EA 3ZJYC 1EYGA 2KNBA 3N9YC 4IM0A 3IG3A 1LGRA 3BVMA 4KN7C 1PFMA 4TUUA 3J7A5 2KQ4X 1CKMA 1CSPA 1LACA 3EN2A 4DV6L 1DZ1A 3QR8A 1WMHB 4KZCA 3I4LA 3I2ZA 1KDAA 3I90A 3SK8A 4JOIA 2PQAA 1VQGA 1WM2A 5M5YB 3S2DH 4KJNA 2KK8A 5AFWA 1P7EA 2XEWA 1L0YB 5M5YH 2MX2A 4GLAC 1BT0A 2UUAQ 5HURA 2EMSA 3J81j 1RAXA 3PO0A 4FYDA 1ILQA 4K8JA 4GB9A 1X3GA 2W3SA 3QO2A 4A3GB 4A3LH 2Z0DB 2K6QA 3NRZA 4DUZL 1F2RI 1E8ZA 2JYOA 3ICEA 4MSQB 4FXDA 3T16A 1PH7A 1YJJA 4LF7L 4IW0A 1G6JA 1LM8B 1NMFA 2OQ0A 1HRJA 1WRIA 1WI5A 3HOXG 2KN5A 4C4VB 1JR0D 3I8ZA 2UU9L 3Q8EA 1R7SA 1EEFD 4AOFA 2KBNA 4BXXH 1HTPA 1EWYC 2UWQA 4IUMB 2G9DA 3A8JE 4TKNA 4DR3L 3EHVA 5GADC 2LSSA 5KNBA 1X3EA 2PVGC 4G7ZC 2K5WA 1VDVA 3P4QB 5BMHA 1E10A 1G8ZD 2JA6B 4B3RQ 4AQYL 3L54A 3CCJA 4KHZA 2GA4B 4KV6A 1QG7A 1N36Q 3QJYA 1XO3A 2L7RA 5C4XH 4KY7A 4FF2A 2CHWA 5FLXc 4Q2JA 4XWTA 1E90A 4GIVA 4DNIA 4HKZE 5BN3A 3IFWB 3PF4A 1JT8A 1AN8A 2KTFA 3ENEA 2R6GA 1XPUA 2EIFA 3H6MA 4FBJB 3PREA 1STEA 1GHKA 2H89B 2NYZD 1CKNA 3PUXA 1FVIA 4A3KH 1PTOC 1CZWA 4C1NI 4WJ4A 4IFDG 4XDCA 1S5FD 2SEBD 2KKCA 4M01A 2GB1A 3TEHB 5EE0A 1WJJA 2IGGA 4HVBA 3F2UA 3I70A 4FJYA 2GN5A 4BBNF 4FN2A 2FMCA 3STBC 1PTOB 1R4PB 1TZ1A 1JJGA 1LTGD 1R4QB 5IOIA 3WALA 3MXGA 4K0KL 4KKJA 1D5MC 2FCNA 3AE5B 3HRDD 1JJCB 3GV3A 1PGBA 4LWCA 3BG3A 3OIQA 3F1ZA 2UYZB 3OG5A 1L1OA 4K6DA 4V0BA 1MD2D 1BBXC 1YZ6A 2PIAA 1TWAH 1R4NB 2KJRA 3TUOA 1EZ6A 3TJPA 4S0RA 2PI2A 2VUMG 4DR1Q 5JZEB 5AEKB 1WVLA 4P73A 1F9RA 2EZVA 3T3NA 3E56A 2B2WA 2KWDA 4LF8L 1KABA 1YOVB 1CQVA 1H9SB 2KOLA 4RM8A 2MPMA 2MCNB 3H0GG 4DR5Q 3CCEA 2B2UA 4AJWA 3G71A 2NVXB 3NHEB 1DGSA 4ZRZA 1UD7A 3NELA 4Q5VA 1F9SA 3HP3A 3IL8A 3KK7A 4I65A 2MHVA 1BMLC 4S17A 5DCNA 2ZVOA 2MBBB 2KQ7A 4HTHA 4BBRG 1BF4A 2RPVA 1P9DU 4LTUA 4LJOB 2PVOD 3E5SA 3UDGA 1PLFA 4GLVB 3J81c 2MJ8A 1VMCA 3VYSA 1H9MA 4QF4A 1LO5D 1ZYRC 2MP1A 4ZCKA 1EIGA 1K83H 1YMHE 1N63A 1MJDA 1Q12A 3H15A 1D7QA 4MN3A 1RM6C 2FCQA 4X65Q 1OEYJ 4QQBX 1R4MI 2BYVE 3HOWH 4R4QA 3Q0AA 1LT5D 2Q2UA 3HOWB 2AQ1B 4K3BA 1A0IA 1C4PA 3MJ5A 1I50B 3Q8FA 1WMHA 4UY8C 4JI3L 1WD0A 1Q10A 1VQEA 5C3EB 3I91A 1UGJA 3HUIA 1JE5A 1U5KA 3NSWA 2XN9C 2D62A 2PEAA 3BDLA 4IOAA 3RCZA 1NYQA 1N33Q 1JWAD 4NMZA 4CKBA 3RZDH 4WURA 1RTOA 4A3MH 1FNUA 2RA4A 3D4WA 1DONA 4G0NB 1C8CA 4Y7NH 1IW7C 2DZIA 2KCMA 2DJGC 1X54A 2WACA 5EPLA 2Y3AA 4PYUA 2BCOA 4A3BH 1HTQA 3WOFA 1M8AA 1PH1A 2BS4B 3K0XA 3KW5B 1GOZA 4DUZQ 1IYFA 2BTEA 1IBLQ 2VXWA 2NZOA 1Q8IA 2NWGA 1V43A 2L12A 1SSOA 3FEWX 5FLXL 2UU9Q 3F8TA 4YSYB 4ZDVA 3S1MB 4EE2A 2L9HA 2IX0A 4K5WA 5EKLA 2KUMA 4MZ9A 3ER0A 2BPSA 2O6VD 3TBIB 1VQ9A 3EFUA 1FGBD 5J39A 3P1MA 4BZAA 4O42A 3OSOA 2E3TA 1YN3A 1VQFA 3KFUA 1I6VC 4KHPL 1G6PA 1AYFA 1RODA 3A74A 2ZM6L 3A4RA 3CCQA 3NENA 4II2B 3S2AA 4EOYA 3AE8B 5IP7G 2KEDA 1EYDA 3R8BA 5LNK1 4JI6L 4IUNA 2OEDA 1YHQA 3S2HB 3EQLC 4NJCA 3W1BA 2UXDL 3JAMi 4MGKE 1GUNA 4NAWA 1BXTA 2XWBB 2GBRA 1I4GA 3W5OA 3PUWA 2WB1B 2HDMA 2GBMA 2KO3A 1K0RA 4HCPB 1LTLA 5J3BA 2DNEA 2OWOA 4JI2L 5BYSA 2QKIC 1MHWC 3PQIA 1IUEA 3AYHB 4DK1A 3J81L 2N1WA 1PFNA 5G5HA 1CUKA 3GTPB 4LNQA 1F9JA 3GZNI 4IALA 3MC0B 4BVUC 4B9WA 1XX8A 2OOBB 4JI8Q 4A3DH 4KY5A 1QZEA 1W2BA 1Z2MA 3EC8A 2A68C 3H7PA 3A1QA 3ZRFA 3A4SC 5BO4B 5CBEE 2DAFA 3KOJA 3D4RA 3VAWA 3DWQA 3L13A 1WTOA 2AYOB 3RI7C 1EF1A 2LXAA 3RFZB 2K28A 2MNAA 4ANVA 2IDYA 2M1MA 1VQMA 2RKSA 2YTYA 2PNHA 2UXBL 1STYA 1STHA 3I4MH 4AS1A 4K81A 1UWMA 3GD7A 3RNGC 5GAEC 2EJGC 2B76B 2WXMA 3ULLA 2V0GA 2K22A 3ZDMC 1EQVA 2E2JH 2V1YA 3M4YA 1EEID 3J80i 1PH8A 1JRPA 3PRMB 3AN1A 2SAKA 3QQ8B 4LFCQ 4GU2A 4OW0A 4W9JA 3RZFA 3N1ZC 1S5BD 2IY0B 2FXQA 3U9OA 3I4MG 2RCNA 3HKZG 3S9WA 4MGYE 2LXJA 1NTGA 1K9MC 2EKIA 2KX3A 1DOKA 1RD9D 5E6NA 1N62A 4DV7L 1LT6D 3T13A 2V1CC 3AU4A 3CC7A 4B3TL 2IO2B 3H6NA 2EYHA 3ZKJC 4HN7A 2K5QA 4HKQA 2D9UA 1X3QA 1PA6A 3DM1A 4P2CB 2DYBA 1S5DD 3AFPA 2C7NB 4W9KA 4HJGE 2KAJA 3ZVVA 2QHOA 2DBYA 2JQOA 2JZZA 2BKRB 2L15A 1I6HH 1EO6A 4EZLA 1PZJD 3KH0A 3PLUA 4BY1H 2J53A 4JG2A 5C3JB 2F0LA 3S14B 1BBUA 2N7JA 3U8ZA 1FCLA 5IWAQ 4BBRH 4G50A 4P7IA 1V49A 1DOYA 5I2YA 4QUFA 2F0MA 2L5TA 3IRBA 4DU9A 4DV5L 1JMLA 1QWYA 1GAQB 1IGDA 1TKEA 2GBNA 5AZGA 2MBQA 4I7AA 1V9JA 3ZDTA 2PE9A 3JSVB 2RDGA 1IBKQ 3GTJH 1L0XB 2KDIA 2E74C 3RR5A 3DOWA 1QOFA 3B1LX 2IGDA 5D65A 3I4MB 2FJ2A 3F2BA 4LFBL 4IPDA 3CSTA 3X3MA 3CHBD 1YEZA 1PV4A 1HNWL 2KD0A 3BWUD 2FIDA 3GS2A 5C23A 3I57A 2JP1A 1I3QH 1RFKA 2NCNA 4KIKB 1T0SC 3E0JA 3K9OB 3QIJA 2A6HD 2E2JB 2ZEQA 4QB4A 1Z47A 4UDUC 1GC6A 2WDVB 4N59A 4U673 3WCQA 2KLGA 4AQYQ 1WCMG 1WJ4A 1I4HA 1U4LA 4ZKBB 1GUGA 4MACA 4EEWA 4HPMB 2PMVA 3ND8A 1N5XA 1MSHA 3PSEB 3V3XA 2I5HA 4CJ1B 1MG8A 3LYYA 1IL8A 4X66L 3TMPB 4FVMA 4XQQA 1E2VA 3T8MA 2CHXA 3MEHA 2MO0A 4ID6A 1G6ZA 2INNE 4LFAL 4X57B 2JEAI 2ZTDA 4DXFA 5C0XG 1FIQA 2N9LA 4R4TA 3AU7A 1OQYA 2O2VB 4KZ0A 3T56B 1SYGA 2V3NA 4GDLA 5LLIA 3W9CB 1B7YB 1IBXA 1XPRA 2QDLA 4KLKA 4R4IA 3TEYA 4DR6L 3TREA 3ZLZA 4A3KB 2NVTH 4EQPA 3SFDB 3R3MA 3GE3C 3KDFA 2L1AA 2N9XA 3DVNU 1EY7A 2AX5A 2LEKA 4JL9A 1Y1VH 3BU2A 5KNCA 1KLUD 1S3SG 4XDXA 5IN7A 1Y8OB 1Y1WH 4HPPA 3JVZX 1PTOH 3BS1A 3S15H 2LS01 1LXDA 3H8HA 4J3OD 2K75A 3ZUNA 1A2TA 2A5UA 3Q6BA 1SNMA 4DR2L 3NVZA 2GMIC 1NMGA 4MTKA 1QVGA 2Z6KC 4CGYB 1QILA 1A8VA 3J80L 1Q46A 2WXFA 3MP9A 2NN6I 1WM3A 1KQSA 1I3QB 2CCZA 4DAVA 1UWXA 3LGJA 3AE6B 3Q8CA 4NW2A 1R9TB 4M8MA 4CBVA 1IBLL 1WR6E 2N9EB 4M02A 3H0GH 4B95A 1HH2P 3E9SA 3MFYA 1E22A 1QB5D 2JJQA 4P71A 4P16A 2AEHA 3HKZE 4Y52H 3FMCA 3J9CA 3D31A 5HGQA 1SN8A 3FKYA 2IHEA 2X38A 2HHHL 5GXGB 1ASZA 4DR7Q 3M3YB 3SD5A 4UP8A 1VQDA 4RCNA 3M3JA 1GUSA 4APVA 4A4IA 1Y56A 2MH7A 1I35A 5LXHA 2LGDA 2L1BA 2MJEA 3LJ3A 1IYUA 2IZVB 1J9OA 3PPAA 1SF0A 1PYBA 1DOIA 4OL7A 5DPTA 3SR1A 4MELA 2JA5G 1YITA 1IXRA 1AP0A 1TY0A 3RT3B 1HJPA 2JU6X 1V80A 1V2YA 3BK1A 3NVWA 1H95A 2LMCA 4GDKB 4XX5A 2R2QA 4PK1A 4JBMA 4B3MQ 3JAMc 1UGMA 2F3WA 1F2ZA 2LMCB 1CHQD 4DWFA 1AE3A 2A6HC 4C80A 1OXTA 2AMCB 4LF4L 1C7YA 4BBSH 4JI2Q 1B50A 3N20C 1F2RC 5FKAC 4ABNA 3LWUA 1QVCA 1I50H 3TP8A 4A3KG 5CHFA 3AEFB 4LNFA 1SRUA 4YCWA 1WGYA 2AUKA 4KDLB 1CK1A 3VRBB 5I2XA 4DV5Q 3ALBA 2C7MB 1NVID 1VJKA 2B8FA 3GB1A 3EROA 3GTMB 3VUXA 4Y7NB 1GJXA 3P4SB 1WTHA 3PZDA 4XC2A 2NBFA 3S2DB 3PUVA 4BY1G 2D11A 3L16A 4QGUA 5F2DA 1TJEA 2B3AA 1NENB 1BUIC 2BW2A 2UUCL 1KRTA 1VZ7A 4HAEA 4KMUC 2E2HB 3NVVA 3WANA 2B2UC 2F0JA 2H4OA 3PCOB 3I56A 2NN6G 5DPWA 2O6VB 4FULA 3H09A 3A5ZB 3P20A 3FHWA 4K2LA 4L1BA 1F2LA 2B2WC 1KXLA 2FUHB 2LZ6A 2F0FA 1OFFA 2JSOA 3EVQA 4J8QA 2V3PA 2KENA 4MTNA 1AZQA 1WH3A 3I3TB 1LUZA 2M19A 2WS3B 1II3A 2OTJA 3RYTA 1C48A 1OTCA 4E71A 1XYIA 1E8WA 1FXAA 2IGHA 2JA8B 2ID0A 4X66Q 4L5SA 4HCEA 1E2ZA 1EZ8A 1FL0A 4HJKA 5EPKA 4HDOA 4J6HA 4RHSA 3NQTA 4LFAQ 5KGUA 1KIXA 4POGA 4CJ0B 2R93G 1TTNA 4JGHB 3VTWA 1W6KA 1ROEA 2M0AA 3ND9A 3P4PB 3TN2A 3U50C 1X32A 3DVGX 3DVGY 4WJNA 1K83B 3M85A 2VL6A 4EKUA 1EFWA 1CT1D 1QNUA 4NB3A 2WV6D 3GTLH 2KCTA 4FXKC 4ITKA 4HPLB 3J80c 5T8IA 4CKEA 4LF6L 2D5DA 4ZQ3A 2Z8LA 1D8LA 5DAUA 4JPSA 2F0HA 1YHAA 2FFKB 3NTKA 2A69C 1QOAA 1B9NA 3IXSA 1OQRA 4QAYA 3P75A 4KSLC 2Y5BB 2D3CA 3AEGB 4RF0A 3QJZA 2YTVA 1Q3LA 1PGAA 4TQ0A 1PZID 1Q86C 2VQFL 2RD0A 2HDLA 3HZXA 1V9PA 4CJ2C 1YJ1A 1V5TA 1E6EB 2QEXA 3CMMB 3SFEB 3V62A 2D0PA 4XT1B 4L23A 3HRZC 4FP5D 2OT2A 2L05A 3BYYB 4HMJA 1WF9A 5G2NA 3PF5A 2B2VC 4RGNA 4XYCA 1AH9A 3D4DA 1E7VA 1GXDC 4LAAA 5IYCH 4MT5A 2FUG1 4XTCS 4ZHOA 4C4VA 3PZ7A 1B9MA 1MKHA 2A73B 2EYPA 5LL6S 5CV7A 5IODA 3Q3FA 4N6EB 5HHDG 1EYCA 4JI4Q 4TQUS 3AMUA 1SMYD 4ZUJA 2LHDA 4G3XB 4IG7B 4WAFA 3VRAB 3ML8A 4JBWA 4KD4A 1L7YA 5EKKA 2EOTA 2NVYH 1RDPD 1GM5A 3MXPA 3D6CA 2FCMA 2I38A 2JUOA 3ZQ4A 2NVYB 3OIPA 1QT9A 3Q3OC 3UI3A 4D2KA 4DV0Q 1D5XC 4AWJA 2EY5A 1HNXQ 2JX5A 5ELCA 4B3TQ 5E4XA 1P3QU 3OOCA 1IP9A 4IPCA 3TEXA 1WTWA 2ES2A 3LWEA 2BB6A 1TS4A 2KJHB 2L32A 3DCGA 3K8AA 4ANXA 2LGXA 2WP8J 5ELNA 3V05A 2LGSA 1IBML 2V9HA 1PUTA 5H8YE 5BN5A 4NAMA 5FK9C 3PIO3 2LXCA 1WFQA 2EDGA 3M95A 2N4FA 3SDZA 5C4HA 3MA2B 1TWCB 3CMAA 1A3VA 4LF9Q 2L0TA 1KTKA 2K5HA 3JAML 3SVMA 1WWTA 2C7HA 3VDZA 4KDIC 4C2MH 3C46A 1B4OA 5I9PA 4A3GG 2WIIB 2KTRB 3DDCB 2GVBA 1ESFA 2XVSA 4JI0L 1TS3A 2PPHA 2BYEA 3M7GA 4FDBA 1UE1A 3ERQA 1HTOA 1Q0WB 1YX6B 4CDFC 3R66C 4KGSA 1LT4D 1SJHD 3N6RA 1E7PB 1K3RA 4JBJA 4DV6Q 1GPXA 3E3XA 2Z9HA 4HEDA 4AYBG 1L4ZB 2KXJA 3E9HA 1SR3A 2WB1G 2R7ZH 2RGFA 1XXGA 2KECA 3MC8A 2PLPA 4RKBA 2DX5B 3M4OB 3RNFC 1S5CD 2RSUA 5CHWA 2K6AA 2WQYB 3PV1A 1SNDA 2Y5PA 1DYQA 2RSNA 2BDOA 2ZTCA 1PXUA 3TP5A 4GMVA 3KLWA 3AEBB 3R93A 5AZHA 2CS4A 2MA9B 1OGWA 2CH4A 4P6VF 3NBIA 3AEDB 5M5WB 1T5XD 4DHJD 4RM9A 1HR0W 4YSXB 1Q1EA 3IVFA 4YCVA 3NZSA 2MHJA 4K7UA 1JOOA 3AI5A 2CVRA 2EY2A 2KC2A 2NVQH 3PVLA 3L3OC 1WIAA 1Z9FA 2D2CC 3Q23A 1KDBA 1JWBD 4KJOA 4DHZB 1KDCA 2KHJA 3VR4A 3R7RA 2XRSD 3GTGB 3ULJA 5LMNL 1M90C 3GTGH 4OO1I 3EIVA 4Q0FA 3W5VB 1VZ6A 3OJ3A 2JQRB 3V6CB 2DENB 2D5GA 5LL6X 2CWAA 2IT1A 1K0SA 1R4MB 2AL3A 3TRZA 1V97A 2LGYA 4OEMB 2HQLA 1TWHB 2R61A 4GSWA 3KF8B 4OELB 1U4AA 1JWMD 3QC8B 1ET9A 3T1HQ 3A54A 1AEXA 1N34Q 3UI2A 4EUTA 3SK6A 4DV3L 2IWHA 4CQNA 1MG4A 3Q8DA 1N6ZA 5IA7A 4A6QA 1PHJA 4LNOA 3K7AB 1WYWB 3B08A 4C3HH 3DHQA 3C0RB 3OAWA 3G7LA 4DA2A 2YU9H 1YNND 4HDQA 1MPEA 3AE1B 2XK5B 2AKWB 1XNRQ 1L4DB 1DD2A 2I07B 3BY4B 4YTNB 2X6LA 4IJLA 3RD2A 3E0EA 1X65A 1YNJD 3NP8A 2VNUD 3DWGC 2E75C 1OXXK 1XLPA 5ELBA 3W1GA 1K8GA 4GN4B 3OTOQ 4J6IA 2Q8RE 1FRDA 1XLNA 1VQHA 1MIUA 4DDID 1PFBA 4N8FA 2CHZA 1O7YA 1PH2A 4IFDH 3N3KB 2M9VA 2BF8B 4GOPC 3NJTA 4NZLB 1EWHA 2KHIA 3G4SA 4A3EH 2L0CA 5IGCA 4KGRA 3TZDA 3UF8A 2EYJA 1EWCA 2KHWB 3N32A 1HFGA 1FD6A 2AWOA 2P5ZX 2R3ZA 2M00A 3CD6A 3PGEA 2E2IH 1WXAA 3L4PA 4IM2A 3QOJA 4LJPB 3NUCA 3AB9A 2REXA 3AV8A 4HSPA 1XJVA 1JWSD 1IGCA 3HK0A 3L0WB 2KWVB 3I4NG 4DQOC 1WI0A 4JC0A 3Q2AC 3T9LA 2HUGA 3NS1A 4RAUC 2B2YC 4HJ7A 4WFN3 1Y14B 1YIJA 2GBJA 4LNNA 2N9PC 2IPKD 1AE2A 1X3PA 2RDFA 5AJ3Q 2F03A 4YIJA 4PMBA 3HOXB 3SXHA 2F0OA 4IPGA 1A63A 3EA6A 3HOXH 2ICEC 4GGQA 2RPQA 5C6AA 2W9NA 4A3IH 5IGBA 1VF5C 2RMMA 1NI2A 5DEHA 1AW7A 2K1BA 5J17A 1B70B 4TVAB 1PDQA 4GXBA 1G291 3EUB2 4W9GA 2JF5A 5GROA 1TQOA 4DK0A 3FILB 1JB3A 1ZEQX 5A2QL 5K36H 4X3TA 4JI7Q 2K0PA 2J0KA 1UAPA 3ZYYX 2MP2B 2ONQA 3VQIA 1ZDXA 2Y0SG 1F0ZA 3C3LA 3AXCA 1HUMA 3KBGA 2HTHA 2R7FA 4M00A 3QK0A 2DAJA 1F1HA 2XRQD 1CMXB 2MW5A 1NAPA 5NUCA 2BYFA 4NDXA 1XLOA 3K80C 2BBCA 2KYWA 1C4QA 3QOLA 2F0KA 2Q8IB 4AYBE 4N9TA 2WXHA 3PHWB 4WRDA 1ISNA 5EE9A 3PIP3 4RGTA 2LXKA 1MVKA 4DFAA 3S1NH 5JEAG 1SB3C 4K5VA 3AEVA 1Q81C 1N33L 3Q8AA 4OVUA 1L6UA 1LTAD 2E2HH 1HUNA 1GUTA 4MH8A 5L95C 1ILPA 1WXSA 4DNTB 4CHTB 2LD9A 4JW0A 3KUCB 2PW7A 4FF1A 2LRUA 2E2IB 5IP4D 1D3ZA 1U9RA 3SGIA 3I4NH 4AQ7A 2BH8A 4KIKA 5EDSA 4US9A 4NXML 2K03A 1UBQA 3GV6A 2M0XA 2CFMA 3VR2A 2LVQA 1O7ZA 4S3SA 1TS5A 3KBXA 2UXCQ 1RYJA 4DV1L 1PRTD 4JK1C 2F0DA 2JYTA 3VUYA 2WINB 5LMNQ 1AZPA 1X55A 3PT2B 1N32Q 1EU3A 1B53A 4OONA 4DV4Q 1MHHE 4IJHA 1EOTA 4A3JH 1ACCA 3ML9A 1TXYA 3MVVA 5HY6A 4A3JB 2PKOA 5FO8B 5T1IA 4OWXB 4LFCL 4DF7A 1EQTA 1E2WA 5IT9L 3CMEA 1RF2D 3BDOA 2JA6H 3HOYH 3S24A 4CDDC 1NJIC 4GLXA 1QKZA 1WX8A 1YQ3B 2VH2A 2CH4W 4HJAA 3L08A 4BY7B 1QJOA 2RDHA 5JJZA 4W9CA 2IO1B 4GN1A 4H44C 1C76A 4FF4A 1YNXA 4NJ6A 3TDQA 1WZ3A 2ZXPA 3PMFA 2CJNA 1TIFA 2NR2A 3H7PB 1X6OA 4LDTD 4XZ4A 4JI0Q 1EYAA 1LFDA 3VH3B 1WXQA 2ZT9C 4JBKA 1B3QA 2KHSA 1CKOA 3M9BA 4PZ7A 3FP9A 5GAGC 1T5EA 1E1OA 1PYWD 1IBKL 3BIID 1M1KC 4MHEA 1Z7TA 1WZ0A 5CHVC 3RUIB 3CCRA 3AQQA 2J52A 1T0YA 1C0AA 3KF6A 4CHKA 5DNFA 2OTLA 4LFBQ 1BCPB 4LCDE 4EQ5A 2N49A 4R4OA 3Q69A 1TVXA 3VHTC 1ZXHA 3WOEA 4F7XA 1HEZE 1SE4A 1Y8NB 2R7DA 2EMTA 1V8QA 2EYLA 2F4IA 3I4NB 4GZYC 2R92B 1NI3A 4R4CA 1KC8C 2K7VA 4A3JG 2B2YA 1WE7A 1STAA 4BKGA 1IYJB 4RNAA 1T0QC 1PH5A 1K28A 2NTSA 4C1NK 5LHY1 1XEEA 3NEMA 2K32A 1V5OA 4DR4Q 1LTTD 1HNZQ 1CA5A 1KRSA 1JW9D 2UXCL 1SEBD 1LTRD 1PZKD 2DGYA 2DLBA 4DK3C 4I7ZC 2IYDB 1HZCA
chains in the Genus database with same CATH topology
2WXGA 1N60A 1BR9A 3W5UB 2HTME 4KKUA 1E0BA 2OXPA 5A35A 1RCVD 1WTQA 1SYDA 5IGGA 5IT9E 1EY6A 4RCOA 2ZXRA 1FM0D 3W2DA 2SNMA 5BMGA 5FR3A 1O80A 3A8KE 1WTXA 2O5IC 2BS3B 4WQMA 2C5CA 1T3QA 1CM9A 1WTVA 1I4RA 4RHRA 3KF8A 5CGKA 3AMZA 2BB5A 4ZOHC 2M2LA 1XLQA 3FVQA 5K36G 2N55A 1Y8PB 1WGKA 4RH6A 4KKTA 5CV9A 3AM9A 2YYZA 3DEPA 1JORA 3M7NA 3U4EG 2IW3A 5CV5A 3IFTA 4ZYSA 3IAYA 1T6BX 1VCIA 3T53B 2A5HA 5I4DA 1WYGA 4A3MB 1DCZA 1CFMA 4ARCA 2C9OA 5D3IB 1SYCA 2OF1A 4ZK9B 2PCFB 4A3BB 2EXZA 1F9PA 3DMUA 4RA8A 1H9KA 4YT0B 2WXNA 5JPNC 2WU5B 3PV0A 2O4XA 2F0QA 2WXOA 3TSSA 1LTID 3PUZA 4OZBA 1SDFA 1B9RA 1K53A 3GP7A 3ZJTA 1CZGA 1OXSC 2EPBA 2TMPA 3V96A 4EQOA 1BNZA 2QIEB 5C2TB 3MXNA 4XYQA 1CZPA 5G3LD 1IBXB 2KACA 3D3RA 1C78A 2M56B 5BYQA 5JVG3 1OXVA 1NSNS 2KA7A 2JA5B 5C0XJ 5C5LA 2JEBI 3KLSX 1HPCA 3D6WA 3A56A 2YEPF 4ZAIA 3NQIA 3EGRA 4K5XA 3FAHA 2K3UA 1ESRA 5E3FA 4OGQC 2R7ZB 1BCPF 1HQRD 2JXMB 4M8AA 1TU2B 2ON8A 2A68D 3OHXC 2B2VA 2EVBA 2F0PA 3FPUB 5I6WA 3TP6A 4OIKA 3FKIB 2RQXA 4FNFA 1MI2A 3AE3B 1GB1A 3MHBA 3CQZB 1BUVT 4USAA 4KN4C 2LJIA 5JOBA 3K5MA 4R9WA 1FR3A 1SBBB 1QQRA 2RSOA 3AEEB 1UUPA 5ELEA 1BO0A 5IGDA 2FBWB 2EY6A 2VB2X 5JAVA 3IAM1 4K14A 4DN4M 1EY9A 1WCMB 1U4PA 3EFXD 2ICIA 4G4KA 3AB5A 4TKOB 2CU3A 3L9AX 4MM3B 1LTSD 5C0XH 4IZ8A 1ZXTA 1FNWA 4ZHPA 1RHPA 4HMIA 3PO3B 5TSSA 1VRAB 1FEHA 4FF3A 4YSZB 3SK4A 2E76C 1HA5A 1IHZA 3AEAB 2FHTA 3CWIA 1OO9B 1TWGB 3V2TA 3I72A 4A3FB 1B44D 5K5PA 4LMQD 2IJ0A 2L55A 3D8GA 3GTQB 5KRUA 4C3HG 5J1ZA 1SMYC 4ZLTF 1PRTB 4WORA 2EYOA 4X3KA 1V1PA 5FLXE 2WXLA 2PMZB 1BCPC 4B9XA 1FD7D 2BDNA 1SNCA 4H13C 4TSSA 2QILA 1B1ZA 3R2IA 1PFDA 1JICA 5HI1A 2L83A 1SJED 5G5GA 3QG1A 1SYEA 2DYOA 4LJZC 3BK2A 5M5XB 3O13A 2INPE 5AUIA 3HVDA 5D7GA 4OVZA 2ZXOA 5C3WA 3R2TA 4C3HB 3RMHA 4N58A 2JE6I 4UAIA 5EE3A 3J81E 2KEEA 2F1MA 1PGXA 1VZ8A 1D1KA 3ZJUA 4IFDI 2F0WA 1SXTA 3K5NA 3P7JA 5CORA 2QJLA 4OIJA 4DAPA 2B39A 3VA5A 1HCZA 2XWJB 1FO4A 1H9JA 2WXIA 2DNCA 1HTLD 1ZE3D 2FE8A 3S1QB 3NK9A 1JC7A 1NR2A 2W54A 1JQYD 1ZXIA 1MI0A 3VR8B 1MBYA 1VDZA 3AE9B 2I2YA 2WXRA 2NN6H 2MJ3A 2EYFA 2QSDA 1DJRD 5JXVA 4EVOA 4PQXA 2LFNA 2SOBA 1F2YA 1RTNA 4RKLA 4OO1H 5J22A 3GTOB 3U52E 2B8GA 3QB3A 5DM63 1WD1A 1FMAD 4DGZA 2J42A 3FRPB 2N88A 4A3IB 1HA6A 1YNNC 2PZWA 1K8MA 5BMIA 2L52A 1NEKB 2R93B 2EY1A 2MJDA 2RBMA 3IAS1 2JWUA 1ENAA 1Y1WB 2B2TC 3NPPA 2QMTA 3PZ8A 3B2GA 4A55A 4B0MA 1SSNA 2SDFA 3HOUB 5AUKA 1TY2A 2Z1CA 1SE2A 3GTKB 3SK5A 2LFIA 1ZKOA 1ENCA 3N52A 1EL0A 1TWFB 3HKZB 3P4RB 2F0EA 4DNRB 1MSGA 4NAWB 4ARIA 5ISRA 2WDQB 3U2SC 5EQ0A 3URYA 5EBDA 3NUHB 1KNAA 3ONAB 2RVLA 5CV8A 1KLGD 2QCPX 4U68A 2J4XA 4ME5A 1A3TA 3LXFA 5MPOA 2CW0C 5EBCA 2Y5CA 2GI9A 3K5LA 1DM0B 3DUZA 4WH4A 3RZOB 3OMGA 4ZUIA 3AE2B 1D5ZC 1VLBA 1IKMA 1ONLA 3FILA 3GQBA 1J7BA 1ZDVA 4ZRPA 3B2FA 1L5PA 4KY6A 1JOQA 3U9SA 2K01A 5FOBB 3BVGA 1UEAB 1AWDA 5KNDA 4ZKCB 3I73A 5HFYA 5COYA 1C4CA 4HR7B 1XTCD 5E6JA 2WKCA 1YNTE 2LY7A 1Y69U 3OWFA 4JWUC 3VYUA 1LTBD 2G9HD 2LKVA 1DXMA 1HQMC 4ODGA 1WTPA 3MZ5A 5M3FB 1C79A 2WKDA 1ENFA 1U4MA 1CTMA 2QEJC 3P42A 1QF6A 3DWPA 5EGTA 1V1OA 4FXGC 3K57A 1XWEA 2HQEA 2HDEA 3BDCA 2SNSA 1PTOF 4HEA1 3HEJA 3FC4A 1BOSA 1SNQA 2PQEA 2JZPA 5JEAJ 1YNJC 1QOHA 4G57A 5CR3A 1A6XA 2WXKA 4K2KA 4IUTA 3HOVB 3Q6SA 1V8CA 1TR5A 3VYTA 1H9SA 3RD4A 1ZOYB 2BT6A 1U4RA 1DOMA 4IQZA 2WAQB 2PZTA 2DY8A 4RFBA 5IIFA 4A9AA 1ZYRD 3J7YW 3GTLB 5ELFA 1B3AA 3LNNA 1P7FA 4QMGA 1FNVA 2DY7A 2LHEA 3CKIB 2KVMA 4L6TB 4XYOA 1K51A 4A8XC 3DEOA 4C3IB 1J7CA 4ULLA 4LLGM 3G6JB 4A3DB 2AQ3B 2ZW0A 4FXCA 3I3CA 2DYMA 4M1UB 3HS0C 3NHHA 2F0UA 1HHVA 1EM7A 1STGA 5T1GA 5KIXA 3H3VC 1DOLA 2ENBA 5FO9B 1EFID 3NBHA 2B2TA 4B08A 4G7OC 3U7ZA 4H0LC 1HZ6A 2FINB 3IKJA 1EY0A 3BVZA 3BYTB 3OW7A 1RWSA 2IL8A 2LUMA 1YN4A 1JQ4A 1EIHA 1XCTL 2K5PA 4KK7A 1F77A 3S16B 1B2TA 2WP9B 1G2SA 1CQFA 4ILWA 4US8A 5CYUA 2HCCA 1TZOA 1IW7D 4K6LA 4L63B 4EQNA 1I6HB 4PV1C 2W3RA 5JVH3 4C2MB 2YEPB 1PTOD 3QWNA 1K8OA 4BY1B 5M9OA 1RJTA 1JOKA 4BBRB 2BE5D 1A15A 4KKIA 2QDBA 1N5WA 2Q5WD 1OXUA 3C2PA 1I4PA 1FFVA 4HCSA 3SE0A 1TKYA 1L6VA 3J80E 1KFYB 4YTMB 3A7AB 2Y0SB 4WJWA 1AFPA 1H9RA 3TP7A 2ACZB 1S4ZA 3IT4B 2H1EA 5KYIA 2PNRC 3MWYW 2OEOA 5KYLA 4A93B 1G2TA 4F88A 1J7AA 2J0TD 1PDXA 4IFDJ 4XQNA 3Q22A 1A70A 1K52A 5C4JB 1K50A 3Q8BA 3H91A 2A6ED 2N9KA 1XF5L 1J8IA 2K05A 5CV6A 2BOSA 3JAME 4IUQA 1ICWA 2X6GA 1CJEA 4XT3B 3NZ3A 1PRTC 3S15B 2JYEA 1F2MA 3GTJB 1SNOA 5C0XI 4PMWA 1O7LA 4RGMA 3NE5B 3CIRB 3MFGA 1E9MA 3IT6B 4XIGS 2AUJD 3K59A 5D14A 2V4DA 2L4NA 3LB8C 4KGTA 2NB0A 4C7ZA 2A6EC 5JPMC 1BQQT 2K33A 5CC4A 1QOBA 1DGJA 3ETRA 2B63B 3C8YA 3DWAA 3H0GB 3W3AA 1JCKB 1S5ED 2VZKB 2EE1A 2KJXA 3A7LA 4OO1G 2HCIA 4IN3A 4QUCA 1TKWB 2L11A 3E6ZX 4PNYA 1TKGA 2F0NA 3KLRA 3T3OA 2WDRB 2VZKD 5E4WC 4BWGB 3FDTA 2PW5A 3P63A 1FCCC 4HROA 2A74C 2KCNA 3J7AF 3AH7A 2AQ2B 2F0IA 4TMAB 1MHXA 2AWNA 3VR6A 3CRLC 4C3IG 3BZDB 3PO2B 2E6XA 1Y1VB 4JE3B 4PT5A 3HOZB 1FFUA 3I9V1 2BA1A 3T4AC 1I7HA 2XIWA 4BBSB 1GUOA 2KMMA 2PTLA 5H92C 3IFDA 1PMRA 4R8NA 3DWMA 1RKNA 4IDIA 1STBA 3RLFA 4KD3A 2W82A 3S1NB 3KWVA 4GLSC 4XE0A 1XCQL 2XSCA 4TQ1A 1ML0D 5C4ZA 5I9OA 1D2BA 3K0YA 1CHPD 3NXWA 5BN4A 4C7YA 1HXYD 5JEAH 4GDLB 1ET6A 3K6OA 1YN5A 2BE5C 2FMMA 2VB3X 4JWSC 3L7ZC 1VR9A 2XNAC 3Q24A 2J7ZA 4ZRQA 3ITPA 1EY4A 5C4XB 2PW9A 3K58A 2BYTA 4TRDA 1LV9A 4X3UA 4NP5A 2QF7A 1QNKA 1SE3A 1Z6HA 3K5OA 2CQAA 3VA7A 4XDDA 4BA1I 3RZDB 5DM73 1LABA 1SIJA 1G91A 1CA6A 3OPOA 3TMEA 2E2DC 2GRIA 3CU7A 3B9JA 1GUWA 1DOXA 4F8MA 3TEZA 4R8IA 2WU2B 3R3OA 3QIAA 4A90A 3MTSA 1SYBA 1L0VB 2WNMA 3SHLA 2V4IB 1TWAB 1D4BA 1O78A 1TYGB 4WWMA 1KRHA 2WXQA 4LK1C 5C44B 2ZW1A 1BDOA 3DXJC 2Z4IA 3MHZA 3MXUA 4JX1C 2VUMB 4H7BA 2PYKA 1I4XA 1YJIA 4LK0M 1LLRD 4YTPB 5CV4A 5M3MB 4IUPA 3GO5A 3VR9B 2F0SA 2H88B 3T51B 4HRSA 5EJWA 1QCBD 3FPPA 1EY8A 3AE7B 1C4AA 3C1EA 4E6IA 4KHVA 1GHJA 2Z4HA 1JROA 3SR6A 4KTAA 1NUCA 1NYRA 4H2AA 3CRKC 1VMPA 1E0ZA 2WLBA 1HFNA 1QOGA 4YXDB 2NZ1D 3LX0A 4V190 5CBAE 4BS9A 5IGFA 3NTHA 3ZJVA 4CKCA 5IOCA 1KH0A 2NMQA 1BCPD 1SYFA 2K5DA 1C9FA 4OHJA 2A69D 5KEEA 4EGVA 4RF1A 2N0SB 4XWWA 2MGSA 2NVQB 4DAYA 2DN8A 5HGTA 1NCVA 1NR4A 2PPBC 4XQJA 1I4QA 2KDMA 1CI3M 1A3UA 1EY5A 3WDNA 5EPJA 4KKSA 4IUVA 4IKGA 2JSVX 4L8JA 2CHBD 1PRTF 1TIID 1Q90A 2F0VA 1HZ5A 2KQ3A 1QE6A 5E1FA 3HG9A 2WXJA 2X69A 1D6EC 1VF7A 2YU9B 5A2QE 5I6YA 1FYCA 5D3DA 3X3NA 5ELDA 3AECB 1FXIA 2O2LD 3MAQA 1D1IA 3KUPA 2K04A 3EJIA 4QCLA 4PMCA 4RGOS 4C3JG 3KWLA 1KNEA 5EE1A 3NTIA 1A2UA 1SNPA 4O1NA 4DXGA 1FRRA 4A3EB 4G7HC 4OZAA 2I46A 1N61A 5HG2A 1WSPA 4FO2A 2JA7B 4REZA 1KF6B 2DWQA 3HGBA 4YWGG 3NWSA 1STNA 3KQ4A 4IUUA 4OZCA 4C3JB 1MGSA 2EYMA 2CJOA 4BA2I 1ZPSA 4KX6B 2EJMA 1GB4A 2IX3A 2BS2B 3TZUA 1TT2A 2IX1A 5EKIA 3ABVB 3VR3A 4HSVA 4IURA 3RPFC 1UNSA 3AE4B 1KAAA 3NVYA 2MEKA 3W1SA 5C3XA 2F3VA 2MUYA 1IYVA 3HVZA 4QIWB 1JE4A 3OWEB 2PZUA 4AYBB 2KN4A 3NWTA 3S1RB 1ZP0B 1F9QA 1ZUD2 1JWUD 1JALA 4WIPA 3SEBA 1EU4A 3C1FA 5CMDA 4J1MA 4KI0A 3RUZA 2F0GA 4F87A 3P1HA 2EELA 1QLBB 2Q8TA 5FO7B 3ZGZA 3A8IE 2PO4A 4R3DA 2TSSA 3S17B 1IKLA 2K9XA 2EJFC 2O5JC 4N9PA 4XXEA 2G1EA 2F0TA 3KLSA 1TS2A 4L2YA 4X3SA 3PUYA 1C77A 1Q1BA 5IGEA 1M4VA 4M0WA 2CW0D 3OMCA 4IOIE 5G3LF 1W6JA 2BA0A 2W55A 3VR5A 5C5MA 3J7AV 1SAPA 2KCCA 4NKLA 1V1PB 3HOYB 1OQQA 4RWSC 3TEWA 4K8IA 2WXPA 5BYRA 3H94A 4Z9CB 2NUCA 4MIUA 2LGIA 2JXTA 1WTRA 2NTTA 1SFOB 1YQ4B 4C56C 2OHFA 3VYRA 3A55A 1LT3D 2NVTB 4B0EA 3N9YC 3BVMA 4KN7C 1PFMA 2KQ4X 1LACA 1DZ1A 3I4LA 3I90A 1KDAA 3SK8A 5M5YB 4KJNA 5AFWA 1P7EA 1L0YB 5HURA 3PO0A 4FYDA 1ILQA 4K8JA 2W3SA 3QO2A 4A3GB 3NRZA 1F2RI 2JYOA 4FXDA 3T16A 1YJJA 1WRIA 1HRJA 1JR0D 3I8ZA 3Q8EA 1R7SA 1EEFD 1EWYC 1HTPA 2G9DA 3A8JE 5KNBA 2PVGC 4G7ZC 2K5WA 1VDVA 3P4QB 5BMHA 1E10A 1G8ZD 2JA6B 4KHZA 2GA4B 4KV6A 1QG7A 1XO3A 3QJYA 4KY7A 4FF2A 4Q2JA 4XWTA 4HKZE 5BN3A 1AN8A 3T3NA 2R6GA 3H6MA 1STEA 1GHKA 2H89B 2NYZD 3PUXA 1PTOC 1CZWA 4C1NI 4IFDG 4XDCA 1S5FD 2SEBD 2GB1A 5EE0A 2IGGA 3F2UA 3I70A 2FMCA 1PTOB 1R4PB 1LTGD 1R4QB 3MXGA 4KKJA 1D5MC 3AE5B 3HRDD 3GV3A 1PGBA 3BG3A 3OIQA 4K6DA 4V0BA 1MD2D 1BBXC 2PIAA 3TUOA 1EZ6A 1WVLA 1F9RA 2EZVA 3E56A 2B2WA 2KWDA 1KABA 1CQVA 1H9SB 2KOLA 2MPMA 2B2UA 2NVXB 4ZRZA 4Q5VA 1F9SA 3HP3A 3IL8A 3KK7A 2MHVA 4I65A 1BMLC 4HTHA 1BF4A 2RPVA 4LTUA 2PVOD 3E5SA 1PLFA 2MJ8A 1VMCA 3VYSA 1H9MA 4QF4A 1LO5D 1ZYRC 2MP1A 1EIGA 1YMHE 1N63A 1Q12A 4MN3A 1RM6C 3Q0AA 1LT5D 3HOWB 2AQ1B 1C4PA 3MJ5A 1I50B 3Q8FA 1WD0A 1Q10A 1UGJA 5C3EB 3I91A 3HUIA 3NSWA 2XN9C 2D62A 3BDLA 1NYQA 1JWAD 4NMZA 4CKBA 4WURA 1RTOA 1FNUA 2RA4A 3D4WA 1DONA 1C8CA 1IW7C 2WACA 5EPLA 2Y3AA 2BCOA 3WOFA 1M8AA 2BS4B 1GOZA 2BTEA 2VXWA 1Q8IA 2NWGA 1V43A 2L12A 1SSOA 3FEWX 5FLXL 4YSYB 3S1MB 4EE2A 2L9HA 5EKLA 2IX0A 4K5WA 2KUMA 3TBIB 1FGBD 5J39A 3P1MA 4O42A 3OSOA 2E3TA 1YN3A 1I6VC 1AYFA 1RODA 3AE8B 2KEDA 1EYDA 3R8BA 4IUNA 2OEDA 3S2HB 3EQLC 4NJCA 1GUNA 1BXTA 2XWBB 1I4GA 3PUWA 2WB1B 2HDMA 2DNEA 5BYSA 2QKIC 1IUEA 4DK1A 3J81L 1PFNA 5G5HA 3GTPB 4IALA 3MC0B 4B9WA 1XX8A 4KY5A 2A68C 5CBEE 3D4RA 3DWQA 1WTOA 3RFZB 2K28A 2IDYA 2RKSA 4AS1A 1STYA 1STHA 1UWMA 3GD7A 2EJGC 2B76B 2WXMA 2V0GA 2K22A 1EQVA 3M4YA 1EEID 1JRPA 3AN1A 2SAKA 4OW0A 1S5BD 3U9OA 3S9WA 2EKIA 1DOKA 1RD9D 1N62A 1LT6D 3T13A 2EYHA 4HN7A 2K5QA 4HKQA 2D9UA 1X3QA 3DM1A 4P2CB 1S5DD 4HJGE 2KAJA 2DBYA 1PZJD 2J53A 5C3JB 2F0LA 3S14B 2N7JA 1FCLA 1DOYA 5I2YA 4QUFA 2F0MA 2L5TA 4DU9A 1JMLA 1IGDA 1TKEA 1QWYA 1GAQB 2RDGA 1L0XB 2E74C 1QOFA 2IGDA 5D65A 3I4MB 2FJ2A 3X3MA 3CHBD 3GS2A 3BWUD 3I57A 2JP1A 1RFKA 3E0JA 2A6HD 2E2JB 4QB4A 1Z47A 4UDUC 2WDVB 4N59A 4U673 3WCQA 1I4HA 1U4LA 4ZKBB 1GUGA 4MACA 2PMVA 3ND8A 1N5XA 1MSHA 3V3XA 4CJ1B 3LYYA 1IL8A 4FVMA 4XQQA 1E2VA 3MEHA 4ID6A 1G6ZA 2INNE 2JEAI 4DXFA 5C0XG 1FIQA 2N9LA 3AU7A 5LNK1 3W9CB 3T56B 1SYGA 2V3NA 1IBXA 3TEYA 4A3KB 4EQPA 3SFDB 2L1AA 1EY7A 2AX5A 2LEKA 5KNCA 1KLUD 4XDXA 1Y8OB 1PTOH 3BS1A 2LS01 3H8HA 4J3OD 1A2TA 1SNMA 3NVZA 4CGYB 1QILA 3J80L 2WXFA 3MP9A 2NN6I 1I3QB 4DAVA 1UWXA 3AE6B 3Q8CA 4NW2A 1R9TB 4CBVA 3E9SA 3MFYA 1QB5D 4P16A 3FMCA 3J9CA 3D31A 2X38A 5GXGB 3M3YB 4RCNA 1GUSA 1Y56A 2MH7A 2L1BA 2MJEA 1IYUA 1J9OA 1SF0A 1DOIA 4OL7A 3SR1A 1AP0A 1TY0A 2JU6X 3BK1A 3NVWA 4GDKB 2LMCA 2F3WA 1F2ZA 2LMCB 1CHQD 2A6HC 4C80A 1OXTA 1B50A 1F2RC 5FKAC 4ABNA 3LWUA 3TP8A 3AEFB 2AUKA 1CK1A 3VRBB 5I2XA 1NVID 1VJKA 2B8FA 3GB1A 3EROA 3GTMB 4Y7NB 1GJXA 3P4SB 2NBFA 3S2DB 3PUVA 5F2DA 1TJEA 1NENB 1BUIC 2BW2A 1VZ7A 4HAEA 4KMUC 2E2HB 3NVVA 2B2UC 2F0JA 2H4OA 2NN6G 3H09A 3P20A 4K2LA 4L1BA 1F2LA 2B2WC 2F0FA 1OFFA 2JSOA 3EVQA 4J8QA 2V3PA 1AZQA 2M19A 2WS3B 1II3A 1C48A 1XYIA 1FXAA 2IGHA 2JA8B 2ID0A 4HCEA 1E2ZA 1EZ8A 5EPKA 4J6HA 4RHSA 3NQTA 5KGUA 4CJ0B 1W6KA 1ROEA 2M0AA 3ND9A 3P4PB 3TN2A 1X32A 1K83B 3M85A 1CT1D 1QNUA 2WV6D 4FXKC 4ITKA 5T8IA 4CKEA 2D5DA 4ZQ3A 2Z8LA 5DAUA 4JPSA 2F0HA 2FFKB 3NTKA 2A69C 1QOAA 1B9NA 3IXSA 1OQRA 3P75A 4RF0A 3AEGB 1Q3LA 1PGAA 4TQ0A 1PZID 2HDLA 3HZXA 4CJ2C 1E6EB 3SFEB 4XT1B 4L23A 3HRZC 4FP5D 2OT2A 3BYYB 4HMJA 2B2VC 4RGNA 3D4DA 1GXDC 4LAAA 4MT5A 2FUG1 4XTCS 4ZHOA 3PZ7A 1B9MA 2A73B 2EYPA 5IODA 5LL6S 5CV7A 4N6EB 5HHDG 1EYCA 3AMUA 4TQUS 4WAFA 1SMYD 4ZUJA 2LHDA 3VRAB 4JBWA 4KD4A 5EKKA 2EOTA 3ZQ4A 1RDPD 2I38A 3MXPA 3D6CA 2NVYB 3OIPA 1QT9A 3UI3A 4D2KA 1D5XC 2EY5A 2JX5A 5ELCA 5E4XA 3OOCA 3TEXA 1WTWA 3LWEA 2BB6A 1TS4A 2L32A 2WP8J 3V05A 5H8YE 1PUTA 5BN5A 4NAMA 5FK9C 3PIO3 2EDGA 3SDZA 5C4HA 3MA2B 1TWCB 1A3VA 1KTKA 3JAML 3SVMA 1WWTA 3C46A 1B4OA 5I9PA 2WIIB 1ESFA 2XVSA 1TS3A 3M7GA 3ERQA 4KGSA 1LT4D 1SJHD 3N6RA 1E7PB 1GPXA 4HEDA 1L4ZB 1XXGA 2KECA 2PLPA 4RKBA 3M4OB 1S5CD 2K6AA 2WQYB 1SNDA 2Y5PA 1DYQA 2RSNA 2BDOA 1PXUA 3TP5A 3AEBB 3R93A 4P6VF 3NBIA 3AEDB 5M5WB 1T5XD 4YSXB 1Q1EA 1JOOA 2CVRA 2EY2A 3L3OC 2D2CC 3Q23A 1KDBA 1JWBD 4KJOA 1KDCA 3VR4A 2XRSD 3GTGB 4OO1I 4Q0FA 3W5VB 1VZ6A 2JQRB 2D5GA 5LL6X 2IT1A 1V97A 1TWHB 2R61A 1JWMD 1ET9A 3A54A 1AEXA 3UI2A 3SK6A 2IWHA 4CQNA 4A6QA 3K7AB 3DHQA 4DA2A 3G7LA 1YNND 1MPEA 3AE1B 1L4DB 1DD2A 2I07B 4YTNB 2X6LA 1YNJD 3NP8A 2VNUD 3DWGC 2E75C 1OXXK 1XLPA 5ELBA 2Q8RE 1FRDA 1XLNA 1PFBA 1O7YA 4IFDH 2M9VA 4NZLB 1EWHA 2L0CA 5IGCA 4KGRA 3TZDA 2EYJA 1EWCA 1HFGA 1FD6A 2AWOA 2R3ZA 2M00A 3L4PA 3QOJA 3NUCA 3AB9A 3AV8A 4HSPA 1JWSD 1IGCA 4DQOC 2HUGA 3NS1A 4RAUC 2B2YC 4WFN3 2IPKD 1X3PA 2RDFA 2F03A 4YIJA 4PMBA 3HOXB 3SXHA 2F0OA 3EA6A 2ICEC 5C6AA 5IGBA 1VF5C 2RMMA 5DEHA 1AW7A 2K1BA 1PDQA 1G291 3EUB2 1TQOA 4DK0A 3FILB 1JB3A 1ZEQX 5A2QL 5K36H 4X3TA 2K0PA 1UAPA 3ZYYX 2ONQA 3VQIA 1ZDXA 1F0ZA 3C3LA 1HUMA 3KBGA 2XRQD 1NAPA 5NUCA 4NDXA 1XLOA 2BBCA 1C4QA 3QOLA 2F0KA 2Q8IB 2WXHA 4N9TA 4WRDA 5EE9A 3PIP3 4RGTA 1MVKA 4DFAA 5JEAG 1SB3C 4K5VA 3Q8AA 1L6UA 1LTAD 1HUNA 1GUTA 4MH8A 1ILPA 4DNTB 4CHTB 2PW7A 4FF1A 2E2IB 1U9RA 4AQ7A 4US9A 2K03A 3GV6A 3VR2A 1O7ZA 4S3SA 1TS5A 3KBXA 1RYJA 1PRTD 4JK1C 2F0DA 2JYTA 2WINB 1AZPA 1EU3A 1B53A 1MHHE