4DXWA

Crystal structure of navrh, a voltage-gated sodium channel
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
227
structure length
210
Chain Sequence
TPFFSSLKDNRIFQFTVVSIIILNAVLIGATTYELDPLFLETIHLLDYGITIFFVIEILIRFIGSGWNIFDTVIVAISLIPVLRLLRIFRVLRLISVIPELKQIIEAILESVRRVFFVSLLLFIILYIYATMGAILFGNDDPSRWGDLGISLITLFQVLTLSSWETVMLPMQEIYWWSWVYFFSFIIICSITILNLVIAILVDVVIQKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ion transport protein
publication title Crystal structure of an orthologue of the NaChBac voltage-gated sodium channel
pubmed doi rcsb
source organism Alpha proteobacterium himb114
molecule tags Transport protein
total genus 79
structure length 210
sequence length 227
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00520 Ion_trans Ion transport protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4dxwA02
1.20.120.350 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Voltage-gated potassium channels. Chain C 4dxwA01
3SPHA 4R7CA 3KG2A 5J9PC 4WFHA 2HVJC 4OXSA 3SPJA 3X2QC 5BZBA 5IY5C 4GX0A 1OCOC 2EIJC 4P2ZA 4J9ZB 3E8HA 4P9PA 5EBLC 5E1AC 4LCUC 2WLJA 3AG2C 1ZWIC 2ATKC 4MTGA 4RAIA 2QKSA 5B3SC 3F7YC 3UM7A 4RUFA 2BOCC 4WFEA 4MVUA 2WLNA 3F5WC 3TCUA 3FB6C 4PDVA 4X8AA 3LNMB 3SYAA 5EC2C 3OR7C 3SYCA 2JK5C 4MSWC 4PA9A 3ASNC 2BOBC 4R50A 2W0FC 3ABMC 4PDLA 4ZBMA 2WLIA 3SYPA 2H8PC 3SPIA 3ZJZA 4MTOA 2ZXWC 2HJFC 2EIKC 3UKMA 4MW8A 4RO2A 2DWDC 4H33A 5B1AC 1V54C 5KUMA 4I9WA 3STLC 1BL8A 2WLKA 2X6CA 2HG5C 3EFFK 3LDDA 2WLMA 3RVZA 3AG3C 3E89A 5EK0A 5CBFA 2R9RB 3K08A 3K0GA 1ORQC 4JTDB 5B1BC 3PJSK 2AHYA 4LBEC 4PA4A 4G28B 2HVKC 2Q68A 4MVMA 1K4CC 1R3KC 2IH1C 4GX1A 3RBZA 2DWEC 3ABLC 3T1CA 4GX5A 3F7VC 3SPGA 3K06A 2HFEC 2WLHA 1OCZC 5CBHA 3STZC 4F4LA 4GX2A 4JTCB 4PDRA 1P7BA 1QLEC 2WLLA 2A79B 2ZD9A 2K1EA 1XL4A 1S5HC 3AG4C 4PA6A 1XL6A 4LP8A 3FB8C 4PA7A 4RUEA 2EIMC 4WFFA 3T4ZA 4CBCA 3HPLC 3IFXA 3RW0A 1V55C 1G4YB 3WG7C 3R65A 3ZRSA 1JVMA 4TWKA 1M56C 3T4DA 3LDCA 2NLJC 4MVQA 3E8BA 1R3IC 3LUTB 2Q6AA 3FB7C 2IH3C 3K03A 3SYQA 1K4DC 4MTFA 3SPCA 4J9YB 3TETA 2YEVA 2A9HA 2ITCC 4G27B 2EILC 2ITDC 1R3LC 4X89A 4XDJA 3T2MA 4UUJC 1LNQA 5EBMC 3OUSA 4P30A 4MVSA 2WLIB 4JTAB 3BEHA 3GB7C 4KFMA 3SJQC 4XDKA 4MVZA 2P7TC 3ASOC 4R6ZA 4QE7A 2Y69C 4WFGA 3RVYA 4DXWA 5KUKA 2KB1A 3OUFA 4HZ3A 3OR6C 3E86A 3SYOA 4MVRA 3IGAC 1ORSC 2QTOA 2DYRC 3LDEA 1OCRC 4X88A 3JYCA 4PA3A 4R8CA 4BW5A 4PDMA 5CBGA 4MW3A 4H37A 3E8GA 2A0LA 3AG1C 3E8FA 4QE9A 5EC1C 3K0DA 3ABKC 2Q69A 4QNHB 4EKWA 3FB5C 4XDLA 5EBWC 4P9OA 2Q67A 2EINC 3E83A 1J95A 4HYOA 1OCCC 2X6BA 3OGCC 4MS2A 2DYSC 3VOUA 2KYHA 1M57C 2OCCC 2X6AA 3K04A 2WLLB 4MVOA 1KKDA 2AHZA 1R3JC
chains in the Genus database with same CATH superfamily
1FJGO 2A69F 1SQQH 2ZXOA 3NYJA 3CCUV 1XMOB 2CTWA 3APQA 1S3JA 3IAYA 5KYWB 4DR1B 1APCA 1JJ2U 4NR1A 4U3JA 2CUGA 3ZC4A 4LF5O 4JI3B 5K1XA 1WNSA 4MSWC 3H2VA 4U5CE 3SXMA 1K05A 2JEXA 3W7XA 4LH6A 1G4WR 3FAJA 1SQFA 1RM1B 4X1IB 4GZRB 4H33A 3V5XA 1TKNA 3OMAB 3SXYA 2ZR3A 1LE4A 1I7FA 3RKOF 1Y76A 2TMVP 1ZHXA 1YHQV 2OKUA 3RF3A 3QMKA 1GN3A 3C62A 4ZOLB 2J7PD 1X4TA 5DN6G 1ORQC 2J45A 1JFFB 3LS0A 1K34A 1U89A 4LNUB 2Z5UA 2CGNA 2DQ3A 3QO7A 2CYDA 3U2MA 3RBZA 1VEWA 1JMWA 1TWHA 4XEFA 1B3QA 3ZVRA 2W6IG 1NT2B 4G7HF 4DR6B 2LCHA 4JEBA 2A0BA 2R7XA 4O4JB 1YEWA 3NXSA 4GX2A 2PF4E 4O4HB 2YHSA 1GQAA 2EZPA 4JRZA 1Q3EA 1XL4A 3ZWIA 2CH7B 3CYOA 1NU1H 4ANJA 3IFXA 4CJOA 3GM3A 5L0CA 4HEAJ 2N74A 4MVQA 3E8BA 4TV9B 3QW1A 4YWQA 3F5TA 1M4UA 1N36B 1TR2A 1JX9A 1IBLB 3JAMN 1VYIA 3AGTA 3NKEA 5A2QN 5EBMC 4P30A 4FFBA 4CDAA 3SDLA 4B3RB 4PJ0Z 2ZDIC 2ZNJA 1VOMA 2F22A 4R32A 3W2WA 1GO3F 1XQ8A 3G50A 1G1XB 1CPYA 2CTQA 4X65O 3IGAC 2HLDG 2HJ3A 1QVFU 4UV8A 5EZYA 3L73H 2HJMA 1BE3H 3EFOB 1W59A 2Y0PA 4AE4B 4MW3A 4EFBA 3BRJA 2FL4A 3I5DA 5JQGA 5EC1C 4DUZB 1S5JA 5DS4A 2Q67A 1TWGA 2XLVA 4ICGA 3G6EV 2OJQA 1Q0KA 1TWAA 1RSOA 1FTSA 2PYLA 1QR8A 3AG1B 4PACA 1MA1A 3TGUH 1OCOC 1M1KW 3CC7V 2W4MA 1WB7A 1NR1A 1MOFA 3K5OA 4DK1A 4FPPA 5B3SB 4KUMA 3IJ4A 4MVUA 1NH2D 3JALA 3TCUA 3FB6C 3X2QB 3LNMB 2XT9A 1GM7A 1N33O 1K33A 3JSZA 2LW1A 1HNZB 3D3IA 3C7JA 3CAXA 4AHCA 5JVDA 3MHSC 2L6FA 1KD1W 2HJFC 3TQOA 2VWKA 1UG7A 2QEXV 3DXRA 4DR5B 4LF7O 3RYFA 1BHAA 3KKYA 3JD0A 2QR4A 4DUYB 2UUAB 4O2AA 3W4YA 4CS9C 2AHYA 4LBEC 4U3FH 4H44B 2O9XA 3CRRA 5D91A 1G8XA 2N04A 5HSWA 4K35A 2OIEA 4B3SO 1MQVA 2A68F 1H38A 4F4LA 1E1RG 1D0YA 3RQEA 2R7VA 4DV0B 5DECA 3L1MA 1N34O 1M56C 4CSAC 1W0JG 2XL4A 3E70C 3SPCA 2LP7A 1TFOB 2F4VB 4AILC 5COFA 4CH6A 2EPMX 1IBMB 3HB3B 3U11A 5EYPA 1LNQA 3CMAV 2OT5A 2QM4A 4LFAB 1D0XA 3ZBHA 3S29A 4KFMA 4CZZA 3M8AA 4TQFA 3ZHRA 4FM0A 1GN6A 4CJGA 4KHPB 1EN4A 2KB1A 2YRFA 2XASA 5JH7A 1Q0DA 4G0HA 2QWRB 5KX5B 3K1IA 1YVWA 3VM6A 2YUAA 4MTXA 3LDEA 3N2GA 1SR2A 4DRXB 1GH6A 3H65A 3PMRA 2WVOA 3M79A 4KC9A 3E8GA 4YJ3A 1B04A 4YT5A 1J95A 1NBMG 4J42A 3WB0A 4AL0A 1EA8A 1OCRB 4CS9A 3CSXA 4I50A 3SPHA 1HNWO 2XM0A 3RIPA 5J2TB 1NZ6A 2YIBA 3A9CA 1W0KG 5CA1B 2YLDA 1Q43A 2NR5A 2QDOA 5EBLC 4E2LA 4LCUC 1R1BA 1VARA 3F47A 2C04A 2YL3A 4DV5B 1KBHA 1DOWA 1SYQA 1SZIA 1T01A 4X66O 4O4LA 3OEEG 4NYKA 2YLGA 3MX3A 3TJ5A 3OR7C 4ZHQB 4HBNA 4Z2WA 1O87A 4YN0B 1Z5WA 5A9GA 1YTFD 4CSAA 4JI1B 3C8GB 4X20B 4K7BA 2ZXWC 3TK0A 2EIKC 3B2EE 1QCEA 3MFNA 1PNKA 2ADQB 2NN4A 2ZE7A 4JZGA 3U0ZA 1LPEA 3IQTA 1ZX3A 1WN7A 2AWYA 3STLC 4BJ6C 1NVPD 1R73A 2EPOA 4U5EE 3K08A 4CS8C 2IW5A 5KLVH 4BPMA 3K58A 2UU9B 5JT4A 2QE7G 5BQIA 2IH1C 1MMMA 1GS9A 2P0NA 3EG9B 2RSEB 1OCOB 4JC7A 3AG3B 3T9OA 4PDRA 3FXHA 4UVCA 3V5YA 3M99B 2R7RA 3H9VA 5IJ0B 3AK1A 3QO5A 3C3SA 2P90A 3LUTB 5JS5A 4JYAO 1GRJA 1QU7A 3U0CA 2UXCO 2KK1A 2ZM6B 5FNVA 2PX0A 2YI9A 3TJ6A 4EHPA 1VP7A 4NTFA 3SYNA 4MVSA 1MZEA 1YZAA 4U7OA 1YI2V 2JS3A 3H1LH 4MVZA 5A6AA 3RVYA 3OAAG 5LOVB 4JYYA 3U2LA 4I0XA 4YIPA 2DN9A 4O2BB 2FTKA 4MVRA 3SYOA 3CEIA 1XHXA 2J0WA 4RD9A 1Q0FA 1JRAA 2JJ2G 4JAUA 1LIHA 1AEPA 1GN2A 3MBGA 2MHRA 4BJ6A 1ZHWA 4QNHB 5JJJB 4EKWA 2PZSA 5L3DA 2ZT9B 2ZE6A 4CS8A 1IXBA 3OGCC 5J2UB 2DYSC 4DV1O 2ZKOA 4P9PA 3KG2A 4JI7O 5KMGB 3JCUZ 1I4YA 1WASA 3I56V 3TULA 3CPWU 4I1MA 5JVEA 1NBBA 3HKBB 3NYMA 2QWOB 3B9QA 4JW1A 5JP7A 1QR9A 1M57B 3K5LA 4WFEA 4I44A 4LF8O 4FZ1A 3ECSA 4I4TB 4KI2A 4UB8Z 5FPRA 3M1CB 2LFFA 3ASNC 1PPJH 1EI7A 3D8CA 4XLNF 4ZBMA 3DWWA 1H2NA 3EVKA 2QKCA 2EULA 3UKMA 2RCVA 3ZN1A 1J5EO 1MMGA 3CRQA 1XBLA 1W2BU 1V54C 2F93B 1H8EG 1AR1B 3B77A 4I9WA 1Z63A 3CXCU 1K8AW 4U5FE 4I5SA 5CN0A 3LDDA 3N27A 4JI6B 1AJQA 4JTDB 1Z23A 1RJ9A 3IQ6A 1TGOA 1PD0A 2Q68A 5B1AB 3T4RA 4CIPA 5AC5A 4IL6Z 3JASB 1TWCA 3SGIA 2UXDO 1X59A 4JI5O 3AG7A 3FAVB 1DF4A 1R6KA 2AZ2A 1JJOA 5E33A 2OJED 5DQTA 1HW7A 5L0JA 2WLLA 2A79B 2LFSA 3ML0A 4PA6A 3JYYA 4NXMO 2P1AA 3SR2C 1PCXA 4TWKA 4XTKA 1XNRB 2YLIA 1XNQB 4K0DA 4PELA 3AG4B 5CA3A 3T1YO 2JGDA 2WPDG 3RGBA 2D2CB 2ITCC 4BJ1A 3DZAA 2EILC 3WG7B 1Q6HA 2J8WA 2AZ0A 2LK4A 3M4BA 3AGUA 2A0UA 4JYCA 2EPLX 3CS5A 4BAYA 1OW8A 4IAOA 2XSEA 1Y4MA 1VLTA 2YIDA 1FS0G 4IB4A 4FLYA 5K1PA 2R02A 3RYIB 4XDKA 3V5ZA 4R6ZA 5LBQA 4DXWA 5L3EA 1OR2A 5C8YA 4YJ2B 4L87A 2QY9A 2DMXA 3HKDA 5IE9A 3L70H 4F4BA 1ZW2A 5KHHA 2QKAA 4B08A 1O3UA 4DR3B 5D5QA 3BA9A 5KYUB 2A06H 1Y66A 4MT8A 4GLXA 4DO2A 3E8FA 5LXTA 2VB6A 5LYJB 4B3TB 5TJ5E 4F6EA 3ZCCA 5KHGA 3E83A 1IBKB 3HKEA 4X1KA 5H5NA 1A7EA 3WB2A 3K04A 2HS5A 3M4CA 3B09A 2BSKA 1BSMA 4AQYO 4WFHA 5JRAA 1DOVA 2IJHA 1Q6IA 4CS4A 4QDLA 5LGTA 1MSDA 4OPAA 3EGDB 1Y6DA 4IIJB 1RM1C 1WPBA 3EXAA 3I4UA 2JK5C 4J11A 3B8NA 2PYJA 1YYJA 3JAKB 5T3TA 1WJZA 3DM9B 5GPGB 2H8PC 4O6YA 4MQ9F 1KU9A 4DRJB 3KCXA 1EN6A 3GM1A 4MW8A 4D6TH 3O6XA 4ER9A 3PCVA 2X6CA 5CA0A 4UXNA 2WLMA 3SXZA 3CC4V 2GUZA 4FZ0A 3NYLA 3WU2Z 1Q0MA 2W4BA 1P4RA 3L71H 3ETDA 4X62O 3JAWB 1SS3A 1WP7A 2DGJA 4W8KA 4JV5O 1L3PA 2B1IA 4CBEA 1LE2A 2Q8VA 3ZRVA 3SPGA 2XS1A 4JE9A 4N4WA 1S72V 1SESA 1TUBA 4NTBA 5DEDA 2NPUA 4LF4B 3RYHB 1SQVH 1NZEA 2HKVA 5LMNB 1A41A 1S5HC 2Q9CA 1FXKB 1AB3A 2XLHA 3NR7A 4XPWA 5FZTA 3S27A 1A0BA 1YJNV 1IVSA 3WODF 1WLEA 1JPXA 4DRHB 1O9GA 4K0KB 2WSSG 2B1GA 4HE8D 1VQKV 2UUBO 4EEQA 3GODA 2PGGA 5BR8O 1I94B 4C3BA 4U9DA 4PJMA 4X1IA 4JEAA 2VQFB 1RP3B 1XMQB 4CH5A 3B40A 1MMNA 4JJFA 2Q4PA 1QHTA 4B6IA 3GWKC 4E0HA 3ZMTA 4L8JA 2KGOA 1E83A 5BMVA 1NSGB 4JASA 1Q5OA 4Q20A 4TV8B 1NU7D 1ZHTA 1W2WA 5DQZA 2BTOA 2W9YA 1JFFA 2PI4A 1QKRA 4JZAA 1E84A 4PDMA 2V4DA 4LNUA 4GQHA 1SQXH 1BZKA 4DV4B 2Z3YA 1SA0B 3WHNA 3AG1C 3IHUA 4A4AA 1C02A 2BC5A 1B68A 3NMIA 1RXQA 1DLBA 2V3CC 4O4JA 4O4HA 2X6BA 1E79G 3B0VC 1Z5ZA 1BCCH 3JT1A 3G4ZA 5LP6B 1URFA 5B3SC 1U96A 2AHZA 1Q0GA 2W0XA 2M4EA 4Q5SF 3X2QC 1HWYA 3ABKB 5TISZ 1VF6C 1LKXA 2R25A 4TV9A 3SZRA 4IT5A 1YITV 4RAIA 1DGSA 1CPRA 4CIHA 4UCRA 3ZG1A 3CE2A 2Q0AA 4WBNB 2VCBA 2EX3A 4BJ5A 3AG2B 2PP4A 2UUHA 4JAAA 1UFIA 4RDAA 5A69A 4YY3B 3U8PA 3OTOO 4JKVA 4XPYA 1L0NH 3CCVV 2WL8A 4UVBA 4UFZA 1COWG 4Z9IA 1VQPV 2YI8A 3LNRA 3ABMB 4LFBB 3G67A 1FD9A 1TQGA 2QWPB 3CRAA 2RJZA 4AE4A 1VQMV 3JSLA 4LC1A 2HZ8A 4Q7CA 4GX5A 2WLHA 3JARB 1S05A 2HV7A 2HUJA 3MD0A 5CBHA 1YJWV 4I1OB 3QTCA 1FFXB 3AQBA 1P7BA 4G2KA 1K04A 3ZHQA 1Q81W 2Q73A 1XWJA 1OKKA 4IARA 1WPXA 3ABLB 4CC5A 4W4LA 4DV3O 3MHHC 3CCSV 3A11A 2GAQA 4ZLDA 1EN5A 2E5LO 4LDQA 2Q6AA 5IDJA 2IH3C 1VQOV 1SKVA 2J9VA 3S90A 4DV6O 1R4TA 3SJBC 1WTYA 4LFCO 4CC6A 4JI4B 2XL8A 1C17M 3SJAC 4G27B 1HMDA 1VF6A 1F1MA 2J9WA 2IJKA 3E22B 2VRZA 5ITZB 3K5NA 2NUPB 5C93A 3LESA 4C3DA 1THZA 1H2LA 5CIVA 3CCQV 1D1BA 4PFOA 3OUFA 1YYXA 3OR6C 1M2VA 4GT1A 2A6EF 1RKCA 2N05A 3P30A 3JTLO 2OOCA 5E79Z 1OCRC 3VQYA 4NTAA 2UXBO 3A0HZ 4Z1MG 3W8HA 4FFKA 1AUEA 4H37A 5HFMA 3BVOA 1KP2A 1AI5A 2XLOA 2PTMA 4HYOA 5IJ9B 1CXZB 2H8AA 1BGYH 3VOUA 4X1YB 4YXWG 1N33B 2PFDA 5AC4A 2C03A 3FOPA 3N2KA 3U10A 1V4AA 2DB4A 1WA8B 3AJMA 4EUKB 2H7BA 4UVAA 1PNMA 1EBOA 4JI3O 4UDVA 2GSMB 1D1CA 2CTPA 3UM7A 1VYKA 5LA6B 1OQCA 2BOCC 3OT7A 2PBEA 2LSEA 3LSUA 4PD4F 2ASRA 3BY6A 3JD4A 4BWAA 2VS0A 3H2UA 1SRYA 3HKKA 3AK2A 2KW3C 1ZU4A 3IPMO 4U5HA 4JI0B 1P49A 4NCQA 1A7VA 3OD4A 5IT9N 2YWAA 3OMNB 4JF3A 4XWJA 5CI8A 5LHHA 1YXBA 1RKEA 3N24A 1ZLZA 1RPOA 4UCOA 2OWOA 2JS5A 3L8JA 2O57A 1TVKB 4K8ZA 4JPRA 5KX5A 1FMWA 3VAYA 4AX2A 2VH3A 3AG3C 4D7TA 2ETSA 2ODMA 1XZQA 3SEOA 4DRXA 3BRCA 4WCEV 4EBJA 4DR4B 1BZ4A 4DBQA 3OM3B 1Q6UA 4FAPB 2VCCA 2I8BA 3K6BA 2QWQB 4J7TA 2KG7B 2IYLD 3OE7G 3OGIB 5J2TA 2AGAA 4KXRA 3ZMZA 1WN0A 3NMJA 4C7OB 5FLXN 1SQBH 3HPLC 3T1HB 1F51A 4DOZA 2D3OW 1N36O 1L0LH 5F5FA 3W7UA 2NSFA 2HSQA 1JPNA 2Q7EA 3SYQA 3RQFA 4D4XA 2WA3A 2YEVA 2ZDIA 1VQ7V 2EIMB 4ZHQA 4B3RO 1O5HA 2KSDA 2ICWG 1Y67A 3C8GA 1U0BB 4X20A 5KAFZ 3EHMA 4ASUG 2KKWA 4OGQB 2OQMA 4X64B 3HKCA 2XLMA 3IC7A 1AJPA 1VQ6V 3GEEA 5KUKA 3U8VA 2YIBD 2ZE5A 1HNWB 1WWPA 1ZHYA 3LS1A 3Q6NA 4BR6A 4N23A 2QTOA 4DUZO 3AK3A 3JYCA 1HNXO 3TK1A 1NI8A 3JCUQ 1UJWB 2NSGA 1I4ZA 1YDXA 3ZIAG 5CMUA 2A0LA 3JATB 4BEJA 4OPHA 2Q3TA 4X66B 4UV9A 5IYZB 1OXKA 4P9OA 2H7VC 5FCLA 4MS2A 4FLWA 1M57C 2GV9A 4XEKA 3H1KH 4OXSA 5IJ0A 4KBLA 2A1DD 2HP8A 1LM3B 4GX0A 4P2ZA 2GBOA 2Q00A 2H94A 1YJ9V 4H4KC 1ZWIC 2XLEA 1K7DA 3D36C 4GCZA 2XRHA 1VQ8V 3CWBH 4JVSA 4KP4A 5JLIA 1Z5VA 5JQGB 2H7OA 1B6QA 2BE3A 3EH1A 2W0FC 4DV2B 1E86A 3VYWA 3AEIA 1XI1A 2R72A 4I55B 4P9FA 4ABMA 4DUYO 2UUAO 5B1AC 5T1DB 2JRIA 3E35A 3QO8A 4C7UA 4XEVA 4O2BA 2QSAA 1PP9H 2ZIOA 3C63A 4L6RA 1ORJA 5BUOA 2R7TA 4PA4A 5L0HA 3QG5A 2OU6A 2HVKC 2Z15A 2Q7HA 3FYIB 3MAQA 1R3KC 1YLMA 3EJNA 2UXCB 3K1HA 3B8MA 5DVWA 3C3TA 2VQEO 3G6BA 1RPRA 3ABTA 3QTHA 2UUCO 4DW1A 3O9OA 5J2UA 3U5SA 5A6BA 1QQ3A 3AG4C 4U9EA 2A3QA 3ETEA 4RUEA 5KMGA 4JGSA 4UB6Z 3WG7C 5CI9A 2PX3A 2WZLA 1LR1A 2Y4UA 4E4EA 3UMIA 1SZTA 3QVZA 1EFRG 3RH3A 2AW9A 3HKBA 1OCZB 1QVGU 4YIOA 1BR2A 4O6MA 2NG1A 4K3AA 4QPKA 1IBMO 4DR7B 4N21A 1YSCA 3I5QA 1SZXA 2A9HA 3HNIA 5JUAA 4OIRF 3C90A 3FAPB 3T2MA 2QM7A 1FAPB 3D36A 4KHPO 4UCUA 1NLXA 1VQ4V 2GWWA 4IJJA 1KC8W 2WVNA 2CCYA 2OIGA 1E2XA 3IQ5A 2XXAB 4QE7A 2VCAA 1SERA 3E86A 4EWCA 3FDQA 3BAAA 3ABUA 1AP5A 4JI7B 1MMDA 4N6CA 1S7ZA 1PD3A 3ZHSA 4R8CA 4Q6GA 1NH2B 1XUQA 3JASA 1OV9A 1ZL8B 2XNDG 3EZIA 4H13B 4KL1A 5L0IA 5EYPB 3J81N 1GM9A 4LF8B 3P3PA 2HHHO 2LIGA 4MVOA 4X89A 2Y3BA 1D5AA 1ORYA 1Q90D 3OFNG 3GWLA 3JRTA 2FB5A 3I5PA 4FIPC 3TD7A 2K9PA 2Y39A 5JH7B 2F1MA 3T6BA 4HFKB 2ATKC 3H1HH 4PFPA 2BCCH 2E3CA 5H6RA 5DS6A 4ZIBA 1YIJV 2KJGA 3W7WA 3CCLV 2XUMA 4JI1O 4LH7A 2VASA 1H8HG 3SYAA 2P6VA 2BOBC 4NVPA 1E85A 2MYSA 4YJ3B 4OINF 3SYPA 3ZIBA 4JI5B 5KHKA 3EZHA 3RYIA 2R03A 4E7ZA 3ZRWB 1H6GA 3K79A 4YJ2A 4RBNA 3Q4HB 2UU9O 2FMLA 1AR5A 1FAFA 4NXMB 3ZTZA 3NDBB 1L1FA 3SP1A 1V74B 2R7OA 2ZPAA 4FESA 3UMKA 1K4CC 3K3WA 4GKKB 5KYUA 4TSFG 4FM1A 1FXKC 1ZSPA 4GX1A 5KYXB 5LYJA 3K59A 1K73W 3T1YB 1WATA 5JWPA 1YA9A 2FFHA 2Y48A 1S5LZ 5B1BB 1US6A 1IURA 4WFBV 4J7ZA 3L75H 2K1EA 4PA7A 1U97A 3W7TA 1RMVA 2A7WA 4BJTA 3RW0A 1ROPA 5F2VO 5GW7A 2B9ZA 3UT5B 1LVKA 3W8IA 2NLJC 3ZEDA 2IM8A 2ZM6O 4IIJA 2YVKA 3FB7C 2BL2A 3S9OA 5L3VA 3JD2A 4H54A 3ZHTA 5E2QA 1I0HA 1K3EA 4NC3A 2UUIA 1V55B 4PJNA 2DW4A 3JAKA 1HW2A 3OUSA 2GTSA 4JI8O 1R6NA 4LF9B 3HNKA 3J7AU 4FLZA 4ZLCA 5LHIA 1T5OA 2NUTB 3LLIA 3UO2A 3APOA 3PN1A 4H0LB 2JGUA 1MMAA 5LMUO 5FL7G 4WFGA 3E2EA 5HV9A 4Z9HA 2V7QG 5A6KA 2M64A 1BR4A 3G80A 1M5IA 5LP6C 4IYHA 3J06A 1QQCA 3CCEV 1YF2A 4HFFB 2P5OA 3ABKC 1TUEB 3DKAA 1D1AA 1YTFB 1S0VA 1KU2A 3FX7A 2QWNB 1H7IA 1BT8A 1G5ZA 4YK5A 2DYRB 5DM6V 3RYHA 5L3CA 2KYHA 1XDCA 2NNUA 5B66Z 1XHZA 4XQ1A 1FXKA 3L34A 3SPJA 3NG1A 1BS3A 4J7YA 3ZQYA 1OHHG 2IM9A 4EIYA 1NVPB 3EHBB 1AI6A 1ZAUA 3AG2C 4F6RB 4IYIA 2EINB 1M6TA 1JR9A 1OCCB 4QGPA 2Y3HA 3JD1A 4I3MA 3F7YC 2LP4A 4RUFA 3UQ8A 5CB4A 2Q4FA 1L8DA 1QZXA 4WGZA 5T3WA 1G6UA 5IY5B 2IXMA 3SYCA 4X62B 4J80A 2F95B 2WAMA 2DQ0A 1WGWA 1PKXA 3ABMC 2G38A 3MDSA 2X7RB 3M15A 5EGYA 3C8ZA 4P9TA 2I15A 2PNOA 3UR3C 2Q9BA 4RO2A 2OYQA 2PI5A 4JI6O 5GTIZ 1OW7A 2DWDC 5COGA 4QI2A 3CCMV 1ZHZA 1AI4A 3ZMVA 2FYUH 4DYLA 2XLDA 4LR3A 4B3MO 1Z2GA 4TV8A 2XAGA 4ZKIA 3OMIB 5L3BA 4WJ0A 3JYHA 3ZSUA 2IXNA 2XM4A 3FFQA 3I55V 5L0FA 1HY5A 3DJUB 1SA0A 3FMSA 4LF6B 3ABLC 3T1CA 4EB6B 4FLVA 2DE0X 3KYJA 3K06A 1PV3A 4BW9A 1PM9A 2YL7A 5LP6A 5BR8B 3DC5A 1V9PA 2EPKX 1M93A 1N0JA 5EIBC 256BA 4OX9B 1ST6A 2ADPA 2L35A 3ZRXA 3K03A 4PJJA 2L6LA 4J9YB 2DI3A 1EKYA 4IHJB 4WBNA 2B5UA 2BTQB 1P7GA 1PL4A 1VIBA 4CH4A 4G7ZF 2ZIMA 1GGQA 2ZINA 1HP8A 2R7SA 4YHHO 3JRMO 2CAZC 1H9TA 4K8XA 3K9AA 4LWSB 3KL4A 2EPNA 3HNJA 5KYWA 3DXJF 2Q0OC 3M7MX 4B3TO 3G71V 2LQGA 1I5NA 2P7VA 4A2NB 5KYYB 3ASOB 1IBKO 4YT4A 2Y69B 3A8TA 3CX5F 1VMGA 3BCCH 3QW0A 4JCHA 4DR2B 3DE8A 1LS4A 2XAJA 3JARA 1H2GA 4ONSA 1TAEA 4GKJB 3T6GB 3L8IA 3GEIA 2XAHA 3QVNA 3WB1A 2B0HA 2D5RB 3EGXB 1KKCA 3FVYA 4D7SA 1NFOA 3LLKA 3Q6MA 2WVQA 1FJGB 4ZOLA 4DV7O 3K5MA 1BQ0A 1Z3IX 3LAYA 1D0ZA 2MW2B 2WLNA 4C3EA 5EC2C 4HAMA 4O4IB 3HLZA 2EIJB 2XAQA 5ITZA 2P61A 1FNTc 2FGYA 4LF5B 1IXMA 4OIQF 1Q8IA 4HNAB 1N4CA 3ZJZA 3MYIA 2IJJA 1M9NA 2CH7A 4NTWA 1HDJA 4YL3A 1S76D 1OKKD 3CEXA 3EFFK 4J41A 4YT2A 1I5YA 4W8PA 1NQTA 5EK0A 1RCPA 4DRIB 4DV3B 3PJSK 2UXXA 1AILA 2CK3G 2Y0IA 4MVMA 1NJIW 2E5LB 4NXNO 1DTOA 1BDJB 3O39A 4DV6B 3CJHB 5IWAO 5LMNO 3S3WA 1XOUA 5IJ9A 4FMTA 4OD4A 2GDCA 2A6HF 1DK1A 2LD6A 4X1YA 4PJLA 3GVMA 3ICXA 3DD7A 4TOIA 3H1JH 2EIMC 2AVKA 1HR0O 3DSQA 2AP3A 4GUNA 1IZMA 3LNNA 3HTKC 1WA8A 1AVMA 5CA0B 2GUZB 1G8MA 2RNBA 1OW6A 4W4KA 3CQZA 1VQLV 1K4DC 5LA6A 1QLEB 2OTLV 3EFOA 3QVYA 3V7OA 3LEOA 1EQ1A 3D3QA 4J10A 1F4MA 2JVDA 4X9QA 1Z6AA 1WOLA 3VF0A 4CS2A 2UXBB 1VMAA 2YQYA 3Q7GA 4XDJA 2Y3GA 1XMQO 2LQTA 1MZFA 3RYCB 3K33A 1TUBB 2GFHA 2WLIB 2ZCEA 2R7UA 2X51A 4FLXA 4ZI7B 1CP9A 4FLUA 3RWRD 3CP1A 4N6HA 3G4XA 3KCYA 3SXKA 5L0DA 1TVKA 4CDYA 1ZUQA 1SC5B 5H9CA 4X0RA 1Z7Qc 4DV4O 2RDCA 4DBRA 2W6JG 1LI5A 4NTYA 4X88A 1H2SB 4BW5A 2EZOA 1VQ5V 4X65B 1ENVA 3ETQA 3POVA 2Q69A 3JSEO 4Z9JA 2YL1A 5EBWC 1CPQA 1N32O 2KG7A 2J0XA 1R5ID 4C7OA 1QVXA 4JI2O 5J9PC 3L0IA 2EBOA 5BZBA 2JDIG 2G3VA 5BMVB 4J9ZB 2WA4A 5E1AC 2ZR2A 2B0JA 4JCZA 5H2FZ 2QKSA 2IBFA 2GHYA 4EBKA 2J9BA 1NTMH 2L7AA 3O65A 2LFDA 2HEPA 3LJBA 4E18A 1WP8A 4YY3O 1QPUA 3S0XA 3OW2U 2YL0A 2LFRA 2XAFA 1JAFA 2Y3DA 5GONB 4DK0A 2LW7A 3IC9A 1ZW3A 3DC6A 4D4NA 1I5XA 1XMOO 4LFBO 1HW1A 4UCTA 5KUMA 3ZQVA 4DR1O 5F5HA 3VRCA 3CC2V 3AQCA 3RVZA 3DE9A 3L74H 3E89A 2QTVA 3K0GA 5L0GA 1J8MF 4TUYB 3R66A 4LF7B 3FYEB 1IW7F 3BFRA 5FPOA 3JATA 5COMA 2V26A 1IDSA 3FKSG 2QE9A 4JURI 3JD3A 5IYZA 4WABA 3QF7A 1AI7A 3RFRA 3MLGA 1OCZC 5D92A 2YIAA 4WFAV 1BMFG 5DS5A 2EJ7A 2MWQA 2HMQA 3C8GD 4LLEA 2E74B 4BIZA 1Y74B 4B3SB 1HE1A 4WGYA 1XZPA 1CGOA 3ZRSA 2WZGA 4FK5C 3T4DA 2J7PA 4JI4O 3Q7LA 1ZYRF 5BY1A 3GEHA 3ITFA 4U3JB 1GTOA 4DR6O 1N34B 1FFTB 4Q4ZF 4OIOF 3N0TA 3GWNA 2L9JA 1HNXB 2ITDC 1NFNA 2ZXRA 3CRMA 1N1CA 3CZ6A 4O7GA 1NS1A 2YZSA 5BQHA 4I55A 4QJFB 5IYDO 2GTAA 1ZTEA 2R7WA 3OEHG 5CA1A 2RQ6A 3UNGC 1Y76B 2VWJA 1YAUO 4LDKA 1T6IA 4FLTA 2RD9A 1ZVZA 1IBLO 4BEMJ 2L81A 1A32A 1TA8A 4I9QA 3DAFA 5F28E 2CGEA 2XOKG 1Y6XA 3B29A 3K1IC 1AJNA 2L6HA 1NR7A 1CGNA 3IEEA 3G4SV 3VBBA 2CDYA 4RWUA 1KB9F 4CDVA 1VF5B 4R7CA 1JOYA 4IWBA 4DW0A 2IU3A 1M2VB 2YXHA 5JSLA 1PNLA 4PV1B 2YXLA 3TJTA 4CS3A 4MTGA 3EQLF 3K7DA 3ZHUA 2OCCB 4XBFA 4JI0O 1T6UA 2KSFA 3GORA 4LDRA 4GEHA 1YDIA 4AK9A 2QM8A 4E0IA 2PUSA 2OTJV 4PA9A 3EG9A 4R50A 3L9DA 3CCRV 1F4NA 4FFBB 3SPIA 2R70A 2VQEB 5A6BD 2UXNA 3UCSC 1K92A 3N2KB 5JJNB 2KQ9A 2UUCB 2L6GA 2XXAA 4PHZA 4DR4O 2EJRA 3R2PA 2OEXA 1A7DA 5LGNA 4GYTA 2HG5C 3ZDLA 1L7CA 2ZQMA 1MG1A 1D5NA 2R9RB 5B1BC 3DJNB 5EZYB 4NB5A 4G28B 2R9AA 1ZL8A 1HNZO 1KTMA 3ZN0A 3ATPA 5JCOC 3WAQA 1LUVA 3T1HO 3P32A 1T9KA 1YJGA 4DR5O 2CGOA 1E1QG 4FVMA 1RKEB 2P4KA 3T4ZA 1RSOB 3CMEV 1V55C 5LOVA 5EHHA 1JVMA 3SJCC 1FFHA 3RT3C 3U3FA 4E7SA 1FYJA 1XILA 2QJ1A 2HR3A 4JJGA 2OCHA 5K0IA 2KNHA 1VTMP 1B06A 2E87A 3JALB 2XTAA 4JYAB 2F66C 3FOOA 5BXZA 4X64O 1M90W 2X0LA 3U9JA 3KPHA 4NY3A 4DV0O 1HE9A 1UFBA 1R6TA 3VQWA 5JVDB 1JCHA 3ZRWA 3DXRB 2HHHB 1K40A 1SQGA 1MSWD 3Q4HA 3C18A 2HKOA 3RYFB 4IGGA 4UCVA 2F4VO 1ORSC 1FXHA 1GK9A 4TQDA 2DYRC 4O2AB 3A2FA 4PA3A 3TXSA 2D4UA 2M6YA 2CTRA 1K9MW 2YEVB 4CH3A 2JEUA 1FKAO 5KYXA 1FR0A 4QE9A 1HMOA 3K0DA 4I4TA 2ARHA 4LFAO 3CCJV 4BIOA 1F23A 3DMDA 4JZ2A 2EINC 1OCCC 4PK4A 3KH2A 3U3BA 4J7KA 3KYIA 1NTZH 2X6AA 3HKCB 1R3JC 1YVIA 3K66A 3UGOA 3JCZA 4XPXA 3UGPA 5IY5C 5JCOA 4ULWA 3K9SA 4DV1B 3UT5A 1OR3A 1KNYA 1YZCA 2Q7GA 2WLJA 4XLPF 5A6JA 1KECA 1Q82W 4TT3G 3P3NA 3LSSA 4EBBA 1PL0A 2W45A 2CE4A 3ETGA 5AG2A 3OWTA 1P84F 5KHJA 3S28A 4DV2O 1MNDA 2BE5F 4X8AA 3L72H 1YA7O 3FAVA 4PDLA 2HMZA 1FXVA 2KC3A 3GM2A 1FPOA 3TXQA 2GA0A 1MNEA 2NUTA 2XLWA 3R7CA 1O9HA 4DV5O 1SMYF 2R05A 5LHGA 2RMKB 1N0NA 5DLJA 1K5SA 3WFVA 1J5EB 5CBFA 3OA1A 3THOA 3N2GB 3TOMA 1SF8A 2ZE8A 3BHPA 3N2ZB 4BG0A 2DWEC 3DM5A 1KP3A 2P22C 2HFEC 3U9MA 1VK5A 1GMGA 2UXDB 4I50B 1LS1A 2JPUA 4CBCA 4JI8B 2MK3A 2IBZH 2E75B 1T5EA 4DR7O 4U5BE 1C03A 1G4YB 3T6JA 1H2KA 1SQPH 2DJVA 1AR4A 3VQVA 1AVOB 4F6RA 1SF9A 4OD5A 3PHF2 5LMUB 2WB7A 4PI2A 3ZHVA 1K97A 4O4LB 3TOLA 2P67A 3CD6V 1GAXA 1NG1A 2HFIA 5L3GA 1M56B 2JIZG 4JTAB 1EZJA 3GB7C 3OTFA 1Y4CA 4JAVA 3SJQC 2FKXA 1UPGA 2P7TC 3ASOC 3BPZA 3FD9A 2Y69C 3DTUB 3GWOA 2F43G 4HZ3A 1BHBA 2VC9A 2KQXA 2XS8A 1NKDA 3EGDA 3LSQA 4FX5A 1AROP 3RYLA 3W2VA 4QIWF 5AGFA 2IXOA 3S3XA 4EB6A 1J8YF 2Q7RA 3JZ0A 3GANA 1K5QA 1BR1A 2R7QA 4XDLA 4UCSA 2ZXPA 1CGME 1EZVH 4QI0A 1PV0A 5B1OA 1KKDA 4U5DE 1F7YA 2YXYA 4QPJA 5H6QA 2R9IA 1RFYA 2EIJC 3E8HA 2FAPB 4AQYB 1MNGA 1S77D 1KYOF 4B3MB 4IHJA 3JAWA 2BTQA 2QTSA 4NQFA 4PDVA 5FNVB 1BQZA 2QA4V 3IQCA 4G7OF 2G3KA 1KQSU 3UO3A 2OEVA 1YZBA 1OZ0A 3QNEA 1JR8A 1OXBA 3PDMP 1BBHA 4LWSA 4J30B 4I0XB 4GKKO 2GDSA 2X0CA 3ZMUA 4YL1A 4O6NA 2DOSA 5LL6Y 3H1IH 1Q7YW 2ZXWB 2EIKB 2M7WA 3K57A 3CSKA 5KYYA 3NRHA 3KZIZ 4FJCC 3KKBA 4U5GA 3B0PA 5E3CA 3ZTMA 2CNWD 2LGQA 3F7VC 1QNMA 2YKZA 3H01A 3MYFA 2AXTZ 2IXPA 5BQGA 3STZC 4JV5B 1ZZPA 4JTCB 5KHIA 1Q86W 1QLEC 1QBZA 4LLCA 2ZD9A 3AOUA 3DAGA 4OIPF 1ZU5A 2YS8A 1OJHA 3FB8C 4KNWA 2QGNA 1I08A 2IU0A 2QUPA 3EGXA 2XL6A 2QNLA 1N8RW 5D5PA 3R65A 3F46A 3B71A 4YHHB 5E3AA 1G4US 4IRUA 1R3IC 4AI8A 1MABG 5HFLA 4MTFA 1JOGA 1YCIA 4LF9O 4O4IA 2E76B 4EFEA 1WAZA 2WWWA 2J9UA 4UUJC 3LEVA 3NKDA 4HNAA 2C2AA 2Q9AA 2UUBB 3ZMSA 1XNRO 4IAQA 2ETNA 3UMHA 4CX9A 3EHNA 1NTKH 1XNQO 3EPVA 5B1NA 3B0UX 2P4VA 4B7KA 1EM1A 2YDEA 4FM2A 1LI7A 5KAIZ 4PR9A 4YL0A 3RN4A 2Q9LA 5CBGA 1JPJA 1M2OA 1RJ9B 1U6HA 3ZX6A 2CNWA 2AU5A 4DV7B 3CJHA 3NMKA 3CB2A 5EIBD 3KMIA 3VQXA 1VQNV 3FB5C 3US6A 3W7SA 4N06A 2CW0F 2WLLB 3DI5A 2JX0A 3O10A 5KA5A 2HVJC 4RQEA 1CEZA 4ULVA 1VLSA 2G62A 2CDQA 3A0BZ 4DR3O 3CRCA 1GM8A 2JD3A 4Z1VA 1GKFA 2Y4TA 3BA8A 2F23A 3HNLA 2DYSB 2Q5ZA 5IYBO 4FWVA 3CHXA 2JGDB 5KYNA 3F5WC 1KUQA 2H3OA 4O79A 2YICA 1YARO 4I7ZB 3RYCA 1FMVA 4DVZA 2IJIA 2ILMA 4NXNB 3X1OA 2YC0A 2WLIA 4DVYP 1FFXA 5IWAB 4MTOA 1IX9A 4DJ9A 4ZI7A 5L3FA 4LERA 5JJEB 2QLAA 4RQFA 1BL8A 4LACB 1XREA 2WLKA 3ASNB 5C8YB 5IYCO 1KMIZ 4WF9V 3OTOB 4J7JA 4KNVA 4BJ5C 4PI0A 1HR0B 3DGEA 4JYBA 1SETA 2LGWA 2RN9A 3HKDB 4LF6O 5GTHZ 5CB4B 1QSPA 3BABA 3ZS8C 3RQGA 1V54B 4A5UB 2HSBA 2V1DA 4MNDA 5LXTB 3HJCA 4G78A 2WZFA 1WB8A 2P6JA 3E22A 4P6IC 2AWCA 3EH2A 4J32B 4JIOA 3HKEB 2NUPA 3OEOA 1LUWA 4X1KB 1H2MA 4OX9O 1XL6A 4LP8A 4WFFA 1D2DA 1FFTC 2BSKB 1PD1A 1TFKB 3JSNA 2LO1A 4AL1A 1AP6A 2P06A 3LDCA 1T6QA 1DF5A 2LJ2A 4NKGB 1GN4A 2ZNIA 2YSUB 4CS7A 3SNHA 3TETA 2PY5A 4U7NA 3S84A 2HV6A 2IOQA 1R3LC 4LF4O 1VF7A 2Z0AA 5KA6A 5GONA 2J46A 1NU9C 4YT8A 4M63A 3E9VA 4LFCB 4K1OA 3BEHA 3O55A 4BIUA 1VQ9V 1GM5A 1JMKC 1N32B 2OG2A 3RFYA 3CXHF 2XHBA 4NTXA 2EILB 5L3QA 4GYCB 4K0KO 1QLNA 4E17A 4JI2B 2HJDA 1VB5A 5B3IA 4YJWA 3HR0A 5LGUA 2JJ1G 4DR2O 4TUYA 3QZCA 1JQ0A 1I94O 1XEQA 4GKJO 3J80N 2VQFO 1IZ3A 5B5EZ 1H9GA 1JA8A 3A0RA 3FHDA 2OCCC 1Y74A 3B4SA 4B7EA
chains in the Genus database with same CATH topology
3OFNG 4R7CA 1JOYA 4WFHA 2IJHA 4FIPC 2IU3A 3CCUV 5LGTA 1PNLA 1S3JA 2ATKC 4MTGA 5H6RA 1JJ2U 2OCCB 1RM1C 4XBFA 1YIJV 3W7WA 3CCLV 1H8HG 2QM8A 2OTJV 3SYAA 2JK5C 4MSWC 4PA9A 2BOBC 4R50A 3B8NA 3SYPA 3CCRV 2JEXA 1F4NA 3W7XA 2H8PC 3SPIA 1RM1B 2UXNA 4MW8A 1K92A 4H33A 3OMAB 3ZRWB 2ZR3A 3K79A 2EJRA 5LGNA 2X6CA 2HG5C 1YHQV 4UXNA 2WLMA 2ZQMA 1MG1A 3CC4V 2R9RB 5B1BC 5DN6G 1ORQC 1L1FA 1P4RA 1K34A 3ETDA 4G28B 2Z5UA 1K4CC 2DQ3A 3K3WA 3QO7A 4TSFG 1FXKC 2B1IA 4GX1A 3RBZA 3ZN0A 2W6IG 3ZRVA 1K73W 3SPGA 1S72V 1SESA 2Y48A 3NXSA 4GX2A 5B1BB 3P32A 4WFBV 2EZPA 1XL4A 2K1EA 1E1QG 1S5HC 4PA7A 3W7TA 3CYOA 3T4ZA 1FXKB 3IFXA 3RW0A 1V55C 3CMEV 1ROPA 1JVMA 5GW7A 1YJNV 2NLJC 4MVQA 3E8BA 1WLEA 1JPXA 3FB7C 2HR3A 2WSSG 3JD2A 1K3EA 2B1GA 1JX9A 1VQKV 1V55B 1M90W 2X0LA 2DW4A 5EBMC 3OUSA 4P30A 1R6NA 5LHIA 1JCHA 2ZDIC 3ZRWA 5FL7G 4WFGA 1GO3F 3ZMTA 1MSWD 1CPYA 3E2EA 2HKOA 4JASA 3IGAC 2HLDG 2V7QG 4Q20A 1ORSC 1FXHA 1GK9A 4UV8A 1QVFU 2DYRC 2PI4A 4PA3A 4PDMA 1K9MW 2YEVB 4MW3A 2JEUA 3CCEV 2Z3YA 4QE9A 3AG1C 5EC1C 3K0DA 3ABKC 1TUEB 3CCJV 1YTFB 1S0VA 1F23A 1DLBA 2Q67A 2EINC 1OCCC 2X6BA 1E79G 2DYRB 5DM6V 2KYHA 5L3CA 2X6AA 5B3SC 2NNUA 2AHZA 1R3JC 3G6EV 3JCZA 1FXKA 5IY5C 3SPJA 3X2QC 1HWYA 1QR8A 3AG1B 1OHHG 3ABKB 1OCOC 1M1KW 3CC7V 1NVPB 3EHBB 1AI6A 2WLJA 3AG2C 1NR1A 1MOFA 2EINB 1OCCB 1YITV 3JD1A 1KECA 4RAIA 1Q82W 4TT3G 3F7YC 4FPPA 3LSSA 4RUFA 5B3SB 1PL0A 4KUMA 3ETGA 4MVUA 1NH2D 5IY5B 3TCUA 3FB6C 3X2QB 4X8AA 3LNMB 3SYCA 1GM7A 2WAMA 1K33A 2DQ0A 1PKXA 3ABMC 3AG2B 4PDLA 3D3IA 1FXVA 2X7RB 3MHSC 1KD1W 2HJFC 4RO2A 2PI5A 2DWDC 3CCVV 2QEXV 4UVBA 3CCMV 1AI4A 3ZMVA 1COWG 5LHGA 1BHAA 1VQPV 3JD0A 1K5SA 2XAGA 3ABMB 3WFVA 5CBFA 4ZKIA 3OMIB 5L3BA 2AHYA 4LBEC 1VQMV 3I55V 4LC1A 2DWEC 3ABLC 3T1CA 4GX5A 1KP3A 3K06A 2HFEC 2WLHA 3MD0A 5CBHA 1YJWV 1GMGA 1H38A 4F4LA 1E1RG 1P7BA 4G2KA 4CBCA 1Q81W 2MK3A 1WPXA 1G4YB 3ABLB 3MHHC 3CCSV 1M56C 1W0JG 2Q6AA 3ZRXA 5IDJA 2IH3C 1VQOV 3K03A 3SPCA 2LP7A 4J9YB 1K97A 2B5UA 2P67A 3CD6V 4G27B 3HB3B 5L3GA 1M56B 2IJKA 1LNQA 3CMAV 2OT5A 2JIZG 4JTAB 5C93A 1EZJA 3GB7C 4JAVA 1THZA 4KFMA 3SJQC 4CZZA 2P7TC 3ASOC 3CCQV 2Y69C 3DTUB 3GWOA 2F43G 2KB1A 3K9AA 3OUFA 4HZ3A 3OR6C 1BHBA 2XASA 4GT1A 1NKDA 4MTXA 3LSQA 3P30A 3LDEA 1OCRC 4Z1MG 3G71V 1AROP 4QIWF 4H37A 3ASOB 3E8GA 2Y69B 5HFMA 1KP2A 1AI5A 2XAJA 1H2GA 1K5QA 4XDLA 4HYOA 1J95A 1NBMG 5B1OA 1OCRB 3VOUA 1KKDA 4YXWG 3SPHA 2XAHA 1W0KG 4QPJA 5H6QA 2R9IA 2EIJC 3E8HA 5EBLC 4E2LA 4LCUC 4UVAA 1PNMA 1EBOA 2GSMB 1S77D 3UM7A 2BOCC 2WLNA 3OEEG 3BY6A 4PDVA 5EC2C 3OR7C 3JD4A 4HAMA 2EIJB 1SRYA 2QA4V 2XAQA 1YTFD 1IXMA 1KQSU 3ZJZA 2ZXWC 3OMNB 4JF3A 2EIKC 1QCEA 2IJJA 5LHHA 1PNKA 1M9NA 1OZ0A 3QNEA 1RPOA 3STLC 1S76D 3EFFK 1I5YA 4JPRA 1NVPD 1R73A 3AG3C 3ZMUA 1NQTA 5EK0A 3K08A 1Q7YW 4WCEV 2IW5A 3PJSK 2ZXWB 2UXXA 2EIKB 2M7WA 2CK3G 3OM3B 2QE7G 4MVMA 1NJIW 4FJCC 2IH1C 1DTOA 3F7VC 1OCOB 3H01A 3AG3B 4FMTA 3STZC 4JTCB 4PDRA 1Q86W 1QLEC 1QBZA 3OE7G 4UVCA 2ZD9A 3ZMZA 3FB8C 3M99B 2EIMC 2IU0A 3HPLC 1N8RW 1F51A 3R65A 2D3OW 3QO5A 3W7UA 2P90A 1G8MA 3LUTB 1R3IC 1VQLV 1MABG 3SYQA 1K4DC 5HFLA 1QLEB 2OTLV 4MTFA 2YEVA 2ZDIA 1VQ7V 1F4MA 2EIMB 2WWWA 4XDJA 4UUJC 4MVSA 2WLIB 4ASUG 2C2AA 4U7OA 1YI2V 1CP9A 3ZMSA 3CP1A 3IC7A 4MVZA 1AJPA 3RVYA 1VQ6V 5KUKA 3OAAG 5B1NA 5H9CA 3SYOA 2FTKA 4MVRA 2W6JG 4N23A 2QTOA 2JJ2G 3JYCA 4JAUA 4X88A 3TK1A 2EZOA 4BW5A 5CBGA 1UJWB 1VQ5V 1ENVA 3ZIAG 5CMUA 2A0LA 2Q69A 4QNHB 4EKWA 4UV9A 1VQNV 5L3DA 3FB5C 5EBWC 4P9OA 3W7SA 3OGCC 4MS2A 2DYSC 1M57C 2WLLB 4P9PA 3KG2A 5J9PC 5KA5A 2EBOA 2HVJC 4OXSA 5BZBA 4RQEA 1CEZA 3I56V 2JDIG 3CPWU 4GX0A 4P2ZA 4J9ZB 2H94A 5E1AC 2ZR2A 1YJ9V 1GM8A 1ZWIC 1GKFA 1K7DA 4GCZA 2DYSB 2QKSA 2GHYA 1QR9A 1M57B 1VQ8V 5IYBO 4WFEA 4KP4A 3F5WC 1B6QA 3OW2U 2LFRA 2XAFA 3ASNC 2IJIA 2W0FC 4ZBMA 2WLIA 3AEIA 1I5XA 4MTOA 5L3FA 3UKMA 3ZN1A 5B1AC 1W2BU 1V54C 5KUMA 1H8EG 3E35A 1AR1B 3B77A 3QO8A 4I9WA 4RQFA 3CXCU 1K8AW 3CC2V 1BL8A 4I5SA 5CN0A 4WF9V 2WLKA 3ASNB 5IYCO 3LDDA 3RVZA 1AJQA 3DGEA 3E89A 1SETA 4JYBA 4JTDB 3K0GA 4PA4A 2HVKC 2Q68A 3FYEB 3FYIB 5B1AB 1R3KC 1V54B 3FKSG 2V1DA 3B8MA 3JD3A 1DF4A 1R6KA 1RPRA 1AI7A 2P6JA 3ABTA 1OCZC 4WFAV 1BMFG 2WLLA 2A79B 2LFSA 3AG4C 3ML0A 4PA6A 4BIZA 3ETEA 1XL6A 4LP8A 4RUEA 4WFFA 4JGSA 3WG7C 3ZRSA 1SZTA 4TWKA 4FK5C 1EFRG 3T4DA 3LDCA 1OCZB 1QVGU 1DF5A 4QPKA 4PELA 2YSUB 4N21A 3AG4B 5CA3A 1YSCA 1GTOA 3TETA 2A9HA 1FFTB 2WPDG 4U7NA 2ITCC 2EILC 2ITDC 1R3LC 4X89A 3WG7B 3T2MA 2QM7A 5KA6A 4JYCA 4BAYA 3D36A 1Y4MA 1VQ4V 3BEHA 1FS0G 4QJFB 4BIUA 5IYDO 1KC8W 1VQ9V 4XDKA 4R6ZA 5LBQA 4QE7A 4DXWA 3OEHG 1SERA 2EILB 5L3EA 4L87A 3E86A 1QLNA 3ABUA 5LGUA 1PD3A 2JJ1G 4R8CA 1JQ0A 1NH2B 2XNDG 4MT8A 1Y66A 4DO2A 3E8FA 2XOKG 1AJNA 1GM9A 1NR7A 3ZCCA 3G4SV 3E83A 3A0RA 3VBBA 2OCCC 4MVOA 3K04A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SPH A;  4R7C A;  3KG2 A;  5J9P C;  4WFH A;  2HVJ C;  4OXS A;  3SPJ A;  3X2Q C;  5BZB A;  5IY5 C;  4GX0 A;  1OCO C;  2EIJ C;  4P2Z A;  4J9Z B;  3E8H A;  4P9P A;  5EBL C;  5E1A C;  4LCU C;  2WLJ A;  3AG2 C;  1ZWI C;  2ATK C;  4MTG A;  4RAI A;  2QKS A;  5B3S C;  3F7Y C;  3UM7 A;  4RUF A;  2BOC C;  4WFE A;  4MVU A;  2WLN A;  3F5W C;  3TCU A;  3FB6 C;  4PDV A;  4X8A A;  3LNM B;  3SYA A;  5EC2 C;  3OR7 C;  3SYC A;  2JK5 C;  4MSW C;  4PA9 A;  3ASN C;  2BOB C;  4R50 A;  2W0F C;  3ABM C;  4PDL A;  4ZBM A;  2WLI A;  3SYP A;  2H8P C;  3SPI A;  3ZJZ A;  4MTO A;  2ZXW C;  2HJF C;  2EIK C;  3UKM A;  4MW8 A;  4RO2 A;  2DWD C;  4H33 A;  5B1A C;  1V54 C;  5KUM A;  4I9W A;  3STL C;  1BL8 A;  2WLK A;  2X6C A;  2HG5 C;  3EFF K;  3LDD A;  2WLM A;  3RVZ A;  3AG3 C;  3E89 A;  5EK0 A;  5CBF A;  2R9R B;  3K08 A;  3K0G A;  1ORQ C;  4JTD B;  5B1B C;  3PJS K;  2AHY A;  4LBE C;  4PA4 A;  4G28 B;  2HVK C;  2Q68 A;  4MVM A;  1K4C C;  1R3K C;  2IH1 C;  4GX1 A;  3RBZ A;  2DWE C;  3ABL C;  3T1C A;  4GX5 A;  3F7V C;  3SPG A;  3K06 A;  2HFE C;  2WLH A;  1OCZ C;  5CBH A;  3STZ C;  4F4L A;  4GX2 A;  4JTC B;  4PDR A;  1P7B A;  1QLE C;  2WLL A;  2A79 B;  2ZD9 A;  2K1E A;  1XL4 A;  1S5H C;  3AG4 C;  4PA6 A;  1XL6 A;  4LP8 A;  3FB8 C;  4PA7 A;  4RUE A;  2EIM C;  4WFF A;  3T4Z A;  4CBC A;  3HPL C;  3IFX A;  3RW0 A;  1V55 C;  1G4Y B;  3WG7 C;  3R65 A;  3ZRS A;  1JVM A;  4TWK A;  1M56 C;  3T4D A;  3LDC A;  2NLJ C;  4MVQ A;  3E8B A;  1R3I C;  3LUT B;  2Q6A A;  3FB7 C;  2IH3 C;  3K03 A;  3SYQ A;  1K4D C;  4MTF A;  3SPC A;  4J9Y B;  3TET A;  2YEV A;  2A9H A;  2ITC C;  4G27 B;  2EIL C;  2ITD C;  1R3L C;  4X89 A;  4XDJ A;  3T2M A;  4UUJ C;  1LNQ A;  5EBM C;  3OUS A;  4P30 A;  4MVS A;  2WLI B;  4JTA B;  3BEH A;  3GB7 C;  4KFM A;  3SJQ C;  4XDK A;  4MVZ A;  2P7T C;  3ASO C;  4R6Z A;  4QE7 A;  2Y69 C;  4WFG A;  3RVY A;  4DXW A;  5KUK A;  2KB1 A;  3OUF A;  4HZ3 A;  3OR6 C;  3E86 A;  3SYO A;  4MVR A;  3IGA C;  1ORS C;  2QTO A;  2DYR C;  3LDE A;  1OCR C;  4X88 A;  3JYC A;  4PA3 A;  4R8C A;  4BW5 A;  4PDM A;  5CBG A;  4MW3 A;  4H37 A;  3E8G A;  2A0L A;  3AG1 C;  3E8F A;  4QE9 A;  5EC1 C;  3K0D A;  3ABK C;  2Q69 A;  4QNH B;  4EKW A;  3FB5 C;  4XDL A;  5EBW C;  4P9O A;  2Q67 A;  2EIN C;  3E83 A;  1J95 A;  4HYO A;  1OCC C;  2X6B A;  3OGC C;  4MS2 A;  2DYS C;  3VOU A;  2KYH A;  1M57 C;  2OCC C;  2X6A A;  3K04 A;  2WLL B;  4MVO A;  1KKD A;  2AHZ A;  1R3J C; 
#chains in the Genus database with same CATH topology
 1FJG O;  2A69 F;  1SQQ H;  2ZXO A;  3NYJ A;  3CCU V;  1XMO B;  2CTW A;  3APQ A;  1S3J A;  3IAY A;  5KYW B;  4DR1 B;  1APC A;  1JJ2 U;  4NR1 A;  4U3J A;  2CUG A;  3ZC4 A;  4LF5 O;  4JI3 B;  5K1X A;  1WNS A;  4MSW C;  3H2V A;  4U5C E;  3SXM A;  1K05 A;  2JEX A;  3W7X A;  4LH6 A;  1G4W R;  3FAJ A;  1SQF A;  1RM1 B;  4X1I B;  4GZR B;  4H33 A;  3V5X A;  1TKN A;  3OMA B;  3SXY A;  2ZR3 A;  1LE4 A;  1I7F A;  3RKO F;  1Y76 A;  2TMV P;  1ZHX A;  1YHQ V;  2OKU A;  3RF3 A;  3QMK A;  1GN3 A;  3C62 A;  4ZOL B;  2J7P D;  1X4T A;  5DN6 G;  1ORQ C;  2J45 A;  1JFF B;  3LS0 A;  1K34 A;  1U89 A;  4LNU B;  2Z5U A;  2CGN A;  2DQ3 A;  3QO7 A;  2CYD A;  3U2M A;  3RBZ A;  1VEW A;  1JMW A;  1TWH A;  4XEF A;  1B3Q A;  3ZVR A;  2W6I G;  1NT2 B;  4G7H F;  4DR6 B;  2LCH A;  4JEB A;  2A0B A;  2R7X A;  4O4J B;  1YEW A;  3NXS A;  4GX2 A;  2PF4 E;  4O4H B;  2YHS A;  1GQA A;  2EZP A;  4JRZ A;  1Q3E A;  1XL4 A;  3ZWI A;  2CH7 B;  3CYO A;  1NU1 H;  4ANJ A;  3IFX A;  4CJO A;  3GM3 A;  5L0C A;  4HEA J;  2N74 A;  4MVQ A;  3E8B A;  4TV9 B;  3QW1 A;  4YWQ A;  3F5T A;  1M4U A;  1N36 B;  1TR2 A;  1JX9 A;  1IBL B;  3JAM N;  1VYI A;  3AGT A;  3NKE A;  5A2Q N;  5EBM C;  4P30 A;  4FFB A;  4CDA A;  3SDL A;  4B3R B;  4PJ0 Z;  2ZDI C;  2ZNJ A;  1VOM A;  2F22 A;  4R32 A;  3W2W A;  1GO3 F;  1XQ8 A;  3G50 A;  1G1X B;  1CPY A;  2CTQ A;  4X65 O;  3IGA C;  2HLD G;  2HJ3 A;  1QVF U;  4UV8 A;  5EZY A;  3L73 H;  2HJM A;  1BE3 H;  3EFO B;  1W59 A;  2Y0P A;  4AE4 B;  4MW3 A;  4EFB A;  3BRJ A;  2FL4 A;  3I5D A;  5JQG A;  5EC1 C;  4DUZ B;  1S5J A;  5DS4 A;  2Q67 A;  1TWG A;  2XLV A;  4ICG A;  3G6E V;  2OJQ A;  1Q0K A;  1TWA A;  1RSO A;  1FTS A;  2PYL A;  1QR8 A;  3AG1 B;  4PAC A;  1MA1 A;  3TGU H;  1OCO C;  1M1K W;  3CC7 V;  2W4M A;  1WB7 A;  1NR1 A;  1MOF A;  3K5O A;  4DK1 A;  4FPP A;  5B3S B;  4KUM A;  3IJ4 A;  4MVU A;  1NH2 D;  3JAL A;  3TCU A;  3FB6 C;  3X2Q B;  3LNM B;  2XT9 A;  1GM7 A;  1N33 O;  1K33 A;  3JSZ A;  2LW1 A;  1HNZ B;  3D3I A;  3C7J A;  3CAX A;  4AHC A;  5JVD A;  3MHS C;  2L6F A;  1KD1 W;  2HJF C;  3TQO A;  2VWK A;  1UG7 A;  2QEX V;  3DXR A;  4DR5 B;  4LF7 O;  3RYF A;  1BHA A;  3KKY A;  3JD0 A;  2QR4 A;  4DUY B;  2UUA B;  4O2A A;  3W4Y A;  4CS9 C;  2AHY A;  4LBE C;  4U3F H;  4H44 B;  2O9X A;  3CRR A;  5D91 A;  1G8X A;  2N04 A;  5HSW A;  4K35 A;  2OIE A;  4B3S O;  1MQV A;  2A68 F;  1H38 A;  4F4L A;  1E1R G;  1D0Y A;  3RQE A;  2R7V A;  4DV0 B;  5DEC A;  3L1M A;  1N34 O;  1M56 C;  4CSA C;  1W0J G;  2XL4 A;  3E70 C;  3SPC A;  2LP7 A;  1TFO B;  2F4V B;  4AIL C;  5COF A;  4CH6 A;  2EPM X;  1IBM B;  3HB3 B;  3U11 A;  5EYP A;  1LNQ A;  3CMA V;  2OT5 A;  2QM4 A;  4LFA B;  1D0X A;  3ZBH A;  3S29 A;  4KFM A;  4CZZ A;  3M8A A;  4TQF A;  3ZHR A;  4FM0 A;  1GN6 A;  4CJG A;  4KHP B;  1EN4 A;  2KB1 A;  2YRF A;  2XAS A;  5JH7 A;  1Q0D A;  4G0H A;  2QWR B;  5KX5 B;  3K1I A;  1YVW A;  3VM6 A;  2YUA A;  4MTX A;  3LDE A;  3N2G A;  1SR2 A;  4DRX B;  1GH6 A;  3H65 A;  3PMR A;  2WVO A;  3M79 A;  4KC9 A;  3E8G A;  4YJ3 A;  1B04 A;  4YT5 A;  1J95 A;  1NBM G;  4J42 A;  3WB0 A;  4AL0 A;  1EA8 A;  1OCR B;  4CS9 A;  3CSX A;  4I50 A;  3SPH A;  1HNW O;  2XM0 A;  3RIP A;  5J2T B;  1NZ6 A;  2YIB A;  3A9C A;  1W0K G;  5CA1 B;  2YLD A;  1Q43 A;  2NR5 A;  2QDO A;  5EBL C;  4E2L A;  4LCU C;  1R1B A;  1VAR A;  3F47 A;  2C04 A;  2YL3 A;  4DV5 B;  1KBH A;  1DOW A;  1SYQ A;  1SZI A;  1T01 A;  4X66 O;  4O4L A;  3OEE G;  4NYK A;  2YLG A;  3MX3 A;  3TJ5 A;  3OR7 C;  4ZHQ B;  4HBN A;  4Z2W A;  1O87 A;  4YN0 B;  1Z5W A;  5A9G A;  1YTF D;  4CSA A;  4JI1 B;  3C8G B;  4X20 B;  4K7B A;  2ZXW C;  3TK0 A;  2EIK C;  3B2E E;  1QCE A;  3MFN A;  1PNK A;  2ADQ B;  2NN4 A;  2ZE7 A;  4JZG A;  3U0Z A;  1LPE A;  3IQT A;  1ZX3 A;  1WN7 A;  2AWY A;  3STL C;  4BJ6 C;  1NVP D;  1R73 A;  2EPO A;  4U5E E;  3K08 A;  4CS8 C;  2IW5 A;  5KLV H;  4BPM A;  3K58 A;  2UU9 B;  5JT4 A;  2QE7 G;  5BQI A;  2IH1 C;  1MMM A;  1GS9 A;  2P0N A;  3EG9 B;  2RSE B;  1OCO B;  4JC7 A;  3AG3 B;  3T9O A;  4PDR A;  3FXH A;  4UVC A;  3V5Y A;  3M99 B;  2R7R A;  3H9V A;  5IJ0 B;  3AK1 A;  3QO5 A;  3C3S A;  2P90 A;  3LUT B;  5JS5 A;  4JYA O;  1GRJ A;  1QU7 A;  3U0C A;  2UXC O;  2KK1 A;  2ZM6 B;  5FNV A;  2PX0 A;  2YI9 A;  3TJ6 A;  4EHP A;  1VP7 A;  4NTF A;  3SYN A;  4MVS A;  1MZE A;  1YZA A;  4U7O A;  1YI2 V;  2JS3 A;  3H1L H;  4MVZ A;  5A6A A;  3RVY A;  3OAA G;  5LOV B;  4JYY A;  3U2L A;  4I0X A;  4YIP A;  2DN9 A;  4O2B B;  2FTK A;  4MVR A;  3SYO A;  3CEI A;  1XHX A;  2J0W A;  4RD9 A;  1Q0F A;  1JRA A;  2JJ2 G;  4JAU A;  1LIH A;  1AEP A;  1GN2 A;  3MBG A;  2MHR A;  4BJ6 A;  1ZHW A;  4QNH B;  5JJJ B;  4EKW A;  2PZS A;  5L3D A;  2ZT9 B;  2ZE6 A;  4CS8 A;  1IXB A;  3OGC C;  5J2U B;  2DYS C;  4DV1 O;  2ZKO A;  4P9P A;  3KG2 A;  4JI7 O;  5KMG B;  3JCU Z;  1I4Y A;  1WAS A;  3I56 V;  3TUL A;  3CPW U;  4I1M A;  5JVE A;  1NBB A;  3HKB B;  3NYM A;  2QWO B;  3B9Q A;  4JW1 A;  5JP7 A;  1QR9 A;  1M57 B;  3K5L A;  4WFE A;  4I44 A;  4LF8 O;  4FZ1 A;  3ECS A;  4I4T B;  4KI2 A;  4UB8 Z;  5FPR A;  3M1C B;  2LFF A;  3ASN C;  1PPJ H;  1EI7 A;  3D8C A;  4XLN F;  4ZBM A;  3DWW A;  1H2N A;  3EVK A;  2QKC A;  2EUL A;  3UKM A;  2RCV A;  3ZN1 A;  1J5E O;  1MMG A;  3CRQ A;  1XBL A;  1W2B U;  1V54 C;  2F93 B;  1H8E G;  1AR1 B;  3B77 A;  4I9W A;  1Z63 A;  3CXC U;  1K8A W;  4U5F E;  4I5S A;  5CN0 A;  3LDD A;  3N27 A;  4JI6 B;  1AJQ A;  4JTD B;  1Z23 A;  1RJ9 A;  3IQ6 A;  1TGO A;  1PD0 A;  2Q68 A;  5B1A B;  3T4R A;  4CIP A;  5AC5 A;  4IL6 Z;  3JAS B;  1TWC A;  3SGI A;  2UXD O;  1X59 A;  4JI5 O;  3AG7 A;  3FAV B;  1DF4 A;  1R6K A;  2AZ2 A;  1JJO A;  5E33 A;  2OJE D;  5DQT A;  1HW7 A;  5L0J A;  2WLL A;  2A79 B;  2LFS A;  3ML0 A;  4PA6 A;  3JYY A;  4NXM O;  2P1A A;  3SR2 C;  1PCX A;  4TWK A;  4XTK A;  1XNR B;  2YLI A;  1XNQ B;  4K0D A;  4PEL A;  3AG4 B;  5CA3 A;  3T1Y O;  2JGD A;  2WPD G;  3RGB A;  2D2C B;  2ITC C;  4BJ1 A;  3DZA A;  2EIL C;  3WG7 B;  1Q6H A;  2J8W A;  2AZ0 A;  2LK4 A;  3M4B A;  3AGU A;  2A0U A;  4JYC A;  2EPL X;  3CS5 A;  4BAY A;  1OW8 A;  4IAO A;  2XSE A;  1Y4M A;  1VLT A;  2YID A;  1FS0 G;  4IB4 A;  4FLY A;  5K1P A;  2R02 A;  3RYI B;  4XDK A;  3V5Z A;  4R6Z A;  5LBQ A;  4DXW A;  5L3E A;  1OR2 A;  5C8Y A;  4YJ2 B;  4L87 A;  2QY9 A;  2DMX A;  3HKD A;  5IE9 A;  3L70 H;  4F4B A;  1ZW2 A;  5KHH A;  2QKA A;  4B08 A;  1O3U A;  4DR3 B;  5D5Q A;  3BA9 A;  5KYU B;  2A06 H;  1Y66 A;  4MT8 A;  4GLX A;  4DO2 A;  3E8F A;  5LXT A;  2VB6 A;  5LYJ B;  4B3T B;  5TJ5 E;  4F6E A;  3ZCC A;  5KHG A;  3E83 A;  1IBK B;  3HKE A;  4X1K A;  5H5N A;  1A7E A;  3WB2 A;  3K04 A;  2HS5 A;  3M4C A;  3B09 A;  2BSK A;  1BSM A;  4AQY O;  4WFH A;  5JRA A;  1DOV A;  2IJH A;  1Q6I A;  4CS4 A;  4QDL A;  5LGT A;  1MSD A;  4OPA A;  3EGD B;  1Y6D A;  4IIJ B;  1RM1 C;  1WPB A;  3EXA A;  3I4U A;  2JK5 C;  4J11 A;  3B8N A;  2PYJ A;  1YYJ A;  3JAK B;  5T3T A;  1WJZ A;  3DM9 B;  5GPG B;  2H8P C;  4O6Y A;  4MQ9 F;  1KU9 A;  4DRJ B;  3KCX A;  1EN6 A;  3GM1 A;  4MW8 A;  4D6T H;  3O6X A;  4ER9 A;  3PCV A;  2X6C A;  5CA0 A;  4UXN A;  2WLM A;  3SXZ A;  3CC4 V;  2GUZ A;  4FZ0 A;  3NYL A;  3WU2 Z;  1Q0M A;  2W4B A;  1P4R A;  3L71 H;  3ETD A;  4X62 O;  3JAW B;  1SS3 A;  1WP7 A;  2DGJ A;  4W8K A;  4JV5 O;  1L3P A;  2B1I A;  4CBE A;  1LE2 A;  2Q8V A;  3ZRV A;  3SPG A;  2XS1 A;  4JE9 A;  4N4W A;  1S72 V;  1SES A;  1TUB A;  4NTB A;  5DED A;  2NPU A;  4LF4 B;  3RYH B;  1SQV H;  1NZE A;  2HKV A;  5LMN B;  1A41 A;  1S5H C;  2Q9C A;  1FXK B;  1AB3 A;  2XLH A;  3NR7 A;  4XPW A;  5FZT A;  3S27 A;  1A0B A;  1YJN V;  1IVS A;  3WOD F;  1WLE A;  1JPX A;  4DRH B;  1O9G A;  4K0K B;  2WSS G;  2B1G A;  4HE8 D;  1VQK V;  2UUB O;  4EEQ A;  3GOD A;  2PGG A;  5BR8 O;  1I94 B;  4C3B A;  4U9D A;  4PJM A;  4X1I A;  4JEA A;  2VQF B;  1RP3 B;  1XMQ B;  4CH5 A;  3B40 A;  1MMN A;  4JJF A;  2Q4P A;  1QHT A;  4B6I A;  3GWK C;  4E0H A;  3ZMT A;  4L8J A;  2KGO A;  1E83 A;  5BMV A;  1NSG B;  4JAS A;  1Q5O A;  4Q20 A;  4TV8 B;  1NU7 D;  1ZHT A;  1W2W A;  5DQZ A;  2BTO A;  2W9Y A;  1JFF A;  2PI4 A;  1QKR A;  4JZA A;  1E84 A;  4PDM A;  2V4D A;  4LNU A;  4GQH A;  1SQX H;  1BZK A;  4DV4 B;  2Z3Y A;  1SA0 B;  3WHN A;  3AG1 C;  3IHU A;  4A4A A;  1C02 A;  2BC5 A;  1B68 A;  3NMI A;  1RXQ A;  1DLB A;  2V3C C;  4O4J A;  4O4H A;  2X6B A;  1E79 G;  3B0V C;  1Z5Z A;  1BCC H;  3JT1 A;  3G4Z A;  5LP6 B;  1URF A;  5B3S C;  1U96 A;  2AHZ A;  1Q0G A;  2W0X A;  2M4E A;  4Q5S F;  3X2Q C;  1HWY A;  3ABK B;  5TIS Z;  1VF6 C;  1LKX A;  2R25 A;  4TV9 A;  3SZR A;  4IT5 A;  1YIT V;  4RAI A;  1DGS A;  1CPR A;  4CIH A;  4UCR A;  3ZG1 A;  3CE2 A;  2Q0A A;  4WBN B;  2VCB A;  2EX3 A;  4BJ5 A;  3AG2 B;  2PP4 A;  2UUH A;  4JAA A;  1UFI A;  4RDA A;  5A69 A;  4YY3 B;  3U8P A;  3OTO O;  4JKV A;  4XPY A;  1L0N H;  3CCV V;  2WL8 A;  4UVB A;  4UFZ A;  1COW G;  4Z9I A;  1VQP V;  2YI8 A;  3LNR A;  3ABM B;  4LFB B;  3G67 A;  1FD9 A;  1TQG A;  2QWP B;  3CRA A;  2RJZ A;  4AE4 A;  1VQM V;  3JSL A;  4LC1 A;  2HZ8 A;  4Q7C A;  4GX5 A;  2WLH A;  3JAR B;  1S05 A;  2HV7 A;  2HUJ A;  3MD0 A;  5CBH A;  1YJW V;  4I1O B;  3QTC A;  1FFX B;  3AQB A;  1P7B A;  4G2K A;  1K04 A;  3ZHQ A;  1Q81 W;  2Q73 A;  1XWJ A;  1OKK A;  4IAR A;  1WPX A;  3ABL B;  4CC5 A;  4W4L A;  4DV3 O;  3MHH C;  3CCS V;  3A11 A;  2GAQ A;  4ZLD A;  1EN5 A;  2E5L O;  4LDQ A;  2Q6A A;  5IDJ A;  2IH3 C;  1VQO V;  1SKV A;  2J9V A;  3S90 A;  4DV6 O;  1R4T A;  3SJB C;  1WTY A;  4LFC O;  4CC6 A;  4JI4 B;  2XL8 A;  1C17 M;  3SJA C;  4G27 B;  1HMD A;  1VF6 A;  1F1M A;  2J9W A;  2IJK A;  3E22 B;  2VRZ A;  5ITZ B;  3K5N A;  2NUP B;  5C93 A;  3LES A;  4C3D A;  1THZ A;  1H2L A;  5CIV A;  3CCQ V;  1D1B A;  4PFO A;  3OUF A;  1YYX A;  3OR6 C;  1M2V A;  4GT1 A;  2A6E F;  1RKC A;  2N05 A;  3P30 A;  3JTL O;  2OOC A;  5E79 Z;  1OCR C;  3VQY A;  4NTA A;  2UXB O;  3A0H Z;  4Z1M G;  3W8H A;  4FFK A;  1AUE A;  4H37 A;  5HFM A;  3BVO A;  1KP2 A;  1AI5 A;  2XLO A;  2PTM A;  4HYO A;  5IJ9 B;  1CXZ B;  2H8A A;  1BGY H;  3VOU A;  4X1Y B;  4YXW G;  1N33 B;  2PFD A;  5AC4 A;  2C03 A;  3FOP A;  3N2K A;  3U10 A;  1V4A A;  2DB4 A;  1WA8 B;  3AJM A;  4EUK B;  2H7B A;  4UVA A;  1PNM A;  1EBO A;  4JI3 O;  4UDV A;  2GSM B;  1D1C A;  2CTP A;  3UM7 A;  1VYK A;  5LA6 B;  1OQC A;  2BOC C;  3OT7 A;  2PBE A;  2LSE A;  3LSU A;  4PD4 F;  2ASR A;  3BY6 A;  3JD4 A;  4BWA A;  2VS0 A;  3H2U A;  1SRY A;  3HKK A;  3AK2 A;  2KW3 C;  1ZU4 A;  3IPM O;  4U5H A;  4JI0 B;  1P49 A;  4NCQ A;  1A7V A;  3OD4 A;  5IT9 N;  2YWA A;  3OMN B;  4JF3 A;  4XWJ A;  5CI8 A;  5LHH A;  1YXB A;  1RKE A;  3N24 A;  1ZLZ A;  1RPO A;  4UCO A;  2OWO A;  2JS5 A;  3L8J A;  2O57 A;  1TVK B;  4K8Z A;  4JPR A;  5KX5 A;  1FMW A;  3VAY A;  4AX2 A;  2VH3 A;  3AG3 C;  4D7T A;  2ETS A;  2ODM A;  1XZQ A;  3SEO A;  4DRX A;  3BRC A;  4WCE V;  4EBJ A;  4DR4 B;  1BZ4 A;  4DBQ A;  3OM3 B;  1Q6U A;  4FAP B;  2VCC A;  2I8B A;  3K6B A;  2QWQ B;  4J7T A;  2KG7 B;  2IYL D;  3OE7 G;  3OGI B;  5J2T A;  2AGA A;  4KXR A;  3ZMZ A;  1WN0 A;  3NMJ A;  4C7O B;  5FLX N;  1SQB H;  3HPL C;  3T1H B;  1F51 A;  4DOZ A;  2D3O W;  1N36 O;  1L0L H;  5F5F A;  3W7U A;  2NSF A;  2HSQ A;  1JPN A;  2Q7E A;  3SYQ A;  3RQF A;  4D4X A;  2WA3 A;  2YEV A;  2ZDI A;  1VQ7 V;  2EIM B;  4ZHQ A;  4B3R O;  1O5H A;  2KSD A;  2ICW G;  1Y67 A;  3C8G A;  1U0B B;  4X20 A;  5KAF Z;  3EHM A;  4ASU G;  2KKW A;  4OGQ B;  2OQM A;  4X64 B;  3HKC A;  2XLM A;  3IC7 A;  1AJP A;  1VQ6 V;  3GEE A;  5KUK A;  3U8V A;  2YIB D;  2ZE5 A;  1HNW B;  1WWP A;  1ZHY A;  3LS1 A;  3Q6N A;  4BR6 A;  4N23 A;  2QTO A;  4DUZ O;  3AK3 A;  3JYC A;  1HNX O;  3TK1 A;  1NI8 A;  3JCU Q;  1UJW B;  2NSG A;  1I4Z A;  1YDX A;  3ZIA G;  5CMU A;  2A0L A;  3JAT B;  4BEJ A;  4OPH A;  2Q3T A;  4X66 B;  4UV9 A;  5IYZ B;  1OXK A;  4P9O A;  2H7V C;  5FCL A;  4MS2 A;  4FLW A;  1M57 C;  2GV9 A;  4XEK A;  3H1K H;  4OXS A;  5IJ0 A;  4KBL A;  2A1D D;  2HP8 A;  1LM3 B;  4GX0 A;  4P2Z A;  2GBO A;  2Q00 A;  2H94 A;  1YJ9 V;  4H4K C;  1ZWI C;  2XLE A;  1K7D A;  3D36 C;  4GCZ A;  2XRH A;  1VQ8 V;  3CWB H;  4JVS A;  4KP4 A;  5JLI A;  1Z5V A;  5JQG B;  2H7O A;  1B6Q A;  2BE3 A;  3EH1 A;  2W0F C;  4DV2 B;  1E86 A;  3VYW A;  3AEI A;  1XI1 A;  2R72 A;  4I55 B;  4P9F A;  4ABM A;  4DUY O;  2UUA O;  5B1A C;  5T1D B;  2JRI A;  3E35 A;  3QO8 A;  4C7U A;  4XEV A;  4O2B A;  2QSA A;  1PP9 H;  2ZIO A;  3C63 A;  4L6R A;  1ORJ A;  5BUO A;  2R7T A;  4PA4 A;  5L0H A;  3QG5 A;  2OU6 A;  2HVK C;  2Z15 A;  2Q7H A;  3FYI B;  3MAQ A;  1R3K C;  1YLM A;  3EJN A;  2UXC B;  3K1H A;  3B8M A;  5DVW A;  3C3T A;  2VQE O;  3G6B A;  1RPR A;  3ABT A;  3QTH A;  2UUC O;  4DW1 A;  3O9O A;  5J2U A;  3U5S A;  5A6B A;  1QQ3 A;  3AG4 C;  4U9E A;  2A3Q A;  3ETE A;  4RUE A;  5KMG A;  4JGS A;  4UB6 Z;  3WG7 C;  5CI9 A;  2PX3 A;  2WZL A;  1LR1 A;  2Y4U A;  4E4E A;  3UMI A;  1SZT A;  3QVZ A;  1EFR G;  3RH3 A;  2AW9 A;  3HKB A;  1OCZ B;  1QVG U;  4YIO A;  1BR2 A;  4O6M A;  2NG1 A;  4K3A A;  4QPK A;  1IBM O;  4DR7 B;  4N21 A;  1YSC A;  3I5Q A;  1SZX A;  2A9H A;  3HNI A;  5JUA A;  4OIR F;  3C90 A;  3FAP B;  3T2M A;  2QM7 A;  1FAP B;  3D36 A;  4KHP O;  4UCU A;  1NLX A;  1VQ4 V;  2GWW A;  4IJJ A;  1KC8 W;  2WVN A;  2CCY A;  2OIG A;  1E2X A;  3IQ5 A;  2XXA B;  4QE7 A;  2VCA A;  1SER A;  3E86 A;  4EWC A;  3FDQ A;  3BAA A;  3ABU A;  1AP5 A;  4JI7 B;  1MMD A;  4N6C A;  1S7Z A;  1PD3 A;  3ZHS A;  4R8C A;  4Q6G A;  1NH2 B;  1XUQ A;  3JAS A;  1OV9 A;  1ZL8 B;  2XND G;  3EZI A;  4H13 B;  4KL1 A;  5L0I A;  5EYP B;  3J81 N;  1GM9 A;  4LF8 B;  3P3P A;  2HHH O;  2LIG A;  4MVO A;  4X89 A;  2Y3B A;  1D5A A;  1ORY A;  1Q90 D;  3OFN G;  3GWL A;  3JRT A;  2FB5 A;  3I5P A;  4FIP C;  3TD7 A;  2K9P A;  2Y39 A;  5JH7 B;  2F1M A;  3T6B A;  4HFK B;  2ATK C;  3H1H H;  4PFP A;  2BCC H;  2E3C A;  5H6R A;  5DS6 A;  4ZIB A;  1YIJ V;  2KJG A;  3W7W A;  3CCL V;  2XUM A;  4JI1 O;  4LH7 A;  2VAS A;  1H8H G;  3SYA A;  2P6V A;  2BOB C;  4NVP A;  1E85 A;  2MYS A;  4YJ3 B;  4OIN F;  3SYP A;  3ZIB A;  4JI5 B;  5KHK A;  3EZH A;  3RYI A;  2R03 A;  4E7Z A;  3ZRW B;  1H6G A;  3K79 A;  4YJ2 A;  4RBN A;  3Q4H B;  2UU9 O;  2FML A;  1AR5 A;  1FAF A;  4NXM B;  3ZTZ A;  3NDB B;  1L1F A;  3SP1 A;  1V74 B;  2R7O A;  2ZPA A;  4FES A;  3UMK A;  1K4C C;  3K3W A;  4GKK B;  5KYU A;  4TSF G;  4FM1 A;  1FXK C;  1ZSP A;  4GX1 A;  5KYX B;  5LYJ A;  3K59 A;  1K73 W;  3T1Y B;  1WAT A;  5JWP A;  1YA9 A;  2FFH A;  2Y48 A;  1S5L Z;  5B1B B;  1US6 A;  1IUR A;  4WFB V;  4J7Z A;  3L75 H;  2K1E A;  4PA7 A;  1U97 A;  3W7T A;  1RMV A;  2A7W A;  4BJT A;  3RW0 A;  1ROP A;  5F2V O;  5GW7 A;  2B9Z A;  3UT5 B;  1LVK A;  3W8I A;  2NLJ C;  3ZED A;  2IM8 A;  2ZM6 O;  4IIJ A;  2YVK A;  3FB7 C;  2BL2 A;  3S9O A;  5L3V A;  3JD2 A;  4H54 A;  3ZHT A;  5E2Q A;  1I0H A;  1K3E A;  4NC3 A;  2UUI A;  1V55 B;  4PJN A;  2DW4 A;  3JAK A;  1HW2 A;  3OUS A;  2GTS A;  4JI8 O;  1R6N A;  4LF9 B;  3HNK A;  3J7A U;  4FLZ A;  4ZLC A;  5LHI A;  1T5O A;  2NUT B;  3LLI A;  3UO2 A;  3APO A;  3PN1 A;  4H0L B;  2JGU A;  1MMA A;  5LMU O;  5FL7 G;  4WFG A;  3E2E A;  5HV9 A;  4Z9H A;  2V7Q G;  5A6K A;  2M64 A;  1BR4 A;  3G80 A;  1M5I A;  5LP6 C;  4IYH A;  3J06 A;  1QQC A;  3CCE V;  1YF2 A;  4HFF B;  2P5O A;  3ABK C;  1TUE B;  3DKA A;  1D1A A;  1YTF B;  1S0V A;  1KU2 A;  3FX7 A;  2QWN B;  1H7I A;  1BT8 A;  1G5Z A;  4YK5 A;  2DYR B;  5DM6 V;  3RYH A;  5L3C A;  2KYH A;  1XDC A;  2NNU A;  5B66 Z;  1XHZ A;  4XQ1 A;  1FXK A;  3L34 A;  3SPJ A;  3NG1 A;  1BS3 A;  4J7Y A;  3ZQY A;  1OHH G;  2IM9 A;  4EIY A;  1NVP B;  3EHB B;  1AI6 A;  1ZAU A;  3AG2 C;  4F6R B;  4IYI A;  2EIN B;  1M6T A;  1JR9 A;  1OCC B;  4QGP A;  2Y3H A;  3JD1 A;  4I3M A;  3F7Y C;  2LP4 A;  4RUF A;  3UQ8 A;  5CB4 A;  2Q4F A;  1L8D A;  1QZX A;  4WGZ A;  5T3W A;  1G6U A;  5IY5 B;  2IXM A;  3SYC A;  4X62 B;  4J80 A;  2F95 B;  2WAM A;  2DQ0 A;  1WGW A;  1PKX A;  3ABM C;  2G38 A;  3MDS A;  2X7R B;  3M15 A;  5EGY A;  3C8Z A;  4P9T A;  2I15 A;  2PNO A;  3UR3 C;  2Q9B A;  4RO2 A;  2OYQ A;  2PI5 A;  4JI6 O;  5GTI Z;  1OW7 A;  2DWD C;  5COG A;  4QI2 A;  3CCM V;  1ZHZ A;  1AI4 A;  3ZMV A;  2FYU H;  4DYL A;  2XLD A;  4LR3 A;  4B3M O;  1Z2G A;  4TV8 A;  2XAG A;  4ZKI A;  3OMI B;  5L3B A;  4WJ0 A;  3JYH A;  3ZSU A;  2IXN A;  2XM4 A;  3FFQ A;  3I55 V;  5L0F A;  1HY5 A;  3DJU B;  1SA0 A;  3FMS A;  4LF6 B;  3ABL C;  3T1C A;  4EB6 B;  4FLV A;  2DE0 X;  3KYJ A;  3K06 A;  1PV3 A;  4BW9 A;  1PM9 A;  2YL7 A;  5LP6 A;  5BR8 B;  3DC5 A;  1V9P A;  2EPK X;  1M93 A;  1N0J A;  5EIB C;  256B A;  4OX9 B;  1ST6 A;  2ADP A;  2L35 A;  3ZRX A;  3K03 A;  4PJJ A;  2L6L A;  4J9Y B;  2DI3 A;  1EKY A;  4IHJ B;  4WBN A;  2B5U A;  2BTQ B;  1P7G A;  1PL4 A;  1VIB A;  4CH4 A;  4G7Z F;  2ZIM A;  1GGQ A;  2ZIN A;  1HP8 A;  2R7S A;  4YHH O;  3JRM O;  2CAZ C;  1H9T A;  4K8X A;  3K9A A;  4LWS B;  3KL4 A;  2EPN A;  3HNJ A;  5KYW A;  3DXJ F;  2Q0O C;  3M7M X;  4B3T O;  3G71 V;  2LQG A;  1I5N A;  2P7V A;  4A2N B;  5KYY B;  3ASO B;  1IBK O;  4YT4 A;  2Y69 B;  3A8T A;  3CX5 F;  1VMG A;  3BCC H;  3QW0 A;  4JCH A;  4DR2 B;  3DE8 A;  1LS4 A;  2XAJ A;  3JAR A;  1H2G A;  4ONS A;  1TAE A;  4GKJ B;  3T6G B;  3L8I A;  3GEI A;  2XAH A;  3QVN A;  3WB1 A;  2B0H A;  2D5R B;  3EGX B;  1KKC A;  3FVY A;  4D7S A;  1NFO A;  3LLK A;  3Q6M A;  2WVQ A;  1FJG B;  4ZOL A;  4DV7 O;  3K5M A;  1BQ0 A;  1Z3I X;  3LAY A;  1D0Z A;  2MW2 B;  2WLN A;  4C3E A;  5EC2 C;  4HAM A;  4O4I B;  3HLZ A;  2EIJ B;  2XAQ A;  5ITZ A;  2P61 A;  1FNT c;  2FGY A;  4LF5 B;  1IXM A;  4OIQ F;  1Q8I A;  4HNA B;  1N4C A;  3ZJZ A;  3MYI A;  2IJJ A;  1M9N A;  2CH7 A;  4NTW A;  1HDJ A;  4YL3 A;  1S76 D;  1OKK D;  3CEX A;  3EFF K;  4J41 A;  4YT2 A;  1I5Y A;  4W8P A;  1NQT A;  5EK0 A;  1RCP A;  4DRI B;  4DV3 B;  3PJS K;  2UXX A;  1AIL A;  2CK3 G;  2Y0I A;  4MVM A;  1NJI W;  2E5L B;  4NXN O;  1DTO A;  1BDJ B;  3O39 A;  4DV6 B;  3CJH B;  5IWA O;  5LMN O;  3S3W A;  1XOU A;  5IJ9 A;  4FMT A;  4OD4 A;  2GDC A;  2A6H F;  1DK1 A;  2LD6 A;  4X1Y A;  4PJL A;  3GVM A;  3ICX A;  3DD7 A;  4TOI A;  3H1J H;  2EIM C;  2AVK A;  1HR0 O;  3DSQ A;  2AP3 A;  4GUN A;  1IZM A;  3LNN A;  3HTK C;  1WA8 A;  1AVM A;  5CA0 B;  2GUZ B;  1G8M A;  2RNB A;  1OW6 A;  4W4K A;  3CQZ A;  1VQL V;  1K4D C;  5LA6 A;  1QLE B;  2OTL V;  3EFO A;  3QVY A;  3V7O A;  3LEO A;  1EQ1 A;  3D3Q A;  4J10 A;  1F4M A;  2JVD A;  4X9Q A;  1Z6A A;  1WOL A;  3VF0 A;  4CS2 A;  2UXB B;  1VMA A;  2YQY A;  3Q7G A;  4XDJ A;  2Y3G A;  1XMQ O;  2LQT A;  1MZF A;  3RYC B;  3K33 A;  1TUB B;  2GFH A;  2WLI B;  2ZCE A;  2R7U A;  2X51 A;  4FLX A;  4ZI7 B;  1CP9 A;  4FLU A;  3RWR D;  3CP1 A;  4N6H A;  3G4X A;  3KCY A;  3SXK A;  5L0D A;  1TVK A;  4CDY A;  1ZUQ A;  1SC5 B;  5H9C A;  4X0R A;  1Z7Q c;  4DV4 O;  2RDC A;  4DBR A;  2W6J G;  1LI5 A;  4NTY A;  4X88 A;  1H2S B;  4BW5 A;  2EZO A;  1VQ5 V;  4X65 B;  1ENV A;  3ETQ A;  3POV A;  2Q69 A;  3JSE O;  4Z9J A;  2YL1 A;  5EBW C;  1CPQ A;  1N32 O;  2KG7 A;  2J0X A;  1R5I D;  4C7O A;  1QVX A;  4JI2 O;  5J9P C;  3L0I A;  2EBO A;  5BZB A;  2JDI G;  2G3V A;  5BMV B;  4J9Z B;  2WA4 A;  5E1A C;  2ZR2 A;  2B0J A;  4JCZ A;  5H2F Z;  2QKS A;  2IBF A;  2GHY A;  4EBK A;  2J9B A;  1NTM H;  2L7A A;  3O65 A;  2LFD A;  2HEP A;  3LJB A;  4E18 A;  1WP8 A;  4YY3 O;  1QPU A;  3S0X A;  3OW2 U;  2YL0 A;  2LFR A;  2XAF A;  1JAF A;  2Y3D A;  5GON B;  4DK0 A;  2LW7 A;  3IC9 A;  1ZW3 A;  3DC6 A;  4D4N A;  1I5X A;  1XMO O;  4LFB O;  1HW1 A;  4UCT A;  5KUM A;  3ZQV A;  4DR1 O;  5F5H A;  3VRC A;  3CC2 V;  3AQC A;  3RVZ A;  3DE9 A;  3L74 H;  3E89 A;  2QTV A;  3K0G A;  5L0G A;  1J8M F;  4TUY B;  3R66 A;  4LF7 B;  3FYE B;  1IW7 F;  3BFR A;  5FPO A;  3JAT A;  5COM A;  2V26 A;  1IDS A;  3FKS G;  2QE9 A;  4JUR I;  3JD3 A;  5IYZ A;  4WAB A;  3QF7 A;  1AI7 A;  3RFR A;  3MLG A;  1OCZ C;  5D92 A;  2YIA A;  4WFA V;  1BMF G;  5DS5 A;  2EJ7 A;  2MWQ A;  2HMQ A;  3C8G D;  4LLE A;  2E74 B;  4BIZ A;  1Y74 B;  4B3S B;  1HE1 A;  4WGY A;  1XZP A;  1CGO A;  3ZRS A;  2WZG A;  4FK5 C;  3T4D A;  2J7P A;  4JI4 O;  3Q7L A;  1ZYR F;  5BY1 A;  3GEH A;  3ITF A;  4U3J B;  1GTO A;  4DR6 O;  1N34 B;  1FFT B;  4Q4Z F;  4OIO F;  3N0T A;  3GWN A;  2L9J A;  1HNX B;  2ITD C;  1NFN A;  2ZXR A;  3CRM A;  1N1C A;  3CZ6 A;  4O7G A;  1NS1 A;  2YZS A;  5BQH A;  4I55 A;  4QJF B;  5IYD O;  2GTA A;  1ZTE A;  2R7W A;  3OEH G;  5CA1 A;  2RQ6 A;  3UNG C;  1Y76 B;  2VWJ A;  1YAU O;  4LDK A;  1T6I A;  4FLT A;  2RD9 A;  1ZVZ A;  1IBL O;  4BEM J;  2L81 A;  1A32 A;  1TA8 A;  4I9Q A;  3DAF A;  5F28 E;  2CGE A;  2XOK G;  1Y6X A;  3B29 A;  3K1I C;  1AJN A;  2L6H A;  1NR7 A;  1CGN A;  3IEE A;  3G4S V;  3VBB A;  2CDY A;  4RWU A;  1KB9 F;  4CDV A;  1VF5 B;  4R7C A;  1JOY A;  4IWB A;  4DW0 A;  2IU3 A;  1M2V B;  2YXH A;  5JSL A;  1PNL A;  4PV1 B;  2YXL A;  3TJT A;  4CS3 A;  4MTG A;  3EQL F;  3K7D A;  3ZHU A;  2OCC B;  4XBF A;  4JI0 O;  1T6U A;  2KSF A;  3GOR A;  4LDR A;  4GEH A;  1YDI A;  4AK9 A;  2QM8 A;  4E0I A;  2PUS A;  2OTJ V;  4PA9 A;  3EG9 A;  4R50 A;  3L9D A;  3CCR V;  1F4N A;  4FFB B;  3SPI A;  2R70 A;  2VQE B;  5A6B D;  2UXN A;  3UCS C;  1K92 A;  3N2K B;  5JJN B;  2KQ9 A;  2UUC B;  2L6G A;  2XXA A;  4PHZ A;  4DR4 O;  2EJR A;  3R2P A;  2OEX A;  1A7D A;  5LGN A;  4GYT A;  2HG5 C;  3ZDL A;  1L7C A;  2ZQM A;  1MG1 A;  1D5N A;  2R9R B;  5B1B C;  3DJN B;  5EZY B;  4NB5 A;  4G28 B;  2R9A A;  1ZL8 A;  1HNZ O;  1KTM A;  3ZN0 A;  3ATP A;  5JCO C;  3WAQ A;  1LUV A;  3T1H O;  3P32 A;  1T9K A;  1YJG A;  4DR5 O;  2CGO A;  1E1Q G;  4FVM A;  1RKE B;  2P4K A;  3T4Z A;  1RSO B;  3CME V;  1V55 C;  5LOV A;  5EHH A;  1JVM A;  3SJC C;  1FFH A;  3RT3 C;  3U3F A;  4E7S A;  1FYJ A;  1XIL A;  2QJ1 A;  2HR3 A;  4JJG A;  2OCH A;  5K0I A;  2KNH A;  1VTM P;  1B06 A;  2E87 A;  3JAL B;  2XTA A;  4JYA B;  2F66 C;  3FOO A;  5BXZ A;  4X64 O;  1M90 W;  2X0L A;  3U9J A;  3KPH A;  4NY3 A;  4DV0 O;  1HE9 A;  1UFB A;  1R6T A;  3VQW A;  5JVD B;  1JCH A;  3ZRW A;  3DXR B;  2HHH B;  1K40 A;  1SQG A;  1MSW D;  3Q4H A;  3C18 A;  2HKO A;  3RYF B;  4IGG A;  4UCV A;  2F4V O;  1ORS C;  1FXH A;  1GK9 A;  4TQD A;  2DYR C;  4O2A B;  3A2F A;  4PA3 A;  3TXS A;  2D4U A;  2M6Y A;  2CTR A;  1K9M W;  2YEV B;  4CH3 A;  2JEU A;  1FKA O;  5KYX A;  1FR0 A;  4QE9 A;  1HMO A;  3K0D A;  4I4T A;  2ARH A;  4LFA O;  3CCJ V;  4BIO A;  1F23 A;  3DMD A;  4JZ2 A;  2EIN C;  1OCC C;  4PK4 A;  3KH2 A;  3U3B A;  4J7K A;  3KYI A;  1NTZ H;  2X6A A;  3HKC B;  1R3J C;  1YVI A;  3K66 A;  3UGO A;  3JCZ A;  4XPX A;  3UGP A;  5IY5 C;  5JCO A;  4ULW A;  3K9S A;  4DV1 B;  3UT5 A;  1OR3 A;  1KNY A;  1YZC A;  2Q7G A;  2WLJ A;  4XLP F;  5A6J A;  1KEC A;  1Q82 W;  4TT3 G;  3P3N A;  3LSS A;  4EBB A;  1PL0 A;  2W45 A;  2CE4 A;  3ETG A;  5AG2 A;  3OWT A;  1P84 F;  5KHJ A;  3S28 A;  4DV2 O;  1MND A;  2BE5 F;  4X8A A;  3L72 H;  1YA7 O;  3FAV A;  4PDL A;  2HMZ A;  1FXV A;  2KC3 A;  3GM2 A;  1FPO A;  3TXQ A;  2GA0 A;  1MNE A;  2NUT A;  2XLW A;  3R7C A;  1O9H A;  4DV5 O;  1SMY F;  2R05 A;  5LHG A;  2RMK B;  1N0N A;  5DLJ A;  1K5S A;  3WFV A;  1J5E B;  5CBF A;  3OA1 A;  3THO A;  3N2G B;  3TOM A;  1SF8 A;  2ZE8 A;  3BHP A;  3N2Z B;  4BG0 A;  2DWE C;  3DM5 A;  1KP3 A;  2P22 C;  2HFE C;  3U9M A;  1VK5 A;  1GMG A;  2UXD B;  4I50 B;  1LS1 A;  2JPU A;  4CBC A;  4JI8 B;  2MK3 A;  2IBZ H;  2E75 B;  1T5E A;  4DR7 O;  4U5B E;  1C03 A;  1G4Y B;  3T6J A;  1H2K A;  1SQP H;  2DJV A;  1AR4 A;  3VQV A;  1AVO B;  4F6R A;  1SF9 A;  4OD5 A;  3PHF 2;  5LMU B;  2WB7 A;  4PI2 A;  3ZHV A;  1K97 A;  4O4L B;  3TOL A;  2P67 A;  3CD6 V;  1GAX A;  1NG1 A;  2HFI A;  5L3G A;  1M56 B;  2JIZ G;  4JTA B;  1EZJ A;  3GB7 C;  3OTF A;  1Y4C A;  4JAV A;  3SJQ C;  2FKX A;  1UPG A;  2P7T C;  3ASO C;  3BPZ A;  3FD9 A;  2Y69 C;  3DTU B;  3GWO A;  2F43 G;  4HZ3 A;  1BHB A;  2VC9 A;  2KQX A;  2XS8 A;  1NKD A;  3EGD A;  3LSQ A;  4FX5 A;  1ARO P;  3RYL A;  3W2V A;  4QIW F;  5AGF A;  2IXO A;  3S3X A;  4EB6 A;  1J8Y F;  2Q7R A;  3JZ0 A;  3GAN A;  1K5Q A;  1BR1 A;  2R7Q A;  4XDL A;  4UCS A;  2ZXP A;  1CGM E;  1EZV H;  4QI0 A;  1PV0 A;  5B1O A;  1KKD A;  4U5D E;  1F7Y A;  2YXY A;  4QPJ A;  5H6Q A;  2R9I A;  1RFY A;  2EIJ C;  3E8H A;  2FAP B;  4AQY B;  1MNG A;  1S77 D;  1KYO F;  4B3M B;  4IHJ A;  3JAW A;  2BTQ A;  2QTS A;  4NQF A;  4PDV A;  5FNV B;  1BQZ A;  2QA4 V;  3IQC A;  4G7O F;  2G3K A;  1KQS U;  3UO3 A;  2OEV A;  1YZB A;  1OZ0 A;  3QNE A;  1JR8 A;  1OXB A;  3PDM P;  1BBH A;  4LWS A;  4J30 B;  4I0X B;  4GKK O;  2GDS A;  2X0C A;  3ZMU A;  4YL1 A;  4O6N A;  2DOS A;  5LL6 Y;  3H1I H;  1Q7Y W;  2ZXW B;  2EIK B;  2M7W A;  3K57 A;  3CSK A;  5KYY A;  3NRH A;  3KZI Z;  4FJC C;  3KKB A;  4U5G A;  3B0P A;  5E3C A;  3ZTM A;  2CNW D;  2LGQ A;  3F7V C;  1QNM A;  2YKZ A;  3H01 A;  3MYF A;  2AXT Z;  2IXP A;  5BQG A;  3STZ C;  4JV5 B;  1ZZP A;  4JTC B;  5KHI A;  1Q86 W;  1QLE C;  1QBZ A;  4LLC A;  2ZD9 A;  3AOU A;  3DAG A;  4OIP F;  1ZU5 A;  2YS8 A;  1OJH A;  3FB8 C;  4KNW A;  2QGN A;  1I08 A;  2IU0 A;  2QUP A;  3EGX A;  2XL6 A;  2QNL A;  1N8R W;  5D5P A;  3R65 A;  3F46 A;  3B71 A;  4YHH B;  5E3A A;  1G4U S;  4IRU A;  1R3I C;  4AI8 A;  1MAB G;  5HFL A;  4MTF A;  1JOG A;  1YCI A;  4LF9 O;  4O4I A;  2E76 B;  4EFE A;  1WAZ A;  2WWW A;  2J9U A;  4UUJ C;  3LEV A;  3NKD A;  4HNA A;  2C2A A;  2Q9A A;  2UUB B;  3ZMS A;  1XNR O;  4IAQ A;  2ETN A;  3UMH A;  4CX9 A;  3EHN A;  1NTK H;  1XNQ O;  3EPV A;  5B1N A;  3B0U X;  2P4V A;  4B7K A;  1EM1 A;  2YDE A;  4FM2 A;  1LI7 A;  5KAI Z;  4PR9 A;  4YL0 A;  3RN4 A;  2Q9L A;  5CBG A;  1JPJ A;  1M2O A;  1RJ9 B;  1U6H A;  3ZX6 A;  2CNW A;  2AU5 A;  4DV7 B;  3CJH A;  3NMK A;  3CB2 A;  5EIB D;  3KMI A;  3VQX A;  1VQN V;  3FB5 C;  3US6 A;  3W7S A;  4N06 A;  2CW0 F;  2WLL B;  3DI5 A;  2JX0 A;  3O10 A;  5KA5 A;  2HVJ C;  4RQE A;  1CEZ A;  4ULV A;  1VLS A;  2G62 A;  2CDQ A;  3A0B Z;  4DR3 O;  3CRC A;  1GM8 A;  2JD3 A;  4Z1V A;  1GKF A;  2Y4T A;  3BA8 A;  2F23 A;  3HNL A;  2DYS B;  2Q5Z A;  5IYB O;  4FWV A;  3CHX A;  2JGD B;  5KYN A;  3F5W C;  1KUQ A;  2H3O A;  4O79 A;  2YIC A;  1YAR O;  4I7Z B;  3RYC A;  1FMV A;  4DVZ A;  2IJI A;  2ILM A;  4NXN B;  3X1O A;  2YC0 A;  2WLI A;  4DVY P;  1FFX A;  5IWA B;  4MTO A;  1IX9 A;  4DJ9 A;  4ZI7 A;  5L3F A;  4LER A;  5JJE B;  2QLA A;  4RQF A;  1BL8 A;  4LAC B;  1XRE A;  2WLK A;  3ASN B;  5C8Y B;  5IYC O;  1KMI Z;  4WF9 V;  3OTO B;  4J7J A;  4KNV A;  4BJ5 C;  4PI0 A;  1HR0 B;  3DGE A;  4JYB A;  1SET A;  2LGW A;  2RN9 A;  3HKD B;  4LF6 O;  5GTH Z;  5CB4 B;  1QSP A;  3BAB A;  3ZS8 C;  3RQG A;  1V54 B;  4A5U B;  2HSB A;  2V1D A;  4MND A;  5LXT B;  3HJC A;  4G78 A;  2WZF A;  1WB8 A;  2P6J A;  3E22 A;  4P6I C;  2AWC A;  3EH2 A;  4J32 B;  4JIO A;  3HKE B;  2NUP A;  3OEO A;  1LUW A;  4X1K B;  1H2M A;  4OX9 O;  1XL6 A;  4LP8 A;  4WFF A;  1D2D A;  1FFT C;  2BSK B;  1PD1 A;  1TFK B;  3JSN A;  2LO1 A;  4AL1 A;  1AP6 A;  2P06 A;  3LDC A;  1T6Q A;  1DF5 A;  2LJ2 A;  4NKG B;  1GN4 A;  2ZNI A;  2YSU B;  4CS7 A;  3SNH A;  3TET A;  2PY5 A;  4U7N A;  3S84 A;  2HV6 A;  2IOQ A;  1R3L C;  4LF4 O;  1VF7 A;  2Z0A A;  5KA6 A;  5GON A;  2J46 A;  1NU9 C;  4YT8 A;  4M63 A;  3E9V A;  4LFC B;  4K1O A;  3BEH A;  3O55 A;  4BIU A;  1VQ9 V;  1GM5 A;  1JMK C;  1N32 B;  2OG2 A;  3RFY A;  3CXH F;  2XHB A;  4NTX A;  2EIL B;  5L3Q A;  4GYC B;  4K0K O;  1QLN A;  4E17 A;  4JI2 B;  2HJD A;  1VB5 A;  5B3I A;  4YJW A;  3HR0 A;  5LGU A;  2JJ1 G;  4DR2 O;  4TUY A;  3QZC A;  1JQ0 A;  1I94 O;  1XEQ A;  4GKJ O;  3J80 N;  2VQF O;  1IZ3 A;  5B5E Z;  1H9G A;  1JA8 A;  3A0R A;  3FHD A;  2OCC C;  1Y74 A;  3B4S A;  4B7E A; 
#chains in the Genus database with same CATH homology
 3OFN G;  4R7C A;  1JOY A;  4WFH A;  2IJH A;  4FIP C;  2IU3 A;  3CCU V;  5LGT A;  1PNL A;  1S3J A;  2ATK C;  4MTG A;  5H6R A;  1JJ2 U;  2OCC B;  1RM1 C;  4XBF A;  1YIJ V;  3W7W A;  3CCL V;  1H8H G;  2QM8 A;  2OTJ V;  3SYA A;  2JK5 C;  4MSW C;  4PA9 A;  2BOB C;  4R50 A;  3B8N A;  3SYP A;  3CCR V;  2JEX A;  1F4N A;  3W7X A;  2H8P C;  3SPI A;  1RM1 B;  2UXN A;  4MW8 A;  1K92 A;  4H33 A;  3OMA B;  3ZRW B;  2ZR3 A;  3K79 A;  2EJR A;  5LGN A;  2X6C A;  2HG5 C;  1YHQ V;  4UXN A;  2WLM A;  2ZQM A;  1MG1 A;  3CC4 V;  2R9R B;  5B1B C;  5DN6 G;  1ORQ C;  1L1F A;  1P4R A;  1K34 A;  3ETD A;  4G28 B;  2Z5U A;  1K4C C;  2DQ3 A;  3K3W A;  3QO7 A;  4TSF G;  1FXK C;  2B1I A;  4GX1 A;  3RBZ A;  3ZN0 A;  2W6I G;  3ZRV A;  1K73 W;  3SPG A;  1S72 V;  1SES A;  2Y48 A;  3NXS A;  4GX2 A;  5B1B B;  3P32 A;  4WFB V;  2EZP A;  1XL4 A;  2K1E A;  1E1Q G;  1S5H C;  4PA7 A;  3W7T A;  3CYO A;  3T4Z A;  1FXK B;  3IFX A;  3RW0 A;  1V55 C;  3CME V;  1ROP A;  1JVM A;  5GW7 A;  1YJN V;  2NLJ C;  4MVQ A;  3E8B A;  1WLE A;  1JPX A;  3FB7 C;  2HR3 A;  2WSS G;  3JD2 A;  1K3E A;  2B1G A;  1JX9 A;  1VQK V;  1V55 B;  1M90 W;  2X0L A;  2DW4 A;  5EBM C;  3OUS A;  4P30 A;  1R6N A;  5LHI A;  1JCH A;  2ZDI C;  3ZRW A;  5FL7 G;  4WFG A;  1GO3 F;  3ZMT A;  1MSW D;  1CPY A;  3E2E A;  2HKO A;  4JAS A;  3IGA C;  2HLD G;  2V7Q G;  4Q20 A;  1ORS C;  1FXH A;  1GK9 A;  4UV8 A;  1QVF U;  2DYR C;  2PI4 A;  4PA3 A;  4PDM A;  1K9M W;  2YEV B;  4MW3 A;  2JEU A;  3CCE V;  2Z3Y A;  4QE9 A;  3AG1 C;  5EC1 C;  3K0D A;  3ABK C;  1TUE B;  3CCJ V;  1YTF B;  1S0V A;  1F23 A;  1DLB A;  2Q67 A;  2EIN C;  1OCC C;  2X6B A;  1E79 G;  2DYR B;  5DM6 V;  2KYH A;  5L3C A;  2X6A A;  5B3S C;  2NNU A;  2AHZ A;  1R3J C;  3G6E V;  3JCZ A;  1FXK A;  5IY5 C;  3SPJ A;  3X2Q C;  1HWY A;  1QR8 A;  3AG1 B;  1OHH G;  3ABK B;  1OCO C;  1M1K W;  3CC7 V;  1NVP B;  3EHB B;  1AI6 A;  2WLJ A;  3AG2 C;  1NR1 A;  1MOF A;  2EIN B;  1OCC B;  1YIT V;  3JD1 A;  1KEC A;  4RAI A;  1Q82 W;  4TT3 G;  3F7Y C;  4FPP A;  3LSS A;  4RUF A;  5B3S B;  1PL0 A;  4KUM A;  3ETG A;  4MVU A;  1NH2 D;  5IY5 B;  3TCU A;  3FB6 C;  3X2Q B;  4X8A A;  3LNM B;  3SYC A;  1GM7 A;  2WAM A;  1K33 A;  2DQ0 A;  1PKX A;  3ABM C;  3AG2 B;  4PDL A;  3D3I A;  1FXV A;  2X7R B;  3MHS C;  1KD1 W;  2HJF C;  4RO2 A;  2PI5 A;  2DWD C;  3CCV V;  2QEX V;  4UVB A;  3CCM V;  1AI4 A;  3ZMV A;  1COW G;  5LHG A;  1BHA A;  1VQP V;  3JD0 A;  1K5S A;  2XAG A;  3ABM B;  3WFV A;  5CBF A;  4ZKI A;  3OMI B;  5L3B A;  2AHY A;  4LBE C;  1VQM V;  3I55 V;  4LC1 A;  2DWE C;  3ABL C;  3T1C A;  4GX5 A;  1KP3 A;  3K06 A;  2HFE C;  2WLH A;  3MD0 A;  5CBH A;  1YJW V;  1GMG A;  1H38 A;  4F4L A;  1E1R G;  1P7B A;  4G2K A;  4CBC A;  1Q81 W;  2MK3 A;  1WPX A;  1G4Y B;  3ABL B;  3MHH C;  3CCS V;  1M56 C;  1W0J G;  2Q6A A;  3ZRX A;  5IDJ A;  2IH3 C;  1VQO V;  3K03 A;  3SPC A;  2LP7 A;  4J9Y B;  1K97 A;  2B5U A;  2P67 A;  3CD6 V;  4G27 B;  3HB3 B;  5L3G A;  1M56 B;  2IJK A;  1LNQ A;  3CMA V;  2OT5 A;  2JIZ G;  4JTA B;  5C93 A;  1EZJ A;  3GB7 C;  4JAV A;  1THZ A;  4KFM A;  3SJQ C;  4CZZ A;  2P7T C;  3ASO C;  3CCQ V;  2Y69 C;  3DTU B;  3GWO A;  2F43 G;  2KB1 A;  3K9A A;  3OUF A;  4HZ3 A;  3OR6 C;  1BHB A;  2XAS A;  4GT1 A;  1NKD A;  4MTX A;  3LSQ A;  3P30 A;  3LDE A;  1OCR C;  4Z1M G;  3G71 V;  1ARO P;  4QIW F;  4H37 A;  3ASO B;  3E8G A;  2Y69 B;  5HFM A;  1KP2 A;  1AI5 A;  2XAJ A;  1H2G A;  1K5Q A;  4XDL A;  4HYO A;  1J95 A;  1NBM G;  5B1O A;  1OCR B;  3VOU A;  1KKD A;  4YXW G;  3SPH A;  2XAH A;  1W0K G;  4QPJ A;  5H6Q A;  2R9I A;  2EIJ C;  3E8H A;  5EBL C;  4E2L A;  4LCU C;  4UVA A;  1PNM A;  1EBO A;  2GSM B;  1S77 D;  3UM7 A;  2BOC C;  2WLN A;  3OEE G;  3BY6 A;  4PDV A;  5EC2 C;  3OR7 C;  3JD4 A;  4HAM A;  2EIJ B;  1SRY A;  2QA4 V;  2XAQ A;  1YTF D;  1IXM A;  1KQS U;  3ZJZ A;  2ZXW C;  3OMN B;  4JF3 A;  2EIK C;  1QCE A;  2IJJ A;  5LHH A;  1PNK A;  1M9N A;  1OZ0 A;  3QNE A;  1RPO A;  3STL C;  1S76 D;  3EFF K;  1I5Y A;  4JPR A;  1NVP D;  1R73 A;  3AG3 C;  3ZMU A;  1NQT A;  5EK0 A;  3K08 A;  1Q7Y W;  4WCE V;  2IW5 A;  3PJS K;  2ZXW B;  2UXX A;  2EIK B;  2M7W A;  2CK3 G;  3OM3 B;  2QE7 G;  4MVM A;  1NJI W;  4FJC C;  2IH1 C;  1DTO A;  3F7V C;  1OCO B;  3H01 A;  3AG3 B;  4FMT A;  3STZ C;  4JTC B;  4PDR A;  1Q86 W;  1QLE C;  1QBZ A;  3OE7 G;  4UVC A;  2ZD9 A;  3ZMZ A;  3FB8 C;  3M99 B;  2EIM C;  2IU0 A;  3HPL C;  1N8R W;  1F51 A;  3R65 A;  2D3O W;  3QO5 A;  3W7U A;  2P90 A;  1G8M A;  3LUT B;  1R3I C;  1VQL V;  1MAB G;  3SYQ A;  1K4D C;  5HFL A;  1QLE B;  2OTL V;  4MTF A;  2YEV A;  2ZDI A;  1VQ7 V;  1F4M A;  2EIM B;  2WWW A;  4XDJ A;  4UUJ C;  4MVS A;  2WLI B;  4ASU G;  2C2A A;  4U7O A;  1YI2 V;  1CP9 A;  3ZMS A;  3CP1 A;  3IC7 A;  4MVZ A;  1AJP A;  3RVY A;  1VQ6 V;  5KUK A;  3OAA G;  5B1N A;  5H9C A;  3SYO A;  2FTK A;  4MVR A;  2W6J G;  4N23 A;  2QTO A;  2JJ2 G;  3JYC A;  4JAU A;  4X88 A;  3TK1 A;  2EZO A;  4BW5 A;  5CBG A;  1UJW B;  1VQ5 V;  1ENV A;  3ZIA G;  5CMU A;  2A0L A;  2Q69 A;  4QNH B;  4EKW A;  4UV9 A;  1VQN V;  5L3D A;  3FB5 C;  5EBW C;  4P9O A;  3W7S A;  3OGC C;  4MS2 A;  2DYS C;  1M57 C;  2WLL B;  4P9P A;  3KG2 A;  5J9P C;  5KA5 A;  2EBO A;  2HVJ C;  4OXS A;  5BZB A;  4RQE A;  1CEZ A;  3I56 V;  2JDI G;  3CPW U;  4GX0 A;  4P2Z A;  4J9Z B;  2H94 A;  5E1A C;  2ZR2 A;  1YJ9 V;  1GM8 A;  1ZWI C;  1GKF A;  1K7D A;  4GCZ A;  2DYS B;  2QKS A;  2GHY A;  1QR9 A;  1M57 B;  1VQ8 V;  5IYB O;  4WFE A;  4KP4 A;  3F5W C;  1B6Q A;  3OW2 U;  2LFR A;  2XAF A;  3ASN C;  2IJI A;  2W0F C;  4ZBM A;  2WLI A;  3AEI A;  1I5X A;  4MTO A;  5L3F A;  3UKM A;  3ZN1 A;  5B1A C;  1W2B U;  1V54 C;  5KUM A;  1H8E G;  3E35 A;  1AR1 B;  3B77 A;  3QO8 A;  4I9W A;  4RQF A;  3CXC U;  1K8A W;  3CC2 V;  1BL8 A;  4I5S A;  5CN0 A;  4WF9 V;  2WLK A;  3ASN B;  5IYC O;  3LDD A;  3RVZ A;  1AJQ A;  3DGE A;  3E89 A;  1SET A;  4JYB A;  4JTD B;  3K0G A;  4PA4 A;  2HVK C;  2Q68 A;  3FYE B;  3FYI B;  5B1A B;  1R3K C;  1V54 B;  3FKS G;  2V1D A;  3B8M A;  3JD3 A;  1DF4 A;  1R6K A;  1RPR A;  1AI7 A;  2P6J A;  3ABT A;  1OCZ C;  4WFA V;  1BMF G;  2WLL A;  2A79 B;  2LFS A;  3AG4 C;  3ML0 A;  4PA6 A;  4BIZ A;  3ETE A;  1XL6 A;  4LP8 A;  4RUE A;  4WFF A;  4JGS A;  3WG7 C;  3ZRS A;  1SZT A;  4TWK A;  4FK5 C;  1EFR G;  3T4D A;  3LDC A;  1OCZ B;  1QVG U;  1DF5 A;  4QPK A;  4PEL A;  2YSU B;  4N21 A;  3AG4 B;  5CA3 A;  1YSC A;  1GTO A;  3TET A;  2A9H A;  1FFT B;  2WPD G;  4U7N A;  2ITC C;  2EIL C;  2ITD C;  1R3L C;  4X89 A;  3WG7 B;  3T2M A;  2QM7 A;  5KA6 A;  4JYC A;  4BAY A;  3D36 A;  1Y4M A;  1VQ4 V;  3BEH A;  1FS0 G;  4QJF B;  4BIU A;  5IYD O;  1KC8 W;  1VQ9 V;  4XDK A;  4R6Z A;  5LBQ A;  4QE7 A;  4DXW A;  3OEH G;  1SER A;  2EIL B;  5L3E A;  4L87 A;  3E86 A;  1QLN A;  3ABU A;  5LGU A;  1PD3 A;  2JJ1 G;  4R8C A;  1JQ0 A;  1NH2 B;  2XND G;  4MT8 A;  1Y66 A;  4DO2 A;  3E8F A;  2XOK G;  1AJN A;  1GM9 A;  1NR7 A;  3ZCC A;  3G4S V;  3E83 A;  3A0R A;  3VBB A;  2OCC C;  4MVO A;  3K04 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...