4DXFA

Crystal structure of staphylococcal superantigen-like protein 4
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
194
structure length
194
Chain Sequence
EINPKFKDLRAYYTKPSLEFKNEIGIILKKWTTIRFMNVVPDYFIYKIALVGKDDKKYGEGVHRNVDVFVVLEENNYNLEKYSVGGITKSNSKKVDHKAGVRITKEDNKGTISHDVSEFKITKEQISLKELDFKLRKQLIEKNNLYGNVGSGKIVIKMKNGGKYTFELHKKLQENRMADVIDGTNIDNIEVNIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Staphylococcal enterotoxin-like toxin
publication title Structural and functional properties of staphylococcal superantigen-like protein 4
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Sugar binding protein
total genus 52
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4dxfA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4dxfA01
1B1ZA 2XRQD 1SJHD 3EA6A 2AQ1B 4RGMA 3DWAA 1S5FD 3BVGA 3TSSA 3W2DA 1SBBB 1L0XB 1ET9A 2RDGA 1SEBD 1B44D 1PTOC 5I4DA 1LT4D 1RF2D 2SEBD 1RD9D 4RHSA 2G9HD 2CHBD 2J4XA 1LT6D 1M4VA 2QEJC 3SEBA 4DXGA 1JQYD 2TSSA 5ELEA 1DYQA 1LLRD 1PZJD 5ELBA 1PTOH 3R8BA 2ICIA 1LTTD 2XNAC 1LTGD 3URYA 1SJED 2AQ2B 1CHPD 1SE2A 2XRSD 2NTSA 1LTID 1I4PA 2RDHA 1JCKB 1QILA 4UDUC 1FNVA 1SXTA 1LTSD 2WV6D 1S5CD 1HTLD 1D5ZC 5ELFA 1I4GA 1JR0D 1LTAD 1T5XD 3DWPA 3GP7A 3OWEB 1EWCA 1DJRD 4TSSA 1FNUA 1BXTA 3V05A 1ENFA 5D3IB 1XXGA 1D5XC 3R2IA 1AW7A 4L63B 1FD7D 1BCPF 1I4RA 2QILA 1TS5A 1PRTB 1I4XA 1MD2D 1UNSA 3MFGA 3BYTB 1ESFA 3BVZA 1YN3A 1GOZA 1FNWA 1BCPD 1G8ZD 1CQVA 1AN8A 1I4QA 2NTTA 4NZLB 1I4HA 5ELDA 1LTRD 1S5BD 1S5DD 4ZYSA 1SE4A 5ELCA 1CK1A 5FKAC 1EU3A 1LO5D 1JWUD 2Z8LA 1RCVD 1SE3A 1ET6A 2IPKD 3CHBD 4K6LA 1FGBD 1EEFD 1PTOB 2O2LD 4RCOA 1XTCD 4RFBA 1JWMD 1KTKA 4C56C 1V1PB 1TY2A 1PRTF 1CHQD 1TS2A 1V1OA 1LTBD 1BCPC 3KLSX 3DWQA 4OHJA 1UUPA 5TSSA 1KLGD 1EU4A 1LT3D 1PRTD 1EEID 1YN4A 3R2TA 1RDPD 2R61A 4RH6A 1S5ED 4Z9CB 3EFXD 1LT5D 1L0YB 1JWSD 5D3DA 1PTOF 1EFID 3O13A 5FK9C 3MC0B 4RGNA 1HQRD 4BWGB 1PYWD 1YN5A 4RGTA 1KLUD 2IJ0A 1TS4A 4O1NA 1CT1D 4RHRA 2XN9C 4DXFA 2AQ3B 1PTOD 3BZDB 1TS3A 1PZID 1STEA 1V1PA 3BVMA 1TY0A 1HXYD 4RGOS 1PRTC 1HA5A 4L6TB 3BYYB 1BCPB 1D6EC 1D5MC 1F77A 1PZKD
chains in the Genus database with same CATH superfamily
2KOXA 2QEXA 3L54A 4UP7A 1WJ4A 2K6DB 1IW7D 2AYOB 4C3HG 4B9XA 2EYLA 4C3IG 1KXLA 4KV6A 1Q86C 2KUMA 3VR9B 3OAWA 4I7ZC 3GTQH 2F0VA 1IYUA 2MO0A 4DK3C 4MACA 4A3LG 2Z0DB 3NHEB 1SMXA 2FHTA 2RDGA 3TMEA 3RZFA 4DR2Q 4LUOA 4BBNC 4DR1L 5DLQE 5E3FA 1QCBD 3VYSA 4BXXH 4A3GB 2NVQB 3IT6B 3NVVA 2JXMB 3U9SA 4ZLTF 4BKSD 1SROA 5ELEA 4QJFA 2DENB 5IT9E 1H9SB 1K3RA 1KDCA 3DM3A 1U9RA 4FO2A 2L00B 2XNAC 3ND8A 1Y1WB 5J22A 4GN5A 5KRUA 4ID6A 4H02A 1DZ1A 4MJSB 2PEAA 3J81j 4QQBX 3C2PA 4A9AA 1BBWA 4IFDI 2EOTA 5D14A 1SSNA 1TT2A 3OW2A 2ASQA 2INNE 1PYBA 3KWVA 3TS2A 1KAWA 4DKAC 1E8XA 2WKCA 3VYUA 1K9MC 1HR0L 4M8NA 1SMYC 3HP3A 1STAA 1RAXA 4GN1A 2E5LL 1PGBA 3QJZA 5JEAH 1AZPA 4DR5Q 4URKA 1FO4A 3QR8A 3T3OA 4QCLA 1ZKOA 3U58A 3CC4A 3UDFA 4FDBA 1QNKA 3D0FA 3ZGZA 2LVOA 1DGJA 3ZRCA 3NS8A 4MSMB 3HOUG 2EQSA 4DR4Q 2MJ3A 3A56A 5EPJA 2BYVE 1YN3A 1E2WA 3E9SA 4OO1G 3IFDA 3M63B 4RNAA 2QSDA 2I07B 4NZLB 4EQNA 3SE0A 5ELDA 3CCQA 3UE1A 2BDOA 4UP9A 3I9V1 1HNZQ 1GVPA 1E8ZA 4WJNA 4DXAB 4MDKE 5EQ0A 3RLFA 1F9SA 2B8FA 3DEPA 5C4XB 3VFKA 4IO9A 3AE8B 4C7ZA 1NAPA 5T1GA 3ND9A 3DVGY 4G57A 2GI9A 4MGKE 2QDLA 4HEDA 3CWIA 3J80i 1AYFA 1WGYA 3N3KB 3T1HQ 3RI7C 4DR6L 1M90C 3OHXC 1PLFA 4I65A 4IWQA 3IXSA 2L8JA 1HRJA 2NR2A 4PS3A 5H1SE 4EQOA 3CPWA 1RFKA 1TQOA 5H92C 3AB5A 4JLCA 2MJ8A 3RT3B 4IG7B 5TSSA 1HTOA 2CJOA 1WTQA 4WWMA 2F0NA 3J81c 1PRTD 5CV6A 4WQMA 1EQVA 1IL8A 3NELA 4Z9CB 2JA7G 1VQFA 4DV4L 1OFFA 2GBNA 5D3DA 3KOJA 4QMGA 1YQ3B 1VLBA 3NHHA 2WS3B 2R6GA 1KNEA 5L83A 3S2AA 4XDXA 1STGA 2A6HC 1X32A 2WXHA 2E2JH 2V4IB 5DPRA 3K81C 5DM63 1W3SA 2MH7A 1FL0A 1D1IA 4MGIE 2LEKA 3NUHB 3VUXA 4GKJQ 5IP9H 1NI3A 3TL5A 2K0PA 2NVYB 1AEXA 2B2VA 5DPWA 3BYYB 1WXVA 2AL6A 4H13C 2KACA 5C4HA 3OG5A 4TV3A 1PYSB 1PZKD 4K0KQ 1WFQA 1WTOA 1HZCA 3SVMA 1YD8U 2GBKA 3Q2AC 1O7IA 2K05A 2V3PA 3PF4A 1UD7A 2JUOA 3A8IE 1SYBA 2GA4B 3CP0A 3RPFC 1H8CA 3S24A 1WYWB 1SBBB 1VMCA 2B2UC 4ZYNA 2KQ3A 1D8LA 2BBCA 2J7ZA 2KYWA 1B44D 3HOUB 1XLPA 1TKEA 4ZHOA 2SEBD 1WX7A 1SLJA 2K1FA 5TR5A 2WU5B 4HLEA 3MEFA 2R93B 5FR6A 1I3QB 3BJUA 2VZKB 3P4QB 3I73A 3LB8C 2O5IC 3Q3FA 4IJHA 2EY2A 5D6JB 3U8ZA 5ELBA 2BE5C 3PQIA 2JXTA 1PV4A 4YWKA 1LXDA 3J7ZC 1G2TA 4CDFC 4FADA 5CV4A 3R3OA 4NXNL 1JRPA 3RNCC 1G51A 1JC7A 2NN6H 1TWHB 1HFNA 2D5GA 1HFGA 4GS3A 4L8JA 3K5NA 3X23A 3M4QA 2KCTA 1EM7A 4GU2A 1F2MA 2LRUA 1QILA 3CF5A 1C4AA 3N52A 1HQMC 1U4LA 3J81L 1IBKL 2K52A 4KN7C 1LTAD 1P8LA 2CQAA 2CHZA 1EWCA 2P5ZX 3N32A 3J80E 2B3AA 2N9EB 4LNNA 1SNPA 2OEDA 2E2IH 1WOCA 2JA7B 3OPOA 1FD7D 2MEKA 2O6VB 3CSTA 4F7ZA 2LKVA 3PSEB 2L5TA 3VYRA 2LUMA 3I3CA 3R93A 1IW7C 1XYIA 2PE6B 2Z4HA 3BIID 1EZ6A 4IFDG 1VQHA 1YHQA 1ZDXA 3H1UA 2HCCA 5FLMH 1VZ8A 3S9WA 2K01A 2UXCQ 2Z59B 2B2WA 3SK6A 4C4VB 1NE3A 1ZXIA 1LO5D 2KMCA 1VQDA 4YTMB 3RN2A 2HD3A 2VUMB 2FCSA 2KQ7A 2VRRB 2ZW1A 4HRSA 1HNWQ 1V5OA 4XT1B 2J0KA 3OTOQ 2I5LX 3RUZA 2MUYA 5IOIA 1F0ZA 3H91A 3V62A 2NBWB 1QZEA 1UEAB 2K33A 5DPSA 2D62A 3DWQA 1QNUA 5AZFA 2KWVB 3AULA 3MXNB 3VDYA 3MC9A 4M01A 4NQKE 3W1SA 5LMUL 3QCAA 2UU7A 5AJ3Q 4ZDVA 3MXGA 5C3EH 2KXJA 3HOYH 2Y3AA 1KABA 4R9WA 4A3DH 5CV5A 1SSOA 4ARCA 1VQ9A 2ALYB 4OWXB 3DWGC 1FR3A 4NAMA 2OQ0A 1CJEA 2W54A 4NQLB 1X3GA 1JJ2A 2IY5B 3VHTC 4HKQA 3IAM1 2R92G 4P75A 5M5YB 2CH4A 2C60A 2DZKA 4OL7A 3CC2A 1X3EA 4KSKC 1QWYA 2LMCA 2N78A 2IZVB 1XF5L 2MX2A 2WGSA 1JJGA 2GLSA 2G9DA 4JWSC 3ERSX 2HDLA 2LXCA 4X3UA 2Y5CA 3FRPB 1EYDA 1JORA 4UHVA 4AYBE 4R3DA 4KI0A 1C7YA 2UYZB 4F8MA 3RNAC 5J3BA 4AQYL 4RF0A 2KLGA 1RWSA 2KX0A 3T1YL 1VR9A 3BVGA 4DAYA 1NMFA 1K0RA 4IALA 1PH9A 2CR5A 3I5JC 4HCPB 5BN4A 2LXAA 4NPNA 1RYJA 1UWXA 1I94L 3EUB2 3FKYA 3KUCB 1PTOC 3GTKB 2FIDA 5IODA 3D4WA 4YIJA 2EXDA 3I70A 1ZEQX 3MFYA 1FXAA 1L1OA 1OXUA 2G9HD 2Z6KC 3TJPA 4DU9A 1T3QA 1IBXB 2BKRB 3SR6A 5BR8L 3MVVA 1CKOA 2KD0A 1PZJD 1BBXC 1EWYC 2JZZA 4GKKQ 4FP5D 3OW7A 2KA7A 1HEZE 4DV6L 2FINB 2XWBB 2UUCQ 3C19A 4DV5L 3WCQA 4A3OA 3CCUA 2HTHA 1SJED 3AFQA 2BDNA 2ZTCA 4JI7L 4ASWC 3AYHB 5KYLA 1GB4A 4LNIA 4GIVA 4X64Q 4XX5A 1E1TA 3H0GG 1MFWA 1C4CA 2EYMA 4KHZA 3S14B 1ROEA 3NXWA 3AE1B 3HK0A 4LF8Q 1ILPA 2HDEA 5EBCA 3WDNA 2UU9Q 1IPGA 2OJRA 2DY7A 4YWLA 3G6JB 1T5XD 1DXMA 2Z0SA 2CW0C 1GAQB 4K5WA 1VQOA 3R2IA 3RNUA 2I5HA 2NS5A 4L63B 2IWHA 2MPMA 1BO0A 1EUJA 2EKEC 3GTGB 4EGVA 1MJDA 5JJKA 2UWQA 5IIFA 3MFGA 2R92B 4PS7A 1TWAB 2ZJRA 2GVAA 1N32Q 2KHWB 2VQFQ 2L1AA 2AWOA 2Q2HA 3PIO3 4IM2A 4MGYE 4W9IA 4YY3L 4F87A 3AEBB 1S5BD 2IY0B 4JV5L 1ENCA 1STYA 2HD5B 3AEEB 3DBSA 4GDLB 4KGSA 4PYUA 3SHLA 4HIKA 1HZ6A 4QAYA 4K2LA 3U4EG 3DMUA 3BZKA 3CXCA 1WGGA 4W9GA 2IPKD 2NPTB 2WXQA 4XZ4A 2NVXB 1PTOB 1IUEA 3NBHA 1VD2A 1XTCD 1VQGA 2BH8A 3HZXA 4C56C 1J7BA 3KBGA 3JSVB 1TY2A 4XWTA 2VW9A 3BG3A 1VZ7A 3Q24A 2WKDA 4X66L 4DPGA 1DGSA 1B9NA 4KX6B 2ZM6L 4JBMA 4YHHL 3TREA 1JT8A 1V97A 1QVGA 3OOCA 1K8GA 1ASZA 2RR9A 4DAVA 4OWTB 2JA6G 1WYDA 4B3RQ 3Q8AA 5FO9B 5HGTA 4EOYA 1K8OA 3EFXD 2J53A 1CUKA 1SFOB 3L17A 2KCCA 3QQ8B 2Q2UA 2C7HA 3IHPC 3D6WA 1JOQA 3A9KA 4BY7H 4A90A 2KNBA 2WB1E 1FFUA 2GRIA 2XN9C 3H0GB 2DN8A 3CKIB 1ISNA 4K7WA 4MHEA 1QOHA 2WDTB 2R7DA 1HPCA 5IP7G 3RMKC 3QIAA 2ZXOA 3KWLA 1AZQA 3WOFA 2TMPA 4KHPL 1WVLA 1CA6A 2IGGA 2YEPF 3CMAA 4LFAQ 3H3VI 5DEHA 3BINA 4S0RA 2Q8IB 2K22A 2SNSA 2A69C 5CHFA 3TSSA 1WSPA 4KD3A 4E3CA 2OTLA 1ET9A 3NTHA 4MTKA 3QARA 1R9TH 5M3MG 2B63H 2XTIA 2VS1A 4WQOB 4KD4A 1F52A 5C0XJ 4AYBG 4GLAC 3EC8A 4P1BC 2E74C 2J4XA 4EEWA 1LT6D 3TBIB 1PH3A 3P1MA 1FFVA 4LWCA 2KCMA 3B1LX 2F0SA 4IM0A 1DYQA 1I6VC 1Q0WB 4BBSG 5CV8A 1STNA 1HE8A 1YMHE 2OOBB 2KT7A 3RLNA 3IKJA 3GV3A 2O2VA 2AQ2B 3T51B 3Q22A 1J5EL 5L37A 1N36L 1I4PA 4TUUA 1VCIA 2YLMA 4KKTA 2AX5A 3FC4A 5IGEA 4DV2L 3ZNHB 1ENAA 5EKKA 1Y69U 1J6QA 5IN7A 2ZTEA 5FJ8G 3RZDB 1XNRQ 3S1MB 1CI3M 4CBVA 4DV3L 3S2DB 5C4JB 2LASA 1VQEA 3I4OA 2N9XA 3QIJA 4A3CG 4RM9A 4JI4L 3PCOB 1R4MI 4A75A 4LF7L 4KDLB 5J2RA 3NK9A 3MA2B 4G4KA 4JPBW 5LMNQ 5BMGA 1GJZA 5C3WA 3GTPB 3ZJUA 3UDXA 2RBMA 5CTRC 1K53A 1CMXB 1WXSA 1BCPD 4PZ8A 5IYBH 2BS4B 1LQBA 2EJMA 2OXPA 3PO3G 2E3TA 3I57A 3TEYA 1Z2MA 2KEDA 4XDDA 4B9KA 1A5RA 1XMQL 1GB1A 1SGHA 2AUKA 2L9HA 5I2YA 3C3LA 1YNJD 2CS4A 2KFKA 2G3QB 4TKNA 3VTUA 5M3FB 3NEMA 2LI5A 5BYRA 3G71A 1YIWA 3M95A 4Y7NH 3CW2C 2JA5H 1C8CA 1CHQD 3VR6A 4A55A 3UE0A 4FF3A 3Q8BA 1LTBD 1LTLA 2OEOA 1GM5A 2F3VA 1E90A 2XEWA 2JJQA 2PI2A 2IDYA 3DVNV 4AYBB 4CDCC 3HOXH 4G7ZC 1YHAA 2REXA 3BDCA 1YN4A 3OWFA 4CDDC 3MC8A 5KEEA 4HXDA 4MTNA 1S5ED 3HOVG 2UXBL 1UWMA 2F0MA 3GD7A 4LK0M 1TWFB 2JYTA 1VQCA 3CPFA 5CBEE 3I4MG 2WLBA 1GUOA 2LUEA 3CCVA 4L23A 5A2QL 2M56B 2OF1A 3T53B 3GTMB 2RHSB 3EFUA 4GOCA 1GG3A 3EROA 3PSIA 2LD9A 2F0OA 3K8AA 4NPSA 1PZID 1V1PA 3DHQA 4A93B 3NOBA 1Y8NB 2NZ1D 2OJWA 4JC0A 4R1JA 3K59A 1U5KA 1ZW7A 5I9OA 4HPLB 5EE1A 4LW1A 4DV7Q 2WXRA 2YU9H 3PZDA 1Q7YC 2JA8H 2XGTA 3OLMD 1PMRA 4LF4Q 1MJEA 3VVWB 3UI3A 1N61A 2WB1G 4IUPA 2PPHA 1FCLA 4HJ5A 1TXYA 2GOWA 1ICWA 1EYAA 3GDEA 1OTRB 2K32A 4NXMQ 5JOBA 2K6AA 1OQRA 1IP9A 2EIFA 4OW0A 4KKSA 3T56B 4B3SQ 4A3IH 3H7PA 4EZJA 1D3ZA 1IKLA 5CV9A 4YSZB 2G4SA 1K28A 1RD9D 4KVGB 5C0XH 2Z1CA 4LAAA 2WNMA 4BKSA 1EIGA 1DCZA 3KDFA 1WRDB 3PO3B 4KN4C 3UQBA 2EVBA 2W9NA 1EQTA 3E6ZX 2PZTA 3T13A 3DCGA 3UDIA 1OQYA 4M0WA 3MAQA 4BBRG 5EGTA 4LFBL 4JI5L 4JBKA 1BMLC 3H7SA 3VDZA 4K2KA 2IX3A 4HIMA 2KTFA 2QJLA 4DK6C 4YL8A 4E71A 1TZ1A 2L76A 3ULLA 1RTOA 3GE8C 4A3MH 3RYTA 4JI1L 1PGXA 4A3JG 2MP2B 1WCMG 3ZNGC 1PH5A 1IBML 1FNVA 3RNBC 2WV6D 1TYGB 3QA8A 2NB0A 4IOAA 4UAIA 2D07B 1E1OA 4IUVA 3VA5A 4JBJA 4OELB 1H4RA 2QA4A 1KJTA 2L3ZA 2VNUD 2MFIA 4IDIA 3KLRA 4G0NB 5D94A 3HOVB 4DHJD 4C3JH 1PVOA 1GUSA 3MHBA 2QILA 5C44B 5G3LF 4DK5A 3U50C 3I4MB 2R2OA 3KF8A 1FD6A 5E7NA 4DR7Q 1CSPA 3GTOB 2H1EA 1N6ZA 4LTUA 5AUKA 2RSOA 4N8FA 2O4XA 1N34L 3M7NA 1F9RA 4DUYL 4A3BH 2NTTA 3ZLZA 2X6LA 1YIJA 3I63C 4ANWA 3JC66 1E6EB 1L0WA 4PT5A 2XVSA 1ILQA 1HNXQ 5CX3A 3VUWA 2HJ8A 1G6JA 2N9LA 2CFMA 4KIKA 1WD1A 3PUWA 1WJUA 3AE5B 3PO2H 4IOCA 4OXPA 4KY5A 2BWES 5C4ZA 1KDAA 2F0IA 3KLSA 1TWGB 4A3KH 1NCVA 2OT2A 4J3OD 1ESRA 1UE7A 3PHXB 4BOSC 1PH4A 2KTRA 2I46A 2A6HD 1HUMA 1P9DU 1C4PA 5G2NA 2BA0A 3CAMA 4DV0L 2C9OA 1PUTA 3D6CA 2O6VD 1GD7A 2NVQH 4A3GH 2MBBB 1G291 4QUFA 4POFA 4JI7Q 4JYAL 4JVZA 4L5QA 3U30A 3GTLB 1QB5D 3NVYA 2B2YA 2A19A 1WM2A 4RH6A 2KJHB 5I9PA 2K8BA 5DCNA 2KBNA 4BFRA 5HURA 5HGQA 1LFDA 2SNMA 3WOEA 3PF5A 2D11A 1EOVA 3FPUB 1NSNS 1Y1WG 3W9CB 2LZ6A 4P6VF 2L0FA 2GBMA 5A35A 4PYZA 2ZVNA 4AQ7A 3BZDB 2PQAB 1VF5C 4RGOS 1SYEA 5FLXc 2KN4A 1PGAA 3I4NB 2JRIB 3TMPB 4FA6A 2L0CA 1LYLA 4OX9L 2A1AA 1UE5A 3CQZB 1V43A 4RG1A 1T9HA 4RF1A 1QF6A 1SJHD 1JALA 2BE5D 4FJYA 1E0ZA 4I6PA 1YNJC 4JX1C 2B39A 4B9WA 3K5LA 2FUG1 3NUCA 3AU4A 1C0AA 1JWAD 1SE8A 5C2TB 5EKLA 2RCNA 5JPNC 2FNJB 1S40A 1TR5A 2V4DA 2WXNA 2M8SA 1SRUA 1XEEA 4DBGA 1B50A 3PUYA 4L5RC 3GV6A 2DNCA 4RHSA 2CKHB 3P4SB 1J7CA 2KJXA 1AE3A 2QEJC 5C4XH 4IWPA 2LJIA 2PYKA 1SE9A 3GB1A 3TS0A 4JI6Q 1J0GA 1PHJA 1NENB 1FEHA 1IZ6A 4C3HH 2WDRB 5M5WB 2VH2A 4C3IH 1J9OA 1XX8A 1R4MB 4O42A 3ULJA 3M4OB 4A3LH 1WGHA 2X6GA 3CRLC 5KHQA 3H09A 2V9HA 1BUIC 2F0LA 5EPKA 1L4DB 1S5CD 2WX1A 1HTLD 2NUCA 3K5OA 4K14A 3Q8EA 5ELFA 1JR0D 3DWPA 3KJOA 3GTJH 3KFUA 4HPMB 2LMCB 2UUAL 3S15B 1R4PB 1KOTA 2FMCA 3ULPA 5EE3A 2BB5A 3KH0A 1VQKA 4JGHB 3CCSA 3L2PA 3X0WA 2F0HA 3RN5A 2FBWB 3U7ZA 1NY4A 1T0YA 2PTLA 3BDOA 4I6LB 4X62Q 2L11A 2LS01 4EX5A 3KJPA 4AJYB 2LGIA 4LFCQ 1V1QA 2PCFB 5HY6A 1AN8A 2NVYH 5E1FA 4APVA 5FLXL 1N33L 2WXGA 4YWMA 3DHGC 1FXIA 3KYDD 1ZXHA 2EYJA 3A9JA 1NR2A 3QC8B 1SIFA 3AXCA 4NAWA 1H95A 5LL6X 2CH4W 1K8MA 3Q8CA 3VA7A 3TEXA 2KJRA 3KQ4A 3AECB 1ZE3D 1ZYRC 4J1MA 4GNXC 5LNK1 1D7QA 4IFDJ 5F2DA 2KWDA 2WWZA 3HOUH 4ZRKA 5EBDA 3A0JA 4OO1H 1QG7A 5LXHA 2M9VA 3D4RA 3X3MA 1KRSA 5JVH3 1E8YA 1Q46A 2HQEA 1C9OA 1MBYA 3SD5A 2CU1A 2LFNA 3R2TA 3ABVB 1VZ6A 4UY8C 2M1MA 2R93G 5KHOA 1PQSA 1PH7A 2SOBA 5LLIA 1WE6A 4R4IA 3QK0A 3MC0B 1FRDA 3FAHA 5D7GA 4LF9Q 1XCTL 4B3MQ 2DBYA 1SNCA 4NJCA 2WXOA 3I4LA 4JOIC 1O7YA 2Z0EB 1DOIA 1PTOD 2KDIA 2KFJA 3NQIA 1EIFA 4LF7Q 1YNNC 2F0GA 2GN5A 3PV0A 1VQBA 3VR2A 3ZXVA 3HFZB 2O5JC 4Q2JA 2F0QA 1WX8A 5HHDG 2ENBA 2VB3X 4LK1C 1VDVA 3PPAA 2BH2A 3NVWA 4DF7A 3ZUNA 1TWCH 5DM73 3MP9A 4QF4A 3N1XC 2K03A 5GQOA 3Q3MC 4KLKA 4B3TQ 3RMHA 4DNRB 1V9PA 1UE1A 1GNUA 1UF0A 3OJ3A 4NNJB 1TGZB 1FJGQ 1CFMA 5I4DA 4A20A 1WTRA 1S3OA 1VQ8A 4IM3A 2QF7A 5JHBA 4WWOA 3HKZB 3FHWA 1SYDA 2JSOA 2E2HH 2D0OA 4GNXB 4WJ3M 1Y14B 3H94A 1XPOA 3PT2B 2CW0D 4ME3A 1FGUA 1SYGA 3GO5A 4ACFA 3R8BA 3GTQB 4A6QA 1N63A 3ONSA 2VUMG 1PXUA 5LXIB 2EXZA 4I7AA 1ZPSA 2KX3A 1C48A 3OMGA 2F0PA 4JI3Q 2D10A 2KANA 3E0JA 5EE0A 2CQOA 3MXPA 3S17H 3DPDA 1CTMA 1V6EA 3PGZA 1A3VA 1Q1OA 4FHJA 2F03A 1V2YA 3A9KB 5EDSA 3P42A 1DOKA 1XNQL 3ML8A 3ETRA 1X54A 2EY6A 4XYOA 5IGCA 3K7AH 3FILA 4HCSA 5L95C 3ZRFA 2JK8A 2RVLA 1RM6C 3P2BA 3APFA 3Q14C 4W9JA 3FPPA 3F2UA 1AH9A 1E7ZA 4IURA 2R3ZA 1OO9B 4ZRZA 3NPPA 2UUBQ 2KEEA 4WJPA 3CU7A 4KGTA 3NY5A 2IGHA 4YCWA 1I4QA 2QIEB 2RSNA 3IG3A 3PV1A 1MKHA 1PA6A 1CK1A 4DV1Q 1NMGA 2ZJDA 2BS2B 3AH7A 3IAYA 5IWAQ 1HHVA 3CHBD 1N5XA 4K3CA 5C1ZA 4ZKBB 3F1ZA 2ASBA 1V9JA 3GTKH 4IFDH 1MSHA 1WTVA 1B4OA 2O2VB 3EIVA 2PW5A 2EELA 1EIYB 1I6HB 3DVNU 4HTHA 4YTNB 2K28A 2I1KA 2IO2B 2NMQA 4YCVA 2PIAA 3KF6B 4GOPC 3B2GA 5D65A 4IC7B 2JF5A 3V96A 1IBMQ 1J7AA 1EY5A 5KYIA 4HSPA 2HHHQ 2MA9B 4EQPA 5FK9C 3J81i 3UQAA 3I72A 1YEZA 3N9YC 1CKNB 3I90A 5C5MA 2J42A 1WH3A 3HUIA 2A69D 1D1KA 1LGRA 1IBLL 1AWDA 3T16A 1YQ4B 4HJGE 3D3RA 1C3TA 1TU2B 1RTNA 1YJ9A 2BQQA 2AQ3B 2AWNA 1Y8OB 3BU2A 3NWSA 4JI0L 3SHQA 1U4RA 4US8A 3CC7A 5JAVA 1YJWA 2K3UA 1B70B 1OGWA 4IUMB 4HIDA 2K5DA 2L83A 4MELA 1RLFA 4RA8A 3S2HH 4E6IA 4GXBA 4PS8A 1F9QA 2AQ1B 3CIRB 3CSFA 1HZ5A 2E2JB 4DNTB 1YNXA 1TKYA 2R92H 1NVID 4DR3Q 4WJWA 2NYZD 4HIOA 1VCBA 4G50A 1L0XB 4OVVA 3QWNA 2F0FA 3B6YA 2K04A 3A1QA 4IUNA 2YTXA 3U7DA 1BF4A 1K73C 3L9AX 4P72A 2KC1A 1YVCA 2UXDQ 4YT0B 3EGRA 2NZHA 4X3KA 2WINB 3WWVA 5IGFA 4LF6Q 1PTOH 2DAJA 3NENA 3HOZG 5C5LA 2K14A 4AIMA 3I56A 2QHOA 3EHVA 2F4VL 4HROA 3ZVVA 3URYA 4MZ9A 4HKZE 4A4IA 3VR3A 2MCNB 4A3EG 2INCC 5G55A 3PHWB 2CWAA 2VQEQ 4MM3A 1H9KA 3I55A 2Y5BB 1MHHE 1TJEA 1BBUA 4HCNB 4GOPB 4JK1C 3DHIC 4NW2A 2CJNA 1LTSD 3L16A 3APDA 4MGZE 3J9CA 2RPQA 5J39A 1P0RA 4BKTA 2LGXA 3MJWA 4O2DA 2IT1A 3C0RB 4RKBA 1D5XC 1TTNA 4JW0A 1AW7A 4CO7A 3NZ3A 4C80A 3RNFC 1I35A 4HCEA 2D3BA 3JAMc 2K5PA 2WACA 2JT4B 3RR5A 2CHXA 3RZOH 1CSQA 1JMCA 2MBEA 4FXDA 4XT3B 3VR4A 1Z47A 4X65L 1MD2D 4JE3B 1SF0A 2CCZA 1H9SA 1UEBA 1X56A 1S4ZA 3BYTB 3H0GH 3K57A 3UDGA 2MBOA 4E74A 3U9OA 4FF2A 2PJHA 1QOGA 3TDQA 4YSXB 4D2KA 2ID0A 4MJSA 1A6XA 4KSLC 3ZW3A 4OIKA 4N8X1 5ELCA 1GXDC 2R7FA 4JI8Q 4CDEC 3J81E 1DONA 3H7PB 4LNOA 2LY7A 1JWUD 3AM9A 1GC6A 2LRWA 2HIVA 3LJ3A 4ZOHC 1MJCA 1PFNA 1QVCA 4OGQC 1EOTA 1MSGA 1BR9A 3G6EA 4K6LA 2BT6A 2B2TC 3KDFB 4FULA 2C7NB 2LHEA 2NWGA 4JCVE 1XPRA 1VQAA 1JWMD 2F0TA 2DAFA 4F1SA 2MBQA 1NJIC 4W9CA 3A33B 1PRTF 4BVUC 1YNTE 1NBFC 3Q6BA 1V1OA 4DHZE 2Y0SE 2M00A 4NB3A 3NQTA 1K83B 1U4PA 3DM1A 2PMVA 1K51A 3RN9C 1MI0A 5CC4A 3W5VB 1EU4A 3M85A 4FF1A 5BO4B 1EEID 2N7JA 1UAPA 5JJLA 2WU2B 1TKGA 4FVMA 3M9BA 1HJPA 1EY8A 4A3FG 3HOZB 2RDBC 4XYCA 4LDTB 5KGUA 3GQBA 1EIHA 2FCQA 1B8AA 3HOWG 5K36G 1D4BA 2ZPNA 4DR1Q 1UGMA 4A3EB 5CGKA 2HJ1A 1CT1D 1HZ9A 1WI0A 1DOXA 4WRDA 3PIOA 4DXFA 4GB9A 5C3EB 1XCQL 4AS1A 1NYQA 3AEFB 1O78A 1QOFA 2X38A 3HOYB 3NZSA 3PRPB 2MJEA 1OQQA 2JA6H 2C5CA 2QGQA 3TP5A 3OIQA 3TP8A 4HVBA 4LF5L 1VRAB 1D5MC 3QWZB 5C4JH 4BS9A 1SB3C 4CYEA 1KF6B 5E6PA 3DBHB 1G6PA 1HH2P 2LXKA 3ERQA 3OIPA 4MN3A 3JAML 3F2DA 4OWWB 1KFYB 2PVOD 4K81A 2PPBC 4K7SA 3W2DA 2MSED 2KMAA 3Q8DA 4ANXA 2PVGC 5J17A 3IVFA 3CCRA 1RJTA 1EF5A 2LVQA 4US9A 1HR0Q 2IX1A 3MWYW 2I5MX 5IP7H 1KDBA 2N7DA 1WMHA 2KTRB 1HUNA 2CHBD 4QY7A 4P73A 2E5LQ 3DUZA 1XO3A 3DBLI 3T4AC 2TSSA 4KKUA 2RHQB 1DOYA 5AFWA 4AOFA 3DQVA 2AEHA 5C23A 4EKUA 4DUZL 4NY0A 5IO9A 3SDZA 3CCEA 4KV2A 3JAMi 2DLBA 2N88A 5M3FG 5G3LD 1LTID 2RDHA 2ZJPA 5M3MH 1E24A 3Q6SA 2IO3B 1GJXA 3V61A 1Z5SB 1D5ZC 3IAS1 4FLHA 4DR2L 1I4GA 4R8NA 2V1CC 3AE4B 4YTPB 2PE9A 3HS0C 4BBSH 3DOWA 4M8AA 1I4RA 4DR6Q 2RSUA 1OXVA 2WAQB 4A3FB 5HI1A 4ARIA 4YCUA 3TCAA 3GTMH 1KL9A 3HOWB 1I4XA 1YHBA 4U68A 1Q90A 5GXGB 5T8IA 3R7RA 4FYDA 5EPLA 3NS1A 1EZ8A 4HDQA 2KQSA 3NG0A 1G8ZD 5AUIA 2L15A 2JSVX 1MI2A 1MG8A 1S5DD 3FKIG 2LSSA 2ZW0A 3TZDA 5FJ8H 4DV4Q 1NUCA 2NVUI 3G4SA 2AMCB 1WD0A 4A93G 2E76C 3EQLC 5M5XH 4A3CH 2D3GA 4LLGM 5KIXA 4BAXA 1JB7A 2NBFA 3EBEA 3M7GA 4U673 1W6KA 3DDCB 3NRZA 1Q1EA 1QZGA 2K6QA 3SU8X 3AEAB 1LV9A 4WORA 2RPVA 4IKGA 2O6VA 4BY1H 2IO1B 3E9HA 2AUJD 2GVBA 5DAUA 3KLSX 4C2MB 4DR4L 1AARA 1X1MA 1NBWA 1X6OA 3PO3H 1EY6A 1BVSA 2A73B 3SK4A 2YEPB 4EFOA 2KHJA 1I50H 3FP9A 1L0YB 1HNZL 3DVGX 2Y0SG 3AMZA 3L7ZC 2CHWA 2EYPA 2SDFA 1T5EA 5CV7A 4CJ1B 2R7ZG 1V5TA 3A74A 3V6EB 1B2TA 4S17A 2B2UA 2F0UA 4K6DA 1WTHA 3S1RH 3TRZA 5FR3A 3CCMA 3VR8B 1PFMA 2C9WB 5IOCA 4RHRA 3PUVA 3T1HL 2EMTA 3PUXA 4RMAA 1K8RB 4EUTA 1K50A 1F2ZA 1HXYD 4HR7B 2EMSA 3W1GA 4L6TB 4LUVA 3PZ8A 4FNFA 5GROA 2OTJA 3JAME 2JEBI 3IT4B 4AWJA 4NXNQ 3P63A 4HAEA 3HOVH 2JY6A 2KDEB 2MWSB 3T3NA 4MH8A 2YYZA 1EY9A 3I4MH 4BY7B 5C3JB 2Q5WD 5M9OA 3DWAA 5IY0A 3Q3OC 4YWGG 1A3UA 5C44G 1SAPA 3A5ZB 3AB9A 2J0JA 1IBKQ 2V1YA 1ZOYB 4ZRQA 3L0OA 2XBBC 4YXDB 4R4OA 1WTXA 1SNQA 2VZAA 2B2VC 3FKIB 4H0LC 1BOSA 3DEOA 1EFWA 1E5WA 1F2RI 3EN2A 4ODGA 4GKJL 3BY4B 2EJFC 2AL3A 2MQHA 4L2YA 2F52A 4OZCA 3KK7A 1X3QA 2H4OA 4K5VA 2KVRA 2MO1A 4K0KL 2Q2IA 2HT1A 2B63B 3M3JA 3RZWC 3UIOB 2XRSD 1E7VA 1N62A 1STBA 3R3MA 4JBWA 1WY8A 4IWOA 1QOAA 2DWQA 4B95A 4PZ7A 4UDUC 4KKJA 1HCZA 1WI5A 2FIFA 1O80A 4JQWC 1OEYJ 4JI2L 3LDZE 1ENFA 4IUTA 4K3BA 3TP6A 4LCDE 1CZWA 1FM0D 4BBRH 5IT9c 3H3VH 2LXJA 4DHZB 2Y0SB 4RMFA 3KUDB 1TS5A 2R7ZB 1PH2A 1EL0A 1UZXB 1ZYRD 3IFWB 1KQSA 1UNSA 3NE5B 1DD2A 1E7PB 3ZIMA 2IL8A 1F1HA 1E22A 4A3JH 5LMUQ 2ZJQA 4F88A 1WCMH 2DGYA 3HGBA 5IYCG 5K5PA 1QKZA 2G45B 4WJ4A 1GHKA 1PH6A 1CQVA 1QOBA 1FXTB 1WR1A 1I4HA 2FJ2A 2PQEA 2VY3A 1JMLA 3MZ5A 2DNFA 4F8CB 1F2YA 3W5OA 2ZZPB 1A62A 1EU3A 3SGIA 5D2MB 2Z8LA 1ML0D 5HG2A 2EPBA 1SE3A 2I0QA 2N8NA 4ALPA 3I4NG 3AQQA 4P2CB 4MIUA 2WYQA 5KNBA 4WURA 4M8MA 3W1YA 2KAJA 4GDKA 2KO3A 4OVUA 1VS0A 2K8HA 2D2QA 2KDMA 4G7HC 3MHSD 1Z6HA 3HKZE 2A74C 1KM7A 4UPAA 4Y52H 1EQQA 4P16A 4V0BA 2FCMA 4HJ8A 2KWUB 5NUCA 1CKMA 1SYCA 2ES2A 2VZKD 1KLGD 3SDLC 1XWEA 4XGAB 1Y1VG 2K9XA 2A68C 1YNND 2B2WC 3EVQA 4BA1I 2V3SA 4RCNA 1SIJA 2M19A 2B29A 4AQYQ 1P1AA 4Y7NB 3AE6B 3T1YQ 1MHXA 2KK8A 3STBC 3O13A 4GDLA 1IYJB 2D2CC 1X3FA 1I94Q 1E9MA 4IZ8A 1CZGA 1HNWL 3DBRI 1KLUD 4CJ2C 2NPTA 3QOJA 4LJOB 3OTOL 4RM8A 3HOXB 1Q82C 3S1QB 5E6JA 3ZTDA 2N9KA 3JSVA 2MHJA 5BR8Q 3W1SC 2HCIA 2HQLA 1G2SA 2Z6KA 1QUQA 1UWVA 1T0QC 2L55A 2K5HA 1I7HA 3M4PA 4DV6Q 3DBLB 5IT9L 5AJ3L 4DV5Q 2N4FA 4OZBA 2XRQD 4BKGA 1VQMA 3E56A 2PLPA 5CYUA 2KMMA 3MTNB 4DK0A 1PH1A 5IYDG 1FMAD 3RCZA 1Y1WH 2L12A 5A2QE 2RKSA 1SNMA 3UINB 1O7ZA 4OIJA 2BA1A 1L7YA 3WANA 2H89B 4POGA 2KQ4X 4ULLA 4ZUJA 2YU9B 3M3YB 4KY7A 5AZHA 2JA8B 1F2LA 2ZCBA 4DXGA 1YJJA 3CMEA 1JQYD 5AEKB 3APCA 3GS2A 2QCPX 4IPCA 2EJGC 3PIP3 1N5WA 2W55A 5GADC 3Q0AA 3ZJVA 1GHJA 4A3IB 4PMCA 4JWUC 1L2NA 3ITPA 4M1UB 1V80A 2D3CA 4YY3Q 2IY1B 3HKSA 4OEMB 2GMIC 3J7AF 3WAPA 1JCKB 2L1BA 1VQNA 4JV5Q 1SXTA 1WFYA 3AI5A 3KVFB 4HJKA 5BMHA 4CHTB 1YJIA 1C4QA 3NZUA 1L1OC 3OWEB 1Y1VB 2BKFA 4K7UA 1XLOA 3VH4B 1BXTA 3L4PA 2MHVA 2JVCA 4FXGC 1Q10A 2LGYA 1IL2A 5CHVC 1WYGA 1BCPF 2RD0A 1C78A 1YITA 1SNDA 3PLUA 5JHAA 4A3MB 1C77A 5BN3A 4X66Q 4GKKL 2BB6A 1EF1A 1F2RC 4LF5Q 1WWTA 2ZM6Q 1TVXA 3IL8A 4B08A 4YHHQ 1KC8C 2UUCL 3UF8A 1FYCA 4A8XC 1ESFA 1GKHA 3NP8A 4HPPA 1FNWA 1ONLA 5COYA 4X64L 3PRZA 3AEVA 3S1NB 2L7RA 2QMTA 3VQIA 4LF8L 2JYOA 2BVCA 3A1QB 5HKHA 3J80c 4C7YA 1RCVD 4C3JB 2KHIA 2BW2A 2ZVOA 2FE8A 1TZOA 2XK5A 1EEFD 4PG3A 1OXTA 4NDXA 4KKIA 1A15A 2L05A 1E0BA 2FFKB 3MXUA 1RODA 1MG4A 2E8GA 1EQRA 1A70A 1JOOA 4PV1C 3RUIB 4A3BB 4N9PA 1J8IA 2JU6X 1VQJA 2BOSA 2PI2E 1V86A 3HHMA 3QB3A 4CKCA 4KHPQ 4MM3B 1N32L 3RULA 2VQFL 1QQRA 3ZDMC 5IP4D 1GUTA 1Z9FA 3PO2B 1CZPA 1YX5B 5GMVA 1EWIA 2NCNA 1A63A 2MW5A 1ZKHA 2B76B 4TKOB 4DAYB 1VJKA 3VH3B 2IGDA 3OMCA 3NTKA 4I6NB 2MQJA 3HKZG 2ZTDA 4A3KB 2KKCA 1WXAA 4W9KA 4BBNF 4LJPB 3TIXA 1B3AA 2WP9B 4RGNA 1HQRD 2VL6A 5CORA 4Q5VA 2CKZB 1OXSC 2NN6I 2Z9HA 5FOBB 1D2BA 1L1OB 4IQZA 3L10B 1OTCA 4B0EA 3LYYA 1T6BX 2M17A 3S16B 1VQPA 1M94A 1MVKA 4XE0A 3ZDTA 4ABNA 1P7FA 4KZCA 2K75A 1BKBA 1MHWC 4P7IA 1YOVB 2JXXA 4N6EB 2HUGA 3WAOA 2KOLA 5JVG3 4BXXG 1EUVB 1BCPB 1GO3E 1F77A 1R4QB 2L0TA 2M2LA 4L1BA 2R93H 2FAZA 1I3QH 4B3RL 2I1JA 3RNGC 1J5EQ 3Q69A 3EFCA 4KK7A 2RDFA 1N36Q 4DN4M 3A4RA 3ER0A 4TVAB 1FPYA 3QHTA 3O65B 1IGDA 2XSCA 1XPUA 4QIWE 2WHIA 4DV2Q 1G6ZA 3JYUA 1TWHH 3PRMB 1KD1C 2IW3A 1RF2D 1NYRA 4LDTD 2NVTB 4HWIB 5DPTA 4ANVA 3P4RB 1H9RA 4ZKCB 2INDC 1Z7TA 2Q8TA 5KNDA 4KTAA 4DV3Q 1TBEA 3J80L 2G5DA 2KVZA 3ALBA 3L08A 3D31A 4W9LA 4JI4Q 4K5XA 2PMZB 2Q2TA 1KHIA 5JEAG 4GMVA 2MBHA 2FXQA 3V60A 5JPMC 3M4YA 3Q23A 4LFAL 2JA7H 3U52E 2KLCA 2IX0A 3K6OA 1M8AA 3UIPB 1E10A 1I6HH 2OCEA 3ENEA 3PGEA 4V190 4N9TA 1NTGA 4KJNA 1XMQQ 3B08A 2PKOA 3TQYA 2KDBA 4W9EA 2B8GA 3NBHB 3U4VA 4TSSA 2F0KA 3GP7A 3ICEA 1U4AA 4II2B 1DJRD 4C3HB 1FNUA 3QAQA 3W1BA 4C3IB 1WGDA 1XXGA 3HM3A 4NP5A 3TUOA 3PZ7A 2AHOB 5BN5A 2VUMH 3I8ZA 2W82A 2YVCA 4FJVB 4IOIE 1IXRA 2EDGA 4A76A 3DBHI 3T8MA 1XMOL 5BYQA 1EO6A 1GC7A 2JE6I 4M02A 2LWPA 4GN4B 2A5HA 4FXKC 4UP8A 1EY0A 1XLNA 3GTJB 1JW9D 2KDFB 2K5NA 1JQ4A 3RNEC 3WALA 5T1IA 3J7AV 2UXBQ 1T0RC 2J52A 5GAEC 5IAAC 4HMJA 2A5UA 2MP2A 3SK5A 4K8JA 2N1WA 4CKEA 1WMHB 4TQ0A 3TN2A 1VQ7A 1KNAA 1XNRL 1G91A 2B3GA 2WDVB 1RFAA 4PMBA 2EKIA 3VRBB 1ZGUB 4HK2A 4GSWA 1HTPA 4ZCKA 3DBRB 1PDQA 3K9OB 3SFEB 3HG9A 5LMNL 2YTYA 4CQNA 3K0YA 5M5YH 4HDOA 4B0MA 4HJAA 1GUNA 1OXXK 1STHA 4IPHA 1Y8RC 3OJ4B 5IP9G 3PLVA 4TQ1A 5FLXE 2ONQA 2QDBA 1QJOA 1RDPD 2D0PA 2RCFA 2JRHA 2X8XX 3AE2B 1DOMA 1L2FA 5IGBA 4WJQA 4A3PA 1X3PA 1A2TA 1YZ6A 4R4CA 5DNFA 4II3B 3WA0A 3TP7A 4P1CC 4W9FA 1XLQA 2EE1A 4RWSC 2N49A 4BWGB 4ICUA 4JI2Q 5IGDA 3U4ZA 4DHJB 3NBIA 1IGCA 4GLXA 2KZRA 1X9NA 2IJ0A 1QVFA 1JOKA 3U2SC 4W9HA 1PFDA 2MJDA 1WR6E 4X3TA 1EYGA 3GE3C 1STEA 1P16A 3BVMA 3P20A 2L52A 2JN4A 2WAQE 3DXJC 3HRDD 3UGBB 4LFBQ 1C1YB 2Z4IA 5IGGA 4JI5Q 3BK1A 1BUVT 2WXIA 3D8GA 2ZNVC 1YQBA 4ZAIA 1B7YB 1BDOA 4IUUA 3SFDB 2VH1A 4JI1Q 2NN6G 2F0WA 4RGMA 1N8RC 5JJIA 4C00A 4XXEA 1AE2A 3K80C 2KVMA 3IBEA 2A6ED 3KYHC 1EWHA 2QCZA 4LNKA 5G5GA 2WDQB 3KW5B 3ZTCA 3S14H 2M0XA 3I91A 1SN8A 4HEA1 1E2VA 3GZNB 3SEBA 2CU3A 2H88B 4OZAA 1LLRD 5IKCM 1TWCB 1U4MA 2PQAA 2RMMA 1CQFA 1S3SG 2K5QA 4DV7L 2XIWA 4IUQA 1L5PA 3AEDB 3AN1A 4DAMA 3SXHA 4LF4L 1JE5A 3V3XA 2N55A 1N34Q 1CHPD 1SE2A 2EY5A 3IRBA 3AEGB 5EE9A 4DUYQ 3GTGH 3L0WB 4DWFA 1K83H 2GBJA 4EQ5A 2KFKB 3K58A 4NXML 1W6JA 1ZP0B 1TWAH 5FLMG 2A8VA 2E2HB 2Q8RE 4X3SA 4B3SL 2I2YA 4N58A 2K1BA 1WJ6A 1FVIA 3BWUD 1ASYA 4JPSA 1DOLA 5D3IB 3FDTA 1YJ1A 5CHWA 3HOZH 1WGKA 2WIIB 4NMZA 3M62B 2DY8A 2XWJB 1Q8KA 1MPEA 1NDDA 4A3EH 3S17B 2EYHA 2JZPA 3CCJA 4DV0Q 2NVXH 1VDZA 1NNXA 4QUCA 2MGSA 3A54A 1E2ZA 1WM3A 1TKWB 1GOZA 3C1FA 4JYAQ 3A4SC 3OSOA 1P7EA 1YI2A 3K7AB 2ZNVB 3R7QA 3KLWA 4ZYSA 1C79A 3MEHA 1SE4A 4KMUC 4PMWA 4EZLA 5ELNA 5C3EG 5JXVA 3PUZA 3HOYG 2JYEA 2PNRC 3NTIA 2WXMA 4CJ0B 2WXFA 4A3DG 2IO0B 2DNEA 2K39A 2LHDA 2NZOA 1HZBA 1GUAB 3AV8A 1PFBA 2O2LD 3H6MA 4KHVA 4PQXA 4FN2A 1VMPA 4RFBA 3EJIA 1V1PB 2AWTA 4GN3B 1SFOH 1SR3A 3CF6E 4BZAA 4DFAA 2ATWA 5H8YE 4HN7A 1VQLA 2FUHB 4ZK9B 2I38A 1M1KC 2YV5A 2RQXA 3NWTA 4ME5A 4DR7L 4OX9Q 2GB1A 2F0DA 5E6NA 5FO7B 3F2CA 1IYFA 2ZT9C 2DYBA 3ECIA 1AFPA 2BTEA 3VYTA 1HNXL 1FIQA 1SNOA 2N7EA 3P1HA 4QIWB 3AU5A 1PTOF 3BK2A 2E2IB 4FHKA 1P3QU 1GUGA 3FMCA 3JW0X 2K8CA 3F2BA 2JP1A 1P98A 4O1NA 2F0EA 4XC2A 1LACA 3HRZC 1TS3A 2EZVA 1VQ6A 4M0WB 5IA7A 2K7VA 1ZXTA 2K50A 1PRTC 2DX5B 1C9FA 3H8HA 1XD3B 5BYSA 2B2YC 1LABA 2IHEA 1BNZA 3FEWX 3VAWA 4DDGD 4KY6A 4G11A 1H9MA 1R4NI 4A3FH 1UELA 1WJNA 2K25A 2NBUA 3LX0A 3N30A 3VR5A 1Q5WB 2LFIA 3N1ZC 4H2AA 5G5HA 3HOWH 5K36H 3P75A 1OEYA 2WXPA 2GBRA 3AE3B 1UBQA 4ZHPA 5LHY1 2WAQG 4WJOA 4GDKB 4FJZA 1LT4D 1J8CA 3Q3JA 3I7FA 1CA5A 2KC2A 5ELOA 1QZHA 2UUAQ 3G48A 3F8TA 3LWEA 4XQNA 3SR1A 3S2HB 2RA4A 4AP4C 3ZNZB 3MJ5A 3V6CB 5IE8A 3KF8B 2JQOA 3QO2A 2JEAI 1K3BC 1Y56A 1KH0A 4A3DB 3RZDH 1IYVA 2C5LC 3S1MH 4G3XB 3WAMA 2DJGC 3W5UB 1LTGD 2M0AA 3H15A 3S2DH 3RD2A 4C4VA 3ZQ4A 5JH5C 5EJWA 3H6NA 2BCOA 1WZ3A 1BQQT 1ZDVA 2NTSA 2HIXA 4CHKA 5JJZA 1N33Q 4H7BA 4C2MH 4KIKB 4XDCA 3LNNA 2DYMA 1WTPA 1UE6A 3GTPH 1V8QA 3ONAB 5I6YA 3A5UA 4J8QA 1VQ4A 3PVLA 2ZXPA 1WXMA 3NVZA 2KENA 1X55A 1PDXA 1QUQB 1KIXA 4N9F4 4AJWA 2PZWA 4G7OC 2D5DA 4JI6L 3RD4A 5I2XA 4GNXA 3D4DA 1UBIA 1O7LA 4HMIA 4WFN3 5M3FH 1PRTB 4H44C 3CMMB 4LNFA 3NSWA 4K1RB 4WAFA 1T0SC 1ACCA 1L6UA 5CR3A 4MNOA 4USAA 3A8KE 3T9LA 1JRUA 2A6EC 4HJ7A 2JWUA 5FKAC 4IPDA 2A68D 1H9JA 3N6RA 1JWBD 1ET6A 3TBLD 3A8JE 3RZOB 3N1YC 2J7QB 2LJ5A 3LXFA 4ILWA 1S72A 3LWUA 5CMDA 4B6WA 4JL9A 3STBD 4CKBA 2KWCA 2DUDA 1JICA 3ZO5B 1TWFH 1II3A 2F4IA 1TS2A 3E0EA 1KAAA 4BY7G 4JOIA 2AKWB 2EYOA 2PO4A 3C8YA 5MPOA 4X62L 1EY7A 1Q12A 1UUPA 5E6OA 4LFCL 5EKIA 3FKIH 3ZJTA 5C0XI 3G7LA 4P74A 3PREA 4RAUC 4A93H 3RLOA 2G1EA 3PTFC 3WIMA 3N20C 2KHSA 1VQ5A 4MT5A 3ZYYX 3C46A 4WWPA 1PYWD 3I3TB 4XYQA 3QG1A 1QT9A 1TT5B 1JJCB 3KUZA 1PFSA 3K7UC 4RGTA 4XIGS 1AP0A 2ACZB 4IW0A 1TS4A 2MP1A 5JZEB 2B63G 2A4ZA 2NBVB 2ON8A 4CGYB 4DA2A 4DR5L 4BA2I 2MRPA 1L0VB 1R7SA 5BMIA 4KDIC 2L4NA 1XMOQ 4J15A 1Q8IA 2RGFA 3QX1A 1B1ZA 3B0AA 4R4QA 2MLBA 1YJNA 3QJYA 4M00A 2R7ZH 4NKLA 2YTVA 3FVQA 1UGJA 3TZUA 3LGJA 2DZMA 3KF6A 2BYEA 2E2DC 2JA9A 1HR0W 2FMMA 3Q3NC 4WH4A 3PO0A 2XK5B 1V8CA 4WIPA 4LF9L 3TEZA 4B3ML 2JA6B 3K0XA 1XNQQ 1CKNA 2R2QA 4K8IA 1FRRA 2F1MA 2DYOA 5I6WA 1E3PA 2VB2X 1RL2A 4TMAB 4LMQD 2ZEQA 3V2TA 3BS1A 3CRKC 2ZCCA 5C3XA 4IJLA 4NJ7A 1L4ZB 4LUZA 3DHHC 4DK1A 1MIUA 1BT0A 4J6IA 3AE7B 1LTTD 3D32A 3TEWA 1RKNA 4BY1G 1JE4A 2ICEC 1UH6A 3SK8A 4XQQA 3K9PB 4F7XA 3ZKJC 3MXNA 2HTME 3QOLA 1NR4A 5C44H 3L3OC 4JIOU 3A55A 1CM9A 5HFYA 1WRIA 3A9JB 4PZ6A 4B3TL 2C7MB 4S3SA 4TQUS 4R8IA 5IYBG 3GTOH 2LGDA 1NI2A 4NAWB 5AZGA 2JX5A 1FJGL 3AU7A 4REZA 1B9MA 1KLVA 4C1NK 4AUQC 1RRBA 2E75C 3JVZX 2HDMA 2D3AA 1NEKB 3DWMA 1EYCA 3E9IA 1WF9A 1XTDA 2IBIB 5M3MB 2JA5G 2K5WA 4OVZA 1TWGH 2WFWA 4MH0E 3S1QH 3BVZA 1XT9B 3ML9A 4JI3L 2Y5PA 4DDID 1R9TB 1GUWA 4WWNA 4KGRA 1LTRD 2VXWA 1VQIA 4MSQB 4LJZC 4ZUIA 3HOXG 4BBSB 1WIAA 3PS6A 4GOPA 2W3RA 4IN3A 2RF4A 1E8WA 3NJTA 4EZKA 3P4PB 2FCNA 1B3QA 4P71A 5LL6S 3GTLH 1V81A 2IHFA 1FGBD 4YSYB 4RCOA 2Z6BA 2DZIA 1KTKA 1IBLQ 2QDFA 2V3NA 3ZXRA 1Q1BA 5LMNW 3OYYA 2QKIC 3ZJYC 4JI0Q 4EVOA 5IYCH 3CD6A 1IBXA 4OHJA 2UUBL 3M3YH 2K4KA 2PMZE 1MGSA 4C1NI 1QLBB 1B53A 4IPGA 1F9PA 4ICVA 1LT3D 1LM0A 1WX9A 2KCNA 4DGZA 5M5XB 4GGQA 3MHZA 3I4NH 5C6AA 2JA8G 4QL5A 2KJ6A 2ZPYA 2G4DB 1JWSD 4DV1L 4GZYC 2H5XA 3HM6X 1R4NB 4L5TA 1EFID 3CQZH 2BWFA 2M4NA 1SYFA 1IHZA 5IWAL 4BY1B 2DJFC 4R4TA 4ANUA 4ZRPA 1XQQA 1N60A 1YN5A 2SAKA 2V0GA 2WP8J 2LVPA 2CVRA 4AH6A 1E7UA 2WXJA 4A3IG 1LM8B 1K52A 2JZ3B 5E4WC 1SMYD 2EYFA 2F3IA 1Y1VH 5C0XG 1HA5A 2MNAA 2HE7A 3HEJA 1D6EC 1I50B 2K5VA 1WTWA 3Q8FA 1KRHA 2F4VQ 4TRDA 5FO8B 4JG2A 5CBAE 1K0SA 4NJ6A 3EA6A 5EAYA 3S1RB 3H3VC 2E6XA 4RKLA 1VF7A 1S5FD 5M5WH 2UXCL 2HHHL 2JA5B 2PW7A 4A3MG 1SEBD 3FILB 3P7JA 1A3TA 1C76A 1WE7A 1XJVA 3S1NH 3M4OH 4X6AH 2BF8B 1Y8PB 3KUPA 3L13A 4FXCA 1FCCC 3E5SA 4W9DA 1K8AC 1X65A 1WZ0A 1M4VA 2N3SA 2PZUA 2BS3B 1DM0B 2J0MA 2W3SA 2ICIA 3S15H 4X57B 4X65Q 2KECA 4C3JG 1L6VA 1WXQA 3HIZA 5GAHC 5IYDH 2BYFA 1JROA 2CWPA 1A0IA 4ZRJA 1PH8A 4DR3L 2QC8A 4OO1I 2J0TD 4GLSC 4HJ9A 4A3BG 4J6HA 4EE2A 4GLVB 3HVDA 2N9PC 2ZXRA 3C1EA 3V05A 1J19A 3H9DA 2WXKA 2WB1B 5JEAJ 3J7YW 5ISRA 3PO2G 1WJJA 2B2TA 1RIPA 2UXDL 4ZQ3A 4QGUA 4LF6L 4HSVA 2OQKA 4XWWA 1F9JA 4A3KG 2JPHA 4DNIA 2V4LA 2OWOA 3VTWA 3S16H 3PMFA 3UI2A 1TIFA 4KZ0A 5J18A 2WX0A 3E3XA 1I42A 3VXWA 2PNHA 2VQEL 2N0SB 1A8VA 3DLLA 1Q81C 4A3GG 3B2FA 1GPXA 3TEHB 3K5MA 3AMUA 2D9UA 1YBYA 2L32A 4BBRB 2WQYB 3R66C 1EY4A 1W2BA 3IFTA 2KN5A 4FBJB 2DZJA 3X3NA 1TIID 1YX6B 2EY1A 3PIPA 3GZNI 1KRTA 3J7A5 1N9WA 2F0JA 3MTSA 3EECA 3BDLA 4A3JB 1WGRA 4N59A 1JB3A 1WCMB 2PW9A 4PK1A 3GOEA 4PNYA 4DAPA 3B9JA 5KNCA 3BZCA 1BCPC 1A2UA 4L5SA 2NVTH 3AE9B 4BOZB 4O0AA 3VRAB 3AFPA 3A7LA 2C35B 1HZAA 4XTCS 1U0LA 2F3WA 2BPSA 3ZNID 1ZUD2 1RHPA 2R61A 4WAAA 1S1QB 3VTVA 4JI8L 4MEMA 1LT5D 4OONA 4FF4A 5E4XA 4Q0FA 1HA6A 2QW7A 3KYCD 3CCLA 2IYDB 1ICFB 4KJOA 5GAGC 2X69A 2UU9L 4ITKA 3W3AA 4QB4A 3A7AB 2JWZA 4ZRIA 1Q3LA 3I2ZA 1V49A 2BYTA 2INPE 2JQRB 5J1ZA 3HVZA 1HTQA 3KBXA 4XQJA 3RFZB 1LUZA 4DQOC 1TY0A 3VUYA 2WXLA 2N1VA 1SDFA 2DHZA 1QE6A 2LGSA 1IKMA 4LNQA 2BGFA 1B9RA 4DUZQ 2OHFA 5C4XG 1I5FA
chains in the Genus database with same CATH topology
1IW7D 4C3HG 4B9XA 2EYLA 4C3IG 4KV6A 2KUMA 4I7ZC 2F0VA 1IYUA 2FHTA 2RDGA 3TMEA 5E3FA 1QCBD 3VYSA 2NVQB 4A3GB 3IT6B 3NVVA 2JXMB 3U9SA 4ZLTF 5ELEA 5IT9E 1H9SB 1KDCA 4FO2A 1U9RA 2XNAC 3ND8A 1Y1WB 5J22A 5KRUA 4ID6A 1DZ1A 4A9AA 3C2PA 4IFDI 2EOTA 5D14A 1SSNA 1TT2A 2INNE 3KWVA 2WKCA 3VYUA 1SMYC 3HP3A 1STAA 1PGBA 5JEAH 1AZPA 1FO4A 3T3OA 4QCLA 1ZKOA 1QNKA 3ZGZA 1DGJA 2MJ3A 5EPJA 3A56A 5AUIA 1YN3A 1E2WA 3E9SA 4OO1G 3IFDA 4RNAA 2QSDA 2I07B 4NZLB 4EQNA 3SE0A 5ELDA 2BDOA 3I9V1 5EQ0A 3RLFA 1F9SA 2B8FA 3DEPA 5C4XB 4C7ZA 3AE8B 1NAPA 5T1GA 3ND9A 4G57A 2GI9A 4HEDA 3CWIA 1AYFA 3OHXC 1PLFA 4I65A 3IXSA 1HRJA 1RFKA 4EQOA 1TQOA 5H92C 3AB5A 2MJ8A 5TSSA 2CJOA 1WTQA 4WWMA 2F0NA 1PRTD 5CV6A 4WQMA 1EQVA 1IL8A 4Z9CB 1OFFA 5D3DA 4QMGA 1YQ3B 1VLBA 3NHHA 2WS3B 2R6GA 1KNEA 4XDXA 1STGA 2A6HC 1X32A 2WXHA 2V4IB 5DM63 2MH7A 1D1IA 2LEKA 3NUHB 1NI3A 2K0PA 2NVYB 1AEXA 2B2VA 3BYYB 4H13C 2KACA 5C4HA 1PZKD 1WTOA 3SVMA 2K05A 2V3PA 3A8IE 1SYBA 2GA4B 1SBBB 1VMCA 2B2UC 2KQ3A 2BBCA 2J7ZA 1B44D 3HOUB 1XLPA 1TKEA 4ZHOA 2SEBD 2WU5B 2R93B 1I3QB 2VZKB 3P4QB 3I73A 3LB8C 2O5IC 2EY2A 5ELBA 2BE5C 2JXTA 1G2TA 5CV4A 3R3OA 1JRPA 1JC7A 2NN6H 1TWHB 1HFNA 2D5GA 1HFGA 4L8JA 3K5NA 1EM7A 1F2MA 1QILA 1C4AA 3N52A 1HQMC 1U4LA 3J81L 4KN7C 1LTAD 2CQAA 1EWCA 3J80E 1SNPA 2OEDA 2JA7B 3OPOA 1FD7D 2MEKA 2LKVA 2L5TA 3VYRA 2LUMA 3I3CA 3R93A 1IW7C 1XYIA 2Z4HA 3BIID 1EZ6A 4IFDG 1ZDXA 2HCCA 1VZ8A 3S9WA 2K01A 2B2WA 3SK6A 1ZXIA 1LO5D 4YTMB 2VUMB 4HRSA 2ZW1A 4XT1B 3RUZA 2MUYA 1F0ZA 3H91A 1UEAB 2K33A 2D62A 3DWQA 1QNUA 3W1SA 3MXGA 2Y3AA 1KABA 4R9WA 5CV5A 1SSOA 4ARCA 3DWGC 1FR3A 4NAMA 1CJEA 2W54A 4HKQA 3IAM1 5M5YB 4OL7A 1QWYA 2LMCA 1XF5L 2G9DA 4JWSC 2HDLA 4X3UA 2Y5CA 3FRPB 1EYDA 1JORA 4R3DA 4KI0A 4F8MA 4RF0A 1RWSA 1VR9A 3BVGA 4DAYA 4US8A 4IALA 5BN4A 1RYJA 1UWXA 3EUB2 1PTOC 3GTKB 5IODA 3D4WA 4YIJA 3I70A 1ZEQX 3MFYA 1FXAA 1OXUA 2G9HD 4DU9A 1T3QA 1IBXB 3SR6A 3MVVA 1PZJD 1BBXC 1EWYC 4FP5D 3OW7A 2KA7A 1HEZE 2FINB 2XWBB 3WCQA 1SJED 2BDNA 5KYLA 1GB4A 1C4CA 2EYMA 4KHZA 3S14B 1ROEA 3NXWA 3AE1B 1ILPA 2HDEA 5EBCA 3WDNA 2DY7A 3G6JB 1T5XD 1DXMA 2CW0C 1GAQB 4K5WA 3R2IA 4L63B 2IWHA 2MPMA 1BO0A 3GTGB 4EGVA 5IIFA 3MFGA 2R92B 1TWAB 2L1AA 2AWOA 3PIO3 4F87A 3AEBB 1S5BD 1ENCA 1STYA 3AEEB 4GDLB 4KGSA 3SHLA 1HZ6A 4K2LA 3U4EG 3DMUA 2IPKD 2WXQA 2NVXB 1PTOB 1IUEA 3NBHA 1XTCD 3HZXA 4C56C 1J7BA 3KBGA 1TY2A 4XWTA 3BG3A 1VZ7A 3Q24A 2WKDA 1B9NA 4KX6B 1V97A 3OOCA 4DAVA 3Q8AA 5FO9B 5HGTA 1K8OA 3EFXD 2J53A 1SFOB 2KCCA 3D6WA 1JOQA 4A90A 1FFUA 2GRIA 2XN9C 3H0GB 2DN8A 3CKIB 4MHEA 1QOHA 1HPCA 3QIAA 2ZXOA 3KWLA 1AZQA 3WOFA 2TMPA 2YEPF 1WVLA 1CA6A 2IGGA 5DEHA 2Q8IB 2K22A 2SNSA 2A69C 3TSSA 1WSPA 4KD3A 1ET9A 3NTHA 4KD4A 5C0XJ 2E74C 2J4XA 1LT6D 3TBIB 3P1MA 1FFVA 2F0SA 1DYQA 1I6VC 5CV8A 1STNA 1YMHE 3IKJA 3GV3A 2AQ2B 3T51B 3Q22A 1I4PA 1VCIA 4KKTA 2AX5A 3FC4A 5IGEA 1ENAA 5EKKA 1Y69U 3RZDB 3S1MB 1CI3M 4CBVA 3S2DB 5C4JB 3NK9A 3MA2B 4G4KA 5BMGA 5C3WA 3GTPB 3ZJUA 2RBMA 1K53A 1BCPD 2BS4B 2EJMA 2OXPA 2E3TA 3I57A 3TEYA 2KEDA 4XDDA 2AUKA 2L9HA 5I2YA 3C3LA 1YNJD 5M3FB 5BYRA 1C8CA 1CHQD 3VR6A 4A55A 4FF3A 3Q8BA 1LTBD 2OEOA 2F3VA 2IDYA 4AYBB 4G7ZC 3BDCA 1YN4A 3OWFA 5KEEA 1S5ED 1UWMA 2F0MA 3GD7A 4LK0M 1TWFB 2JYTA 5CBEE 2WLBA 1GUOA 4L23A 5A2QL 2M56B 2OF1A 3T53B 3GTMB 3EROA 2F0OA 1PZID 1V1PA 3DHQA 4A93B 1Y8NB 2NZ1D 3K59A 5I9OA 5EE1A 2WXRA 1PMRA 1N61A 4IUPA 1FCLA 1ICWA 1EYAA 2K32A 5JOBA 2K6AA 1OQRA 4OW0A 4KKSA 3T56B 1IKLA 5CV9A 4YSZB 1RD9D 5C0XH 2Z1CA 4LAAA 2WNMA 1EIGA 1DCZA 3PO3B 4KN4C 2EVBA 1EQTA 3E6ZX 2PZTA 3T13A 4M0WA 3MAQA 5EGTA 1BMLC 4K2KA 2IX3A 2QJLA 1RTOA 1PGXA 1FNVA 2WV6D 1TYGB 2NB0A 4UAIA 4IUVA 3VA5A 2VNUD 4IDIA 3KLRA 3HOVB 1GUSA 3MHBA 2QILA 5C44B 5G3LF 3I4MB 3KF8A 1FD6A 3GTOB 4LTUA 2H1EA 5AUKA 2RSOA 2O4XA 3M7NA 1F9RA 2NTTA 2X6LA 4PT5A 1E6EB 2XVSA 1ILQA 2N9LA 1WD1A 3PUWA 3AE5B 4KY5A 5C4ZA 1KDAA 2F0IA 3KLSA 1TWGB 1NCVA 2OT2A 4J3OD 1ESRA 2I46A 2A6HD 1HUMA 1C4PA 2BA0A 1PUTA 2C9OA 3D6CA 1G291 4QUFA 3GTLB 1QB5D 3NVYA 2B2YA 4RH6A 5I9PA 5HURA 2SNMA 3WOEA 3FPUB 1NSNS 3W9CB 4P6VF 5A35A 4AQ7A 3BZDB 1VF5C 4RGOS 1SYEA 2KN4A 1PGAA 3I4NB 2L0CA 3CQZB 1V43A 4RF1A 1QF6A 1SJHD 1JALA 2BE5D 1E0ZA 1YNJC 4JX1C 2B39A 4B9WA 3K5LA 2FUG1 3NUCA 5C2TB 1JWAD 5EKLA 5JPNC 1TR5A 2V4DA 2WXNA 1XEEA 1B50A 3PUYA 3GV6A 2DNCA 4RHSA 3P4SB 1J7CA 2KJXA 2QEJC 2LJIA 2PYKA 3GB1A 1NENB 1FEHA 2WDRB 5M5WB 1J9OA 1XX8A 4O42A 3M4OB 2X6GA 3CRLC 3H09A 1BUIC 2F0LA 5EPKA 1L4DB 1S5CD 1HTLD 2NUCA 3K5OA 4K14A 3Q8EA 5ELFA 1JR0D 3DWPA 2LMCB 3S15B 1R4PB 2FMCA 5EE3A 2BB5A 2F0HA 2FBWB 3U7ZA 2PTLA 3BDOA 2L11A 2LS01 2LGIA 2PCFB 1AN8A 5E1FA 5FLXL 2WXGA 1FXIA 1ZXHA 2EYJA 1NR2A 5LL6X 3Q8CA 1K8MA 3VA7A 3TEXA 3KQ4A 3AECB 1ZE3D 1ZYRC 4J1MA 5LNK1 4IFDJ 5F2DA 2KWDA 5EBDA 4OO1H 1QG7A 2M9VA 3D4RA 3X3MA 5JVH3 2HQEA 1MBYA 3ABVB 2LFNA 3R2TA 1VZ6A 2SOBA 3MC0B 1FRDA 3FAHA 5D7GA 1XCTL 2DBYA 1SNCA 4NJCA 2WXOA 3I4LA 1O7YA 1DOIA 1PTOD 3NQIA 1YNNC 2F0GA 3VR2A 3PV0A 2O5JC 4Q2JA 2F0QA 5HHDG 2ENBA 2VB3X 4LK1C 1VDVA 3NVWA 4DF7A 5DM73 3MP9A 4QF4A 2K03A 3RMHA 4DNRB 1CFMA 5I4DA 1WTRA 2QF7A 3HKZB 1SYDA 2JSOA 3H94A 2CW0D 1SYGA 3GO5A 3R8BA 3GTQB 1N63A 1PXUA 2EXZA 1ZPSA 1C48A 3OMGA 2F0PA 5EE0A 3E0JA 3MXPA 1CTMA 1A3VA 2F03A 3P42A 1DOKA 3ETRA 2EY6A 4XYOA 5IGCA 3FILA 4HCSA 2RVLA 1RM6C 3FPPA 3F2UA 4IURA 2R3ZA 1OO9B 4ZRZA 3NPPA 2KEEA 3CU7A 4KGTA 2IGHA 1I4QA 2QIEB 2RSNA 1CK1A 2BS2B 3AH7A 3IAYA 1HHVA 3CHBD 1N5XA 4ZKBB 4IFDH 1MSHA 1WTVA 1B4OA 2PW5A 2EELA 1I6HB 4HTHA 4YTNB 2K28A 2PIAA 2NMQA 3B2GA 5D65A 3V96A 1J7AA 1EY5A 5KYIA 4HSPA 4EQPA 5FK9C 3I72A 3N9YC 3I90A 5C5MA 2J42A 3HUIA 2A69D 1D1KA 1AWDA 3T16A 1YQ4B 4HJGE 3D3RA 1TU2B 1RTNA 2AQ3B 2AWNA 1Y8OB 3NWSA 1U4RA 5JAVA 2K3UA 2L83A 2K5DA 4RA8A 4E6IA 1F9QA 2AQ1B 3CIRB 1HZ5A 2E2JB 4DNTB 1TKYA 1NVID 4WJWA 2NYZD 1L0XB 3QWNA 2F0FA 2K04A 4IUNA 1BF4A 3L9AX 4YT0B 3EGRA 5IGFA 4X3KA 2WINB 3AE7B 1PTOH 5C5LA 4HROA 3URYA 4HKZE 3VR3A 1H9KA 1MHHE 1TJEA 4JK1C 4NW2A 2CJNA 1LTSD 3J9CA 5J39A 2IT1A 4RKBA 1D5XC 1AW7A 3NZ3A 4C80A 4HCEA 2K5PA 2WACA 4FXDA 4XT3B 3VR4A 1Z47A 1MD2D 4JE3B 1SF0A 1H9SA 3BYTB 3K57A 1S4ZA 3U9OA 4FF2A 1QOGA 3TDQA 4YSXB 4D2KA 2ID0A 1A6XA 4OIKA 5ELCA 1GXDC 3J81E 1DONA 2LY7A 1JWUD 3AM9A 4ZOHC 1PFNA 4OGQC 2BT6A 1EOTA 1MSGA 1BR9A 4K6LA 2B2TC 2LHEA 2NWGA 1JWMD 2F0TA 1PRTF 1YNTE 1V1OA 2M00A 1K83B 1U4PA 3DM1A 3NQTA 2PMVA 1K51A 1MI0A 5CC4A 3W5VB 1EU4A 3M85A 4FF1A 1EEID 2N7JA 1UAPA 2WU2B 1TKGA 4FVMA 1EY8A 3HOZB 5KGUA 3GQBA 1EIHA 5K36G 1D4BA 4A3EB 5CGKA 1DOXA 1CT1D 4WRDA 4DXFA 5C3EB 1XCQL 4AS1A 1NYQA 3AEFB 1O78A 1QOFA 2X38A 3HOYB 2MJEA 1OQQA 2C5CA 3TP5A 3OIQA 3TP8A 1VRAB 1D5MC 4BS9A 1SB3C 1KF6B 3OIPA 3ERQA 4MN3A 3JAML 1KFYB 2PVOD 2PPBC 3W2DA 2PVGC 1RJTA 4US9A 2IX1A 3MWYW 1KDBA 1HUNA 2CHBD 3DUZA 1XO3A 3T4AC 2TSSA 4KKUA 1DOYA 5AFWA 3SDZA 2DLBA 2N88A 5G3LD 1LTID 2RDHA 3Q6SA 1GJXA 3IAS1 1D5ZC 1I4GA 4R8NA 3AE4B 4YTPB 3HS0C 4M8AA 1I4RA 1OXVA 2WAQB 4A3FB 5HI1A 4ARIA 5GXGB 3HOWB 1I4XA 4U68A 1Q90A 5T8IA 4FYDA 5EPLA 3NS1A 1EZ8A 1G8ZD 2JSVX 1MI2A 2ZW0A 1S5DD 3TZDA 1NUCA 1WD0A 2E76C 3EQLC 4LLGM 5KIXA 2NBFA 3M7GA 4U673 1W6KA 3NRZA 1Q1EA 3AEAB 1LV9A 4WORA 2RPVA 4IKGA 2AUJD 5DAUA 3KLSX 4C2MB 1EY6A 2A73B 3SK4A 2YEPB 1L0YB 3AMZA 3L7ZC 2EYPA 2SDFA 1T5EA 5CV7A 4CJ1B 1B2TA 2B2UA 2F0UA 4K6DA 5FR3A 3VR8B 1PFMA 5IOCA 4RHRA 3PUVA 3PUXA 1K50A 1F2ZA 1HXYD 4HR7B 4L6TB 3PZ8A 4FNFA 3JAME 2JEBI 3IT4B 3P63A 4HAEA 3T3NA 2YYZA 1EY9A 4BY7B 5C3JB 2Q5WD 5M9OA 3DWAA 4YWGG 1A3UA 1SAPA 3AB9A 1ZOYB 4ZRQA 4YXDB 1WTXA 1SNQA 2B2VC 3FKIB 4H0LC 1BOSA 3DEOA 1F2RI 4L2YA 4ODGA 2EJFC 4OZCA 3KK7A 1X3QA 2H4OA 4K5VA 2B63B 2XRSD 1N62A 1STBA 4JBWA 1QOAA 2DWQA 4UDUC 4KKJA 1HCZA 1O80A 1ENFA 4IUTA 3TP6A 1CZWA 1FM0D 2Y0SB 1TS5A 2R7ZB 1EL0A 1ZYRD 1UNSA 3NE5B 1DD2A 1E7PB 2IL8A 4F88A 3HGBA 5K5PA 1QKZA 1GHKA 1CQVA 1QOBA 1I4HA 2FJ2A 2PQEA 1JMLA 3MZ5A 1F2YA 1EU3A 2Z8LA 1ML0D 5HG2A 2EPBA 1SE3A 4P2CB 4WURA 4MIUA 5KNBA 2KAJA 2KDMA 4G7HC 1Z6HA 2A74C 4P16A 4V0BA 5NUCA 1SYCA 2VZKD 1KLGD 1XWEA 2K9XA 2A68C 1YNND 2B2WC 3EVQA 4BA1I 4RCNA 1SIJA 2M19A 4Y7NB 3AE6B 1MHXA 3O13A 2D2CC 1E9MA 4IZ8A 1CZGA 1KLUD 4CJ2C 3QOJA 3HOXB 3S1QB 5E6JA 2N9KA 2HCIA 1G2SA 2L55A 1I7HA 5IT9L 4OZBA 2XRQD 3E56A 2PLPA 5CYUA 2KMMA 4DK0A 1FMAD 2L12A 5A2QE 2RKSA 1SNMA 1O7ZA 4OIJA 2BA1A 2H89B 2KQ4X 4ULLA 4ZUJA 2YU9B 3M3YB 4KY7A 2JA8B 1F2LA 4DXGA 1YJJA 1JQYD 3GS2A 2QCPX 3PIP3 2EJGC 1N5WA 2W55A 3Q0AA 3ZJVA 1GHJA 4A3IB 4PMCA 4JWUC 3ITPA 4M1UB 3J7AF 1JCKB 2L1BA 1SXTA 5BMHA 4CHTB 1YJIA 1C4QA 3OWEB 1Y1VB 1XLOA 1BXTA 3L4PA 2MHVA 4FXGC 1Q10A 1WYGA 1BCPF 1C78A 1SNDA 4A3MB 1C77A 5BN3A 4MACA 2BB6A 1F2RC 1WWTA 1TVXA 3IL8A 4B08A 1FYCA 4A8XC 1ESFA 3NP8A 1FNWA 1ONLA 5COYA 3S1NB 2QMTA 3VQIA 2JYOA 4C7YA 1RCVD 4C3JB 2BW2A 2FE8A 1TZOA 1EEFD 1OXTA 4NDXA 4KKIA 1A15A 1E0BA 2FFKB 3MXUA 1RODA 1A70A 1JOOA 4PV1C 4A3BB 4N9PA 1J8IA 2JU6X 2BOSA 3QB3A 4CKCA 4MM3B 1QQRA 1GUTA 3PO2B 1CZPA 2B76B 4TKOB 1VJKA 2IGDA 3OMCA 3NTKA 4A3KB 1B3AA 2WP9B 4RGNA 1HQRD 5CORA 4Q5VA 1OXSC 2NN6I 5FOBB 1D2BA 4IQZA 4B0EA 3LYYA 1T6BX 3S16B 1MVKA 4XE0A 4ABNA 1P7FA 4N6EB 2HUGA 2KOLA 5JVG3 1BCPB 1F77A 1R4QB 2M2LA 4L1BA 3Q69A 4KK7A 2RDFA 4DN4M 1IGDA 2XSCA 1G6ZA 2IW3A 1RF2D 1NYRA 2NVTB 3P4RB 1H9RA 4ZKCB 1Z7TA 2Q8TA 5KNDA 4KTAA 3J80L 3D31A 4K5XA 2PMZB 5JEAG 5JPMC 3M4YA 3Q23A 3U52E 2IX0A 3K6OA 1M8AA 1E10A 4V190 4N9TA 4KJNA 2PKOA 2B8GA 4TSSA 2F0KA 3GP7A 1DJRD 4C3HB 1FNUA 4C3IB 1XXGA 4NP5A 3TUOA 3PZ7A 5BN5A 3I8ZA 2W82A 4IOIE 2EDGA 5BYQA 2JE6I 2A5HA 4FXKC 1EY0A 1XLNA 3GTJB 1JW9D 1JQ4A 5T1IA 3J7AV 2J52A 4HMJA 3SK5A 4K8JA 4CKEA 4TQ0A 3TN2A 1G91A 1KNAA 2WDVB 4PMBA 2EKIA 3VRBB 1HTPA 1PDQA 3SFEB 3HG9A 4CQNA 3K0YA 4B0MA 1GUNA 1OXXK 1STHA 1GB1A 4TQ1A 5FLXE 2ONQA 2QDBA 1QJOA 1RDPD 3AE2B 1DOMA 5IGBA 1X3PA 1A2TA 5DNFA 3TP7A 1XLQA 2EE1A 4RWSC 4BWGB 5IGDA 3NBIA 1IGCA 2IJ0A 1JOKA 3U2SC 1PFDA 4X3TA 1STEA 3BVMA 3P20A 2L52A 3DXJC 3HRDD 5IGGA 2Z4IA 3BK1A 1BUVT 2WXIA 3D8GA 4ZAIA 1BDOA 4IUUA 3SFDB 2NN6G 2F0WA 4RGMA 4XXEA 2KVMA 2A6ED 1EWHA 5G5GA 2WDQB 3I91A 4HEA1 1E2VA 3SEBA 2CU3A 2H88B 4OZAA 1LLRD 1TWCB 1U4MA 2RMMA 1CQFA 2K5QA 2XIWA 4IUQA 1L5PA 3AEDB 3AN1A 3V3XA 3SXHA 2N55A 1CHPD 1SE2A 2EY5A 3AEGB 5EE9A 3K58A 1ZP0B 1W6JA 2E2HB 2Q8RE 4X3SA 2I2YA 4N58A 2K1BA 3BWUD 4JPSA 1DOLA 5D3IB 3FDTA 1WGKA 2WIIB 4NMZA 2DY8A 2XWJB 1MPEA 3S17B 2EYHA 2JZPA 1VDZA 4QUCA 2MGSA 3A54A 1E2ZA 1TKWB 1GOZA 3C1FA 3OSOA 1P7EA 3K7AB 4ZYSA 1C79A 3MEHA 1SE4A 4KMUC 4PMWA 5JXVA 3PUZA 2JYEA 2WXMA 2PNRC 3NTIA 2WXFA 4CJ0B 2DNEA 2LHDA 3AV8A 1PFBA 2O2LD 3H6MA 4KHVA 4PQXA 1VMPA 4RFBA 3EJIA 1V1PB 4DFAA 5H8YE 4HN7A 4ZK9B 2I38A 2GB1A 4ME5A 2RQXA 3NWTA 2F0DA 5FO7B 2ZT9C 1AFPA 2BTEA 3VYTA 1FIQA 1SNOA 3P1HA 4QIWB 1PTOF 3BK2A 2E2IB 1GUGA 3FMCA 2JP1A 4O1NA 2F0EA 1LACA 3HRZC 1TS3A 2EZVA 2K7VA 1ZXTA 1PRTC 1C9FA 3H8HA 5BYSA 2B2YC 1BNZA 3FEWX 4KY6A 1H9MA 3LX0A 4H2AA 3VR5A 2LFIA 5G5HA 5K36H 3P75A 2WXPA 3AE3B 4ZHPA 5LHY1 4GDKB 1LT4D 1CA5A 3LWEA 4XQNA 3SR1A 3S2HB 2RA4A 3MJ5A 3QO2A 2JEAI 1Y56A 1KH0A 4A3DB 1IYVA 3W5UB 1LTGD 2M0AA 5EJWA 2BCOA 1BQQT 1ZDVA 2NTSA 5JJZA 4H7BA 4XDCA 3LNNA 2DYMA 1WTPA 1V8QA 3ONAB 5I6YA 4J8QA 2ZXPA 3NVZA 1PDXA 2PZWA 4G7OC 2D5DA 3RD4A 5I2XA 3D4DA 1O7LA 4HMIA 4WFN3 1PRTB 4H44C 3NSWA 4WAFA 1ACCA 1L6UA 5CR3A 4USAA 3A8KE 2A6EC 2JWUA 5FKAC 2A68D 1H9JA 3N6RA 1JWBD 1ET6A 3A8JE 3RZOB 3LXFA 4ILWA 3LWUA 5CMDA 4CKBA 1JICA 2F4IA 1II3A 1TS2A 1KAAA 2EYOA 2PO4A 3C8YA 5MPOA 1EY7A 1Q12A 1UUPA 5EKIA 3ZJTA 5C0XI 3G7LA 4RAUC 2G1EA 2KHSA 4MT5A 3ZYYX 3C46A 1PYWD 4XYQA 3QG1A 1QT9A 4RGTA 4XIGS 1AP0A 2ACZB 1TS4A 2MP1A 2ON8A 4CGYB 4DA2A 4BA2I 1L0VB 1R7SA 5BMIA 2L4NA 1Q8IA 1B1ZA 3QJYA 4NKLA 3FVQA 1UGJA 3TZUA 2E2DC 2FMMA 4WH4A 3PO0A 1V8CA 4WIPA 3TEZA 2JA6B 4K8IA 1FRRA 2F1MA 2DYOA 5I6WA 2VB2X 4TMAB 4LMQD 3V2TA 3BS1A 3CRKC 5C3XA 1L4ZB 4DK1A 3TEWA 1LTTD 1RKNA 1JE4A 2ICEC 3SK8A 4XQQA 4F7XA 3MXNA 2HTME 3QOLA 1NR4A 3L3OC 3A55A 1CM9A 5HFYA 1WRIA 4S3SA 4TQUS 4R8IA 4NAWB 2JX5A 3AU7A 4REZA 1B9MA 4C1NK 2E75C 2HDMA 1NEKB 3DWMA 1EYCA 5M3MB 2K5WA 4OVZA 3BVZA 2Y5PA 1R9TB 1GUWA 4KGRA 1LTRD 2VXWA 4LJZC 4ZUIA 4BBSB 2W3RA 4IN3A 3P4PB 5LL6S 4YSYB 1FGBD 4RCOA 1KTKA 2V3NA 1Q1BA 2QKIC 4EVOA 1IBXA 4OHJA 4C1NI 1MGSA 1QLBB 1B53A 1F9PA 1LT3D 2KCNA 4DGZA 5M5XB 3MHZA 5C6AA 4MH8A 3UI3A 1JWSD 4GZYC 3RPFC 1EFID 1SYFA 1IHZA 4BY1B 4ZRPA 1N60A 1YN5A 2SAKA 2V0GA 2WP8J 2CVRA 2WXJA 1K52A 5E4WC 1SMYD 2EYFA 5C0XG 1HA5A 3HEJA 1D6EC 1I50B 1WTWA 3Q8FA 1KRHA 4TRDA 5FO8B 5CBAE 3EA6A 3S1RB 3H3VC 2E6XA 4RKLA 1VF7A 1S5FD 2JA5B 2PW7A 1SEBD 3FILB 3P7JA 1A3TA 1C76A 3VR9B 1Y8PB 3KUPA 4FXCA 1FCCC 3E5SA 1M4VA 2BS3B 2PZUA 1DM0B 2W3SA 2ICIA 2KECA 4C3JG 1L6VA 1WXQA 1JROA 4GLSC 4OO1I 2J0TD 4J6HA 4EE2A 3HVDA 2ZXRA 3C1EA 3V05A 2WXKA 2WB1B 5JEAJ 3J7YW 5ISRA 2B2TA 4ZQ3A 4HSVA 4XWWA