4DXFA

Crystal structure of staphylococcal superantigen-like protein 4
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
194
structure length
194
Chain Sequence
EINPKFKDLRAYYTKPSLEFKNEIGIILKKWTTIRFMNVVPDYFIYKIALVGKDDKKYGEGVHRNVDVFVVLEENNYNLEKYSVGGITKSNSKKVDHKAGVRITKEDNKGTISHDVSEFKITKEQISLKELDFKLRKQLIEKNNLYGNVGSGKIVIKMKNGGKYTFELHKKLQENRMADVIDGTNIDNIEVNIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Staphylococcal enterotoxin-like toxin
publication title Structural and functional properties of staphylococcal superantigen-like protein 4
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Sugar binding protein
total genus 52
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4dxfA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4dxfA01
2O2LD 1LTTD 2IPKD 1DJRD 5FK9C 1EFID 4RGMA 1PRTD 4RGOS 1PTOD 1FNUA 1ET6A 1PTOC 2CHBD 1ENFA 1KLGD 1V1PA 3R2IA 2SEBD 4K6LA 2Z8LA 5ELBA 1LT6D 1CT1D 1FNVA 4O1NA 1S5ED 1YN3A 3DWQA 1PTOF 1JCKB 1LT4D 1RF2D 2RDHA 1B44D 3EA6A 3R2TA 3BYTB 5FKAC 1TY0A 4BWGB 1SE4A 1CHPD 2G9HD 1TS5A 5D3IB 2IJ0A 4RH6A 1SJED 1BCPD 4C56C 1BCPC 3BVMA 1TS3A 1V1PB 1CK1A 3BYYB 1PYWD 3GP7A 1KTKA 4TSSA 4UDUC 1ESFA 1JWMD 2R61A 1PRTC 3URYA 5TSSA 1BCPF 1BXTA 1D5XC 1SE2A 1TS2A 3BVZA 5I4DA 1LTGD 1HQRD 1LTBD 4RHRA 1DYQA 4Z9CB 3R8BA 5ELCA 1G8ZD 1S5BD 1B1ZA 1PRTF 1V1OA 2ICIA 1LO5D 3TSSA 1I4XA 1FNWA 1I4QA 1XXGA 1RDPD 3W2DA 1LTRD 1STEA 1JQYD 2AQ3B 1SEBD 1I4HA 1TS4A 1SXTA 3BZDB 4L6TB 3OWEB 1PZJD 3BVGA 1FD7D 1LLRD 1LT3D 1JWSD 2RDGA 3MC0B 1AN8A 4RFBA 1UNSA 1M4VA 1LTSD 1D5MC 3SEBA 1RCVD 2NTTA 3KLSX 1GOZA 5D3DA 4OHJA 5ELFA 1ET9A 1SE3A 2XNAC 1SJHD 1S5DD 4RGNA 1EWCA 1EEID 1T5XD 3DWAA 4ZYSA 1I4PA 1F77A 1MD2D 2WV6D 1PZID 1PZKD 1PTOB 1LTID 3V05A 1EU3A 1S5FD 2NTSA 3EFXD 1PTOH 1SBBB 1I4RA 1RD9D 2AQ1B 4RGTA 4DXGA 4RCOA 2AQ2B 2QEJC 1CQVA 1HA5A 1D6EC 2J4XA 4NZLB 1LTAD 5ELDA 3MFGA 1I4GA 1XTCD 2XN9C 1L0XB 2XRSD 1HTLD 1PRTB 1FGBD 1QILA 1LT5D 2XRQD 4DXFA 1L0YB 1S5CD 1JR0D 2TSSA 1YN4A 1HXYD 1TY2A 5ELEA 1BCPB 1D5ZC 1YN5A 3DWPA 4RHSA 1EEFD 2QILA 1KLUD 3O13A 1CHQD 4L63B 1UUPA 3CHBD 1EU4A 1JWUD 1AW7A
chains in the Genus database with same CATH superfamily
4LMQD 4C3JG 4XDCA 3ZVVA 4Y7NH 1YEZA 3FKIG 4DV4L 2VRRB 4RGMA 4X65L 3I70A 3ZKJC 2JN4A 2UXBL 1Q81C 2O5JC 3U2SC 4ANWA 3I4MB 2R6GA 3RN2A 2AMCB 2F0SA 1IYJB 1YIWA 3HOWG 2LGXA 2NBUA 1ZUD2 5G2NA 2KDBA 4O1NA 5IYCH 2L76A 1LYLA 3AM9A 2NVYB 2Q8TA 4W9GA 3I72A 4LFCQ 3ZO5B 2E2IH 4DV5L 3R2TA 3F2BA 4DR1Q 5AEKB 1C4CA 2XK5B 3KWVA 5KHOA 1D1IA 3GTLH 2K8BA 3T53B 1JOKA 5IT9L 2KOLA 3A56A 3DOWA 2K6AA 3I73A 2KVRA 1SE4A 5J2RA 1JMLA 3K0XA 1SIJA 3AMUA 2B2TC 4RMAA 4C3JB 1TWCH 1Y8RC 3GP7A 2KQ3A 5LMNW 3RNEC 3FKIB 1V86A 1EM7A 5FLXL 3A0JA 4LDTD 1I3QH 4DPGA 5DM63 3EUB2 4J8QA 4Y52H 2D0OA 4A20A 3TP8A 2AWNA 3A5UA 3OW7A 4KHZA 3UI2A 4RHRA 4BBSG 3HEJA 3M3YB 1E5WA 3ICEA 2V3PA 3AXCA 3CQZB 4JX1C 3RZOB 1N63A 4BKSD 1J5EQ 2R7ZH 5IY0A 2PQEA 1L2FA 1T0YA 3AECB 2RF4A 4DAVA 2EY2A 3S15H 1RM6C 3DWMA 3RLOA 5C44G 2VH1A 2W3SA 4DHJB 1JE5A 2AQ3B 2WXOA 4IWOA 4HCSA 1LACA 2ZM6Q 2SNSA 1GG3A 3CAMA 4C3IG 1UE1A 3FHWA 1SYDA 3GTPH 2DLBA 4WWNA 3M4QA 3EFCA 4OW0A 5BMIA 1ICFB 1PYBA 4HEDA 1DZ1A 2ZCCA 3T4AC 4FJZA 4OWXB 3UDIA 1QF6A 1F2RC 5CHFA 3KLSX 1A70A 3M63B 2PMZB 2R7FA 4DGZA 2PMVA 1GUWA 5CBAE 2J0TD 3PS6A 4BBSB 4OEMB 3DVGX 1HTQA 3PPAA 1Q1EA 4ZYSA 3EECA 4EZKA 1NI3A 4LFCL 2INDC 3TZUA 4OZBA 2K25A 4HJAA 1A0IA 4DR1L 1QOBA 4FBJB 4XQJA 5M3MG 2NN6G 3SDLC 1EO6A 4HROA 2KDMA 1XCTL 3DBHB 3L08A 3TCAA 2ZXOA 2AQ1B 4B3SQ 1H95A 2FXQA 2PVOD 4H44C 1XNRQ 4C3IB 3T51B 4A3DG 3Q3FA 2ZXRA 2INCC 4AH6A 1EF1A 2IZVB 1R4PB 1SB3C 1HR0Q 1E90A 2EELA 3DHHC 5JXVA 3PHWB 5J18A 3VUYA 5M3FH 4ANVA 4JG2A 2BKRB 1KNEA 3D31A 4L1BA 2WXNA 2C7NB 2K0PA 2SOBA 4JGHB 1D8LA 1NDDA 1EZ8A 3GTQH 3R7RA 4TVAB 1EEFD 4DR4Q 3O13A 3UIOB 4MIUA 5FOBB 4JWUC 5CV6A 2A69C 2PCFB 4G7ZC 1X3PA 4DNRB 1BDOA 3R7QA 1UUPA 4A93H 5HKHA 1J5EL 3C1EA 4HJ5A 5M3MB 3ZGZA 1B9MA 2WXQA 2KCTA 2K8HA 3RLFA 1QNUA 3P75A 3AQQA 2PE6B 2YVCA 1WYDA 4JW0A 3W5UB 3OMGA 3NENA 2ZM6L 4IOAA 1WZ3A 1DXMA 4A3DB 2V4DA 1PTOC 4FVMA 1PDQA 1V1PA 4GS3A 4DA2A 2CHWA 3AE8B 2EYHA 1VQHA 2V4LA 3JW0X 4ANUA 5HGQA 1T0QC 1JMCA 5BYSA 1AP0A 3K0YA 3C3LA 4GMVA 2KNBA 2KT7A 2K5WA 4UY8C 1JT8A 3PUXA 1PDXA 3WAOA 5C3XA 1MBYA 2FINB 4DK0A 4C3HG 3L0WB 3DHQA 2IHFA 1E3PA 2N55A 4RH6A 1NAPA 3CP0A 1BCPC 1SE8A 4D2KA 1V1PB 1HTOA 3TS0A 3UE1A 4B9KA 5FO8B 1BBXC 1KTKA 1W6JA 1NENB 1FYCA 4AYBG 4B3SL 3QJZA 4M00A 2HHHQ 2WP9B 1VQOA 1HUMA 1WTVA 2X38A 1ICWA 1XNRL 5AUIA 5L95C 2M8SA 3BDOA 1EQQA 5AUKA 2MHJA 1HR0L 3TIXA 1KJTA 2GA4B 1ML0D 2I5HA 4JK1C 4FYDA 2WXFA 1V8CA 4O2DA 3DBRB 4PMCA 4B08A 2MP2B 2EY5A 4MJSA 2ICIA 3OIQA 2KDFB 3WIMA 2N9LA 1YNJD 5BYQA 4YWLA 1FNWA 1F52A 1R9TH 2LVPA 1GKHA 4C3HB 3I57A 3GTOB 1S3SG 3H7PA 4HK2A 2MWSB 4L5TA 3OJ4B 2K22A 2AL6A 4NXMQ 2MNAA 1HFNA 4JPBW 2KEEA 2PQAA 1KXLA 1JRPA 3Q24A 2JWUA 5G3LD 2JSVX 2B3GA 2Z6BA 2B63G 1LLRD 4AYBB 2LI5A 3PIP3 4OVZA 3P20A 4RFBA 1DOIA 2ES2A 1UNSA 4C2MH 4GN3B 4GOPC 1LTSD 1WGGA 4MJSB 5DPWA 3KLWA 4CJ0B 4Q2JA 1K73C 1YJNA 2KWUB 3BK1A 3HOVG 4OONA 4PNYA 3H7PB 5C3EH 1FIQA 2MSED 2KLGA 5I2XA 1SRUA 1EFWA 2IX1A 1CKNA 4A3MH 4OZCA 4RG1A 2W54A 5GXGB 3AE7B 1C4PA 1BF4A 1L5PA 4J3OD 2C5CA 4DV1Q 1PH9A 1SBBB 4KK7A 3P42A 2DYBA 2L0TA 4IG7B 1TIFA 1CQVA 2QA4A 3B08A 3JC66 4DHZE 1WJ4A 1IBMQ 4BBRG 2B63B 4JI2Q 3FPPA 1JWBD 2IO1B 4HIKA 4HJKA 2PW7A 1ZXHA 2A5UA 2B8FA 2HHHL 2WX1A 2QGQA 1JR0D 1CKNB 3N6RA 3MTNB 4YTNB 1TY2A 2OCEA 5K36H 2LJIA 5EPJA 4KHPQ 5ELEA 1SFOH 1D5ZC 1A15A 2VZAA 4P75A 3HOVB 2R92H 2ZNVB 4DXAB 3SK8A 2KZRA 1N34Q 2N0SB 5G55A 1UGMA 3PUZA 2VUMH 5E1FA 5C0XI 1OTRB 2KTRA 1AW7A 2MQHA 2QF7A 2OJWA 2DY7A 2QC8A 3B2GA 3L13A 3X23A 4CDCC 1JRUA 2GBMA 4C3JH 1E7PB 3J81j 1E0ZA 3C8YA 3A74A 4K5XA 2CHZA 3QWZB 4RGOS 3M95A 1U5KA 4NXML 2GN5A 3PO2H 3U58A 2CHBD 2SAKA 4BBRB 4LFBQ 3N1XC 3ZRFA 2B2VA 1MHHE 3HUIA 4N58A 1G291 3CMAA 2EY1A 1KM7A 1H9KA 2CH4W 3UDFA 1WGYA 4GNXC 1NSNS 1PV4A 2KTRB 1A3VA 1RHPA 2NB0A 3DWQA 4M8AA 2KJHB 4K8IA 2IGGA 3A1QA 2LRUA 3NBHA 3S1QH 2IYDB 3CCVA 2NBVB 3MHBA 1VD2A 5M5YH 1L7YA 4A6QA 1A62A 2M9VA 1TS3A 3E3XA 3AN1A 4DV1L 1G6JA 3U30A 4DNIA 2GOWA 1ESFA 2NVQB 3K8AA 3AFPA 1BXTA 4FXGC 2RA4A 3NHEB 3K57A 1IBML 3AE6B 3A1QB 3K9PB 3NBHB 3ZNID 4JI2L 5C6AA 2D3BA 2JZZA 3X0WA 5ELCA 3TJPA 5D2MB 4BBSH 3KBGA 5FR6A 3OPOA 4KHPL 4LF9Q 5CTRC 2UUCQ 1VZ8A 4ODGA 4DDGD 2B2UC 1F2MA 1XXGA 3EVQA 3IT4B 2IGDA 4II2B 1N34L 4IUVA 1CA5A 1Q1OA 1Q90A 3Q23A 1DM0B 1A2TA 4UHVA 3DUZA 3J7AV 3AI5A 5EAYA 3RNFC 1IBKQ 2I46A 3GV6A 3PO0A 4K7SA 1AN8A 1EUJA 1RTOA 2AEHA 4AS1A 4ARIA 1BUVT 3JSVB 4AUQC 4F8MA 2BS2B 3AE9B 1EY8A 4LFBL 4G7HC 3H3VI 4BY7H 1NJIC 3KUPA 1SDFA 4WWPA 1VQKA 2CKHB 2WXRA 1MD2D 3W1SC 1P0RA 1QVCA 3I2ZA 2LEKA 2N78A 3GD7A 2D62A 1CZPA 4LNOA 1FXAA 4OO1I 1S5FD 2NTSA 2NN6H 2NUCA 1WYGA 1I4RA 1KH0A 4K6DA 4N59A 3PUVA 3IXSA 3PZ8A 4NZLB 1VR9A 2A73B 1PHJA 2BQQA 3MXNB 5E6NA 2JZ3B 1I50B 1QILA 2KVMA 4YT0B 3RN9C 5IT9c 1YN4A 1G51A 1HXYD 5I9PA 1N33Q 3PF4A 1WR1A 3VQIA 4B3MQ 4QQBX 1QKZA 1MPEA 4HMIA 1PYSB 2OHFA 2MBQA 2WLBA 3MVVA 3P63A 4R8NA 1E1OA 1G6ZA 3TL5A 1JORA 1UF0A 4BOSC 3VAWA 2HD5B 3BZDB 2UUCL 1PQSA 5FLXc 2K1FA 4ACFA 2ZJDA 2DJGC 5FLXE 2D5DA 3ND9A 1EY6A 1R4NI 1XD3B 1HTPA 1EFID 1X3QA 2M56B 4ICUA 3KWLA 4XZ4A 2D2CC 2F0QA 3S2HB 3A33B 2J0MA 1VQLA 4I6PA 2DYMA 2PW9A 1IBKL 3AE3B 4WAAA 5IAAC 3AEEB 4MGYE 1S40A 1PTOF 1JCKB 4PV1C 3HOZG 4FF1A 1E9MA 1FRRA 1R7SA 1PFNA 2DBYA 4KLKA 2ATWA 2NPTB 2ONQA 3DHIC 2N7EA 1S4ZA 4AOFA 1A3TA 1STNA 4C3HH 3GTOH 2D10A 1Z5SB 3KDFA 2FE8A 1V97A 2YV5A 2YU9B 1EUVB 4IPCA 4OX9Q 2QDFA 1C4QA 4BXXH 3NUHB 2UU7A 1NY4A 1BCPF 5C0XH 1YHQA 1KRSA 1L2NA 4H0LC 2E2HH 1TWAB 1ASYA 1V49A 5EDSA 1ROEA 4IFDG 3I55A 1V1OA 4KD3A 4ZQ3A 1U4RA 1LO5D 3R93A 1N33L 1VS0A 3TSSA 4LF4Q 4B3ML 1RFAA 1FPYA 4FF4A 1TVXA 2A6EC 4R9WA 3LB8C 1K8AC 1IYUA 1NE3A 3CRKC 5CV9A 2Q2UA 3CSTA 1V1QA 2JVCA 4RF0A 2L9HA 1GJZA 1SXTA 1TKGA 1Q10A 3UGBB 3Q8DA 5BO4B 2DZJA 2B63H 5ISRA 3BJUA 4LNKA 1JALA 1SNDA 1YQ3B 2HQEA 1GOZA 5H1SE 3S1NB 3EFUA 4MH0E 2GB1A 2LGYA 1TR5A 2YYZA 4JBMA 1K53A 4EEWA 4LF6Q 1I7HA 2M00A 2FIDA 3QHTA 3DWAA 2K5HA 5DLQE 2A19A 4GIVA 5EE9A 1WM2A 1SNPA 5CHVC 4IC7B 1GHJA 2CH4A 1PTOB 4AIMA 3ERQA 4ZK9B 4N9TA 1WY8A 3H6NA 1WTHA 2CU1A 5HY6A 1PFSA 4CYEA 2FCSA 1RD9D 3ZXVA 3V62A 3MJ5A 4H7BA 3RNGC 2K32A 2J4XA 4US9A 1EL0A 4P71A 1G2TA 1VRAB 3GZNB 3HOUH 1WGRA 3K81C 4C80A 1FGBD 1SYBA 3KVFB 4OX9L 4G3XB 4LAAA 1S5CD 3RZDB 5LHY1 1FXTB 1ENAA 4JI1Q 4WWOA 1BCPB 1MSHA 4QIWB 2MBEA 4A3LH 2WU2B 2KACA 4R3DA 2W9NA 4P7IA 4YSXB 1GC7A 3EN2A 3PO3G 2JYEA 3HRDD 4E71A 1RKNA 3L7ZC 2BYVE 1EY9A 2QHOA 3LDZE 4GLSC 1CKMA 4PZ8A 4LF4L 3WAMA 3H3VH 2RHSB 3T16A 1X65A 1WD1A 4P1BC 4OELB 5JEAG 2SDFA 4LJZC 3GTJB 3ENEA 4XWWA 2G3QB 1N62A 3PUWA 1KDAA 1ZYRC 1A6XA 2GBJA 3N1ZC 3N1YC 1QWYA 3OAWA 2BH2A 3Q69A 2B3AA 4OO1H 1GD7A 2DN8A 1VMCA 2Z4IA 3CCUA 1Y1WG 1VQAA 4AJWA 5JHBA 3EQLC 3VYSA 3NWSA 4HIMA 1Z6HA 3A9JA 1CZWA 4KZ0A 1QB5D 1L4ZB 2KCNA 2Q8IB 4IFDJ 4NNJB 4KV2A 1TY0A 2VZKD 4LF6L 3MXUA 2FCQA 3NE5B 4JVZA 2WINB 5IGFA 1Q7YC 4A3GG 1YQBA 2D11A 4RNAA 1AYFA 3PIO3 5GAHC 1SYCA 2W3RA 4GOPB 2N49A 2AWOA 2LZ6A 4OWWB 2N8NA 4KKIA 4ZUJA 2ZT9C 3T9LA 3D4DA 4K7UA 1DOXA 3AB9A 5EBCA 4N9PA 4B9WA 3URYA 3BU2A 2IW3A 3BVZA 3L9AX 5JPNC 3P4QB 4EQOA 2A8VA 3SU8X 4X66Q 1Y1WB 5NUCA 4I7ZC 3E5SA 2C7MB 4DAYA 1BNZA 2L1BA 1WTWA 4GZYC 4JI1L 1YJWA 3HKSA 4YWGG 5T8IA 5C4XH 3P1HA 4IUPA 5GQOA 1VQ9A 2F3WA 4JV5Q 2L0FA 1NUCA 4FA6A 5CMDA 1OGWA 5C4HA 2E75C 1RDPD 4A3GB 2UUAQ 2ACZB 1PLFA 5G5HA 5C3JB 5LMUQ 1ZKOA 2F0EA 3OYYA 3KBXA 3KF8B 1SEBD 2WB1E 3D4RA 1WTOA 1E7UA 1UBIA 2KDIA 3DDCB 5CC4A 1Y8OB 3L4PA 3QCAA 4M0WB 1I94Q 1X32A 1A63A 2BBCA 5GROA 1H8CA 2LJ5A 1WR6E 1QCBD 1LT3D 3EJIA 1Z2MA 3NWTA 4MGIE 3SGIA 3VH4B 2B8GA 2K5VA 4S0RA 2WACA 1I50H 3E0JA 1SYEA 3U7ZA 3RNUA 3CPFA 4GNXA 1D3ZA 4K3BA 3ONAB 3VR4A 4TRDA 5IWAQ 2LXKA 1V2YA 5KIXA 1S5DD 4X64Q 1VQ5A 1T9HA 4L5SA 3CCLA 4A3CG 1MG4A 2KHWB 4BBNC 3A8JE 3H91A 1NEKB 5J22A 2QEXA 1C4AA 1SGHA 1VQ8A 2FBWB 1LM0A 1PZID 2IL8A 2NWGA 3HRZC 4HR7B 4MZ9A 4DK1A 2MBOA 2C9WB 1VQCA 3J81L 4A3IH 2QEJC 5E3FA 3Q3OC 3MFYA 1D2BA 3I90A 4GNXB 4G4KA 3DEPA 4UP8A 5JAVA 3C46A 4FULA 4KGTA 1ZP0B 3KFUA 3S2HH 2K50A 5C2TB 5T1IA 3AEAB 2XRQD 4MT5A 2KD0A 1STHA 4IUNA 2C35B 2E76C 1L0YB 3Q3JA 2KJXA 5CV8A 3KF6A 4HJGE 4FJYA 3UI3A 5COYA 1Z7TA 1J8IA 1L0VB 2MW5A 2O4XA 3RULA 1YN5A 3DWPA 4X66L 5M5XB 2PNRC 4IZ8A 4PT5A 2B2UA 3OOCA 2FIFA 1WJ6A 2KYWA 1N9WA 2FHTA 5J1ZA 1C3TA 5IP7H 3AV8A 3RMHA 4RAUC 3CKIB 4JV5L 1YOVB 3S2DB 1H9MA 2O2LD 3T1YQ 2EOTA 1F9RA 3KUCB 3UE0A 2JU6X 2GLSA 4KIKB 5CV5A 2UUAL 1EWHA 2ZEQA 2J7ZA 4WIPA 2A68C 5LMUL 4RKBA 1YJ9A 3GTGB 2KQSA 4P16A 3TEWA 3S1MH 2EYLA 4K14A 5C4JH 5AFWA 1T0RC 4YTPB 1ET6A 2MA9B 1AFPA 1I94L 2OT2A 2B2YC 1L1OC 4A76A 4A75A 1XWEA 4K6LA 4DFAA 2D9UA 4JYAQ 1LT6D 4ULLA 1TWAH 4KY6A 4ZLTF 5KHQA 1YN3A 3RD2A 2K5QA 1DGSA 1VF7A 5KYLA 1YNNC 1EY4A 5HI1A 3FRPB 5IWAL 3W1SA 2F0WA 5FJ8H 1VZ6A 3KYCD 1VQIA 1MG8A 4OGQC 4N9F4 4HKZE 2NVTH 5GMVA 3NOBA 2F0MA 4ME3A 2MJDA 3PRZA 3U50C 2ZPYA 1ZW7A 4X62Q 2XK5A 2HTME 2I5LX 2Z6KC 1WRDB 1EY0A 3HM6X 2WYQA 4BVUC 2J42A 4AJYB 4HJ7A 4JI6Q 5L83A 4YIJA 2KX0A 1LUZA 2XVSA 2H4OA 2F0IA 1A3UA 1JWMD 3HGBA 3M4OB 4GDKB 5TSSA 4IKGA 1B70B 3UIPB 3MC9A 1ONLA 3IRBA 2EQSA 2VXWA 1YI2A 5IYBG 1QZEA 3W5VB 1EZ6A 4Z9CB 1X1MA 1MVKA 2JA5H 1WJJA 1S5BD 4KHVA 3F2DA 2F0JA 1F9QA 1GB4A 2O2VB 5EGTA 3ITPA 1KRTA 4XX5A 4ZRZA 1I4QA 1VCBA 2EMTA 1E2WA 2V0GA 1EY7A 1Y8NB 4Q0FA 1HR0W 4NAWA 2VQEQ 3SFEB 1LTRD 2IO3B 2QKIC 1TZ1A 2V4IB 2CW0D 4NPNA 2LUEA 1EQRA 3FMCA 4BA2I 4W9IA 3T1YL 4L6TB 2K7VA 3OWEB 3QOLA 5IP9G 1JB7A 1GO3E 1FM0D 4WJOA 1TWHB 5AJ3Q 1JWSD 1HNZQ 2KA7A 1JROA 2OEDA 2AKWB 3NRZA 1NYQA 4KKJA 3SEBA 4DK5A 5C4ZA 2O6VB 3SHQA 2DY8A 3HOWB 1X6OA 3O65B 4JYAL 4NAWB 1L4DB 2K05A 1SYGA 4RGNA 3W1BA 5IIFA 3S9WA 1QVFA 3SVMA 1OEYJ 2LHEA 4BKGA 4H13C 1V43A 1HZBA 1LV9A 4MSMB 4BOZB 2E3TA 2M17A 2CR5A 3TN2A 1IHZA 2D5GA 4DXGA 2KEDA 1XLQA 1BBWA 1HA5A 3VTWA 4OIJA 4X62L 5BMGA 3PT2B 1C9FA 4MELA 4XDXA 3C19A 1GPXA 2BKFA 4JI6L 3QR8A 3NEMA 4NPSA 2L05A 3MZ5A 4TV3A 3IG3A 3K80C 4O42A 4A3FG 3K5MA 3V6CB 1B8AA 4QAYA 2A6HC 2PIAA 4TQ0A 4R4OA 5HFYA 4KSLC 1I5FA 1WVLA 2MBHA 2WX0A 3HM3A 1IYVA 2F0HA 1P3QU 1JWUD 1RAXA 5LNK1 4A3BG 5KEEA 4A9AA 3MHZA 4HTHA 5C44B 2VQEL 4CHKA 1HZ5A 4OL7A 5JEAH 1LTLA 2LFIA 1MGSA 4PZ7A 1R4MB 4US8A 2A1AA 1PH1A 2JEAI 3DBLB 2ALYB 3QJYA 3N32A 1STGA 3NBIA 5AJ3L 1HNZL 2AYOB 3NQTA 2WU5B 3OSOA 1QOGA 1EOVA 2KUMA 2Q5WD 3ZTDA 2UWQA 1X3EA 3PUYA 4A3FB 2RDHA 1LT4D 2WP8J 5FKAC 3EA6A 3P1MA 3AFQA 1CTMA 1G91A 5IE8A 4YXDB 4NY0A 1TIID 3DWGC 1PA6A 4WURA 3M9BA 5EE0A 4BAXA 3OTOQ 2WHIA 2FMCA 1E7ZA 3ZJTA 3MC8A 3ZYYX 4HSVA 3SE0A 2NYZD 3TZDA 4A3BB 5TR5A 5LL6X 1Y1VH 2KANA 5EE1A 4GLVB 1E8XA 5CYUA 2DWQA 4JPSA 2KC1A 1HJPA 2R61A 4C1NI 3S1RB 1E22A 4QUCA 5EBDA 4LFAQ 2C7HA 2ZTEA 3A9KB 1QNKA 4XTCS 3U52E 2L12A 2V3NA 1LTBD 5D7GA 2IBIB 3B1LX 1SSOA 1WCMH 1XCQL 3DBHI 3KJPA 1B7YB 1KFYB 4DUZQ 3CC4A 3N3KB 3GQBA 1P7FA 2BE5D 4PMWA 1SROA 5C1ZA 2MP2A 3L17A 2GVBA 1B3AA 4NMZA 1V80A 2ON8A 3NZ3A 3PZ7A 1Q82C 2N9KA 2HT1A 1I4HA 2PPBC 3GTMB 3B2FA 1E8YA 4MGKE 2LSSA 4FXKC 4C1NK 4JI7Q 2PI2E 2LD9A 4H2AA 4LUVA 5BR8Q 2CCZA 1MFWA 2TMPA 2E5LQ 4LWCA 3OW2A 4I6LB 4BKTA 3K5OA 1LGRA 5CR3A 1MI2A 1K9MC 2DGYA 2LKVA 5A2QL 3Q6BA 3DVGY 5JJKA 2NN6I 1ZGUB 3L10B 3B9JA 4A3CH 4C4VA 4DV0Q 4LCDE 3BY4B 2ZXPA 1OXVA 3N20C 4W9HA 4BBNF 3V05A 1K83B 5IGCA 1E6EB 3KLSA 5ELOA 3OTOL 4BZAA 4X3UA 1L6UA 4EUTA 2AQ2B 5IKCM 4JC0A 2LXAA 4HMJA 3CCQA 1XEEA 3GTGH 4F1SA 5ELDA 2CHXA 2L11A 1YITA 3M62B 1B9NA 1HCZA 2IY1B 4YWKA 1VDVA 3RFZB 4LFAL 4ZKBB 2F0VA 4C4VB 4KI0A 1BOSA 5H92C 1UZXB 4JBKA 1ZKHA 2WXIA 3Q8EA 3NSWA 4HSPA 2A74C 2HUGA 2WFWA 1KD1C 2CWPA 4P1CC 4MH8A 1YHAA 2HD3A 1A5RA 4OVVA 3KJOA 4DUZL 4ALPA 1LTTD 4ZYNA 4N8X1 2RPVA 2B39A 3TP6A 2E8GA 1P98A 3DVNU 4K7WA 4J6IA 4MTKA 2DYOA 3F8TA 1RODA 1F2ZA 4L23A 2GBKA 3DBRI 4LF7Q 1BT0A 2BWFA 3M4OH 2JZPA 3R2IA 4FDBA 4JI7L 5D65A 3I4MH 2EPBA 5BR8L 2RBMA 1QUQB 2E5LL 1S5ED 2JA7G 2M4NA 2BGFA 2NVYH 2EJMA 1YMHE 1D7QA 4XDDA 3D4WA 4KN7C 2IDYA 2LXCA 3HIZA 4RKLA 1TYGB 2JA6G 1PVOA 4ANXA 4DV0L 2LGSA 1N61A 4DV2Q 3M7GA 2KWVB 3AU5A 1XQQA 4WQMA 1C78A 2HIVA 1FL0A 4APVA 1UWXA 4PG3A 1FGUA 2KECA 1VCIA 4AQYQ 2ASQA 4DKAC 3UDGA 4JOIC 1TWHH 1FMAD 3FKIH 2FCMA 2KX3A 1TS2A 5I4DA 3HVDA 4CBVA 4XXEA 1VQ6A 4UAIA 1OO9B 3S17B 2CQOA 2AUKA 3UQAA 3ZQ4A 4MTNA 3R8BA 2DENB 3HOWH 2A5HA 1HNWQ 1B1ZA 2JA7B 3M3YH 2VB3X 3CQZH 3QARA 2WB1G 3J81c 3RZOH 2E2JB 1AZQA 1IL2A 1YD8U 2MUYA 4URKA 1XPRA 5FR3A 1W3SA 3HP3A 2LRWA 1STEA 2JA6B 3I8ZA 1OXTA 1KL9A 1XO3A 2PE9A 1P7EA 3ZDTA 1BVSA 2DUDA 3NTKA 3W3AA 3PLUA 4FLHA 1JJGA 4GN5A 3EHVA 1ZDVA 3J7YW 3AULA 3VUWA 1KQSA 2RDGA 4Q5VA 3RI7C 1A8VA 3NG0A 3SD5A 2F0DA 4X57B 1J8CA 1M4VA 1CA6A 3TREA 2N7JA 2IX0A 3QQ8B 4LF7L 3EC8A 3K5LA 3A7AB 2JP1A 1XMOQ 5KNCA 1DOMA 1CSPA 3PSIA 5I6YA 2JRHA 3LWUA 1WXSA 4LJOB 2MQJA 4XWTA 4HVBA 2OJRA 1UAPA 2VNUD 4DK6C 4RF1A 2RSNA 3JSVA 2NBFA 4YCVA 2WB1B 3TBIB 2ZW1A 2CS4A 1YVCA 1L1OB 1EU3A 2Z6KA 3R3OA 1K50A 1VQNA 1NVID 2WXPA 4F87A 2R7DA 5JOBA 4RCOA 1YNTE 3NELA 5C44H 2WAQE 1DOYA 4DV2L 1C76A 1L0XB 2XIWA 1Z9FA 4C3IH 4A3KG 3QIAA 2LVQA 4HWIB 4DHJD 1P16A 2R2QA 2K5DA 4HCPB 4OXPA 4XC2A 4AQYL 1TKYA 1UWMA 3ZJVA 2CKZB 1FXIA 2DZKA 4EZLA 3G6JB 4BFRA 3Q0AA 3MXNA 3OJ3A 4A3FH 2P5ZX 5BN5A 2LGDA 4K3CA 2EE1A 1HNWL 4AWJA 1IL8A 1QOFA 4HDOA 2VQFQ 2N7DA 2FFKB 3LXFA 2JQRB 5CX3A 4EFOA 2B2TA 3T3OA 3VH3B 1QVGA 4KKUA 5CHWA 1DJRD 5M3MH 4WJPA 5FK9C 1WE7A 5J17A 4JI8Q 1ESRA 2F3IA 2FJ2A 2QMTA 5JVG3 3M85A 3SDZA 1FEHA 1FRDA 4W9CA 3RNBC 3IHPC 3MXPA 1ENFA 3ML8A 1SMXA 3IFTA 5M5WB 4HIDA 4A3KB 2JYOA 4KD4A 4DAPA 2Z8LA 1N8RC 5ELBA 4A3DH 2C5LC 3ZUNA 3TUOA 2ID0A 2DZMA 1FNVA 1GC6A 2GBNA 2SNMA 3UF8A 5IT9E 2W55A 2WKCA 2PMZE 1F9SA 5CV4A 4ABNA 1XX8A 1RF2D 1XMOL 1B44D 1UGJA 5AZHA 4NW2A 3APDA 1ENCA 5C5LA 3SFDB 1JJCB 4HKQA 3HOYG 1NI2A 4HIOA 4C56C 2G9DA 4WJ4A 1C79A 3V6EB 2NPTA 1DOKA 3P4SB 5JJLA 4HLEA 3AU7A 2EIFA 1GJXA 2NVXB 1HH2P 3GTMH 1UE6A 1J9OA 2HCIA 2IY5B 4WFN3 3FKYA 3VRAB 1WTRA 1VQFA 2Q2HA 2A4ZA 1X54A 2RSUA 4W9EA 1E2ZA 1NR4A 2YTVA 1O80A 4TKNA 4R4IA 3WOEA 4MACA 4MSQB 3HZXA 4B0EA 4ZDVA 1J7CA 3T56B 2UUBQ 3ER0A 3H0GG 4IJLA 4RM8A 3T8MA 1DONA 3QG1A 3CCRA 1YJ1A 2ZJPA 3VFKA 4DU9A 2W82A 1P8LA 2MGSA 2KK8A 3BIID 1VQGA 1FCLA 1HPCA 1TKWB 4E6IA 4IJHA 4I7AA 2KKCA 3HOXG 3ZW3A 2Q2IA 4DR5Q 1WXVA 1YX5B 1FCCC 2AL3A 3CU7A 4K2LA 2VQFL 3T3NA 5CBEE 2JA8G 1WXQA 3I63C 1IW7C 3OMCA 4KKSA 1T6BX 3RNAC 1GNUA 2KHIA 3NXWA 1XPUA 4LNFA 1DD2A 1FD7D 1EWYC 2MH7A 3P4RB 4WJQA 4JI8L 2Q2TA 1KF6B 4GKKQ 4CHTB 2CJOA 3A4RA 1RIPA 1GUAB 3IAM1 3CW2C 2I1JA 1L0WA 5D3DA 2N1VA 1JC7A 2V3SA 1SE3A 1SJHD 3EGRA 2AWTA 1S72A 1EWCA 3H0GB 2JX5A 2L4NA 4EKUA 1WX9A 3D0FA 2PVGC 4DBGA 4R4QA 1V8QA 3HOZB 3DM1A 4F7XA 4RCNA 1U4LA 1AARA 5DPTA 3QO2A 5J39A 2X6GA 2RCNA 2I2YA 4GB9A 2BWES 3DEOA 3I4NG 2KAJA 3CC7A 4YSYB 4DV7Q 3DMUA 3H9DA 2JA8B 5JJZA 1H9RA 2CFMA 4RM9A 2Y5BB 3KH0A 3Q8BA 4CO7A 4GXBA 3OIPA 4HPLB 1WIAA 2KCMA 5IYCG 4NAMA 1MJEA 3N52A 5CGKA 4G11A 4L8JA 1UH6A 5IGBA 1BUIC 1OQQA 3QA8A 2L15A 4GOCA 2WKDA 5DM73 3PRPB 3NTIA 3G7LA 4BKSA 2QDBA 1HEZE 4RMFA 3S24A 1F2RI 3S16B 2UUBL 3HOVH 4TKOB 1CHQD 4FJVB 2J7QB 3J80L 5IO9A 3E9HA 4ZKCB 4LJPB 1EU4A 3CCEA 3ZRCA 1MHWC 1VQ4A 4LDTB 4PYUA 4Y7NB 4HPPA 1K52A 3BS1A 4DR5L 4X3SA 3I4NB 2PKOA 2K4KA 2JA9A 3SR1A 2L5TA 1AZPA 5C23A 4HAEA 1ILQA 2CU3A 2D2QA 1HFGA 1B3QA 4KV6A 2ICEC 4EGVA 1Q86C 3TS2A 3NQIA 4BBRH 1FFUA 2RQXA 1F2LA 4GKKL 4KZCA 4NXNQ 3ND8A 2WDTB 1V5OA 2BYTA 1V5TA 1WTQA 3HFZB 3K58A 3GDEA 2N9EB 3NHHA 2UYZB 2INPE 4QL5A 1Z47A 3U4ZA 5IGDA 2ZJQA 1HUNA 4TUUA 1EQVA 3VTVA 2KFKA 2H88B 1WD0A 2WDRB 1WI0A 4MM3B 4K8JA 1AWDA 1T3QA 3IT6B 1M1KC 4NJ6A 1QOAA 2BA1A 3M7NA 4FN2A 4DV7L 3BDLA 1PRTC 2WXHA 3WCQA 4GOPA 2K3UA 4G50A 5A2QE 3I9V1 1SE2A 5GAGC 2NVQH 2GMIC 1WX7A 4ZRKA 1V6EA 3E56A 1NYRA 3PTFC 3W1YA 4WRDA 2F52A 3T1HQ 2KFKB 3H09A 1UD7A 4PK1A 4ME5A 3G71A 4V0BA 5IP4D 3IL8A 5IODA 1I4XA 3S15B 2L00B 4PYZA 2MFIA 4M1UB 3RZFA 3TEZA 1VQMA 1YZ6A 3CMMB 4FHJA 1J0GA 3PO3B 1WWTA 1WX8A 1WMHA 5E7NA 2OOBB 3GZNI 1XLPA 2VH2A 1X3GA 3STBD 1TXYA 4UP7A 2MEKA 1KRHA 3CD6A 5M3FG 4CDDC 1PZJD 1K0RA 1SR3A 4G7OC 4M8MA 3MC0B 2KCCA 3BZCA 4YY3Q 4LNQA 3Q8FA 4GSWA 1HZ9A 1EWIA 2PZWA 2D3AA 3KF8A 1O7LA 3V61A 2QSDA 1PGXA 3FP9A 4M0WA 4DR2Q 1TT2A 3E6ZX 3KOJA 4OHJA 2BW2A 2B2WC 2HDEA 1ET9A 3BWUD 3ZLZA 1MIUA 5EQ0A 4P73A 2BPSA 4II3B 4A93G 4NXNL 1T5XD 1WMHB 4C7YA 2HIXA 4IWQA 4NJCA 1IGCA 3U4EG 3ZTCA 1Q0WB 3APCA 3R66C 1O7IA 1WJNA 2L8JA 2RDBC 3EFXD 3C0RB 1GUOA 2JQOA 1EIFA 4RGTA 5E4XA 4YCWA 5I2YA 5FO7B 4M8NA 4EE2A 1C0AA 1NNXA 4JOIA 1I4GA 1ZEQX 3JAML 5M3FB 3M3JA 3QB3A 5IOCA 1H9JA 2NS5A 4BY1G 4R8IA 1Y8PB 3JVZX 4MDKE 3U9OA 4A3KH 1PH3A 3K7AB 1WTXA 1SF0A 3OLMD 3RYTA 4PQXA 3SK4A 3GTQB 1YNND 3CCSA 1CKOA 1HZCA 1Y69U 1PH4A 5K5PA 2F0UA 2EVBA 1NR2A 1VF5C 4IPHA 2EYPA 2PZTA 4A93B 5E6JA 2JJQA 3ZJUA 3T1HL 4L63B 3AEDB 3RT3B 3CMEA 3ZNGC 4GLAC 2EJFC 4JBWA 4ITKA 2DNEA 3PCOB 2Y5CA 3A8IE 1PFDA 3PV1A 1AE2A 3I3TB 3NPPA 4A3EG 4HCNB 3CRLC 4WORA 2NVXH 4XT3B 2Z0SA 2MHVA 4CDFC 1E7VA 2J0KA 2Z0EB 4JLCA 5HHDG 3I4OA 3E9IA 2NZ1D 4KJNA 1O7YA 4B3TQ 4DDID 1K3BC 4KIKA 4XQNA 4GU2A 4LLGM 3WAPA 4BY1B 4YY3L 3C1FA 1U4AA 4B3RQ 5FO9B 2KDEB 1SMYC 1TWGB 3HVZA 1K8MA 4IUTA 4E74A 1TWFB 5CV7A 4DR2L 4RA8A 2XBBC 4GN1A 3ML9A 1L6VA 2HDMA 2MLBA 2ZJRA 5MPOA 2G9HD 4WJ3M 1RTNA 1OEYA 4IPGA 4XYCA 2CVRA 2M1MA 4B0MA 1G2SA 2ZW0A 3NVWA 3BVMA 2KWDA 3KYHC 3N9YC 5H8YE 4DHZB 1PYWD 2NCNA 1S1QB 2G5DA 2LUMA 4DN4M 5DAUA 4HCEA 2F4IA 4A3EB 2YU9H 4YTMB 3Q14C 2F0GA 3H3VC 1N6ZA 1C9OA 2KENA 1QG7A 1OFFA 3RLNA 1UEAB 3H94A 2EYOA 1HQRD 1YJJA 2FUG1 3GB1A 2LHDA 1DYQA 3J80i 1G8ZD 4EQPA 2G4DB 3A4SC 2UXCQ 4GDKA 5AZFA 3PV0A 3H0GH 3SK6A 1C1YB 1R9TB 4KDIC 1ZPSA 2RR9A 4BA1I 4X3TA 2K28A 4CJ1B 3TRZA 1NBFC 2WNMA 5BMHA 3HOZH 2D07B 3KLRA 3TEXA 1GXDC 1WGHA 4K81A 1I42A 5E4WC 1RYJA 3BINA 2BS4B 1ZXTA 2G45B 2O2VA 3PGZA 4DF7A 1X9NA 2Z4HA 1I6HB 1WSPA 1TS4A 2F0NA 2KJRA 2L7RA 3PVLA 1GUNA 3UINB 1AEXA 4H02A 4KKTA 1EYCA 4C2MB 3ALBA 3C2PA 1E10A 5K36G 1X3FA 2IO2B 2K8CA 1LFDA 3HK0A 2JF5A 4B3TL 2R92G 1KNAA 3S1NH 4X6AH 1LQBA 3RN5A 2JXTA 3PSEB 1EEID 2VUMG 4B3RL 4IFDH 3VYUA 4M02A 1SLJA 3A7LA 2BOSA 4QUFA 1TJEA 1TTNA 3DQVA 2WAQG 2O6VA 2QJLA 4XIGS 1PZKD 5KRUA 2B76B 2K6DB 3VR8B 3AEBB 1PTOH 3RPFC 4JI5Q 1HA6A 3PO2G 3I4NH 2EKIA 1WGKA 1YIJA 2XN9C 2PTLA 2XRSD 1F2YA 3F2CA 1IYFA 4IWPA 3KYDD 1J7AA 3WALA 2LGIA 4QMGA 1C48A 2IHEA 1SFOB 2LFNA 3HKZE 3MTSA 3AB5A 3RZDH 2DZIA 1K28A 2JT4B 2R92B 2M0AA 3U7DA 4RHSA 1C77A 4YSZB 1PGBA 5IN7A 1KLUD 2MO1A 2A69D 2N88A 5JHAA 2VUMB 2FMMA 3LJ3A 2N9PC 4P6VF 1ZE3D 5A35A 2UXCL 2NZHA 2PJHA 3VA5A 3MWYW 3KUZA 2WAQB 3U8ZA 2NVUI 1SIFA 4YCUA 4CKEA 2WS3B 3H1UA 3IFDA 3GTJH 3DPDA 3PO2B 2KC2A 1PFMA 2ZZPB 4V190 4I6NB 1PTOD 2DJFC 2R93G 1KLGD 3LYYA 1RWSA 4LTUA 2SEBD 2FCNA 2Z0DB 3ZJYC 3K6OA 4A3PA 5I9OA 2O5IC 2KWCA 2K01A 1RRBA 3ETRA 5C3WA 2VY3A 2EXZA 4CKBA 1XJVA 3S1QB 2BA0A 1QE6A 3VA7A 5M5YB 5GAEC 3FPUB 4L5RC 1ACCA 1NMFA 4NJ7A 2K5PA 1CZGA 1RFKA 4YHHQ 3FAHA 2RVLA 3P2BA 3DHGC 3NZSA 1BCPD 2KLCA 3PO3H 2B29A 5DNFA 1MHXA 2DAJA 3KUDB 2LVOA 3JAMi 2YTXA 3MEFA 2K52A 3J9CA 4TSSA 1VLBA 4WH4A 2X8XX 3AE2B 4JI5L 1XF5L 5AZGA 2L0CA 1Q46A 1CSQA 2WXGA 4IALA 2N1WA 2EYMA 3MP9A 4BY7G 2R93B 1LTGD 1OQRA 2HCCA 3LGJA 3X3NA 1VDZA 3I3CA 1ASZA 2JPHA 4DR6Q 2MRPA 5EKIA 3DVNV 4B95A 4E3CA 4JQWC 4DV3Q 3PQIA 1PRTF 1Y1WH 5DEHA 3A9KA 5ELNA 3PZDA 1K3RA 3IAYA 3D6CA 4IUQA 4QIWE 1E1TA 3J81i 4IOIE 3ZXRA 1PUTA 3M4PA 4R4CA 4A3GH 1KDBA 2XTIA 2CW0C 4KGSA 3R3MA 2X6LA 4HJ9A 3VR3A 1TKEA 2R3ZA 4DAMA 1I35A 2JK8A 4A4IA 1IGDA 3D6WA 2QCZA 4ASWC 1LABA 1GAQB 2GI9A 1NMGA 2WXLA 4AP4C 4ZUIA 4BY7B 1E8WA 3K7AH 3J80c 1WFYA 4AQ7A 3VR6A 3J80E 2XNAC 2VS1A 5LMNQ 1I6VC 1N60A 3GS2A 1I4PA 4FF2A 1SNMA 3P4PB 2PYKA 2WV6D 2EYJA 5LLIA 3RZWC 2DAFA 1Q8IA 3VVWB 3QC8B 5DPRA 1R4MI 3IBEA 4YHHL 2PZUA 3DBLI 2OTLA 3ZIMA 2FUHB 2JWZA 1BQQT 1G6PA 1M8AA 2YEPF 3RUZA 1LTAD 3IFWB 1IPGA 1BMLC 3JYUA 4WWMA 1V9PA 2L3ZA 1LT5D 4ZRPA 3E0EA 2F03A 3PF5A 1P1AA 1TBEA 2BYFA 2KN5A 3A55A 2WDQB 1RL2A 1F0ZA 5FLMG 1YQ4B 1UEBA 2BDOA 1JB3A 1QZHA 4BY1H 1MSGA 2KOXA 3HS0C 1AE3A 3LX0A 1TWGH 3V2TA 4WQOB 3NTHA 1TWFH 4K5WA 2IWHA 2QILA 4DR6L 3NS1A 4PS3A 2EY6A 3Q8CA 4DV3L 2M0XA 2V1YA 3K9OB 5M5XH 3SR6A 4KTAA 3H6MA 1MJCA 3KK7A 5EKLA 3NZUA 1D6EC 1JW9D 2G1EA 1PRTB 1HTLD 2N3SA 3G6EA 4EQ5A 3A8KE 1B53A 2XSCA 3S2DH 4BXXG 1QJOA 3WWVA 3VTUA 5C0XG 2L55A 1CQFA 1ZXIA 4A3EH 3L16A 2F4VQ 3V3XA 4W9JA 1PH8A 3VHTC 1WXAA 3W1GA 1WFQA 3TBLD 2JSOA 4EVOA 2H1EA 5IGEA 1WI5A 2B2WA 1N5WA 4LUOA 4JI4Q 4P74A 1VQBA 3X3MA 4REZA 4KN4C 4ZAIA 3CSFA 4BWGB 5LMNL 4DR4L 4X3KA 2KMAA 1QUQA 3I91A 1Q12A 2I07B 3TP5A 1K8OA 1WTPA 4N8FA 2JY6A 4ZHPA 1TS5A 4U68A 1DGJA 3AE1B 3BYYB 3IVFA 3TEYA 2Y0SE 1I6HH 4OIKA 2I0QA 1UE5A 2GBRA 3QK0A 5F2DA 4QGUA 1EIHA 1GUGA 1KC8C 2E2HB 4GDLA 5LXHA 4WJWA 4L5QA 1IUEA 1UELA 1PH5A 2YEPB 4IDIA 1TU2B 4YL8A 1DOLA 4C7ZA 1K8RB 1RLFA 1GVPA 1KAAA 2NMQA 2RCFA 2F0KA 1WF9A 2CJNA 4FNFA 4IM3A 4QB4A 4RWSC 1SYFA 2PQAB 3B6YA 1O7ZA 1CMXB 3S2AA 2BE5C 2Q8RE 5KNDA 2FNJB 3JAMc 2RDFA 1QLBB 1UBQA 5KNBA 4MGZE 3BG3A 3JAME 4GDLB 3HOUG 1XLOA 4POGA 4DQOC 2CQAA 4POFA 2UXDQ 4LF8Q 1PXUA 1ZOYB 2KO3A 3ONSA 5IYDG 4JI3Q 3ZNHB 3VDYA 1WE6A 4FF3A 4JBJA 2NBWB 4KDLB 1D5MC 4KY5A 2F4VL 4A3LG 2VL6A 3P7JA 1QOHA 2PLPA 2MP1A 3S14B 1KAWA 1QT9A 5IYBH 3F1ZA 4UP9A 3L2PA 4DV6Q 2UU9Q 4IO9A 4WAFA 2KVZA 4XGAB 4JI4L 2D0PA 1YNJC 1RJTA 3B0AA 3J81E 3FC4A 3OG5A 2IO0B 3SHLA 4DK3C 1GM5A 3PMFA 1J7BA 2FAZA 4JIOU 3CC2A 1GUTA 2MJ8A 1OQYA 2JUOA 3BDCA 5IOIA 2LWPA 3TMEA 4DUYQ 2WWZA 3CXCA 2ZCBA 4IUUA 4J15A 3HOUB 1YNXA 5HGTA 5J3BA 3W5OA 4OO1G 1WYWB 2KQ4X 3G48A 4NB3A 3DXJC 3TP7A 5C0XJ 2B2YA 1L1OA 1CJEA 2DHZA 3GE3C 2OXPA 2IX3A 3CCMA 5IP9H 2XWJB 4K2KA 2VZKB 4W9LA 3NK9A 1SNOA 2DX5B 2H5XA 1A2UA 3WDNA 3Q6SA 2RHQB 4K0KQ 1XLNA 4A3JG 2K5NA 3PIPA 4O0AA 1B9RA 2JE6I 1VQDA 2O6VD 1JICA 1E8ZA 2KMCA 3EBEA 4TQUS 4DNTB 2RKSA 3ABVB 4J1MA 1V9JA 2WGSA 3DCGA 4KMUC 5T1GA 4HEA1 4XQQA 3UDXA 3GOEA 2CWAA 1X55A 4FP5D 2AUJD 3VYTA 2UXDL 4LF8L 5BN3A 3I56A 1C8CA 4ZRQA 5HURA 2R93H 4MNOA 4JI3L 2EZVA 3MAQA 4IUMB 4A90A 1VQ7A 4CGYB 2ZTDA 5C4XG 3D3RA 1EYAA 4DR3Q 1QZGA 1M94A 3MA2B 2C60A 3Q22A 4A3JB 2K6QA 2DNFA 2PPHA 3KW5B 2UU9L 4I65A 4C00A 1PH7A 4DV6L 4B6WA 3BK2A 4IN3A 4CKCA 2LASA 3APFA 1GUSA 1WRIA 1IW7D 3CIRB 2F0OA 4GN4B 1WGDA 4JCVE 2N9XA 2L32A 4A3BH 4G0NB 4CDEC 1T0SC 3U9SA 2F0TA 4HRSA 4ARCA 2PO4A 2MO0A 4DUYL 4JI0Q 1D5XC 3TMPB 5JH5C 5HG2A 3S1RH 1R4NB 3U4VA 2MJEA 1QQRA 3ZDMC 1PMRA 1T5EA 1U9RA 1SN8A 2E74C 4HDQA 4ICVA 4QCLA 1SNQA 5JPMC 2KMMA 4LNIA 3EROA 1FJGQ 4S3SA 3GTKB 5C4XB 3E9SA 3NVZA 3VXWA 4K5VA 1J19A 3QX1A 1IP9A 1U4MA 1VQJA 3A54A 1PH6A 1BKBA 2A6ED 4K0KL 3CF5A 1XMQQ 3D32A 4A3IG 1YBYA 1WZ0A 2J53A 3TQYA 3W2DA 4LF5Q 5LXIB 1JQYD 5E6PA 4UPAA 3GE8C 4FHKA 1ZDXA 3W9CB 4W9KA 5DPSA 3J7A5 4NKLA 1U4PA 1TGZB 4IOCA 3RMKC 1M90C 4F7ZA 3NJTA 3LWEA 1RCVD 2HE7A 1HZ6A 3ECIA 1F1HA 4LK0M 5ELFA 1EQTA 2HDLA 2WXMA 4LNNA 4IM0A 5IP7G 1E0BA 1WJUA 5EPLA 1F77A 1YJIA 2N4FA 2J0JA 4DR3L 1WXMA 4GGQA 3NVYA 1STAA 4LF9L 3WA0A 1LM8B 3OWFA 4NP5A 2AHOB 1LTID 4A3IB 1UE7A 2WIIB 1SE9A 3HOYB 3NY5A 1BR9A 3OHXC 2OF1A 4S17A 2V9HA 1K83H 2KHJA 1HHVA 3L54A 1EF5A 2QIEB 2K39A 3HKZG 2WXKA 1IZ6A 1F9PA 1AH9A 1VQEA 3HHMA 5LL6S 2JXXA 3L0OA 2BDNA 2HJ1A 4JI0L 1K51A 2OQKA 2PW5A 5FLMH 5FJ8G 1SNCA 1Q8KA 3QIJA 2G4SA 4EX5A 4W9DA 1SAPA 1VQPA 1J6QA 1FJGL 4B9XA 4CQNA 4HN7A 2V1CC 3VYRA 1YX6B 1GB1A 1Q1BA 3DLLA 1OXXK 5BYRA 1IBXA 2YLMA 4U673 3HOXB 2IPKD 1EIYB 1XMQL 4A8XC 2IGHA 2BCOA 5C5MA 5CORA 4FADA 1ZYRD 4LF5L 3S1MB 5D6JB 2ZVNA 5C4JB 2KTFA 1PRTD 1NTGA 1U0LA 5KYIA 2K03A 3NVVA 3HKZB 5EPKA 4F8CB 4WJNA 1Q5WB 1JQ4A 2JA5G 2JYTA 1OXUA 1VJKA 2RGFA 2M2LA 4A55A 4ZCKA 4FO2A 1PH2A 1FR3A 1HNXQ 2M19A 4IW0A 2X69A 3V60A 4EOYA 3Q2AC 2XWBB 1IBXB 4KX6B 2RSOA 3KDFB 2GVAA 2IY0B 3BYTB 2NVTB 1B2TA 1F9JA 5JZEB 1E24A 3VUXA 2Z59B 1K8GA 1SJED 4PS7A 2RD0A 1W6KA 1ISNA 3QOJA 3ULJA 3VR9B 1SSNA 1CK1A 3AE5B 3TDQA 1XPOA 1D1KA 3L3OC 1W2BA 1IKMA 3QAQA 4HPMB 3PRMB 1HQMC 2K75A 3AH7A 4XYQA 1VZ7A 4KVGB 1MI0A 3RR5A 4ID6A 3AYHB 2PEAA 3MHSD 2Y3AA 4MM3A 5KGUA 3I7FA 2JA5B 3NP8A 4AYBE 2MJ3A 3T13A 2OEOA 2BT6A 2E2IB 2KFJA 3S17H 4M01A 1BBUA 1NCVA 2R7ZG 1LXDA 3S14H 5D94A 3M4YA 3GTLB 4QF4A 2JA7H 3MJWA 3FDTA 1FO4A 2HJ8A 1H4RA 3TEHB 4P72A 3EIVA 2E2JH 3HG9A 4IM2A 3AU4A 2YTYA 2BS3B 2R2OA 1TWCB 2K33A 1STBA 5JJIA 2QDLA 1IXRA 4MEMA 3MXGA 2JA6H 2REXA 1UWVA 1KLVA 3VR5A 2RPQA 1E2VA 3SK5A 3IKJA 2BB6A 1I3QB 3CPWA 1FFVA 1TT5B 2XGTA 4IFDI 2DNCA 1B4OA 1Y56A 1JWAD 4DWFA 5IYDH 1D4BA 1XT9B 1HRJA 2E6XA 1XYIA 1N32Q 2HTHA 2WDVB 4W9FA 2K1BA 2JXMB 2L83A 1CI3M 2IT1A 2NZOA 2KQ7A 5DCNA 2K14A 3SXHA 2F0PA 3GV3A 2EMSA 4HJ8A 4IURA 1FD6A 1HNXL 2R7ZB 4XE0A 3FILA 4DR7Q 2ENBA 3V96A 3DBSA 2LXJA 2INNE 4FXCA 3PHXB 2BB5A 3AEVA 2VB2X 4R1JA 2OTJA 2BTEA 3GTPB 4PS8A 2QCPX 3DM3A 3K7UC 2BH8A 2AX5A 4JL9A 3WOFA 2Z9HA 5D14A 4NDXA 5IGGA 4XT1B 2VW9A 2NR2A 4ZHOA 2PI2A 2KBNA 2QW7A 3K5NA 1PFBA 3NS8A 1II3A 1SMYD 3FILB 2TSSA 3J7AF 1MJDA 1KABA 4P2CB 3VRBB 3WANA 4FXDA 3K59A 2ASBA 2BYEA 5E6OA 1XTDA 5G3LF 2MCNB 4EZJA 1EYDA 2EJGC 4A3JH 3CWIA 1NBWA 4QY7A 3BZKA 1C7YA 1WOCA 1Y14B 3VR2A 4NQLB 1Y1VG 1KIXA 4YWMA 1KHIA 2A68D 2RMMA 3A9JB 3UQBA 2LS01 4XYOA 1WM3A 5L37A 3KQ4A 4KGRA 1FNUA 2MPMA 1FVIA 4GKJQ 1K0SA 2HQLA 1GHKA 4L2YA 5M5WH 1CT1D 1WCMG 1WH3A 4OZAA 4TQ1A 2PNHA 4EQNA 4K1RB 3I4LA 1N32L 1DCZA 4A3OA 3GTKH 2L1AA 2LY7A 1JJ2A 2C9OA 2Y0SG 3QWNA 2OWOA 3ULLA 2GRIA 4NQKE 4ZRJA 4OVUA 1CHPD 4ZRIA 3VDZA 1IKLA 5D3IB 2IJ0A 3ERSX 1OTCA 4PMBA 4DR7L 1V81A 2OQ0A 3PREA 5IA7A 3N30A 4BS9A 1PGAA 2KJ6A 3PGEA 1B50A 1Y1VB 3FEWX 5JVH3 2JRIB 3J7ZC 2EDGA 3H15A 4LK1C 2ZNVC 2EYFA 4UDUC 3ZNZB 1EIGA 1MKHA 3AE4B 4DAYB 1XNQQ 2ZVOA 3AEGB 4GLXA 2WXJA 3RCZA 2Z1CA 1IBLQ 5BN4A 1STYA 2K04A 2EKEC 2LMCA 2I38A 4KJOA 4KY7A 1N36Q 1WCMB 1S3OA 4LW1A 2J52A 2F3VA 1Q3LA 2I5MX 1N5XA 5G5GA 1KDCA 4MHEA 2F0FA 2H89B 2Y0SB 1CM9A 2F0LA 2BF8B 5I6WA 4DV4Q 4PZ6A 4X65Q 3RNCC 3HOYH 2MX2A 4JWSC 2UXBQ 2EXDA 2WQYB 3STBC 5JEAJ 5EJWA 3PLVA 1TZOA 2LMCB 2F1MA 3BVGA 1JOQA 4QJFA 1EY5A 3PIOA 3FVQA 3NUCA 1P9DU 4MN3A 3IAS1 1TQOA 2ZPNA 2ZTCA 2NTTA 3Q3NC 2B2VC 3AEFB 4CJ2C 1CUKA 4DV5Q 4GKJL 4G57A 4USAA 5C3EG 3AMZA 1EOTA 1CFMA 4A3MG 1R4QB 2D3GA 4N6EB 3A5ZB 4R4TA 2I1KA 3CF6E 4J6HA 4ILWA 3G4SA 3F2UA 2KHSA 2XEWA 2KXJA 1H9SA 5M9OA 3LNNA 4IPDA 1ILPA 3HOXH 2KN4A 3Q3MC 3CCJA 2D3CA 1BO0A 1O78A 1OXSC 3KF6B 2K9XA 3H7SA 1JE4A 5EKKA 3MFGA 1XTCD 2JA8H 3I4MG 1JOOA 3D8GA 3I5JC 5GADC 5EE3A 3RUIB 4IQZA 4F88A 3ULPA 3RD4A 4DXFA 2L52A 1X56A 1YHBA 2Y5PA 2JEBI 4HXDA 1XNQL 1KOTA 2BVCA 4OWTB 3H8HA 1IBLL 4JE3B 5C3EB 4ZOHC 2A6HD 1H9SB 4LUZA 1VMPA 3GO5A 4KSKC 1N36L 4TMAB 1HE8A 4X64L 4A3MB 1HZAA 1EYGA 3S16H 3CHBD 2MBBB 3MEHA 3Q8AA 2E2DC
chains in the Genus database with same CATH topology
4LMQD 4C3JG 4XDCA 4RGMA 3I70A 2O5JC 3U2SC 3I4MB 2R6GA 2F0SA 1ZUD2 4O1NA 3AM9A 2NVYB 2Q8TA 3I72A 3R2TA 1C4CA 3KWVA 1D1IA 3T53B 1JOKA 5IT9L 2KOLA 3A56A 2K6AA 3I73A 1SE4A 1JMLA 1SIJA 3AMUA 2B2TC 4C3JB 3GP7A 2KQ3A 3FKIB 1EM7A 5FLXL 5DM63 3EUB2 4J8QA 3TP8A 2AWNA 3OW7A 4KHZA 3UI2A 4RHRA 3HEJA 3M3YB 2V3PA 3CQZB 4JX1C 3RZOB 1N63A 2PQEA 3AECB 1RM6C 4DAVA 2EY2A 3DWMA 2W3SA 2AQ3B 2WXOA 4HCSA 1LACA 2SNSA 4C3IG 1SYDA 2DLBA 4OW0A 5BMIA 1DZ1A 4HEDA 3T4AC 1QF6A 1F2RC 3KLSX 1A70A 2PMZB 4DGZA 2PMVA 1GUWA 5CBAE 2J0TD 4BBSB 1Q1EA 4ZYSA 1NI3A 3TZUA 4OZBA 1QOBA 4XQJA 2NN6G 4HROA 2KDMA 1XCTL 2ZXOA 2AQ1B 2PVOD 4H44C 4C3IB 3T51B 2ZXRA 1R4PB 1SB3C 2EELA 5JXVA 1KNEA 3D31A 4L1BA 2WXNA 2K0PA 2SOBA 1EZ8A 1EEFD 3O13A 4MIUA 5FOBB 4JWUC 5CV6A 2A69C 2PCFB 4G7ZC 1X3PA 4DNRB 1BDOA 1UUPA 3C1EA 5M3MB 3ZGZA 1B9MA 2WXQA 3RLFA 1QNUA 3P75A 3W5UB 3OMGA 1DXMA 4A3DB 2V4DA 1PTOC 4FVMA 1PDQA 1V1PA 4DA2A 3AE8B 2EYHA 5BYSA 1AP0A 3K0YA 3C3LA 2K5WA 3PUXA 1PDXA 5C3XA 1MBYA 2FINB 4DK0A 4C3HG 3DHQA 2N55A 4RH6A 1NAPA 1BCPC 4D2KA 1V1PB 5FO8B 1BBXC 1KTKA 1W6JA 1NENB 1FYCA 2WP9B 1WTVA 1HUMA 2X38A 1ICWA 5AUIA 3BDOA 5AUKA 2GA4B 1ML0D 4JK1C 4FYDA 2WXFA 1V8CA 4PMCA 4B08A 2EY5A 2ICIA 3OIQA 2N9LA 1YNJD 5BYQA 1FNWA 4C3HB 3I57A 3GTOB 2K22A 1HFNA 2KEEA 1JRPA 3Q24A 2JWUA 5G3LD 2JSVX 1LLRD 4AYBB 4OVZA 3PIP3 3P20A 4RFBA 1DOIA 1UNSA 1LTSD 4CJ0B 4Q2JA 3BK1A 4PNYA 1FIQA 5I2XA 2IX1A 4OZCA 2W54A 5GXGB 3AE7B 1C4PA 1BF4A 1L5PA 4J3OD 2C5CA 1SBBB 4KK7A 3P42A 1CQVA 2B63B 3FPPA 1JWBD 2PW7A 1ZXHA 2B8FA 1JR0D 4YTNB 3N6RA 1TY2A 5K36H 2LJIA 5EPJA 5ELEA 1D5ZC 1A15A 3HOVB 3SK8A 2N0SB 3PUZA 5E1FA 5C0XI 1AW7A 2QF7A 2DY7A 3B2GA 1E7PB 1E0ZA 3C8YA 4K5XA 4RGOS 3T3OA 2CHBD 2SAKA 4BBRB 2B2VA 1MHHE 3HUIA 4N58A 1G291 2EY1A 1H9KA 1NSNS 1A3VA 1RHPA 2NB0A 3DWQA 4M8AA 4K8IA 2IGGA 3NBHA 3MHBA 4A6QA 2M9VA 1TS3A 3AN1A 1ESFA 2NVQB 4FXGC 1BXTA 2RA4A 3K57A 3AE6B 5C6AA 5ELCA 3KBGA 3OPOA 1VZ8A 4ODGA 2B2UC 1F2MA 1XXGA 3EVQA 3IT4B 2IGDA 4IUVA 1CA5A 1Q90A 3Q23A 1DM0B 1A2TA 3DUZA 3J7AV 2I46A 3GV6A 3PO0A 1AN8A 1RTOA 4AS1A 4ARIA 1BUVT 4F8MA 2BS2B 3AE9B 1EY8A 4G7HC 3KUPA 1SDFA 2WXRA 1MD2D 2LEKA 3GD7A 2D62A 1CZPA 1FXAA 4OO1I 1S5FD 2NTSA 2NN6H 2NUCA 1WYGA 1I4RA 1KH0A 4K6DA 4N59A 3PUVA 3IXSA 3PZ8A 4NZLB 1VR9A 2A73B 1I50B 1QILA 2KVMA 4YT0B 1YN4A 1HXYD 5I9PA 3VQIA 1QKZA 1MPEA 4HMIA 2OHFA 2WLBA 3MVVA 3P63A 4R8NA 1G6ZA 1JORA 3BZDB 5FLXE 2D5DA 3ND9A 1EY6A 1HTPA 1EFID 1X3QA 2M56B 3KWLA 2D2CC 2F0QA 3S2HB 2DYMA 2PW9A 3AE3B 3AEEB 1PTOF 1JCKB 4PV1C 2DBYA 4FF1A 1E9MA 1FRRA 1R7SA 1PFNA 2ONQA 1S4ZA 1A3TA 1STNA 2FE8A 1V97A 2YU9B 1C4QA 3NUHB 5C0XH 1BCPF 4H0LC 1TWAB 1ROEA 4IFDG 1V1OA 4KD3A 4ZQ3A 1U4RA 1LO5D 3R93A 3TSSA 4FF4A 1TVXA 2A6EC 4R9WA 3LB8C 1IYUA 3CRKC 5CV9A 4RF0A 2L9HA 1SXTA 1TKGA 1Q10A 5ISRA 1JALA 1SNDA 1YQ3B 2HQEA 1GOZA 3S1NB 2GB1A 1TR5A 2YYZA 1K53A 1I7HA 2M00A 3DWAA 5EE9A 1SNPA 1GHJA 1PTOB 4ZK9B 3ERQA 4N9TA 1RD9D 3MJ5A 4H7BA 2K32A 2J4XA 4US9A 1EL0A 1G2TA 1VRAB 4C80A 1FGBD 1SYBA 4LAAA 1S5CD 3RZDB 5LHY1 1ENAA 1BCPB 1MSHA 4QIWB 2WU2B 2KACA 4R3DA 4YSXB 2JYEA 3HRDD 1RKNA 3L7ZC 1EY9A 4GLSC 3T16A 1WD1A 5JEAG 2SDFA 4LJZC 3GTJB 4XWWA 1N62A 3PUWA 1KDAA 1ZYRC 1A6XA 3Q69A 1QWYA 4OO1H 2DN8A 2Z4IA 1VMCA 3EQLC 3VYSA 3NWSA 1Z6HA 1CZWA 1QB5D 1L4ZB 2KCNA 2Q8IB 4IFDJ 1TY0A 2VZKD 3MXUA 3NE5B 5IGFA 2WINB 4RNAA 1AYFA 3PIO3 1SYCA 2W3RA 2AWOA 4KKIA 4ZUJA 2ZT9C 3D4DA 1DOXA 3AB9A 5EBCA 4N9PA 4B9WA 3URYA 2IW3A 3BVZA 3L9AX 5JPNC 3P4QB 4EQOA 1Y1WB 5NUCA 4I7ZC 3E5SA 4DAYA 1BNZA 2L1BA 1WTWA 4GZYC 4YWGG 5T8IA 3P1HA 4IUPA 2F3WA 1NUCA 5CMDA 5C4HA 2E75C 1RDPD 4A3GB 2ACZB 1PLFA 5G5HA 5C3JB 1ZKOA 2F0EA 3KBXA 1SEBD 1WTOA 3D4RA 3L4PA 5CC4A 1Y8OB 1X32A 2BBCA 1QCBD 1LT3D 3EJIA 3NWTA 2B8GA 2WACA 3E0JA 1SYEA 3U7ZA 3ONAB 3VR4A 4TRDA 5KIXA 1S5DD 3A8JE 3H91A 1NEKB 5J22A 1C4AA 2FBWB 1PZID 2NWGA 2IL8A 3HRZC 4DK1A 4HR7B 3J81L 2QEJC 5E3FA 3MFYA 1D2BA 3I90A 4G4KA 3DEPA 5JAVA 3C46A 4KGTA 1ZP0B 5C2TB 5T1IA 3AEAB 2XRQD 4MT5A 1STHA 4IUNA 2E76C 1L0YB 2KJXA 5CV8A 4HJGE 3UI3A 5COYA 1Z7TA 1J8IA 1L0VB 2O4XA 1YN5A 3DWPA 5M5XB 2PNRC 4IZ8A 4PT5A 2B2UA 3OOCA 2FHTA 5J1ZA 3AV8A 3RMHA 4RAUC 3CKIB 3S2DB 1H9MA 2O2LD 2EOTA 1F9RA 2JU6X 5CV5A 1EWHA 2J7ZA 4WIPA 2A68C 3GTGB 4RKBA 4P16A 3TEWA 2EYLA 4K14A 5AFWA 4YTPB 1ET6A 1AFPA 2OT2A 2B2YC 1XWEA 4K6LA 4DFAA 2D9UA 1LT6D 4ULLA 4KY6A 4ZLTF 1YN3A 2K5QA 1VF7A 5KYLA 1YNNC 1EY4A 5HI1A 3FRPB 3W1SA 2F0WA 1VZ6A 4OGQC 4HKZE 2F0MA 2MJDA 2HTME 1EY0A 2J42A 4YIJA 2XVSA 2H4OA 2F0IA 1A3UA 1JWMD 3HGBA 3M4OB 4GDKB 5TSSA 4IKGA 1ONLA 2VXWA 3W5VB 1EZ6A 4Z9CB 1MVKA 1S5BD 4KHVA 2F0JA 1F9QA 1GB4A 5EGTA 3ITPA 4ZRZA 1I4QA 1E2WA 2V0GA 1EY7A 1Y8NB 4Q0FA 3SFEB 1LTRD 2QKIC 2V4IB 2CW0D 3FMCA 4BA2I 4L6TB 2K7VA 3OWEB 3QOLA 1FM0D 1TWHB 1JWSD 2KA7A 1JROA 2OEDA 3NRZA 4KKJA 1NYQA 3SEBA 5C4ZA 2DY8A 3HOWB 4NAWB 1L4DB 2K05A 1SYGA 4RGNA 5IIFA 3S9WA 2LHEA 3SVMA 4H13C 1V43A 1LV9A 2E3TA 3TN2A 1IHZA 2D5GA 4DXGA 2KEDA 1XLQA 1HA5A 4OIJA 5BMGA 1C9FA 4XDXA 1GPXA 3MZ5A 4O42A 3K5MA 2A6HC 2PIAA 4TQ0A 5HFYA 1WVLA 1IYVA 2F0HA 1JWUD 5LNK1 5KEEA 4A9AA 3MHZA 4HTHA 5C44B 1HZ5A 4OL7A 5JEAH 2LFIA 1MGSA 4US8A 2JEAI 3QJYA 1STGA 3NBIA 3NQTA 2WU5B 3OSOA 1QOGA 2KUMA 2Q5WD 4A3FB 3PUYA 5FKAC 2RDHA 1LT4D 2WP8J 3EA6A 3P1MA 1CTMA 1G91A 4YXDB 1TIID 3DWGC 4WURA 5EE0A 2FMCA 3ZJTA 3ZYYX 4HSVA 3SE0A 2NYZD 3TZDA 4A3BB 5LL6X 5EE1A 5CYUA 2DWQA 4JPSA 2R61A 4C1NI 3S1RB 4QUCA 5EBDA 1QNKA 4XTCS 3U52E 2L12A 2V3NA 1LTBD 5D7GA 1SSOA 1XCQL 1KFYB 3GQBA 1P7FA 2BE5D 4PMWA 3NZ3A 1B3AA 4NMZA 2ON8A 3PZ7A 2N9KA 1I4HA 2PPBC 3GTMB 3B2FA 4FXKC 4C1NK 4H2AA 2TMPA 3K5OA 5CR3A 1MI2A 5A2QL 2LKVA 2NN6I 3B9JA 2ZXPA 1OXVA 3V05A 1K83B 5IGCA 1E6EB 3KLSA 4X3UA 1L6UA 2AQ2B 4HMJA 1XEEA 5ELDA 2L11A 1B9NA 1HCZA 1VDVA 3RFZB 4ZKBB 2F0VA 4KI0A 1BOSA 5H92C 2WXIA 3Q8EA 3NSWA 4HSPA 2A74C 2HUGA 4MH8A 1LTTD 2RPVA 2B39A 3TP6A 2DYOA 1RODA 1F2ZA 4L23A 2JZPA 3R2IA 5D65A 2EPBA 2RBMA 1S5ED 2EJMA 1YMHE 4XDDA 3D4WA 4KN7C 2IDYA 4RKLA 1TYGB 1N61A 3M7GA 4WQMA 1C78A 1UWXA 2KECA 1VCIA 1FMAD 1TS2A 5I4DA 3HVDA 4CBVA 4XXEA 4UAIA 1OO9B 3S17B 2AUKA 3ZQ4A 3R8BA 2A5HA 1B1ZA 2JA7B 2VB3X 2E2JB 1AZQA 2MUYA 5FR3A 3HP3A 1STEA 2JA6B 3I8ZA 1OXTA 1XO3A 1P7EA 3W3AA 3NTKA 1ZDVA 3J7YW 2RDGA 4Q5VA 2F0DA 1M4VA 1CA6A 2N7JA 2IX0A 3K5LA 3A7AB 2JP1A 5KNCA 1DOMA 5I6YA 3LWUA 4XWTA 1UAPA 2VNUD 4RF1A 2RSNA 2NBFA 2WB1B 3TBIB 2ZW1A 2WXPA 1K50A 1EU3A 3R3OA 1NVID 4F87A 5JOBA 4RCOA 1YNTE 1DOYA 1C76A 1L0XB 2XIWA 3QIAA 2K5DA 1TKYA 1UWMA 3ZJVA 1FXIA 3G6JB 3Q0AA 3MXNA 5BN5A 2EE1A 1IL8A 1QOFA 2FFKB 3LXFA 2JQRB 2B2TA 4KKUA 1DJRD 5FK9C 1ESRA 2FJ2A 2QMTA 5JVG3 3M85A 3SDZA 1FEHA 1FRDA 3MXPA 1ENFA 4HKQA 3IFTA 5M5WB 4A3KB 2JYOA 4KD4A 4DAPA 2Z8LA 5ELBA 3TUOA 2ID0A 1FNVA 2SNMA 5IT9E 2W55A 2WKCA 1F9SA 5CV4A 4ABNA 1XX8A 1RF2D 1UGJA 1B44D 4NW2A 1ENCA 5C5LA 3SFDB 4C56C 2G9DA 1C79A 1DOKA 3P4SB 3AU7A 1GJXA 2NVXB 1J9OA 2HCIA 4WFN3 3VRAB 1WTRA 1E2ZA 1NR4A 1O80A 3WOEA 4MACA 3HZXA 4B0EA 1J7CA 3T56B 1DONA 3QG1A 4DU9A 2W82A 2MGSA 3BIID 1FCLA 1HPCA 1TKWB 4E6IA 1FCCC 3CU7A 4K2LA 3T3NA 5CBEE 1WXQA 1IW7C 3OMCA 4KKSA 1T6BX 3NXWA 1DD2A 1FD7D 1EWYC 2MH7A 3P4RB 1KF6B 4CHTB 2CJOA 3IAM1 5D3DA 1JC7A 1SE3A 1SJHD 3EGRA 1EWCA 3H0GB 2JX5A 2L4NA 2PVGC 1V8QA 3HOZB 3DM1A 4F7XA 4RCNA 1U4LA 3QO2A 5J39A 2X6GA 2I2YA 3DEOA 2KAJA 4YSYB 3DMUA 2JA8B 5JJZA 1H9RA 3Q8BA 3OIPA 4NAMA 3N52A 5CGKA 4L8JA 5IGBA 1BUIC 1OQQA 2WKDA 5DM73 3NTIA 3G7LA 2QDBA 1HEZE 1F2RI 3S16B 4TKOB 1CHQD 3J80L 4ZKCB 1EU4A 4Y7NB 1K52A 3BS1A 4X3SA 3I4NB 2PKOA 3SR1A 2L5TA 1AZPA 4HAEA 1ILQA 2CU3A 1HFGA 4KV6A 2ICEC 4EGVA 3NQIA 1FFUA 2RQXA 1F2LA 3ND8A 2BYTA 1WTQA 3K58A 3NHHA 2INPE 1Z47A 5IGDA 1HUNA 1EQVA 2H88B 1WD0A 2WDRB 4MM3B 4K8JA 1AWDA 1T3QA 3IT6B 1QOAA 2BA1A 3M7NA 3BDLA 1PRTC 2WXHA 3WCQA 2K3UA 5A2QE 3I9V1 1SE2A 3E56A 1NYRA 4WRDA 3H09A 4ME5A 4V0BA 3IL8A 5IODA 1I4XA 3S15B 4M1UB 3TEZA 3PO3B 1WWTA 1XLPA 2MEKA 1KRHA 1PZJD 4G7OC 3MC0B 2KCCA 3Q8FA 2PZWA 3KF8A 1O7LA 2QSDA 1PGXA 4M0WA 1TT2A 3E6ZX 4OHJA 2BW2A 2HDEA 2B2WC 3BWUD 1ET9A 5EQ0A 1T5XD 4C7YA 4NJCA 1IGCA 3U4EG 3EFXD 1GUOA 5E4XA 4RGTA 5I2YA 5FO7B 4EE2A 1I4GA 1ZEQX 3JAML 5M3FB 3QB3A 5IOCA 1H9JA 4R8IA 1Y8PB 3U9OA 1SF0A 3K7AB 1WTXA 4PQXA 3SK4A 3GTQB 1YNND 1Y69U 5K5PA 2F0UA 2EVBA 1NR2A 1VF5C 2EYPA 2PZTA 4A93B 5E6JA 3ZJUA 4L63B 3AEDB 2EJFC 4JBWA 4ITKA 2DNEA 2Y5CA 3A8IE 1PFDA 3NPPA 3CRLC 4WORA 4XT3B 5HHDG 2MHVA 2NZ1D 4KJNA 1O7YA 4XQNA 4LLGM 4BY1B 3C1FA 5FO9B 1SMYC 1TWGB 3HVZA 1K8MA 4IUTA 5CV7A 1TWFB 4RA8A 1L6VA 2HDMA 5MPOA 2G9HD 1RTNA 2CVRA 4B0MA 1G2SA 2ZW0A 3NVWA 3BVMA 2KWDA 3N9YC 5H8YE 1PYWD 2LUMA 4DN4M 5DAUA 4HCEA 2F4IA 4A3EB 4YTMB 2F0GA 3H3VC 1QG7A 1OFFA 1UEAB 3H94A 2EYOA 1HQRD 1YJJA 2FUG1 3GB1A 2LHDA 1DYQA 1G8ZD 4EQPA 3PV0A 3SK6A 1R9TB 1ZPSA 4BA1I 4X3TA 2K28A 4CJ1B 5BMHA 2WNMA 3KLRA 3TEXA 1GXDC 5E4WC 1RYJA 2BS4B 1ZXTA 4DF7A 1I6HB 2Z4HA 1WSPA 1TS4A 2F0NA 1GUNA 1AEXA 4KKTA 1EYCA 4C2MB 3C2PA 1E10A 5K36G 1KNAA 2JXTA 1EEID 4IFDH 3VYUA 3A7LA 2BOSA 4QUFA 1TJEA 2QJLA 4XIGS 1PZKD 5KRUA 2B76B 3VR8B 3AEBB 1PTOH 3RPFC 1HA6A 2EKIA 1WGKA 2XN9C 2PTLA 2XRSD 1F2YA 1J7AA 2LGIA 4QMGA 1C48A 1SFOB 2LFNA 3MTSA 3AB5A 2R92B 2M0AA 4RHSA 1C77A 4YSZB 1PGBA 1KLUD 2A69D 2N88A 2VUMB 2FMMA 4P6VF 1ZE3D 5A35A 3VA5A 3MWYW 2WAQB 4CKEA 2WS3B 3IFDA 3PO2B 1PFMA 4V190 1PTOD 1KLGD 3LYYA 1RWSA 4LTUA 2SEBD 3K6OA 5I9OA 2O5IC 2K01A 3ETRA 5C3WA 4CKBA 2EXZA 3S1QB 2BA0A 1QE6A 3VA7A 5M5YB 3FPUB 1ACCA 2K5PA 1CZGA 1RFKA 3FAHA 2RVLA 1BCPD 5DNFA 1MHXA 3J9CA 4TSSA 1VLBA 4WH4A 3AE2B 1XF5L 2L0CA 2WXGA 4IALA 2EYMA 3MP9A 2R93B 1LTGD 1OQRA 2HCCA 3X3NA 1VDZA 3I3CA 5EKIA 1PRTF 5DEHA 3IAYA 3D6CA 4IUQA 4IOIE 1PUTA 1KDBA 2CW0C 4KGSA 2X6LA 3VR3A 1TKEA 2R3ZA 1IGDA 3D6WA 1LABA 1GAQB 2GI9A 2WXLA 4ZUIA 4BY7B 4AQ7A 3VR6A 3J80E 2XNAC 1I6VC 1N60A 3GS2A 1I4PA 4FF2A 1SNMA 3P4PB 2PYKA 2WV6D 2EYJA 1Q8IA 2PZUA 2YEPF 1BQQT 1M8AA 3RUZA 1LTAD 1BMLC 4WWMA 1LT5D 4ZRPA 2F03A 2WDQB 3A55A 1F0ZA 1YQ4B 2BDOA 1JB3A 1MSGA 3HS0C 3LX0A 3V2TA 3NTHA 4K5WA 2IWHA 3NS1A 2QILA 2EY6A 3Q8CA 3SR6A 4KTAA 5EKLA 3H6MA 3KK7A 1D6EC 1JW9D 2G1EA 1HTLD 1PRTB 3A8KE 1B53A 2XSCA 1QJOA 5C0XG 2L55A 1CQFA 1ZXIA 3V3XA 2JSOA 4EVOA 2H1EA 5IGEA 2B2WA 1N5WA 3X3MA 4REZA 4KN4C 4ZAIA 4BWGB 4X3KA 3I91A 1Q12A 2I07B 3TP5A 1K8OA 1WTPA 4ZHPA 1TS5A 4U68A 1DGJA 3AE1B 3BYYB 3TEYA 4OIKA 5F2DA 1EIHA 1GUGA 2E2HB 4WJWA 1IUEA 2YEPB 4IDIA 1TU2B 1DOLA 4C7ZA 1KAAA 2NMQA 2F0KA 2CJNA 4FNFA 4QB4A 4RWSC 1SYFA 1O7ZA 2BE5C 2Q8RE 5KNDA 2RDFA 1QLBB 5KNBA 3BG3A 3JAME 4GDLB 1XLOA 4DQOC 2CQAA 1PXUA 1ZOYB 4FF3A 1D5MC 4KY5A 3P7JA 1QOHA 2PLPA 2MP1A 3S14B 1QT9A 4WAFA 1YNJC 1RJTA 3J81E 3FC4A 3SHLA 1J7BA 3PMFA 1GUTA 2MJ8A 3BDCA 3TMEA 4IUUA 3HOUB 4OO1G 5HGTA 2KQ4X 3TP7A 3DXJC 5C0XJ 2B2YA 1CJEA 2OXPA 2IX3A 2XWJB 4K2KA 2VZKB 3NK9A 1SNOA 1A2UA 3WDNA 3Q6SA 1XLNA 1B9RA 2JE6I 1JICA 4TQUS 4DNTB 2RKSA 3ABVB 4J1MA 4KMUC 5T1GA 4HEA1 4XQQA 2AUJD 4FP5D 3VYTA 5BN3A 1C8CA 4ZRQA 5HURA 2EZVA 3MAQA 4A90A 4CGYB 3D3RA 1EYAA 3MA2B 3Q22A 4A3JB 4I65A 3BK2A 4IN3A 4CKCA 1GUSA 1WRIA 1IW7D 3CIRB 2F0OA 2L32A 3U9SA 2F0TA 4HRSA 4ARCA 2PO4A 1D5XC 5HG2A 2MJEA 1QQRA 1PMRA 1T5EA 1U9RA 2E74C 4QCLA 1SNQA 5JPMC 2KMMA 3EROA 3GTKB 4S3SA 3NVZA 5C4XB 3E9SA 4K5VA 1U4MA 3A54A 2A6ED 2J53A 3W2DA 1JQYD 1ZDXA 3W9CB 4NKLA 1U4PA 3LWEA 1RCVD 1HZ6A 4LK0M 5ELFA 1EQTA 2HDLA 2WXMA 1E0BA 5EPLA 1F77A 1YJIA 3NVYA 1STAA 3OWFA 4NP5A 1LTID 4A3IB 2WIIB 3HOYB 1BR9A 3OHXC 2OF1A 1HHVA 2QIEB 2WXKA 1F9PA 5LL6S 2BDNA 1K51A 2PW5A 1SNCA 1SAPA 4B9XA 4CQNA 4HN7A 3VYRA 1GB1A 1Q1BA 1OXXK 5BYRA 1IBXA 4U673 3HOXB 2IPKD 4A8XC 2IGHA 2BCOA 5C5MA 5CORA 1ZYRD 3S1MB 5C4JB 1PRTD 5KYIA 2K03A 3NVVA 3HKZB 5EPKA 1JQ4A 2JYTA 1OXUA 1VJKA 2M2LA 4A55A 4FO2A 1FR3A 2M19A 2X69A 2XWBB 1IBXB 4KX6B 2RSOA 3BYTB 2NVTB 1B2TA 1SJED 1W6KA 3QOJA 3VR9B 1SSNA 1CK1A 3AE5B 3TDQA 1D1KA 3L3OC 1IKMA 1HQMC 3AH7A 4XYQA 1VZ7A 1MI0A 4ID6A 2Y3AA 5KGUA 2JA5B 3NP8A 2MJ3A 3T13A 2OEOA 2BT6A 2E2IB 1NCVA 3M4YA 3GTLB 4QF4A 3FDTA 1FO4A 3HG9A 2BS3B 1TWCB 2K33A 1STBA 3MXGA 3VR5A 1E2VA 3SK5A 3IKJA 2BB6A 1I3QB 1FFVA 4IFDI 2DNCA 1B4OA 1Y56A 1JWAD 1D4BA 1HRJA 2E6XA 1XYIA 2WDVB 2K1BA 2JXMB 2L83A 1CI3M 2IT1A 3SXHA 2F0PA 3GV3A 4IURA 1FD6A 2R7ZB 4XE0A 3FILA 2ENBA 3V96A 2INNE 4FXCA 2BB5A 2VB2X 2BTEA 3GTPB 2QCPX 2AX5A 3WOFA 5D14A 4NDXA 5IGGA 4XT1B 4ZHOA 3K5NA 1PFBA 1II3A 1SMYD 3FILB 2TSSA 3J7AF 1KABA 4P2CB 3VRBB 4FXDA 3K59A 5G3LF 1EYDA 2EJGC 3CWIA 3VR2A 2A68D 2RMMA 2LS01 4XYOA 4KGRA 3KQ4A 1FNUA 2MPMA 1GHKA 4L2YA 1CT1D 4OZAA 4TQ1A 4EQNA 3I4LA 1DCZA 2L1AA 2LY7A 2C9OA 2GRIA 3QWNA 1CHPD 1IKLA 5D3IB 2IJ0A 4PMBA 4BS9A 1PGAA 1B50A 1Y1VB 3FEWX 5JVH3 2EDGA 4LK1C 2EYFA 4UDUC 1EIGA 3AE4B 3AEGB 2WXJA 2Z1CA 5BN4A 1STYA 2K04A 2LMCA 2I38A 4KJOA 4KY7A 1WCMB 2J52A 2F3VA 1Q3LA 1N5XA 5G5GA 1KDCA 4MHEA 2F0FA 2H89B 2Y0SB