4DXIA

Crystal structure of an ancestor of all faviina proteins
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
218
structure length
217
Chain Sequence
SVIKSDMKIKLRMEGTVNGHKFVIEGEGEGKPYEGTQTMNLKVKEGAPLPFAYDILTTAFNRVFTKYPKDIPDYFKQSFPEGYSWERSMTFEDGGICTATSDITLEGDCFFYEIRFDGVNFPPNGPVMQKKTLKWEPSTEKMYVRDGVLMGDVNMALLLEGGGHYRCDFKTTYKAKKGVQLPDYHFVDHRIEILSHDKDYNNVKLYEHAVARSSLLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GREEN FLUORESCENT PROTEIN
publication title A hinge migration mechanism unlocks the evolution of green-to-red photoconversion in GFP-like proteins.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Luminescent protein
total genus 57
structure length 217
sequence length 218
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-02-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 4dxiA00
3DQUA 2H5QA 4KAGA 1ZUXA 3DQ4A 4ZINA 3DQ3A 4ZBLA 2DUGA 4IK4A 4W6FA 2G2SB 3DQ5A 5LTPA 3K1KA 4JEOA 1QXTA 3PIBA 5AQBB 5HZUA 3EVRA 2OJKA 2QLGA 5H89A 3LVAA 2G6EA 4OQWA 4ZIOA 1YHHA 5HW9A 3U0MA 2A52B 2ICRA 5J2OA 1C4FA 4W6BA 4W6IA 2EMDA 2OTBA 4PFEA 4Q7RA 3SSHA 3SS0A 2IB6A 1EMBA 4OHSA 1EMGA 2QLHA 5F9GA 4OY4A 4W7EA 3SV5A 3BXBA 3SSYA 3VICA 3SVNA 3DPXA 2BTJA 5DTLA 1YHIA 4EN1A 5DPJA 3U8AA 3P8UA 2G6YA 3PJBA 4B30A 4ORNA 4Q9XA 3SVCA 2V4EB 3GJ2A 3ED8A 2RH7A 3SRYA 4W6GA 2QRFA 2B3PA 4GESB 4W6UA 1JBYA 2H8QA 1XAEA 4DKNA 4KF5A 4GOBA 2VADA 2HJOA 5KTGA 3RWAA 3A8SA 4IK3A 2Z6YA 2H6VA 2PXWA 3I19A 3SSLA 4XL5A 4W6AA 1UISA 1KYSA 2HPWA 1B9CA 3DPZA 4DXNA 2EMOA 4KGFA 3GB3A 3DQIA 3E5WA 5EXCI 3ZULA 4IK1A 1EMCA 2O2BA 4IK5A 4IZNA 5DTXA 3BX9A 4L12A 2YE0A 5EB7A 4RYSA 2GX2A 5FVGA 3CD1A 3MGFA 3O78A 3EK8A 4LJCA 3SG3A 3LF4B 3TMRA 2WHSA 2QZ0A 1OXEA 2ZO7A 4XVPA 3ZTFA 4W6CA 3G9AA 4LQUA 4W76A 1CV7A 1Q4CA 4JGEA 5FVIA 2A46A 3DPWA 2IOVA 3DQMA 4W7CA 1ZGOA 3EKHA 3LF3A 1W7SA 1XA9A 5DQBA 2ARLA 2QT2A 4IK8A 5T3IA 4DXOA 2O24A 4W75A 4HQ9A 4U2VA 4ZB1A 3DQLA 3EK7A 3UG0A 4DXMA 3TMTA 1XMZA 2GW3A 1RRXA 2B3QA 1HCJA 1MOVA 3ST3A 3LVCA 4W7AA 1EMEA 3SVDA 4W6KA 3ZUJA 1YHGA 3PJ5A 2GW4B 2ZMUA 2AWMA 3VK1A 4EULA 5EJUA 2AWJA 2OKWA 3EVPA 3CFAA 3VHTB 3E5VA 2A48A 1H4UA 4L13A 4H48A 3LA1A 2Q57A 2VVHA 4IK9A 1RMPA 3OGOA 5DTYA 5DTZA 3CD9A 4ZF5A 2Z1OA 3GJ1A 3DQEA 3DQ8A 5H87A 2YDZA 4JC2A 1ZGPA 4H3LA 2WIQA 3ZUFA 5HZTA 3ST2A 4I2YA 4W6DA 3U0KA 3IR8A 4W73A 4ANJA 5DPHA 1RMMA 2AWKA 5DRFA 2HGYA 2Z6XA 1OXFA 4KGEA 5H88A 4W6NA 1RM9A 2POXA 1JC0A 3DQAA 3H1RA 5EXBA 3CFHA 1YFPA 3M24A 2VVIA 1MOUA 3V3DA 3DQCA 2A54B 2DUHA 3DQOA 4LJDC 2FZUA 3SSTA 2HQZA 1YZWA 1XQMA 3CGLA 4TZAA 5BTTA 3DQ6A 4NWSA 4KW9A 4W7RA 2QLGB 5DPGA 2VAEA 3DQ2A 1XSSA 1EMMA 4L1IA 4P76A 1Q4AA 2HQKA 2C9JA 3U8CA 2ZMWA 4Z4KA 4OJ0A 5HBDA 2Z6ZA 3SSKA 4EDSA 5EHUA 3SG5A 4HE4A 4KA9A 3NT9A 4Q7UA 1QYFA 3IP2A 4KF4A 4RTCA 2G16B 4N3DA 2Y0GA 3U0NA 3DQDA 2OKYA 2ZO6A 3NEZA 5BT0A 4JF9A 3AI5A 3EKJA 3DQFA 4XGYA 1Q73A 4KW8A 4Q9WA 1W7TA 4DKMA 4BDUA 2VVJA 3SVOA 3WLCA 3CB9A 3LSAA 1YJFA 2DD9A 3RWTA 4W69A 2G3DB 4AS8A 2WSNA 5HZOA 3SVBA 2WHUA 3W1CA 3KCTA 3BXAA 4UTSA 1KP5A 3U0LA 1JC1A 4W6SA 1QY3A 4KPIA 4J88A 3WLDA 3S05A 3SVSA 3SVUA 2DUIA 2V4EA 2A56B 4HQCA 3M22A 5HGEA 2IE2A 3SVEA 3GEXA 3SG4A 3P28A 4JRBA 1OXDA 4EDOA 3ST4A 2G6XA 3DQ9A 2YFPA 3WCKA 3OSQA 4Z4MA 3GL4A 3SSPA 2H5RA 2HRSA 2V4EC 4ZF4A 5HZSA 4HVFA 2WURA 4P1QA 5FVFA 3NF0A 2AHAA 2JADA 1KYRA 4GF6B 1GFLA 5EB6A 4AR7A 3CFFA 1ZGQA 4W74A 3AI4A 2A50B 5EBJA 1H6RA 1JBZA 2AH8A 5DU0A 5BQLA 4EMQA 3W1DA 3O77A 3H1OA 3BXCA 1GL4A 4KW4A 5EXUA 2Q6PA 1Q4DA 2HFCA 1EMKA 4W6TA 1F09A 2FWQA 1YJ2A 4LJDA 3EK4A 2H9WA 4LQTA 3DQ1A 4J89A 4TZGA 3EVUA 4H47A 3PJ7A 4ZF3A 3NEDA 5DQMA 3NT3A 2QLIA 3SSVA 4R6BA 4W6MA 4DXQA 2QLEA 4RYWA 2GX0A 2P4MA 2A47A 1KYPA 4LJBA 2C9IA 3U8PA 5LTRA 2VZXA 4W6RA 2IB5A 4DXPA 2QU1A 2FL1A 2DDDA 3ST0A 3DQNA 2OTEA 2YE1A 3UFZA 4PPJA 5DRGA 2DUEA 1G7KA 2HGDA 2DDCA 1F0BA 1S6ZA 1BFPA 3LS3A 5DY6A 1RMOA 2H5OA 2G5ZB 2EMNA 4KEXA 3ADFA 1HUYA 2DUFA 4PPLA 1Q4EA 3EVVA 4KF5C 4W7FA 1EMAA 5LTQA 2G3OA 4W7DA 4H3MA 4XOWA 2A53B 4OGSA 5LK4A 1Z1QA 2HCGA 5DPIA 3OSRA 3E5TA 5FHVA 2DD7A 2WISA 3DQ7A 3VHTA 4Q7TA 4B30B 4JFGA 3AKOA 4W6HA 4R6DA 3SVRA 1QYOA 1MYWA 2O29A 3CBEA 4W77A 3LVDA 1QYQA 4LW5A 4B5YA 4W6JA 4W6LA 4DXIA 2OGRA 4ZFSA 1EMFA 2WSOA 4PPKA 4J8AA 1W7UA 4XOVA 2PXSA 3SG7A 1GGXA 3SG6A 5BTTB 4W6PA 1Q4BA 2WHTA 4W72A 3DQKA 2H5PA 1Z1PA 3DQHA 4W6OA 3KCSA 4W7XA 3DQJA 1EMLA 3SG2A 4HQ8A 2AWLA 4H3NA
chains in the Genus database with same CATH superfamily
3DQUA 2H5QA 4KAGA 1ZUXA 3DQ4A 4ZINA 3DQ3A 4ZBLA 2DUGA 4IK4A 4W6FA 2G2SB 3DQ5A 5LTPA 3K1KA 4JEOA 1QXTA 3PIBA 5AQBB 5HZUA 3EVRA 2OJKA 2QLGA 5H89A 3LVAA 2G6EA 4OQWA 4ZIOA 1YHHA 5HW9A 3U0MA 2A52B 2ICRA 5J2OA 1C4FA 4W6BA 4W6IA 2EMDA 2OTBA 4PFEA 4Q7RA 3SSHA 3SS0A 2IB6A 1EMBA 4OHSA 1EMGA 2QLHA 5F9GA 4OY4A 4W7EA 3SV5A 3BXBA 3SSYA 3VICA 3SVNA 3DPXA 2BTJA 5DTLA 1YHIA 4EN1A 5DPJA 3U8AA 3P8UA 2G6YA 3PJBA 4B30A 4ORNA 4Q9XA 3SVCA 2V4EB 3GJ2A 3ED8A 2RH7A 3SRYA 4W6GA 2QRFA 2B3PA 4GESB 4W6UA 1JBYA 2H8QA 1XAEA 4DKNA 4KF5A 4GOBA 2VADA 2HJOA 5KTGA 3RWAA 3A8SA 4IK3A 2Z6YA 2H6VA 2PXWA 3I19A 3SSLA 4XL5A 4W6AA 1UISA 1KYSA 2HPWA 1B9CA 3DPZA 4DXNA 2EMOA 4KGFA 3GB3A 3DQIA 3E5WA 5EXCI 3ZULA 4IK1A 1EMCA 2O2BA 4IK5A 4IZNA 5DTXA 3BX9A 4L12A 2YE0A 5EB7A 4RYSA 2GX2A 5FVGA 3CD1A 3MGFA 3O78A 3EK8A 4LJCA 3SG3A 3LF4B 3TMRA 2WHSA 2QZ0A 1OXEA 2ZO7A 4XVPA 3ZTFA 4W6CA 3G9AA 4LQUA 4W76A 1CV7A 1Q4CA 4JGEA 5FVIA 2A46A 3DPWA 2IOVA 3DQMA 4W7CA 1ZGOA 3EKHA 3LF3A 1W7SA 1XA9A 5DQBA 2ARLA 2QT2A 4IK8A 5T3IA 4DXOA 2O24A 4W75A 4HQ9A 4U2VA 4ZB1A 3DQLA 3EK7A 3UG0A 4DXMA 3TMTA 1XMZA 2GW3A 1RRXA 2B3QA 1HCJA 1MOVA 3ST3A 3LVCA 4W7AA 1EMEA 3SVDA 4W6KA 3ZUJA 1YHGA 3PJ5A 2GW4B 2ZMUA 2AWMA 3VK1A 4EULA 5EJUA 2AWJA 2OKWA 3EVPA 3CFAA 3VHTB 3E5VA 2A48A 1H4UA 4L13A 4H48A 3LA1A 2Q57A 2VVHA 4IK9A 1RMPA 3OGOA 5DTYA 5DTZA 3CD9A 4ZF5A 2Z1OA 3GJ1A 3DQEA 3DQ8A 5H87A 2YDZA 4JC2A 1ZGPA 4H3LA 2WIQA 3ZUFA 5HZTA 3ST2A 4I2YA 4W6DA 3U0KA 3IR8A 4W73A 4ANJA 5DPHA 1RMMA 2AWKA 5DRFA 2HGYA 2Z6XA 1OXFA 4KGEA 5H88A 4W6NA 1RM9A 2POXA 1JC0A 3DQAA 3H1RA 5EXBA 3CFHA 1YFPA 3M24A 2VVIA 1MOUA 3V3DA 3DQCA 2A54B 2DUHA 3DQOA 4LJDC 2FZUA 3SSTA 2HQZA 1YZWA 1XQMA 3CGLA 4TZAA 5BTTA 3DQ6A 4NWSA 4KW9A 4W7RA 2QLGB 5DPGA 2VAEA 3DQ2A 1XSSA 1EMMA 4L1IA 4P76A 1Q4AA 2HQKA 2C9JA 3U8CA 2ZMWA 4Z4KA 4OJ0A 5HBDA 2Z6ZA 3SSKA 4EDSA 5EHUA 3SG5A 4HE4A 4KA9A 3NT9A 4Q7UA 1QYFA 3IP2A 4KF4A 4RTCA 2G16B 4N3DA 2Y0GA 3U0NA 3DQDA 2OKYA 2ZO6A 3NEZA 5BT0A 4JF9A 3AI5A 3EKJA 3DQFA 4XGYA 1Q73A 4KW8A 4Q9WA 1W7TA 4DKMA 4BDUA 2VVJA 3SVOA 3WLCA 3CB9A 3LSAA 1YJFA 2DD9A 3RWTA 4W69A 2G3DB 4AS8A 2WSNA 5HZOA 3SVBA 2WHUA 3W1CA 3KCTA 3BXAA 4UTSA 1KP5A 3U0LA 1JC1A 4W6SA 1QY3A 4KPIA 4J88A 3WLDA 3S05A 3SVSA 3SVUA 2DUIA 2V4EA 2A56B 4HQCA 3M22A 5HGEA 2IE2A 3SVEA 3GEXA 3SG4A 3P28A 4JRBA 1OXDA 4EDOA 3ST4A 2G6XA 3DQ9A 2YFPA 3WCKA 3OSQA 4Z4MA 3GL4A 3SSPA 2H5RA 2HRSA 2V4EC 4ZF4A 5HZSA 4HVFA 2WURA 4P1QA 5FVFA 3NF0A 2AHAA 2JADA 1KYRA 4GF6B 1GFLA 5EB6A 4AR7A 3CFFA 1ZGQA 4W74A 3AI4A 2A50B 5EBJA 1H6RA 1JBZA 2AH8A 5DU0A 5BQLA 4EMQA 3W1DA 3O77A 3H1OA 3BXCA 1GL4A 4KW4A 5EXUA 2Q6PA 1Q4DA 2HFCA 1EMKA 4W6TA 1F09A 2FWQA 1YJ2A 4LJDA 3EK4A 2H9WA 4LQTA 3DQ1A 4J89A 4TZGA 3EVUA 4H47A 3PJ7A 4ZF3A 3NEDA 5DQMA 3NT3A 2QLIA 3SSVA 4R6BA 4W6MA 4DXQA 2QLEA 4RYWA 2GX0A 2P4MA 2A47A 1KYPA 4LJBA 2C9IA 3U8PA 5LTRA 2VZXA 4W6RA 2IB5A 4DXPA 2QU1A 2FL1A 2DDDA 3ST0A 3DQNA 2OTEA 2YE1A 3UFZA 4PPJA 5DRGA 2DUEA 1G7KA 2HGDA 2DDCA 1F0BA 1S6ZA 1BFPA 3LS3A 5DY6A 1RMOA 2H5OA 2G5ZB 2EMNA 4KEXA 3ADFA 1HUYA 2DUFA 4PPLA 1Q4EA 3EVVA 4KF5C 4W7FA 1EMAA 5LTQA 2G3OA 4W7DA 4H3MA 4XOWA 2A53B 4OGSA 5LK4A 1Z1QA 2HCGA 5DPIA 3OSRA 3E5TA 5FHVA 2DD7A 2WISA 3DQ7A 3VHTA 4Q7TA 4B30B 4JFGA 3AKOA 4W6HA 4R6DA 3SVRA 1QYOA 1MYWA 2O29A 3CBEA 4W77A 3LVDA 1QYQA 4LW5A 4B5YA 4W6JA 4W6LA 4DXIA 2OGRA 4ZFSA 1EMFA 2WSOA 4PPKA 4J8AA 1W7UA 4XOVA 2PXSA 3SG7A 1GGXA 3SG6A 5BTTB 4W6PA 1Q4BA 2WHTA 4W72A 3DQKA 2H5PA 1Z1PA 3DQHA 4W6OA 3KCSA 4W7XA 3DQJA 1EMLA 3SG2A 4HQ8A 2AWLA 4H3NA
chains in the Genus database with same CATH topology
3DQUA 2H5QA 4KAGA 1ZUXA 3DQ4A 4ZINA 3DQ3A 4ZBLA 2DUGA 4IK4A 4W6FA 2G2SB 3DQ5A 5LTPA 3K1KA 4JEOA 1QXTA 3PIBA 5AQBB 5HZUA 3EVRA 2OJKA 2QLGA 5H89A 3LVAA 2G6EA 4OQWA 4ZIOA 1YHHA 5HW9A 3U0MA 2A52B 2ICRA 5J2OA 1C4FA 4W6BA 4W6IA 2EMDA 2OTBA 4PFEA 4Q7RA 3SSHA 3SS0A 2IB6A 1EMBA 4OHSA 1EMGA 2QLHA 5F9GA 4OY4A 4W7EA 3SV5A 3BXBA 3SSYA 3VICA 3SVNA 3DPXA 2BTJA 5DTLA 1YHIA 4EN1A 5DPJA 3U8AA 3P8UA 2G6YA 3PJBA 4B30A 4ORNA 4Q9XA 3SVCA 2V4EB 3GJ2A 3ED8A 2RH7A 3SRYA 4W6GA 2QRFA 2B3PA 4GESB 4W6UA 1JBYA 2H8QA 1XAEA 4DKNA 4KF5A 4GOBA 2VADA 2HJOA 5KTGA 3RWAA 3A8SA 4IK3A 2Z6YA 2H6VA 2PXWA 3I19A 3SSLA 4XL5A 4W6AA 1UISA 1KYSA 2HPWA 1B9CA 3DPZA 4DXNA 2EMOA 4KGFA 3GB3A 3DQIA 3E5WA 5EXCI 3ZULA 4IK1A 1EMCA 2O2BA 4IK5A 4IZNA 5DTXA 3BX9A 4L12A 2YE0A 5EB7A 4RYSA 2GX2A 5FVGA 3CD1A 3MGFA 3O78A 3EK8A 4LJCA 3SG3A 3LF4B 3TMRA 2WHSA 2QZ0A 1OXEA 2ZO7A 4XVPA 3ZTFA 4W6CA 3G9AA 4LQUA 4W76A 1CV7A 1Q4CA 4JGEA 5FVIA 2A46A 3DPWA 2IOVA 3DQMA 4W7CA 1ZGOA 3EKHA 3LF3A 1W7SA 1XA9A 5DQBA 2ARLA 2QT2A 4IK8A 5T3IA 4DXOA 2O24A 4W75A 4HQ9A 4U2VA 4ZB1A 3DQLA 3EK7A 3UG0A 4DXMA 3TMTA 1XMZA 2GW3A 1RRXA 2B3QA 1HCJA 1MOVA 3ST3A 3LVCA 4W7AA 1EMEA 3SVDA 4W6KA 3ZUJA 1YHGA 3PJ5A 2GW4B 2ZMUA 2AWMA 3VK1A 4EULA 5EJUA 2AWJA 2OKWA 3EVPA 3CFAA 3VHTB 3E5VA 2A48A 1H4UA 4L13A 4H48A 3LA1A 2Q57A 2VVHA 4IK9A 1RMPA 3OGOA 5DTYA 5DTZA 3CD9A 4ZF5A 2Z1OA 3GJ1A 3DQEA 3DQ8A 5H87A 2YDZA 4JC2A 1ZGPA 4H3LA 2WIQA 3ZUFA 5HZTA 3ST2A 4I2YA 4W6DA 3U0KA 3IR8A 4W73A 4ANJA 5DPHA 1RMMA 2AWKA 5DRFA 2HGYA 2Z6XA 1OXFA 4KGEA 5H88A 4W6NA 1RM9A 2POXA 1JC0A 3DQAA 3H1RA 5EXBA 3CFHA 1YFPA 3M24A 2VVIA 1MOUA 3V3DA 3DQCA 2A54B 2DUHA 3DQOA 4LJDC 2FZUA 3SSTA 2HQZA 1YZWA 1XQMA 3CGLA 4TZAA 5BTTA 3DQ6A 4NWSA 4KW9A 4W7RA 2QLGB 5DPGA 2VAEA 3DQ2A 1XSSA 1EMMA 4L1IA 4P76A 1Q4AA 2HQKA 2C9JA 3U8CA 2ZMWA 4Z4KA 4OJ0A 5HBDA 2Z6ZA 3SSKA 4EDSA 5EHUA 3SG5A 4HE4A 4KA9A 3NT9A 4Q7UA 1QYFA 3IP2A 4KF4A 4RTCA 2G16B 4N3DA 2Y0GA 3U0NA 3DQDA 2OKYA 2ZO6A 3NEZA 5BT0A 4JF9A 3AI5A 3EKJA 3DQFA 4XGYA 1Q73A 4KW8A 4Q9WA 1W7TA 4DKMA 4BDUA 2VVJA 3SVOA 3WLCA 3CB9A 3LSAA 1YJFA 2DD9A 3RWTA 4W69A 2G3DB 4AS8A 2WSNA 5HZOA 3SVBA 2WHUA 3W1CA 3KCTA 3BXAA 4UTSA 1KP5A 3U0LA 1JC1A 4W6SA 1QY3A 4KPIA 4J88A 3WLDA 3S05A 3SVSA 3SVUA 2DUIA 2V4EA 2A56B 4HQCA 3M22A 5HGEA 2IE2A 3SVEA 3GEXA 3SG4A 3P28A 4JRBA 1OXDA 4EDOA 3ST4A 2G6XA 3DQ9A 2YFPA 3WCKA 3OSQA 4Z4MA 3GL4A 3SSPA 2H5RA 2HRSA 2V4EC 4ZF4A 5HZSA 4HVFA 2WURA 4P1QA 5FVFA 3NF0A 2AHAA 2JADA 1KYRA 4GF6B 1GFLA 5EB6A 4AR7A 3CFFA 1ZGQA 4W74A 3AI4A 2A50B 5EBJA 1H6RA 1JBZA 2AH8A 5DU0A 5BQLA 4EMQA 3W1DA 3O77A 3H1OA 3BXCA 1GL4A 4KW4A 5EXUA 2Q6PA 1Q4DA 2HFCA 1EMKA 4W6TA 1F09A 2FWQA 1YJ2A 4LJDA 3EK4A 2H9WA 4LQTA 3DQ1A 4J89A 4TZGA 3EVUA 4H47A 3PJ7A 4ZF3A 3NEDA 5DQMA 3NT3A 2QLIA 3SSVA 4R6BA 4W6MA 4DXQA 2QLEA 4RYWA 2GX0A 2P4MA 2A47A 1KYPA 4LJBA 2C9IA 3U8PA 5LTRA 2VZXA 4W6RA 2IB5A 4DXPA 2QU1A 2FL1A 2DDDA 3ST0A 3DQNA 2OTEA 2YE1A 3UFZA 4PPJA 5DRGA 2DUEA 1G7KA 2HGDA 2DDCA 1F0BA 1S6ZA 1BFPA 3LS3A 5DY6A 1RMOA 2H5OA 2G5ZB 2EMNA 4KEXA 3ADFA 1HUYA 2DUFA 4PPLA 1Q4EA 3EVVA 4KF5C 4W7FA 1EMAA 5LTQA 2G3OA 4W7DA 4H3MA 4XOWA 2A53B 4OGSA 5LK4A 1Z1QA 2HCGA 5DPIA 3OSRA 3E5TA 5FHVA 2DD7A 2WISA 3DQ7A 3VHTA 4Q7TA 4B30B 4JFGA 3AKOA 4W6HA 4R6DA 3SVRA 1QYOA 1MYWA 2O29A 3CBEA 4W77A 3LVDA 1QYQA 4LW5A 4B5YA 4W6JA 4W6LA 4DXIA 2OGRA 4ZFSA 1EMFA 2WSOA 4PPKA 4J8AA 1W7UA 4XOVA 2PXSA 3SG7A 1GGXA 3SG6A 5BTTB 4W6PA 1Q4BA 2WHTA 4W72A 3DQKA 2H5PA 1Z1PA 3DQHA 4W6OA 3KCSA 4W7XA 3DQJA 1EMLA 3SG2A 4HQ8A 2AWLA 4H3NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DQU A;  2H5Q A;  4KAG A;  1ZUX A;  3DQ4 A;  4ZIN A;  3DQ3 A;  4ZBL A;  2DUG A;  4IK4 A;  4W6F A;  2G2S B;  3DQ5 A;  5LTP A;  3K1K A;  4JEO A;  1QXT A;  3PIB A;  5AQB B;  5HZU A;  3EVR A;  2OJK A;  2QLG A;  5H89 A;  3LVA A;  2G6E A;  4OQW A;  4ZIO A;  1YHH A;  5HW9 A;  3U0M A;  2A52 B;  2ICR A;  5J2O A;  1C4F A;  4W6B A;  4W6I A;  2EMD A;  2OTB A;  4PFE A;  4Q7R A;  3SSH A;  3SS0 A;  2IB6 A;  1EMB A;  4OHS A;  1EMG A;  2QLH A;  5F9G A;  4OY4 A;  4W7E A;  3SV5 A;  3BXB A;  3SSY A;  3VIC A;  3SVN A;  3DPX A;  2BTJ A;  5DTL A;  1YHI A;  4EN1 A;  5DPJ A;  3U8A A;  3P8U A;  2G6Y A;  3PJB A;  4B30 A;  4ORN A;  4Q9X A;  3SVC A;  2V4E B;  3GJ2 A;  3ED8 A;  2RH7 A;  3SRY A;  4W6G A;  2QRF A;  2B3P A;  4GES B;  4W6U A;  1JBY A;  2H8Q A;  1XAE A;  4DKN A;  4KF5 A;  4GOB A;  2VAD A;  2HJO A;  5KTG A;  3RWA A;  3A8S A;  4IK3 A;  2Z6Y A;  2H6V A;  2PXW A;  3I19 A;  3SSL A;  4XL5 A;  4W6A A;  1UIS A;  1KYS A;  2HPW A;  1B9C A;  3DPZ A;  4DXN A;  2EMO A;  4KGF A;  3GB3 A;  3DQI A;  3E5W A;  5EXC I;  3ZUL A;  4IK1 A;  1EMC A;  2O2B A;  4IK5 A;  4IZN A;  5DTX A;  3BX9 A;  4L12 A;  2YE0 A;  5EB7 A;  4RYS A;  2GX2 A;  5FVG A;  3CD1 A;  3MGF A;  3O78 A;  3EK8 A;  4LJC A;  3SG3 A;  3LF4 B;  3TMR A;  2WHS A;  2QZ0 A;  1OXE A;  2ZO7 A;  4XVP A;  3ZTF A;  4W6C A;  3G9A A;  4LQU A;  4W76 A;  1CV7 A;  1Q4C A;  4JGE A;  5FVI A;  2A46 A;  3DPW A;  2IOV A;  3DQM A;  4W7C A;  1ZGO A;  3EKH A;  3LF3 A;  1W7S A;  1XA9 A;  5DQB A;  2ARL A;  2QT2 A;  4IK8 A;  5T3I A;  4DXO A;  2O24 A;  4W75 A;  4HQ9 A;  4U2V A;  4ZB1 A;  3DQL A;  3EK7 A;  3UG0 A;  4DXM A;  3TMT A;  1XMZ A;  2GW3 A;  1RRX A;  2B3Q A;  1HCJ A;  1MOV A;  3ST3 A;  3LVC A;  4W7A A;  1EME A;  3SVD A;  4W6K A;  3ZUJ A;  1YHG A;  3PJ5 A;  2GW4 B;  2ZMU A;  2AWM A;  3VK1 A;  4EUL A;  5EJU A;  2AWJ A;  2OKW A;  3EVP A;  3CFA A;  3VHT B;  3E5V A;  2A48 A;  1H4U A;  4L13 A;  4H48 A;  3LA1 A;  2Q57 A;  2VVH A;  4IK9 A;  1RMP A;  3OGO A;  5DTY A;  5DTZ A;  3CD9 A;  4ZF5 A;  2Z1O A;  3GJ1 A;  3DQE A;  3DQ8 A;  5H87 A;  2YDZ A;  4JC2 A;  1ZGP A;  4H3L A;  2WIQ A;  3ZUF A;  5HZT A;  3ST2 A;  4I2Y A;  4W6D A;  3U0K A;  3IR8 A;  4W73 A;  4ANJ A;  5DPH A;  1RMM A;  2AWK A;  5DRF A;  2HGY A;  2Z6X A;  1OXF A;  4KGE A;  5H88 A;  4W6N A;  1RM9 A;  2POX A;  1JC0 A;  3DQA A;  3H1R A;  5EXB A;  3CFH A;  1YFP A;  3M24 A;  2VVI A;  1MOU A;  3V3D A;  3DQC A;  2A54 B;  2DUH A;  3DQO A;  4LJD C;  2FZU A;  3SST A;  2HQZ A;  1YZW A;  1XQM A;  3CGL A;  4TZA A;  5BTT A;  3DQ6 A;  4NWS A;  4KW9 A;  4W7R A;  2QLG B;  5DPG A;  2VAE A;  3DQ2 A;  1XSS A;  1EMM A;  4L1I A;  4P76 A;  1Q4A A;  2HQK A;  2C9J A;  3U8C A;  2ZMW A;  4Z4K A;  4OJ0 A;  5HBD A;  2Z6Z A;  3SSK A;  4EDS A;  5EHU A;  3SG5 A;  4HE4 A;  4KA9 A;  3NT9 A;  4Q7U A;  1QYF A;  3IP2 A;  4KF4 A;  4RTC A;  2G16 B;  4N3D A;  2Y0G A;  3U0N A;  3DQD A;  2OKY A;  2ZO6 A;  3NEZ A;  5BT0 A;  4JF9 A;  3AI5 A;  3EKJ A;  3DQF A;  4XGY A;  1Q73 A;  4KW8 A;  4Q9W A;  1W7T A;  4DKM A;  4BDU A;  2VVJ A;  3SVO A;  3WLC A;  3CB9 A;  3LSA A;  1YJF A;  2DD9 A;  3RWT A;  4W69 A;  2G3D B;  4AS8 A;  2WSN A;  5HZO A;  3SVB A;  2WHU A;  3W1C A;  3KCT A;  3BXA A;  4UTS A;  1KP5 A;  3U0L A;  1JC1 A;  4W6S A;  1QY3 A;  4KPI A;  4J88 A;  3WLD A;  3S05 A;  3SVS A;  3SVU A;  2DUI A;  2V4E A;  2A56 B;  4HQC A;  3M22 A;  5HGE A;  2IE2 A;  3SVE A;  3GEX A;  3SG4 A;  3P28 A;  4JRB A;  1OXD A;  4EDO A;  3ST4 A;  2G6X A;  3DQ9 A;  2YFP A;  3WCK A;  3OSQ A;  4Z4M A;  3GL4 A;  3SSP A;  2H5R A;  2HRS A;  2V4E C;  4ZF4 A;  5HZS A;  4HVF A;  2WUR A;  4P1Q A;  5FVF A;  3NF0 A;  2AHA A;  2JAD A;  1KYR A;  4GF6 B;  1GFL A;  5EB6 A;  4AR7 A;  3CFF A;  1ZGQ A;  4W74 A;  3AI4 A;  2A50 B;  5EBJ A;  1H6R A;  1JBZ A;  2AH8 A;  5DU0 A;  5BQL A;  4EMQ A;  3W1D A;  3O77 A;  3H1O A;  3BXC A;  1GL4 A;  4KW4 A;  5EXU A;  2Q6P A;  1Q4D A;  2HFC A;  1EMK A;  4W6T A;  1F09 A;  2FWQ A;  1YJ2 A;  4LJD A;  3EK4 A;  2H9W A;  4LQT A;  3DQ1 A;  4J89 A;  4TZG A;  3EVU A;  4H47 A;  3PJ7 A;  4ZF3 A;  3NED A;  5DQM A;  3NT3 A;  2QLI A;  3SSV A;  4R6B A;  4W6M A;  4DXQ A;  2QLE A;  4RYW A;  2GX0 A;  2P4M A;  2A47 A;  1KYP A;  4LJB A;  2C9I A;  3U8P A;  5LTR A;  2VZX A;  4W6R A;  2IB5 A;  4DXP A;  2QU1 A;  2FL1 A;  2DDD A;  3ST0 A;  3DQN A;  2OTE A;  2YE1 A;  3UFZ A;  4PPJ A;  5DRG A;  2DUE A;  1G7K A;  2HGD A;  2DDC A;  1F0B A;  1S6Z A;  1BFP A;  3LS3 A;  5DY6 A;  1RMO A;  2H5O A;  2G5Z B;  2EMN A;  4KEX A;  3ADF A;  1HUY A;  2DUF A;  4PPL A;  1Q4E A;  3EVV A;  4KF5 C;  4W7F A;  1EMA A;  5LTQ A;  2G3O A;  4W7D A;  4H3M A;  4XOW A;  2A53 B;  4OGS A;  5LK4 A;  1Z1Q A;  2HCG A;  5DPI A;  3OSR A;  3E5T A;  5FHV A;  2DD7 A;  2WIS A;  3DQ7 A;  3VHT A;  4Q7T A;  4B30 B;  4JFG A;  3AKO A;  4W6H A;  4R6D A;  3SVR A;  1QYO A;  1MYW A;  2O29 A;  3CBE A;  4W77 A;  3LVD A;  1QYQ A;  4LW5 A;  4B5Y A;  4W6J A;  4W6L A;  4DXI A;  2OGR A;  4ZFS A;  1EMF A;  2WSO A;  4PPK A;  4J8A A;  1W7U A;  4XOV A;  2PXS A;  3SG7 A;  1GGX A;  3SG6 A;  5BTT B;  4W6P A;  1Q4B A;  2WHT A;  4W72 A;  3DQK A;  2H5P A;  1Z1P A;  3DQH A;  4W6O A;  3KCS A;  4W7X A;  3DQJ A;  1EML A;  3SG2 A;  4HQ8 A;  2AWL A;  4H3N A; 
#chains in the Genus database with same CATH topology
 3DQU A;  2H5Q A;  4KAG A;  1ZUX A;  3DQ4 A;  4ZIN A;  3DQ3 A;  4ZBL A;  2DUG A;  4IK4 A;  4W6F A;  2G2S B;  3DQ5 A;  5LTP A;  3K1K A;  4JEO A;  1QXT A;  3PIB A;  5AQB B;  5HZU A;  3EVR A;  2OJK A;  2QLG A;  5H89 A;  3LVA A;  2G6E A;  4OQW A;  4ZIO A;  1YHH A;  5HW9 A;  3U0M A;  2A52 B;  2ICR A;  5J2O A;  1C4F A;  4W6B A;  4W6I A;  2EMD A;  2OTB A;  4PFE A;  4Q7R A;  3SSH A;  3SS0 A;  2IB6 A;  1EMB A;  4OHS A;  1EMG A;  2QLH A;  5F9G A;  4OY4 A;  4W7E A;  3SV5 A;  3BXB A;  3SSY A;  3VIC A;  3SVN A;  3DPX A;  2BTJ A;  5DTL A;  1YHI A;  4EN1 A;  5DPJ A;  3U8A A;  3P8U A;  2G6Y A;  3PJB A;  4B30 A;  4ORN A;  4Q9X A;  3SVC A;  2V4E B;  3GJ2 A;  3ED8 A;  2RH7 A;  3SRY A;  4W6G A;  2QRF A;  2B3P A;  4GES B;  4W6U A;  1JBY A;  2H8Q A;  1XAE A;  4DKN A;  4KF5 A;  4GOB A;  2VAD A;  2HJO A;  5KTG A;  3RWA A;  3A8S A;  4IK3 A;  2Z6Y A;  2H6V A;  2PXW A;  3I19 A;  3SSL A;  4XL5 A;  4W6A A;  1UIS A;  1KYS A;  2HPW A;  1B9C A;  3DPZ A;  4DXN A;  2EMO A;  4KGF A;  3GB3 A;  3DQI A;  3E5W A;  5EXC I;  3ZUL A;  4IK1 A;  1EMC A;  2O2B A;  4IK5 A;  4IZN A;  5DTX A;  3BX9 A;  4L12 A;  2YE0 A;  5EB7 A;  4RYS A;  2GX2 A;  5FVG A;  3CD1 A;  3MGF A;  3O78 A;  3EK8 A;  4LJC A;  3SG3 A;  3LF4 B;  3TMR A;  2WHS A;  2QZ0 A;  1OXE A;  2ZO7 A;  4XVP A;  3ZTF A;  4W6C A;  3G9A A;  4LQU A;  4W76 A;  1CV7 A;  1Q4C A;  4JGE A;  5FVI A;  2A46 A;  3DPW A;  2IOV A;  3DQM A;  4W7C A;  1ZGO A;  3EKH A;  3LF3 A;  1W7S A;  1XA9 A;  5DQB A;  2ARL A;  2QT2 A;  4IK8 A;  5T3I A;  4DXO A;  2O24 A;  4W75 A;  4HQ9 A;  4U2V A;  4ZB1 A;  3DQL A;  3EK7 A;  3UG0 A;  4DXM A;  3TMT A;  1XMZ A;  2GW3 A;  1RRX A;  2B3Q A;  1HCJ A;  1MOV A;  3ST3 A;  3LVC A;  4W7A A;  1EME A;  3SVD A;  4W6K A;  3ZUJ A;  1YHG A;  3PJ5 A;  2GW4 B;  2ZMU A;  2AWM A;  3VK1 A;  4EUL A;  5EJU A;  2AWJ A;  2OKW A;  3EVP A;  3CFA A;  3VHT B;  3E5V A;  2A48 A;  1H4U A;  4L13 A;  4H48 A;  3LA1 A;  2Q57 A;  2VVH A;  4IK9 A;  1RMP A;  3OGO A;  5DTY A;  5DTZ A;  3CD9 A;  4ZF5 A;  2Z1O A;  3GJ1 A;  3DQE A;  3DQ8 A;  5H87 A;  2YDZ A;  4JC2 A;  1ZGP A;  4H3L A;  2WIQ A;  3ZUF A;  5HZT A;  3ST2 A;  4I2Y A;  4W6D A;  3U0K A;  3IR8 A;  4W73 A;  4ANJ A;  5DPH A;  1RMM A;  2AWK A;  5DRF A;  2HGY A;  2Z6X A;  1OXF A;  4KGE A;  5H88 A;  4W6N A;  1RM9 A;  2POX A;  1JC0 A;  3DQA A;  3H1R A;  5EXB A;  3CFH A;  1YFP A;  3M24 A;  2VVI A;  1MOU A;  3V3D A;  3DQC A;  2A54 B;  2DUH A;  3DQO A;  4LJD C;  2FZU A;  3SST A;  2HQZ A;  1YZW A;  1XQM A;  3CGL A;  4TZA A;  5BTT A;  3DQ6 A;  4NWS A;  4KW9 A;  4W7R A;  2QLG B;  5DPG A;  2VAE A;  3DQ2 A;  1XSS A;  1EMM A;  4L1I A;  4P76 A;  1Q4A A;  2HQK A;  2C9J A;  3U8C A;  2ZMW A;  4Z4K A;  4OJ0 A;  5HBD A;  2Z6Z A;  3SSK A;  4EDS A;  5EHU A;  3SG5 A;  4HE4 A;  4KA9 A;  3NT9 A;  4Q7U A;  1QYF A;  3IP2 A;  4KF4 A;  4RTC A;  2G16 B;  4N3D A;  2Y0G A;  3U0N A;  3DQD A;  2OKY A;  2ZO6 A;  3NEZ A;  5BT0 A;  4JF9 A;  3AI5 A;  3EKJ A;  3DQF A;  4XGY A;  1Q73 A;  4KW8 A;  4Q9W A;  1W7T A;  4DKM A;  4BDU A;  2VVJ A;  3SVO A;  3WLC A;  3CB9 A;  3LSA A;  1YJF A;  2DD9 A;  3RWT A;  4W69 A;  2G3D B;  4AS8 A;  2WSN A;  5HZO A;  3SVB A;  2WHU A;  3W1C A;  3KCT A;  3BXA A;  4UTS A;  1KP5 A;  3U0L A;  1JC1 A;  4W6S A;  1QY3 A;  4KPI A;  4J88 A;  3WLD A;  3S05 A;  3SVS A;  3SVU A;  2DUI A;  2V4E A;  2A56 B;  4HQC A;  3M22 A;  5HGE A;  2IE2 A;  3SVE A;  3GEX A;  3SG4 A;  3P28 A;  4JRB A;  1OXD A;  4EDO A;  3ST4 A;  2G6X A;  3DQ9 A;  2YFP A;  3WCK A;  3OSQ A;  4Z4M A;  3GL4 A;  3SSP A;  2H5R A;  2HRS A;  2V4E C;  4ZF4 A;  5HZS A;  4HVF A;  2WUR A;  4P1Q A;  5FVF A;  3NF0 A;  2AHA A;  2JAD A;  1KYR A;  4GF6 B;  1GFL A;  5EB6 A;  4AR7 A;  3CFF A;  1ZGQ A;  4W74 A;  3AI4 A;  2A50 B;  5EBJ A;  1H6R A;  1JBZ A;  2AH8 A;  5DU0 A;  5BQL A;  4EMQ A;  3W1D A;  3O77 A;  3H1O A;  3BXC A;  1GL4 A;  4KW4 A;  5EXU A;  2Q6P A;  1Q4D A;  2HFC A;  1EMK A;  4W6T A;  1F09 A;  2FWQ A;  1YJ2 A;  4LJD A;  3EK4 A;  2H9W A;  4LQT A;  3DQ1 A;  4J89 A;  4TZG A;  3EVU A;  4H47 A;  3PJ7 A;  4ZF3 A;  3NED A;  5DQM A;  3NT3 A;  2QLI A;  3SSV A;  4R6B A;  4W6M A;  4DXQ A;  2QLE A;  4RYW A;  2GX0 A;  2P4M A;  2A47 A;  1KYP A;  4LJB A;  2C9I A;  3U8P A;  5LTR A;  2VZX A;  4W6R A;  2IB5 A;  4DXP A;  2QU1 A;  2FL1 A;  2DDD A;  3ST0 A;  3DQN A;  2OTE A;  2YE1 A;  3UFZ A;  4PPJ A;  5DRG A;  2DUE A;  1G7K A;  2HGD A;  2DDC A;  1F0B A;  1S6Z A;  1BFP A;  3LS3 A;  5DY6 A;  1RMO A;  2H5O A;  2G5Z B;  2EMN A;  4KEX A;  3ADF A;  1HUY A;  2DUF A;  4PPL A;  1Q4E A;  3EVV A;  4KF5 C;  4W7F A;  1EMA A;  5LTQ A;  2G3O A;  4W7D A;  4H3M A;  4XOW A;  2A53 B;  4OGS A;  5LK4 A;  1Z1Q A;  2HCG A;  5DPI A;  3OSR A;  3E5T A;  5FHV A;  2DD7 A;  2WIS A;  3DQ7 A;  3VHT A;  4Q7T A;  4B30 B;  4JFG A;  3AKO A;  4W6H A;  4R6D A;  3SVR A;  1QYO A;  1MYW A;  2O29 A;  3CBE A;  4W77 A;  3LVD A;  1QYQ A;  4LW5 A;  4B5Y A;  4W6J A;  4W6L A;  4DXI A;  2OGR A;  4ZFS A;  1EMF A;  2WSO A;  4PPK A;  4J8A A;  1W7U A;  4XOV A;  2PXS A;  3SG7 A;  1GGX A;  3SG6 A;  5BTT B;  4W6P A;  1Q4B A;  2WHT A;  4W72 A;  3DQK A;  2H5P A;  1Z1P A;  3DQH A;  4W6O A;  3KCS A;  4W7X A;  3DQJ A;  1EML A;  3SG2 A;  4HQ8 A;  2AWL A;  4H3N A; 
#chains in the Genus database with same CATH homology
 3DQU A;  2H5Q A;  4KAG A;  1ZUX A;  3DQ4 A;  4ZIN A;  3DQ3 A;  4ZBL A;  2DUG A;  4IK4 A;  4W6F A;  2G2S B;  3DQ5 A;  5LTP A;  3K1K A;  4JEO A;  1QXT A;  3PIB A;  5AQB B;  5HZU A;  3EVR A;  2OJK A;  2QLG A;  5H89 A;  3LVA A;  2G6E A;  4OQW A;  4ZIO A;  1YHH A;  5HW9 A;  3U0M A;  2A52 B;  2ICR A;  5J2O A;  1C4F A;  4W6B A;  4W6I A;  2EMD A;  2OTB A;  4PFE A;  4Q7R A;  3SSH A;  3SS0 A;  2IB6 A;  1EMB A;  4OHS A;  1EMG A;  2QLH A;  5F9G A;  4OY4 A;  4W7E A;  3SV5 A;  3BXB A;  3SSY A;  3VIC A;  3SVN A;  3DPX A;  2BTJ A;  5DTL A;  1YHI A;  4EN1 A;  5DPJ A;  3U8A A;  3P8U A;  2G6Y A;  3PJB A;  4B30 A;  4ORN A;  4Q9X A;  3SVC A;  2V4E B;  3GJ2 A;  3ED8 A;  2RH7 A;  3SRY A;  4W6G A;  2QRF A;  2B3P A;  4GES B;  4W6U A;  1JBY A;  2H8Q A;  1XAE A;  4DKN A;  4KF5 A;  4GOB A;  2VAD A;  2HJO A;  5KTG A;  3RWA A;  3A8S A;  4IK3 A;  2Z6Y A;  2H6V A;  2PXW A;  3I19 A;  3SSL A;  4XL5 A;  4W6A A;  1UIS A;  1KYS A;  2HPW A;  1B9C A;  3DPZ A;  4DXN A;  2EMO A;  4KGF A;  3GB3 A;  3DQI A;  3E5W A;  5EXC I;  3ZUL A;  4IK1 A;  1EMC A;  2O2B A;  4IK5 A;  4IZN A;  5DTX A;  3BX9 A;  4L12 A;  2YE0 A;  5EB7 A;  4RYS A;  2GX2 A;  5FVG A;  3CD1 A;  3MGF A;  3O78 A;  3EK8 A;  4LJC A;  3SG3 A;  3LF4 B;  3TMR A;  2WHS A;  2QZ0 A;  1OXE A;  2ZO7 A;  4XVP A;  3ZTF A;  4W6C A;  3G9A A;  4LQU A;  4W76 A;  1CV7 A;  1Q4C A;  4JGE A;  5FVI A;  2A46 A;  3DPW A;  2IOV A;  3DQM A;  4W7C A;  1ZGO A;  3EKH A;  3LF3 A;  1W7S A;  1XA9 A;  5DQB A;  2ARL A;  2QT2 A;  4IK8 A;  5T3I A;  4DXO A;  2O24 A;  4W75 A;  4HQ9 A;  4U2V A;  4ZB1 A;  3DQL A;  3EK7 A;  3UG0 A;  4DXM A;  3TMT A;  1XMZ A;  2GW3 A;  1RRX A;  2B3Q A;  1HCJ A;  1MOV A;  3ST3 A;  3LVC A;  4W7A A;  1EME A;  3SVD A;  4W6K A;  3ZUJ A;  1YHG A;  3PJ5 A;  2GW4 B;  2ZMU A;  2AWM A;  3VK1 A;  4EUL A;  5EJU A;  2AWJ A;  2OKW A;  3EVP A;  3CFA A;  3VHT B;  3E5V A;  2A48 A;  1H4U A;  4L13 A;  4H48 A;  3LA1 A;  2Q57 A;  2VVH A;  4IK9 A;  1RMP A;  3OGO A;  5DTY A;  5DTZ A;  3CD9 A;  4ZF5 A;  2Z1O A;  3GJ1 A;  3DQE A;  3DQ8 A;  5H87 A;  2YDZ A;  4JC2 A;  1ZGP A;  4H3L A;  2WIQ A;  3ZUF A;  5HZT A;  3ST2 A;  4I2Y A;  4W6D A;  3U0K A;  3IR8 A;  4W73 A;  4ANJ A;  5DPH A;  1RMM A;  2AWK A;  5DRF A;  2HGY A;  2Z6X A;  1OXF A;  4KGE A;  5H88 A;  4W6N A;  1RM9 A;  2POX A;  1JC0 A;  3DQA A;  3H1R A;  5EXB A;  3CFH A;  1YFP A;  3M24 A;  2VVI A;  1MOU A;  3V3D A;  3DQC A;  2A54 B;  2DUH A;  3DQO A;  4LJD C;  2FZU A;  3SST A;  2HQZ A;  1YZW A;  1XQM A;  3CGL A;  4TZA A;  5BTT A;  3DQ6 A;  4NWS A;  4KW9 A;  4W7R A;  2QLG B;  5DPG A;  2VAE A;  3DQ2 A;  1XSS A;  1EMM A;  4L1I A;  4P76 A;  1Q4A A;  2HQK A;  2C9J A;  3U8C A;  2ZMW A;  4Z4K A;  4OJ0 A;  5HBD A;  2Z6Z A;  3SSK A;  4EDS A;  5EHU A;  3SG5 A;  4HE4 A;  4KA9 A;  3NT9 A;  4Q7U A;  1QYF A;  3IP2 A;  4KF4 A;  4RTC A;  2G16 B;  4N3D A;  2Y0G A;  3U0N A;  3DQD A;  2OKY A;  2ZO6 A;  3NEZ A;  5BT0 A;  4JF9 A;  3AI5 A;  3EKJ A;  3DQF A;  4XGY A;  1Q73 A;  4KW8 A;  4Q9W A;  1W7T A;  4DKM A;  4BDU A;  2VVJ A;  3SVO A;  3WLC A;  3CB9 A;  3LSA A;  1YJF A;  2DD9 A;  3RWT A;  4W69 A;  2G3D B;  4AS8 A;  2WSN A;  5HZO A;  3SVB A;  2WHU A;  3W1C A;  3KCT A;  3BXA A;  4UTS A;  1KP5 A;  3U0L A;  1JC1 A;  4W6S A;  1QY3 A;  4KPI A;  4J88 A;  3WLD A;  3S05 A;  3SVS A;  3SVU A;  2DUI A;  2V4E A;  2A56 B;  4HQC A;  3M22 A;  5HGE A;  2IE2 A;  3SVE A;  3GEX A;  3SG4 A;  3P28 A;  4JRB A;  1OXD A;  4EDO A;  3ST4 A;  2G6X A;  3DQ9 A;  2YFP A;  3WCK A;  3OSQ A;  4Z4M A;  3GL4 A;  3SSP A;  2H5R A;  2HRS A;  2V4E C;  4ZF4 A;  5HZS A;  4HVF A;  2WUR A;  4P1Q A;  5FVF A;  3NF0 A;  2AHA A;  2JAD A;  1KYR A;  4GF6 B;  1GFL A;  5EB6 A;  4AR7 A;  3CFF A;  1ZGQ A;  4W74 A;  3AI4 A;  2A50 B;  5EBJ A;  1H6R A;  1JBZ A;  2AH8 A;  5DU0 A;  5BQL A;  4EMQ A;  3W1D A;  3O77 A;  3H1O A;  3BXC A;  1GL4 A;  4KW4 A;  5EXU A;  2Q6P A;  1Q4D A;  2HFC A;  1EMK A;  4W6T A;  1F09 A;  2FWQ A;  1YJ2 A;  4LJD A;  3EK4 A;  2H9W A;  4LQT A;  3DQ1 A;  4J89 A;  4TZG A;  3EVU A;  4H47 A;  3PJ7 A;  4ZF3 A;  3NED A;  5DQM A;  3NT3 A;  2QLI A;  3SSV A;  4R6B A;  4W6M A;  4DXQ A;  2QLE A;  4RYW A;  2GX0 A;  2P4M A;  2A47 A;  1KYP A;  4LJB A;  2C9I A;  3U8P A;  5LTR A;  2VZX A;  4W6R A;  2IB5 A;  4DXP A;  2QU1 A;  2FL1 A;  2DDD A;  3ST0 A;  3DQN A;  2OTE A;  2YE1 A;  3UFZ A;  4PPJ A;  5DRG A;  2DUE A;  1G7K A;  2HGD A;  2DDC A;  1F0B A;  1S6Z A;  1BFP A;  3LS3 A;  5DY6 A;  1RMO A;  2H5O A;  2G5Z B;  2EMN A;  4KEX A;  3ADF A;  1HUY A;  2DUF A;  4PPL A;  1Q4E A;  3EVV A;  4KF5 C;  4W7F A;  1EMA A;  5LTQ A;  2G3O A;  4W7D A;  4H3M A;  4XOW A;  2A53 B;  4OGS A;  5LK4 A;  1Z1Q A;  2HCG A;  5DPI A;  3OSR A;  3E5T A;  5FHV A;  2DD7 A;  2WIS A;  3DQ7 A;  3VHT A;  4Q7T A;  4B30 B;  4JFG A;  3AKO A;  4W6H A;  4R6D A;  3SVR A;  1QYO A;  1MYW A;  2O29 A;  3CBE A;  4W77 A;  3LVD A;  1QYQ A;  4LW5 A;  4B5Y A;  4W6J A;  4W6L A;  4DXI A;  2OGR A;  4ZFS A;  1EMF A;  2WSO A;  4PPK A;  4J8A A;  1W7U A;  4XOV A;  2PXS A;  3SG7 A;  1GGX A;  3SG6 A;  5BTT B;  4W6P A;  1Q4B A;  2WHT A;  4W72 A;  3DQK A;  2H5P A;  1Z1P A;  3DQH A;  4W6O A;  3KCS A;  4W7X A;  3DQJ A;  1EML A;  3SG2 A;  4HQ8 A;  2AWL A;  4H3N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...