4DXWA

Crystal structure of navrh, a voltage-gated sodium channel
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
227
structure length
210
Chain Sequence
b'TPFFSSLKDNRIFQFTVVSIIILNAVLIGATTYELDPLFLETIHLLDYGITIFFVIEILIRFIGSGWNIFDTVIVAISLIPVLRLLRIFRVLRLISVIPELKQIIEAILESVRRVFFVSLLLFIILYIYATMGAILFGNDDPSRWGDLGISLITLFQVLTLSSWETVMLPMQEIYWWSWVYFFSFIIICSITILNLVIAILVDVVIQKKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ion transport protein
publication title Crystal structure of an orthologue of the NaChBac voltage-gated sodium channel
pubmed doi rcsb
source organism Alpha proteobacterium himb114
molecule tags Transport protein
total genus 79
structure length 210
sequence length 227
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00520 Ion_trans Ion transport protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4dxwA02
1.20.120.350 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Voltage-gated potassium channels. Chain C 4dxwA01
5KUKA 1P7BA 2WLIB 3E86A 4HZ3A 3ASOC 2DWDC 2X6AA 3ABMC 3E8FA 4MW3A 4MVMA 1S5HC 3TETA 2ITDC 5CBFA 4LBEC 2BOBC 3UKMA 1K4CC 5B3SC 2AHYA 2WLLA 3STLC 4OXSA 3X2QC 2YEVA 1XL4A 4RUFA 2WLJA 1QLEC 2A79B 1V55C 2Y69C 1R3KC 3E8GA 3LDDA 5EC2C 3WG7C 2H8PC 4MTGA 1M56C 3E8BA 3EFFK 3LDEA 4PA9A 4DXWA 4QNHB 1R3JC 4MTFA 2A9HA 2WLKA 2Q6AA 4KFMA 1JVMA 3FB7C 3ABKC 4PDVA 4WFEA 1R3LC 2X6CA 3FB6C 4MTOA 4WFHA 3LDCA 4RO2A 2EIMC 2HVJC 2JK5C 3ABLC 2Q67A 3OR6C 4XDKA 4X88A 2QTOA 4LCUC 2HFEC 4MW8A 1ORQC 2EILC 2EINC 2HVKC 2WLIA 3E89A 4J9ZB 4X89A 3TCUA 2EIKC 4JTDB 2DYRC 3LUTB 3AG4C 4MVOA 3SPHA 2KYHA 2WLNA 3OUSA 3OUFA 3SYQA 3F7YC 2IH3C 3K03A 3K0DA 5EBWC 4MS2A 4R6ZA 2KB1A 4P9OA 3RVYA 1G4YB 3SYCA 4JTAB 1OCRC 3K06A 3K04A 3R65A 5CBGA 4PA3A 3ASNC 2W0FC 2OCCC 3AG1C 5EBLC 3PJSK 2NLJC 3AG2C 4BW5A 4RUEA 3OR7C 4PA7A 3E8HA 1BL8A 2X6BA 4XDLA 1R3IC 1ZWIC 4GX5A 4R7CA 2ATKC 5EC1C 3RBZA 4WFGA 3F5WC 3KG2A 2ZD9A 3FB5C 4G28B 5BZBA 4H33A 2WLMA 4PDRA 3SYOA 2K1EA 4G27B 4P9PA 3VOUA 3GB7C 2EIJC 2ZXWC 2IH1C 1OCCC 1OCZC 3SPCA 4J9YB 5EBMC 4ZBMA 5B1AC 3UM7A 4MVRA 5J9PC 5EK0A 4PDMA 3E83A 3SYPA 2HJFC 1K4DC 2R9RB 5KUMA 4PA4A 4GX2A 3HPLC 3RVZA 2ITCC 1M57C 4QE9A 4H37A 2WLHA 3F7VC 4GX0A 2P7TC 4JTCB 4PDLA 3FB8C 4RAIA 3RW0A 4TWKA 1KKDA 1ORSC 3ZRSA 4HYOA 4GX1A 3T1CA 1J95A 2BOCC 2A0LA 4P30A 2DYSC 4PA6A 3T2MA 3OGCC 4R8CA 3IFXA 3K08A 4MVSA 3SPJA 4MVQA 2DWEC 3T4DA 4CBCA 4UUJC 3IGAC 4QE7A 4WFFA 3SYAA 3SJQC 4LP8A 3SPGA 1LNQA 3LNMB 3BEHA 4MVUA 5CBHA 3K0GA 2AHZA 4X8AA 5IY5C 3JYCA 4R50A 3STZC 4F4LA 3T4ZA 4MVZA 5E1AC 2Q68A 4EKWA 4MSWC 1OCOC 3SPIA 2Q69A 2HG5C 5B1BC 2QKSA 3ZJZA 4XDJA 1V54C 4I9WA 3AG3C 1XL6A 4P2ZA 2WLLB
chains in the Genus database with same CATH superfamily
2OG2A 4LWSB 2Q3TA 4HZ3A 3E86A 1SESA 1FFHA 2RD9A 5FL7G 3ZMUA 5CB4A 2ZXOA 2IOQA 1KU2A 3PHF2 1N0JA 4U3FH 2MYSA 3GM3A 1YTFB 1HNWO 1GK9A 1VLTA 4KC9A 1KC8W 5CA1A 1F7YA 3AQBA 4PA9A 1SYQA 1U89A 2H8AA 5T3WA 4MTFA 5LMNB 1Q82W 1NBMG 4KFMA 1S7ZA 4NTWA 4DR5B 4EBKA 1J5EO 3CJHB 4U5CE 1QR9A 2QWOB 1XILA 2P22C 2HVJC 4H4KC 3UR3C 2GWWA 4X88A 4KHPB 1YF2A 1SS3A 2DJVA 2QTOA 1M2OA 2CH7A 2A6EF 2DB4A 1ZW3A 4XWJA 4LF8O 1NH2B 1A41A 4CS8A 4X89A 1IBMO 1UG7A 1GM9A 5GW7A 1O9HA 2GHYA 5TJ5E 4JI1O 1U6HA 3OUFA 5D5PA 3JAMN 1QSPA 1G8MA 2DI3A 4MS2A 2KB1A 2WAMA 3P30A 2FFHA 1NU1H 3ETQA 1YIJV 4J30B 4TV8B 5JJJB 1XEQA 4NXMO 5K0IA 1EN5A 3RYCA 4X62B 3G4SV 4PA7A 1WASA 3I55V 2Q5ZA 5LGNA 1XHXA 1W2BU 5TISZ 2NN4A 3CCMV 4QDLA 1YDXA 3DI5A 4ABMA 2B5UA 5HFLA 2UU9O 1Q6UA 1PNLA 4U5DE 5JQGB 3FAJA 1NZEA 4PA4A 1AUEA 4GX2A 1WNSA 4DV2O 3CE2A 1EQ1A 4KNWA 1WPXA 2QLAA 1NVPD 3O39A 1KKDA 3LS1A 1H9TA 2EIMB 4NCQA 1HP8A 4GX1A 256BA 2Y3DA 3UT5B 1XZQA 5LHHA 3CD6V 3P3PA 2P06A 3KMIA 2AZ0A 4C3DA 4WFFA 2MWQA 3D36C 4LP8A 2O9XA 2KG7B 2R70A 3ZG1A 1HE9A 4N4WA 1RCPA 3U0CA 4O4LA 1IDSA 2OIGA 5L3GA 1ZW2A 1FFXB 1PL0A 3JASA 1Q7YW 4C3BA 3G67A 1LI7A 2Q68A 4DUZB 4IT5A 1VQ7V 2HG5C 1V54C 4JV5O 1I94O 1JPXA 3TK0A 1IXBA 2UUIA 3ASOC 1NTZH 2N04A 1VQMV 2QJ1A 4JYYA 1H38A 1HW2A 1ZHXA 1S5JA 4U7OA 4OIOF 4OXSA 1XI1A 2PUSA 3TXQA 1YSCA 2ZR3A 4PJ0Z 3JAKB 3U9JA 3L73H 1VLSA 1D0ZA 4YJ2B 3CRRA 3UO2A 1V55C 2PGGA 1KYOF 4MTGA 3ZSUA 1TUEB 3LDEA 2OU6A 4B3RB 5LMNO 2UXBO 5EZYA 4RD9A 4L87A 1OV9A 3B29A 4Z9JA 1WTYA 3I4UA 1ZHYA 4JE9A 4JIOA 4KI2A 4RO2A 3HKEA 3FVYA 2UUAB 1LI5A 4PHZA 3OTOB 1Q5OA 4N6CA 4E17A 4CSAC 3QVZA 3N2ZB 2WLIA 1SETA 2RQ6A 2EIKC 1T6UA 4X1YB 3TOLA 3VAYA 2B0JA 2JS3A 3DWWA 4LFAB 3U10A 2QTSA 1YJGA 1ZHZA 2E87A 3D8CA 1PP9H 4B7EA 3S28A 4O2BA 4DUYO 4FLZA 5KHKA 2LQTA 5H6RA 1AJPA 1GN4A 2HJMA 4U3JB 1OW8A 4DK0A 5KYYB 5B3SB 2OCCC 2M4EA 4O79A 3X2QB 1TUBB 1P7GA 2J46A 2P0NA 4EFBA 4D7TA 2BTOA 3IQ6A 3CP1A 4PDRA 3FOPA 4NTAA 4BR6A 4LF4B 3K57A 2VASA 1OCCC 2V7QG 4DR3O 1AVOB 1K5SA 4H13B 3E83A 2R9RB 4O4JA 1ROPA 5LP6C 4LNUA 4RDAA 2HP8A 3NYLA 4IL6Z 1K7DA 3GVMA 3JD3A 3OEEG 2PTMA 4O4IA 3TXSA 4CS3A 1N34O 2YEVB 4PA6A 3UNGC 1VQ5V 3CCLV 4LR3A 1AJQA 2L6FA 4AHCA 3AG4B 3OAAG 4G7ZF 1NTKH 4Z1MG 2R05A 2PYLA 1SZIA 4JEAA 5COGA 3AOUA 1Y76A 3JARB 4JASA 5E1AC 5FPRA 5ITZB 4JI8B 4MSWC 3T4RA 4DUZO 4JI3O 3CSKA 4IJJA 1GGQA 2IXNA 4JAUA 3K1IA 1P7BA 3ZMTA 4B3SB 2OEVA 3CCJV 2ITDC 3N2KA 1FMWA 3UKMA 2UUBB 2DMXA 1MABG 4PJMA 3M7MX 3NYJA 2Q0AA 3RH3A 3JRMO 4HE8D 4RUFA 1VARA 2RJZA 5KX5A 1SERA 5L3FA 3EFFK 3DAGA 4FPPA 1RMVA 3EZHA 2QE9A 2TMVP 1DF5A 1JVMA 4FM2A 5FZTA 1LUVA 4UV8A 4D4NA 4DYLA 4U5GA 5J2UA 2JK5C 3ABLC 1NR7A 4BIUA 2UUAO 2HVKC 3DXRB 1A0BA 1V4AA 4C7OA 4J9ZB 5JUAA 2B9ZA 5KYXB 4O6NA 4LDRA 3FKSG 3E70C 4WGZA 4PR9A 2DOSA 2GUZA 3JAWA 2YQYA 3OUSA 2ZM6O 2A7WA 1T9KA 4B3TO 4R6ZA 2XM0A 5IYBO 4FAPB 4K8XA 4JTAB 2H94A 4GQHA 2L6HA 1K9MW 1WP8A 1I4ZA 3S3WA 4HEAJ 5GTHZ 1NLXA 4UCOA 5LGTA 5JH7A 4N6HA 2VQFO 2Q00A 1IBKO 1GQAA 3Q4HA 1R3IC 2Q7GA 2OYQA 3RBZA 1ZSPA 3BFRA 1VF7A 4JEBA 1L0NH 3OFNG 2NUPB 3EXAA 1QNMA 3DD7A 3CQZA 1FJGB 1PD3A 3SPCA 4LF4O 1T01A 4Q4ZF 2IW5A 3AG7A 3B4SA 4OIQF 4X64B 1JCHA 1KU9A 4DRXB 1AVMA 1N36B 4NXNO 3C63A 3KL4A 3T1HB 3TQOA 4GX0A 1N4CA 1RKEB 1Y66A 4BJTA 2HMQA 2EINB 4LC1A 4EUKB 2J9VA 3K6BA 3MFNA 1OW7A 3RYLA 3VYWA 3T1YO 2ZDIA 2CTPA 5AC5A 1BR2A 3GWLA 2FMLA 3RYIB 3E22B 4GCZA 5D92A 1SQFA 5J2TB 1NTMH 2OQMA 1UFIA 1HR0B 4EKWA 4XQ1A 1LS1A 1MNDA 3K58A 2YL1A 2CGOA 5DVWA 3I5QA 4PELA 2P67A 2OT5A 3F47A 4P2ZA 5E2QA 4E2LA 2BE5F 5BR8O 2DWDC 1FFTC 4F4BA 4CH6A 1R6NA 3DM9B 5BY1A 5JP7A 2P5OA 3TETA 2OJED 1VMGA 5KAFZ 1KUQA 1K4CC 4M63A 2UUBO 2EIJB 4FFBA 2GA0A 3QMKA 1K92A 3EG9A 2WZLA 1BHAA 3J06A 1M2VB 2QWNB 1NSGB 3JSLA 3U2LA 4J7KA 5DLJA 1UJWB 1QQCA 4JI5B 3K5LA 1R3JC 1WPBA 1JAFA 2Q6AA 3BVOA 2LW7A 3FB7C 3S29A 4O6MA 4YT5A 1ZLZA 3ZHTA 3OA1A 2XLOA 4XBFA 1XUQA 4XLNF 2HMZA 1WA8B 3FYIB 4HNAB 4WABA 2PZSA 1G6UA 2WVNA 1HE1A 1W59A 1SQGA 3G6BA 3HNJA 1NFNA 3Q6NA 3DJUB 4DV7O 4UCUA 1MA1A 2LCHA 1VOMA 2LJ2A 2N05A 3NMKA 3ZRXA 4DK1A 2DYRC 4JZ2A 5L0HA 1L0LH 4YHHO 3LESA 3W7TA 2CNWA 2QWRB 3IHUA 5GTIZ 4AK9A 3ABMB 2KSFA 5L3EA 3FHDA 4PA3A 3HR0A 5LBQA 1JFFB 1GM7A 3F5TA 5H2FZ 5JCOC 4NTFA 3CRAA 1AI6A 2FYUH 3ZIBA 4Z1VA 1BL8A 2CAZC 1M90W 1ZWIC 1SA0A 4O6YA 3U2MA 1YTFD 2LK4A 2KW3C 2RDCA 4C3EA 3H1KH 3SJBC 1CXZB 2JGDB 3U0ZA 5K1XA 2P1AA 4ZBMA 1VMAA 4XPWA 4MVRA 3CRQA 1TGOA 1FJGO 3EFOA 4PDMA 3A0RA 4KNVA 3US6A 5DS4A 4I44A 1PM9A 3AG3B 4QI2A 3WODF 3ZTZA 4IYHA 3K9SA 2P7TC 5KHHA 2CGNA 3L9DA 3T1HO 3V7OA 5D91A 2CTRA 4ZLDA 3B9QA 1MZFA 1VQKV 4FLXA 3K08A 2QDOA 3CX5F 1NH2D 3A9CA 3JTLO 2EBOA 2A1DD 1E85A 3H1LH 1LIHA 1MMDA 3CRMA 1Z6AA 4WBNB 4J7TA 4X8AA 4JCZA 1M9NA 1TA8A 4PFPA 2KGOA 3UMHA 1AP5A 3ZRWA 5KMGB 4MVZA 1O5HA 1N32O 1SZTA 2A06H 1OCOC 3B0PA 5T1DB 2G62A 2QKSA 1SR2A 2WLLB 5LXTA 4DR6B 1NR1A 1BBHA 1ZHTA 1OXKA 3ZHQA 1NU9C 5B5EZ 3BA8A 3EH2A 4BG0A 1D0XA 2F1MA 2GTSA 3POVA 3ABUA 3ZC4A 3ETGA 3DTUB 4JI7B 4ZHQB 2R7QA 1DK1A 4CIPA 2WLJA 4I7ZB 1QLEC 2A79B 4I0XA 2AW9A 4I5SA 3TOMA 1V74B 1ST6A 1T6IA 4DRJB 1Y74A 5IWAB 4I55A 4B3MO 4IARA 3QVYA 2ILMA 3EZIA 3I56V 1L7CA 2VRZA 2YI9A 4JF3A 1XMQB 1YVWA 5E79Z 4DV5B 1D1CA 5AG2A 2VH3A 4CIHA 1JPJA 5IT9N 2AGAA 4MQ9F 4NB5A 4YY3B 4MW8A 4H0LB 4IAOA 2YLIA 1E1QG 3E89A 2OOCA 4HFFB 4YIPA 2OKUA 3TJTA 4W8PA 2JRIA 3V5YA 2HHHB 1YA9A 4MVOA 2WLNA 3U9MA 2QA4V 1N8RW 4I3MA 1ZL8B 2LFSA 1QZXA 1Z5VA 4G7OF 1ENVA 3OMIB 2WVQA 1JOGA 3BHPA 1VYIA 3RYHA 1XNQO 1WN7A 1YJ9V 2UUCO 2W0FC 2PF4E 4YL3A 1H6GA 1TWCA 4NTYA 1XOUA 1NKDA 4NY3A 3A2FA 3VM6A 4LF9B 4CS9A 3CXCU 3GWKC 2ATKC 2A0UA 2AU5A 3THOA 2R03A 1XQ8A 1E1RG 5BZBA 4G27B 3QO5A 2I15A 1KKCA 2KSDA 3FFQA 1Q0GA 3ZHSA 2XL8A 2YLDA 5KUMA 4G78A 2R72A 2NSGA 2L9JA 5CB4B 1B04A 4H37A 1NQTA 1YVIA 1YEWA 4CS7A 2ZCEA 4HYOA 3T1CA 3WB1A 4P30A 1TWHA 1G1XB 2DWEC 5CA1B 1P84F 3SYAA 4X65O 1MSWD 3EGXA 1Q0FA 1IZMA 3LNMB 2IBFA 1E83A 1EN6A 3DSQA 2YWAA 3DC5A 1SF8A 1Q8IA 3QF7A 2HV7A 4CDYA 1QKRA 1NS1A 4JC7A 1KD1W 3APQA 4DVZA 2R7UA 2CH7B 3AG1B 2VQEB 3AG3C 1ZYRF 3N24A 5CI9A 2X6AA 1FXHA 1WOLA 1YAUO 5HSWA 4RWUA 1PD0A 4YJ3A 3NMIA 1KECA 5COFA 4JI7O 5IE9A 1XL4A 1OZ0A 3J81N 5JS5A 4G7HF 1FXKC 1R6TA 1XMOO 1K40A 2ZKOA 1FAPB 2XTAA 1RP3B 2F93B 2MK3A 3CMAV 1RM1C 4LF7B 1LE4A 4AILC 3MDSA 3C7JA 5HV9A 4DXWA 4P6IC 2JGUA 1JQ0A 3RYCB 2NG1A 2Q9CA 2Y4TA 5IWAO 2BE3A 1VQ9V 4J80A 4DOZA 4X1IA 3IQ5A 2W0XA 1IX9A 4QPJA 1TFKB 3E9VA 2Q67A 1M4UA 4DV0O 3A0BZ 3UGPA 4LCUC 4FZ1A 5H5NA 4ULWA 2R7WA 3I5PA 2GAQA 5LYJA 2QNLA 2JDIG 3G4ZA 1BT8A 2HSBA 3HNIA 3LUTB 5COMA 1RKCA 1HNXO 4IGGA 1HNZB 2IH3C 3K03A 4X66O 3RQFA 1RXQA 5EBWC 5L3BA 1SRYA 1U96A 2QKAA 4AL0A 4IIJA 1AI7A 2Y48A 3TK1A 2IJJA 3W2VA 3AG2C 3Q6MA 3IC7A 4BW5A 4JI2B 4LF9O 4DV1B 1PV0A 5KHIA 5EC1C 3JASB 2ZD9A 2Y69B 1VQLV 3K7DA 3SZRA 1YLMA 2PY5A 3SXYA 3JCZA 3VOUA 2ZXWC 3D36A 4UVBA 5EBMC 1OXBA 4UDVA 1BQZA 1WWPA 2FAPB 3G4XA 1BZKA 1BGYH 1K4DC 5EIBC 3KZIZ 5KA6A 4JTCB 3OD4A 1Q6IA 2EILB 3LSUA 2Y0PA 2DE0X 4CS4A 3CRCA 3D3QA 3IC9A 4I4TA 3JT1A 2XXAA 3LLIA 3G50A 1U97A 1LNQA 3ZMZA 4FESA 2P7VA 2ASRA 5EZYB 2ZINA 4KL1A 2L6GA 2LQGA 1NBBA 4LF5B 3ZS8C 4GYTA 2QTVA 3CYOA 4ONSA 4DV4B 1I7FA 3HKEB 3ASNB 3W7XA 5H9CA 3AJMA 3ETDA 2VQEO 2EPLX 2WLIB 2VWKA 4EWCA 1GM8A 1GMGA 3FOOA 3FAVA 2YIDA 4YIOA 2LGQA 3DAFA 3A0HZ 2EZPA 2NPUA 2W6IG 5B1AB 2F4VO 2NSFA 4CSAA 3CB2A 4X20A 3HKCA 4O2BB 1R3KC 1C02A 2JPUA 2F22A 2YL0A 3WG7C 3VF0A 3BCCH 2R9AA 1M56C 3ZHUA 5A9GA 4LF7O 2OTJV 2AXTZ 3L1MA 2A9HA 2WSSG 2XL6A 3HKBA 4DR4B 3QNEA 3SXKA 2XAFA 1LUWA 2YXLA 3ABTA 3N27A 1EBOA 3JD0A 3GEEA 3B2EE 3FD9A 3FXHA 3Q7LA 2XLDA 2KQ9A 1V9PA 1YJWV 4LFBB 1AI4A 3DJNB 3EHNA 3H9VA 1T6QA 4O4JB 4K3AA 4LNUB 2HUJA 1AR5A 3C8GA 3TCUA 1Z7Qc 1Q0KA 4O4IB 2FL4A 3C8ZA 4I1MA 1F51A 5JVDA 2JJ2G 5B1BB 1EZJA 2CE4A 1BQ0A 4TUYA 2AWYA 3K04A 4NVPA 3GWOA 4FM0A 2Y3BA 2Q9LA 5LP6A 4PJLA 3ZX6A 2QR4A 5JWPA 3JALA 2JX0A 5L3CA 3OTFA 2DW4A 4O2AA 4ZOLB 4DR5O 5EBLC 1OR3A 4ZLCA 4LFCB 2B0HA 2NLJC 3PN1A 2X7RB 4JYCA 4ZKIA 2HR3A 1WP7A 1RJ9A 2Z5UA 4JI2O 5BUOA 3DM5A 4KHPO 1Y76B 4DV1O 3KG2A 2KC3A 1CGNA 1FS0G 3MD0A 4X0RA 2P4VA 1VIBA 1AEPA 3EJNA 2UUHA 3HB3B 3SYPA 3IEEA 3UCSC 3ABKB 2XASA 3U8VA 3LLKA 1M6TA 3RVZA 1VK5A 1GN6A 3M1CB 3N2KB 3N2GA 4LH7A 2UXXA 2W4MA 4BEJA 5FNVA 2EULA 5JJEB 5KX5B 2K9PA 4DV3B 3LSSA 3SPJA 1DF4A 4X62O 1CGME 2QM7A 2IXMA 2NR5A 3RQGA 2W4BA 5IYZA 3GM1A 4DBQA 1KP3A 3BEHA 3BY6A 4PJJA 2UXDB 2KK1A 1OQCA 3ZDLA 1JPNA 5IJ9A 4DV4O 3AQCA 4YJWA 3UMKA 1I5YA 1PNMA 4Q7CA 1MMMA 4QJFB 5JRAA 4C7OB 3E8FA 3G71V 1Y6XA 2Q7HA 1WLEA 1D1AA 2GUZB 2P6JA 3JAWB 4G2KA 3STLC 1EKYA 1SQXH 1QLNA 1TAEA 4BIOA 1OCZB 3ZRVA 1LE2A 5DQTA 3E8GA 5EC2C 3T6GB 2EPKX 2H8PC 2VCBA 1CPRA 3E35A 3DGEA 3U3BA 4QNHB 5JVEA 1DOVA 1SQBH 3CCSV 5JH7B 1YYXA 1BSMA 1K05A 4DR4O 2J7PD 2WZGA 2XRHA 4JJFA 2DYSB 1L8DA 3EPVA 3OT7A 2EIMC 4CS2A 4J32B 4BIZA 1FKAO 4LFBO 5A69A 2NUTA 5DM6V 3EGDA 3QTCA 5EHHA 3P3NA 4AI8A 3NKDA 2J0WA 2G3VA 4BAYA 1DLBA 3QTHA 4BJ5A 4DVYP 1YJNV 3MX3A 3W8HA 2V4DA 3JSNA 1OKKD 5DECA 4B3RO 2QKCA 4BEMJ 3NMJA 2YVKA 3O10A 5DQZA 4LFCO 2H7VC 1FR0A 3S0XA 1X59A 4Z2WA 5IJ0A 4IHJA 4R7CA 1U0BB 3O65A 3AGUA 5A2QN 3OTOO 5CIVA 4JI6B 2BSKB 1VQOV 3GB7C 3GANA 4NR1A 1IBLB 4O4HA 3AGTA 3VRCA 3H1JH 3L8IA 1APCA 3AK3A 4LFAO 2IM8A 4PD4F 3CC7V 2LFRA 2R7OA 4RAIA 4PDLA 3RW0A 3ZHVA 3S84A 4FFBB 5F5HA 1JA8A 3MBGA 1CPQA 1XDCA 1S0VA 3B0VC 1KMIZ 3OGCC 3ZCCA 3IPMO 4UV9A 3EG9B 3QW0A 1K73W 4K1OA 1FMVA 3JATA 4UCSA 3ICXA 2LO1A 3G80A 5EIBD 4P9TA 5CBHA 2OTLV 5L0JA 4BJ5C 4JYAB 2Q73A 4F4LA 2IBZH 1Z2GA 1SF9A 3UO3A 3RFYA 4DV6B 4BJ6C 3QW1A 5KLVH 4B6IA 3KKBA 1EN4A 4EFEA 3JARA 2G38A 1K34A 1C03A 2DQ0A 3L8JA 3JYYA 4I9QA 5F5FA 5CA0A 1AILA 3I5DA 2EPMX 1XNRB 4K0KB 5B3SC 2ICWG 2C04A 1D1BA 2FGYA 3X2QC 5D5QA 2VS0A 4U7NA 3K59A 2QWPB 5LA6A 2ETNA 2IYLD 2R7RA 1NFOA 1M57B 1M1KW 2ZPAA 2XLEA 3JYHA 1FXVA 4DRIB 1Q6HA 3H2UA 4JI8O 1SA0B 4TOIA 2YIBD 5E3AA 5CN0A 2DGJA 4WGYA 2E5LB 1PD1A 1VF6C 4B3SO 4J41A 5JCOA 1Q0MA 3DMDA 1ORQC 3B71A 3EFOB 2HFIA 5IY5B 2J45A 3JRTA 1QPUA 4MT8A 1IURA 4TV9A 3AG4C 2ADQB 2IJKA 1GRJA 3UGOA 3S27A 1TVKB 1B6QA 1UPGA 2QSAA 2L7AA 2WB7A 4GKKB 3QZCA 3BPZA 3ZTMA 5GONB 1D0YA 2V26A 1QVXA 4FWVA 5AGFA 1EFRG 4QI0A 4YT4A 3CCUV 2OWOA 4EHPA 2Y3HA 4J7ZA 4JI0B 3W8IA 1QVGU 3E8HA 1YYJA 4TQDA 2PX3A 3V5ZA 1G5ZA 2XAQA 3ZRWB 3BABA 4G28B 1YHQV 2CK3G 3LAYA 3HTKC 4J9YB 1P4RA 1YI2V 5LXTB 1Q43A 4QIWF 2C03A 2NUPA 2LGWA 1N33B 5KYNA 3CCVV 4E0IA 3H01A 2JS5A 3L72H 1GN3A 3K9AA 1C17M 4OGQB 4X9QA 3S9OA 4FZ0A 1J95A 4IB4A 2BOCC 4LDKA 3WB0A 4I0XB 4XPXA 2R9IA 1H8EG 1JX9A 2ZNJA 1LS4A 1RKEA 2UXCB 3SJQC 1Y74B 4JZGA 4BWAA 3JCUZ 1KQSU 4I55B 4Z9IA 2RCVA 3CCRV 4N23A 2KQXA 1OCRB 2CYDA 2F95B 3F46A 2NNUA 1BMFG 5BXZA 3M15A 1YZBA 3ML0A 4X64O 4DW0A 1N36O 2XUMA 4DV6O 1XL6A 4CZZA 2XLWA 4CJOA 2A6HF 4Q20A 1XZPA 1VEWA 2HV6A 2ZE7A 3ZIAG 5KHJA 3GM2A 2D4UA 2YXYA 1EI7A 1BZ4A 2F66C 4TQFA 1XNRO 1H7IA 4J42A 1B68A 2H7OA 5KYWA 1I4YA 3EVKA 1HDJA 3GODA 3RYFA 3KH2A 4IWBA 4Q5SF 1E84A 5C8YA 3RYHB 5T3TA 4R32A 2VC9A 4FLWA 3E8BA 3SJCC 1HR0O 5BMVA 1CEZA 4K7BA 1R3LC 4FK5C 2IXPA 3ZVRA 1YARO 1BHBA 2HS5A 3OR6C 2WZFA 2E5LO 2VCAA 2LFDA 3CS5A 1I5NA 4CX9A 1RSOA 1HMOA 2EINC 1KBHA 1K97A 4OX9B 2WWWA 1GAXA 4PFOA 2ZR2A 5B1NA 4DR1B 2A0BA 1H2SB 2GFHA 4LF6B 1VQNV 2GTAA 5A6BD 3R65A 4JI5O 3SYNA 1LPEA 4WCEV 4NKGB 4XEFA 3CEXA 3U3FA 3EGXB 3OM3B 4A5UB 2HLDG 2HKVA 4JPRA 2EJ7A 1VTMP 4XDLA 1GO3F 4PACA 3OEOA 1K3EA 2MHRA 3F5WC 4U9DA 4PI0A 4H33A 2WLMA 3C3TA 4I50A 4P9PA 3SR2C 3IAYA 2EIJC 1PV3A 3X1OA 1LM3B 1KB9F 4ZI7A 4UFZA 3DE9A 1K33A 1NT2B 3HKDB 2HJFC 1H2MA 1L1FA 4FLVA 4JI4B 2CDQA 2HJ3A 2R7SA 1R4TA 2ITCC 1GKFA 1D2DA 4EB6A 1K04A 2WLHA 4YJ3B 2OEXA 1XREA 3EH1A 1J8MF 4HBNA 4OIPF 3DC6A 3K66A 2A0LA 3MYFA 3IFXA 1Q3EA 3SP1A 3OEHG 3OWTA 4CBCA 2J8WA 3T4DA 3JD1A 1JOYA 4ICGA 4TSFG 1HNWB 1BE3H 2QUPA 4XTKA 3ZHRA 4FLUA 2YIAA 1FXKA 4X1IB 3VQXA 3WFVA 2AVKA 3KPHA 4OINF 4R50A 2H7BA 3K33A 1WN0A 3E2EA 2KKWA 1OJHA 1J5EB 4UXNA 1Z5WA 3W7WA 4XDJA 4J7YA 4I9WA 1GN2A 2O57A 2YDEA 1GM5A 2E74B 1T5OA 4E7SA 2JD3A 5LYJB 3J80N 2Q4PA 3ABMC 4MVMA 3GEIA 1S5HC 3W7UA 1EZVH 1MOFA 4LF8B 5KYUA 3L0IA 2WLLA 2Y39A 4EIYA 3AEIA 2JEUA 2CW0F 3H1IH 1WB7A 1B06A 4JI1B 2PP4A 3SEOA 3J7AU 3B40A 4IIJB 4GKJB 5LOVA 4FX5A 2JJ1G 2QE7G 1H2NA 5FCLA 3B8MA 2EX3A 2ZIOA 4NXMB 4XLPF 3LJBA 2X6CA 4JURI 2P90A 2XLVA 4F6RA 2C2AA 4XEKA 4DR6O 4DO2A 2BTQA 2HKOA 2ZE8A 2VCCA 4DRHB 4WJ0A 1NZ6A 2B1GA 4JGSA 1MMGA 3SXMA 1NU7D 2ZXPA 4UB6Z 4ANJA 1YDIA 3VBBA 4AE4A 4DR1O 3SPHA 4WFAV 4DV2B 2CUGA 3Q7GA 1A32A 1V54B 4LF6O 2Z0AA 1VQ8V 4W4KA 4I4TB 2XXAB 3QVNA 3ASOB 2AWCA 5EGYA 5LGUA 5BQHA 1GH6A 4ULVA 3W4YA 2DN9A 1XMQO 4RUEA 1OR2A 4DV5O 4L6RA 1F23A 4YT8A 3QG5A 3VQVA 2Q9BA 4WFGA 2V1DA 1V55B 2P6VA 4YY3O 3CAXA 3L34A 3ZQYA 2K1EA 1E86A 2IH1C 4DR2B 1M5IA 5EK0A 3FAPB 4A4AA 2HHHO 3QO7A 4JV5B 1N1CA 3O6XA 3U5SA 1AJNA 3BRCA 2LSEA 2D5RB 2PNOA 4X1KA 2YLGA 1Z63A 1YZAA 1F4NA 4X20B 3HKCB 4MVSA 4O4LB 4MVQA 3NDBB 3LSQA 2EIKB 1FTSA 2QGNA 1Q90D 3SPGA 1ZU5A 2YIBA 2OJQA 1RPRA 2AZ2A 3HKBB 1PL4A 3WB2A 4FLYA 2EPNA 5DS5A 3C3SA 5EYPA 3KKYA 1SKVA 2Z15A 2D2CB 2UXBB 3RGBA 1TKNA 5IYCO 4NTXA 1HY5A 3K5MA 2OCCB 2YSUB 3MLGA 5LMUB 4MW3A 3C8GB 4GUNA 4RQFA 1BDJB 1MNGA 1ZZPA 1Q86W 4FJCC 2BC5A 3FMSA 3HNKA 5JVDB 3OMNB 1OCCB 3BAAA 4CH3A 2WA4A 1N0NA 1B3QA 4TUYB 3M4CA 2CDYA 3LDDA 2LP7A 5LP6B 4DBRA 3ZMVA 3JALB 1A7EA 1G8XA 4NC3A 4GKJO 2LW1A 3ZMSA 2LP4A 4O2AB 4FIPC 4DUYB 3MHHC 1LVKA 1WGWA 5JT4A 4N21A 5B3IA 5A6KA 1RJ9B 1K5QA 4PDVA 2PI4A 3FB6C 1VB5A 1DOWA 1KP2A 1O9GA 4B7KA 3NKEA 4NYKA 3D3IA 4ASUG 3GEHA 1KNYA 4LWSA 1O87A 1S3JA 4DR3B 3RWRD 3WHNA 1Y4MA 3N2GB 1R73A 4FMTA 1PCXA 2XLMA 5FNVB 1QU7A 4JVSA 4NTBA 2XAGA 2B1IA 4CBEA 5CMUA 1N34B 3K5OA 1HW7A 3SDLA 5KAIZ 2JVDA 4RBNA 3DXJF 2PFDA 4CC6A 3AG1C 3DKAA 2D3OW 5IYZB 1COWG 3OGIB 3OR7C 3K1HA 4JKVA 4HFKB 5BQGA 4CS8C 4GX5A 2ETSA 4K0DA 2HSQA 5FPOA 3CJHA 4YXWG 4I1OB 5A6AA 2CNWD 5L0CA 4GT1A 5IJ9B 3CZ6A 2Y0IA 1TFOB 1W0KG 1VYKA 1DGSA 5LHGA 3N0TA 4DR2O 2YKZA 4JI3B 3TGUH 1HNZO 2RNBA 3FB8C 4PJNA 3ABLB 4XEVA 2ARHA 1ORSC 3DE8A 1I5XA 2L35A 4E4EA 4Q6GA 1W2WA 3T2MA 5AC4A 5F2VO 3TJ5A 5L3DA 2R7VA 3M99B 3IGAC 3RFRA 4TV8A 2XT9A 2Q9AA 4LLEA 2PI5A 1YCIA 4LDQA 3BRJA 4UCRA 3NR7A 2AHZA 2Q7RA 1QR8A 4J7JA 2I8BA 3T4ZA 2BCCH 1YA7O 2J9UA 4CH5A 4DW1A 4RQEA 1G4US 5JQGA 5KUKA 2W6JG 1PPJH 2NUTB 5LMUO 3EGDB 5CBFA 2BOBC 5A6BA 2WVOA 4PI2A 2JEXA 5B66Z 5A6JA 4D4XA 3JSZA 2AP3A 3V5XA 1GTOA 5LL6Y 4HAMA 2R7XA 3UT5A 4TT3G 1VQPV 2ZM6B 4JW1A 4EEQA 2Y69C 3M79A 1QCEA 3RF3A 4B3TB 2PBEA 1NJIW 1UFBA 3CC4V 1K8AW 1IVSA 3JD2A 2KG7A 1IW7F 2ZT9B 1FPOA 3WU2Z 4LF5O 4JAVA 5J2UB 5IJ0B 2HJDA 4IHJB 1FFXA 3ZN1A 2BL2A 2VQFB 1IBKB 5JJNB 4XDKA 1LKXA 1JMWA 1RFYA 4PV1B 1AP6A 2EILC 1WAZA 1Y4CA 4O4HB 1R5ID 3B09A 2YL7A 2CTQA 4JTDB 1JJ2U 2E75B 1T5EA 3CHXA 4NXNB 2GDCA 2Q8VA 3H2VA 3SYQA 3ETEA 3K0DA 5K1PA 3C18A 4MNDA 3JAKA 4U5HA 3RVYA 4YJ2A 3RT3C 2J9WA 3T6BA 2A3QA 1FFTB 3R7CA 3Q4HB 2XLHA 3ASNC 1Q0DA 2QM8A 3JATB 2RMKB 5DS6A 3T1YB 3KYJA 1ZAUA 4NQFA 1PNKA 4H54A 2YXHA 4ZOLA 5C93A 2IXOA 4DJ9A 5JSLA 4AQYB 3HLZA 3S3XA 3LNNA 1R1BA 1I08A 5B1AC 1MG1A 3UM7A 2PYJA 1MNEA 5L0FA 4CDVA 1BS3A 4YL0A 1IZ3A 1WJZA 5CA0B 1ORJA 1A7VA 4X1YA 3R2PA 2F23A 4G0HA 5BR8B 2M6YA 1OHHG 4W4LA 4BJ6A 5JLIA 4KP4A 1S76D 1Z5ZA 3LNRA 1XHZA 1MMNA 5LA6B 3M8AA 1URFA 4U3JA 5KYYA 2DYRB 1TUBA 2P4KA 1NG1A 3FYEB 5B1OA 4N06A 4GLXA 3KCXA 1TWGA 4OD4A 4YT2A 4JAAA 4J10A 4KXRA 5F28E 2GV9A 3DZAA 2Q69A 5B1BC 2XM4A 4IAQA 2X0CA 1TQGA 2WL8A 4WF9V 3LEOA 3ITFA 1H2KA 3SXZA 4AL1A 1HMDA 4A2NB 5DN6G 2R25A 3KCYA 4TV9B 4LBEC 4DV7B 1MSDA 1VF6A 2YEVA 4DV3O 3NYMA 1GS9A 2M64A 2OIEA 1O3UA 4EBBA 3EHBB 2RSEB 4H44B 4YHHB 2A69F 3R66A 2UXDO 3FX7A 2Y4UA 3K1IC 2KJGA 1LR1A 5GPGB 2XOKG 4U5EE 4IYIA 3ABKC 1VP7A 3K3WA 4MTOA 1NVPB 4U5FE 5ITZA 1XBLA 4E18A 1M93A 3H65A 2X0LA 4BJ1A 2HFEC 4OPHA 2A68F 1FYJA 2XL4A 5KHGA 4KUMA 1YITV 5CA3A 1MZEA 1OCOB 3CEIA 1QBZA 2YUAA 3H1HH 3PMRA 3IJ4A 4IRUA 1JMKC 1G4YB 2DQ3A 4ZIBA 1TWAA 5CBGA 4UVCA 2VB6A 2JIZG 4YN0B 3JCUQ 3K79A 2Y3GA 2CTWA 3RKOF 1H8HG 4O7GA 3TULA 2X6BA 1QLEB 3CSXA 5E3CA 1ZU4A 5L3QA 1XWJA 2YRFA 3VQWA 2EJRA 4AQYO 3MHSC 1OCZC 4FFKA 1SZXA 5IYDO 1N32B 1WATA 3IQCA 3JZ0A 3DXRA 5CI8A 2P61A 2BSKA 2GDSA 2EZOA 3RN4A 2CGEA 3KYIA 5KYXA 4QE9A 1FAFA 5L0GA 1H2LA 3F7VC 1A7DA 3PDMP 4U5BE 1SQQH 3ZRSA 5KYWB 1F1MA 3B77A 1Y67A 5BQIA 1JRAA 2DYSC 3RYFB 2IU0A 2LIGA 5C8YB 2QY9A 3HKKA 3SNHA 1BCCH 2ZIMA 4QE7A 4QPKA 3CPWU 3RIPA 1F4MA 1CP9A 4JYBA 1AROP 1FNTc 1ZVZA 5BMVB 5KA5A 4BW9A 4JI6O 3C90A 4B3MB 3JYCA 3ZN0A 1NI8A 2ODMA 3STZC 2YL3A 4UVAA 1MMAA 3CCQV 2ZE5A 3ECSA 3B8NA 1IBLO 4OIRF 3SPIA 3U8PA 4BPMA 3ZJZA 1RSOB 3T9OA 2W45A 4LACB 3L70H 1SMYF 4DRXA 2MW2B 2H3OA 2ZDIC 4KBLA 4E7ZA 3MAQA 2CCYA 4U9EA 4PK4A 2J9BA 3NXSA 3U11A 2ZQMA 1HW1A 1THZA 3OE7G 4OD5A 3GORA 1X4TA 3G6EV 3K5NA 4JYAO 3RYIA 1XNQB 3E22A 3EHMA 1ZTEA 1AR4A 2YZSA 3BA9A 2UUCB 5J2TA 3QO8A 2ADPA 2VWJA 3LDCA 4I50B 1Y6DA 4GZRB 2UXNA 2E76B 4ZI7B 2Z3YA 4K0KO 2IJHA 2ZNIA 2ZXRA 1R6KA 4EB6B 4GYCB 2XNDG 1CGOA 2X51A 3HNLA 3F7YC 1G4WR 3JSEO 4P9OA 2EPOA 3B0UX 2XS8A 1BR1A 4Z9HA 3TJ6A 3A8TA 1M2VA 3RQEA 4UB8Z 3SJAC 3C8GD 2RN9A 1TVKA 4FVMA 3ATPA 5HFMA 3LS0A 1ZHWA 4F6EA 5GONA 4X65B 1D5NA 1FXKB 3M4BA 1RM1B 2LD6A 3IQTA 1WA8A 4HNAA 3CMEV 3T6JA 4LLCA 2YICA 1DTOA 4EBJA 2XSEA 3MYIA 2YHSA 1S5LZ 4FM1A 4MTXA 2QEXV 1M57C 5KYUB 2HEPA 4D7SA 2XAJA 4GKKO 3LEVA 1D5AA 4C7UA 1AB3A 1SQPH 3P32A 3AK2A 4R8CA 4DR7B 2ZE6A 1QVFU 4LERA 1VQ4V 2WPDG 1S77D 1E2XA 5LOVB 4JI0O 4ER9A 1XMOB 1S05A 4K35A 1JFFA 2FKXA 2N74A 3TD7A 2KNHA 2YC0A 1P49A 2GSMB 4J11A 2L6LA 4MVUA 3K0GA 5IY5C 3GWNA 1H2GA 4B08A 1Q81W 4FLTA 4F6RB 4JCHA 3AK1A 1N33O 2JGDA 2BTQB 4P9FA 1AI5A 3AG2B 3ZQVA 1JJOA 4DV0B 1ZX3A 5FLXN 3ZWIA 2PX0A 4W8KA 3OMAB 1W0JG 2GBOA 2L81A 2AHYA 3OW2U 2XS1A 4AE4B 2ZXWB 1J8YF 2J7PA 1TR2A 2UXCO 1HNXB 4YL1A 4X66B 2R7TA 4D6TH 3L74H 3HJCA 4CDAA 2WLKA 4WBNA 3WAQA 1FD9A 4WFEA 4GEHA 3L71H 1EA8A 5KMGA 2R02A 4WFHA 1E79G 2OCHA 4YK5A 2IJIA 2V3CC 1YXBA 4AX2A 1OW6A 3APOA 3NG1A 1US6A 1VF5B 1OKKA 1ZUQA 2IM9A 2YI8A 1IBMB 3CCEV 4WFBV 3PCVA 4UCTA 2KYHA 3A11A 1SQVH 5IDJA 1MQVA 2QWQB 4CH4A 1WB8A 4X1KB 4ZHQA 1ORYA 3SYCA 1OCRC 4K8ZA 3K06A 2E3CA 4JJGA 2HZ8A 2XAHA 4JZAA 1QQ3A 3S90A 1SC5B 3ZEDA 3PJSK 4L8JA 1JR8A 1IXMA 4YWQA 5EYPB 4CC5A 4XPYA 1JR9A 2M7WA 3FB5C 5H6QA 3SYOA 3WG7B 1I0HA 1M56B 2UU9B 3O55A 4OX9O 5L3VA 3CC2V 2F43G 1S72V 3VQYA 5J9PC 5LHIA 5E33A 2LFFA 1Z3IX 4UCVA 5L0IA 2FTKA 2IU3A 3HPLC 1Z23A 4JRZA 2FB5A 1H9GA 1HWYA 4TWKA 3HKDA 3O9OA 2J0XA 4CS9C 1ZL8A 2Q4FA 2G3KA 3EQLF 1YZCA 3C62A 1QHTA 4QGPA 4DR7O 2F4VB 4UUJC 2YS8A 1AR1B 5DEDA 2Q0OC 3L75H 3SGIA 3ZBHA 1RPOA 2WA3A 4OPAA 4E0HA 3FDQA 2QM4A 2XHBA 1L3PA 2Q7EA 3NRHA 1BR4A 4CJGA 3CXHF 3W7SA 1CPYA 3CWBH 1KTMA 1EM1A 2W9YA 3UQ8A 4LH6A 5L0DA 1I94B 1PKXA 1VQ6V 4JI4O 3UMIA 3W2WA 3FAVB 3JD4A
chains in the Genus database with same CATH topology
1NR1A 5KUKA 2DQ0A 2W6JG 3E86A 4HZ3A 1SESA 5FL7G 3ZMUA 5CBFA 2BOBC 3ABUA 3ETGA 5B3SC 3DTUB 2JEXA 3X2QC 4U7NA 1GTOA 4HAMA 2WLJA 1QLEC 2A79B 4TT3G 1VQPV 1YTFB 2Y69C 1QCEA 1GK9A 4I5SA 1NJIW 1KC8W 3CC4V 1K8AW 1M57B 1M1KW 4PA9A 3JD2A 4MTFA 1Q82W 1NBMG 1FXVA 4KFMA 4JAVA 3I56V 4JF3A 3ZN1A 1QR9A 5CN0A 4XDKA 2HVJC 4X88A 2QTOA 4MW8A 1ORQC 2EILC 1NH2B 1E1QG 3E89A 5IY5B 4X89A 4MT8A 4JTDB 1JJ2U 1GM9A 5GW7A 3AG4C 4MVOA 2GHYA 2IJKA 2WLNA 3OUFA 3SYQA 2QA4V 1N8RW 3ETEA 2LFSA 3K0DA 1G8MA 4MS2A 1B6QA 2KB1A 1ENVA 3RVYA 3OMIB 2WAMA 1FFTB 3P30A 1EFRG 1YIJV 3CCUV 1YJ9V 3ASNC 2W0FC 2QM8A 1NKDA 3G4SV 1QVGU 4PA7A 3E8HA 3CXCU 1PNKA 3I55V 5LGNA 2ATKC 2XAQA 3ZRWB 5C93A 1W2BU 4G28B 5BZBA 1E1RG 1YHQV 2CK3G 3CCMV 4G27B 2B5UA 3QO5A 4J9YB 5B1AC 1MG1A 1P4RA 5HFLA 3UM7A 1YI2V 1PNLA 4QIWF 3CCVV 5KUMA 4PA4A 4GX2A 3H01A 1WPXA 4H37A 1NQTA 1NVPD 3K9AA 1KKDA 2EIMB 1OHHG 4KP4A 1S76D 4HYOA 4GX1A 3T1CA 1J95A 2BOCC 4P30A 5LHHA 3CD6V 2R9IA 1H8EG 1JX9A 2DWEC 4WFFA 3SYAA 2DYRB 4LP8A 3SJQC 1MSWD 1KQSU 3LNMB 3FYEB 5L3GA 3CCRV 4N23A 5B1OA 1OCRB 1PL0A 1Q7YW 2NNUA 1BMFG 2Q68A 1KD1W 1VQ7V 2Q69A 3ML0A 2HG5C 5B1BC 1V54C 3AG1B 3AG3C 1XL6A 1JPXA 4CZZA 4WF9V 4Q20A 3ASOC 2X6AA 1FXHA 5DN6G 3ZIAG 1VQMV 1H38A 4LBEC 4U7OA 4OXSA 1KECA 2YEVA 1YSCA 1XL4A 1OZ0A 2ZR3A 1FXKC 1V55C 3EHBB 1RM1C 2MK3A 3CMAV 4MTGA 1TUEB 3E8BA 3LDEA 4DXWA 1JQ0A 2XOKG 1VQ9V 4L87A 3ABKC 1CEZA 1R3LC 4FK5C 3K3WA 4MTOA 1NVPB 1BHBA 4QPJA 4RO2A 2Q67A 3OR6C 2X0LA 4LCUC 2HFEC 2EINC 1K97A 2WLIA 1SETA 4KUMA 2JDIG 2WWWA 2EIKC 2ZR2A 3LUTB 5B1NA 1YITV 5CA3A 1OCOB 2IH3C 3K03A 1QBZA 5EBWC 5L3BA 1VQNV 1SRYA 1G4YB 2DQ3A 3R65A 4UVCA 5CBGA 2JIZG 4WCEV 5H6RA 1AJPA 1AI7A 2Y48A 3K79A 3TK1A 2IJJA 5B3SB 2OCCC 1H8HG 3OM3B 2HLDG 3AG2C 3X2QB 4JPRA 3IC7A 4BW5A 2X6BA 4XDLA 1GO3F 1K3EA 1QLEB 5EC1C 3F5WC 2ZD9A 2Y69B 3CP1A 1VQLV 4H33A 2WLMA 4PDRA 4P9PA 2EJRA 3JCZA 3VOUA 2EIJC 2ZXWC 3D36A 3MHSC 4UVBA 1OCCC 1OCZC 2V7QG 5EBMC 5IYDO 1K5SA 3E83A 1K33A 1L1FA 2HJFC 1K4DC 2EZOA 2R9RB 1ROPA 2ITCC 1GKFA 5KA6A 4QE9A 1K7DA 3JD3A 2WLHA 3F7VC 3OEEG 4JTCB 2YEVB 3ZRSA 3B77A 2A0LA 2EILB 2DYSC 4PA6A 1VQ5V 3IFXA 3CCLV 2IU0A 3OEHG 4CBCA 3T4DA 1AJQA 3JD1A 1JOYA 4QE7A 4QPKA 3CPWU 1F4MA 1CP9A 4TSFG 3AG4B 3OAAG 4JYBA 1LNQA 3ZMZA 1AROP 4Z1MG 5KA5A 3WFVA 1FXKA 3JYCA 4R50A 3ZN0A 3STZC 4JASA 4UVAA 5E1AC 3E2EA 3CCQV 3CYOA 3B8NA 4MSWC 4UXNA 3SPIA 3ASNB 3W7XA 3W7WA 3ZJZA 5H9CA 4XDJA 4I9WA 4JAUA 3ETDA 1P7BA 2WLIB 3ZMTA 3ABMC 2ZDIC 4MVMA 1S5HC 1GM8A 3W7UA 3CCJV 1GMGA 1MOFA 2ITDC 3UKMA 2WLLA 1MABG 2EZPA 2W6IG 3AEIA 2JEUA 4RUFA 5B1AB 3NXSA 1SERA 2ZQMA 1R3KC 1THZA 3OE7G 3WG7C 2JJ1G 5L3FA 1M56C 3EFFK 2QE7G 3G6EV 4FPPA 2OTJV 2A9HA 2WSSG 3QNEA 1DF5A 1JVMA 2XAFA 3B8MA 3ABTA 3QO8A 1EBOA 3JD0A 4UV8A 2X6CA 2P90A 3LDCA 2C2AA 2JK5C 3ABLC 4DO2A 2UXNA 2HKOA 1YJWV 1NR7A 4BIUA 2Z3YA 1AI4A 2HVKC 2B1GA 4JGSA 4J9ZB 2IJHA 3TCUA 1R6KA 3FKSG 2XNDG 3VBBA 3SPHA 4WFAV 1F51A 3OUSA 2JJ2G 3F7YC 5B1BB 1EZJA 1V54B 4R6ZA 4P9OA 5IYBO 4JTAB 2H94A 1VQ8V 3K04A 3GWOA 3ASOB 1K9MW 5LGUA 5L3CA 2DW4A 5HFMA 5EBLC 2NLJC 2X7RB 4RUEA 5LGTA 4JYCA 4ZKIA 2HR3A 1F23A 1FXKB 2Z5UA 1R3IC 3RBZA 4WFGA 2V1DA 3KG2A 1V55B 3OFNG 1RM1B 1FS0G 2K1EA 3MD0A 3CMEV 2IH1C 1PD3A 3SPCA 1DTOA 5EK0A 2IW5A 3HB3B 3SYPA 1JCHA 3ABKB 2XASA 3QO7A 3RVZA 4MTXA 2QEXV 1M57C 1AJNA 4GX0A 2XAJA 2UXXA 1Y66A 1F4NA 3P32A 2EINB 4LC1A 4R8CA 3LSSA 4MVSA 3SPJA 4MVQA 2WPDG 1VQ4V 1QVFU 1DF4A 2ZDIA 1S77D 3LSQA 2EIKB 2QM7A 3SPGA 1RPRA 4GCZA 1KP3A 2GSMB 3BEHA 3BY6A 4MVUA 3K0GA 5IY5C 1H2GA 1Q81W 5IYCO 4EKWA 4PELA 2OCCB 2P67A 2OT5A 4P2ZA 1I5YA 1PNMA 1AI5A 3AG2B 4E2LA 2YSUB 4QJFB 2DWDC 3E8FA 3OMAB 1W0JG 4MW3A 1R6NA 3G71V 4RQFA 3TETA 1WLEA 1Q86W 1K4CC 4FJCC 2AHYA 2P6JA 4G2KA 3STLC 3OW2U 2EIJB 2ZXWB 3OMNB 1QLNA 1OCZB 1OCCB 3ZRVA 1K92A 1BHAA 3E8GA 3LDDA 5EC2C 2LP7A 3ZMVA 2H8PC 3E35A 3ZMSA 3DGEA 1UJWB 4FIPC 4QNHB 1R3JC 3MHHC 2WLKA 2Q6AA 4N21A 3CCSV 3FB7C 1K5QA 4PDVA 4WFEA 2DYSB 2PI4A 3FB6C 4WFHA 4XBFA 1E79G 3FYIB 2EIMC 1KP2A 2IJIA 3D3IA 4ASUG 4BIZA 1S3JA 3CCEV 3ZRXA 5DM6V 2DYRC 1Y4MA 4WFBV 1R73A 4FMTA 2KYHA 5IDJA 4BAYA 1DLBA 2XAGA 2B1IA 1YJNV 5CMUA 3SYCA 3W7TA 1OCRC 3K06A 3ABMB 5L3EA 2XAHA 4PA3A 5LBQA 1GM7A 3AG1C 3PJSK 2D3OW 1AI6A 1IXMA 1COWG 3OR7C 1BL8A 1M90W 1ZWIC 4GX5A 4R7CA 4YXWG 2M7WA 1YTFD 3FB5C 5H6QA 3SYOA 1VQOV 3WG7B 4GT1A 3GB7C 1M56B 1W0KG 4ZBMA 3CC2V 2F43G 1S72V 4MVRA 5J9PC 5LHIA 4PDMA 3A0RA 5LHGA 2FTKA 2IU3A 3AG3B 3HPLC 3CC7V 2LFRA 4RAIA 2P7TC 4PDLA 3FB8C 3RW0A 1HWYA 3ABLB 4TWKA 1ORSC 1I5XA 3T2MA 1S0VA 1VQKV 3OGCC 3ZCCA 4UV9A 3K08A 1K73W 5L3DA 1NH2D 3M99B 2EBOA 3IGAC 4UUJC 1AR1B 1RPOA 2PI5A 5CBHA 2OTLV 2AHZA 4X8AA 1M9NA 1QR8A 3W7SA 1CPYA 3ZRWA 4F4LA 3T4ZA 4MVZA 1SZTA 1OCOC 1PKXA 2QKSA 1VQ6V 3JD4A 2WLLB 1K34A 4RQEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KUK A;  1P7B A;  2WLI B;  3E86 A;  4HZ3 A;  3ASO C;  2DWD C;  2X6A A;  3ABM C;  3E8F A;  4MW3 A;  4MVM A;  1S5H C;  3TET A;  2ITD C;  5CBF A;  4LBE C;  2BOB C;  3UKM A;  1K4C C;  5B3S C;  2AHY A;  2WLL A;  3STL C;  4OXS A;  3X2Q C;  2YEV A;  1XL4 A;  4RUF A;  2WLJ A;  1QLE C;  2A79 B;  1V55 C;  2Y69 C;  1R3K C;  3E8G A;  3LDD A;  5EC2 C;  3WG7 C;  2H8P C;  4MTG A;  1M56 C;  3E8B A;  3EFF K;  3LDE A;  4PA9 A;  4DXW A;  4QNH B;  1R3J C;  4MTF A;  2A9H A;  2WLK A;  2Q6A A;  4KFM A;  1JVM A;  3FB7 C;  3ABK C;  4PDV A;  4WFE A;  1R3L C;  2X6C A;  3FB6 C;  4MTO A;  4WFH A;  3LDC A;  4RO2 A;  2EIM C;  2HVJ C;  2JK5 C;  3ABL C;  2Q67 A;  3OR6 C;  4XDK A;  4X88 A;  2QTO A;  4LCU C;  2HFE C;  4MW8 A;  1ORQ C;  2EIL C;  2EIN C;  2HVK C;  2WLI A;  3E89 A;  4J9Z B;  4X89 A;  3TCU A;  2EIK C;  4JTD B;  2DYR C;  3LUT B;  3AG4 C;  4MVO A;  3SPH A;  2KYH A;  2WLN A;  3OUS A;  3OUF A;  3SYQ A;  3F7Y C;  2IH3 C;  3K03 A;  3K0D A;  5EBW C;  4MS2 A;  4R6Z A;  2KB1 A;  4P9O A;  3RVY A;  1G4Y B;  3SYC A;  4JTA B;  1OCR C;  3K06 A;  3K04 A;  3R65 A;  5CBG A;  4PA3 A;  3ASN C;  2W0F C;  2OCC C;  3AG1 C;  5EBL C;  3PJS K;  2NLJ C;  3AG2 C;  4BW5 A;  4RUE A;  3OR7 C;  4PA7 A;  3E8H A;  1BL8 A;  2X6B A;  4XDL A;  1R3I C;  1ZWI C;  4GX5 A;  4R7C A;  2ATK C;  5EC1 C;  3RBZ A;  4WFG A;  3F5W C;  3KG2 A;  2ZD9 A;  3FB5 C;  4G28 B;  5BZB A;  4H33 A;  2WLM A;  4PDR A;  3SYO A;  2K1E A;  4G27 B;  4P9P A;  3VOU A;  3GB7 C;  2EIJ C;  2ZXW C;  2IH1 C;  1OCC C;  1OCZ C;  3SPC A;  4J9Y B;  5EBM C;  4ZBM A;  5B1A C;  3UM7 A;  4MVR A;  5J9P C;  5EK0 A;  4PDM A;  3E83 A;  3SYP A;  2HJF C;  1K4D C;  2R9R B;  5KUM A;  4PA4 A;  4GX2 A;  3HPL C;  3RVZ A;  2ITC C;  1M57 C;  4QE9 A;  4H37 A;  2WLH A;  3F7V C;  4GX0 A;  2P7T C;  4JTC B;  4PDL A;  3FB8 C;  4RAI A;  3RW0 A;  4TWK A;  1KKD A;  1ORS C;  3ZRS A;  4HYO A;  4GX1 A;  3T1C A;  1J95 A;  2BOC C;  2A0L A;  4P30 A;  2DYS C;  4PA6 A;  3T2M A;  3OGC C;  4R8C A;  3IFX A;  3K08 A;  4MVS A;  3SPJ A;  4MVQ A;  2DWE C;  3T4D A;  4CBC A;  4UUJ C;  3IGA C;  4QE7 A;  4WFF A;  3SYA A;  3SJQ C;  4LP8 A;  3SPG A;  1LNQ A;  3LNM B;  3BEH A;  4MVU A;  5CBH A;  3K0G A;  2AHZ A;  4X8A A;  5IY5 C;  3JYC A;  4R50 A;  3STZ C;  4F4L A;  3T4Z A;  4MVZ A;  5E1A C;  2Q68 A;  4EKW A;  4MSW C;  1OCO C;  3SPI A;  2Q69 A;  2HG5 C;  5B1B C;  2QKS A;  3ZJZ A;  4XDJ A;  1V54 C;  4I9W A;  3AG3 C;  1XL6 A;  4P2Z A;  2WLL B; 
#chains in the Genus database with same CATH topology
 2OG2 A;  4LWS B;  2Q3T A;  4HZ3 A;  3E86 A;  1SES A;  1FFH A;  2RD9 A;  5FL7 G;  3ZMU A;  5CB4 A;  2ZXO A;  2IOQ A;  1KU2 A;  3PHF 2;  1N0J A;  4U3F H;  2MYS A;  3GM3 A;  1YTF B;  1HNW O;  1GK9 A;  1VLT A;  4KC9 A;  1KC8 W;  5CA1 A;  1F7Y A;  3AQB A;  4PA9 A;  1SYQ A;  1U89 A;  2H8A A;  5T3W A;  4MTF A;  5LMN B;  1Q82 W;  1NBM G;  4KFM A;  1S7Z A;  4NTW A;  4DR5 B;  4EBK A;  1J5E O;  3CJH B;  4U5C E;  1QR9 A;  2QWO B;  1XIL A;  2P22 C;  2HVJ C;  4H4K C;  3UR3 C;  2GWW A;  4X88 A;  4KHP B;  1YF2 A;  1SS3 A;  2DJV A;  2QTO A;  1M2O A;  2CH7 A;  2A6E F;  2DB4 A;  1ZW3 A;  4XWJ A;  4LF8 O;  1NH2 B;  1A41 A;  4CS8 A;  4X89 A;  1IBM O;  1UG7 A;  1GM9 A;  5GW7 A;  1O9H A;  2GHY A;  5TJ5 E;  4JI1 O;  1U6H A;  3OUF A;  5D5P A;  3JAM N;  1QSP A;  1G8M A;  2DI3 A;  4MS2 A;  2KB1 A;  2WAM A;  3P30 A;  2FFH A;  1NU1 H;  3ETQ A;  1YIJ V;  4J30 B;  4TV8 B;  5JJJ B;  1XEQ A;  4NXM O;  5K0I A;  1EN5 A;  3RYC A;  4X62 B;  3G4S V;  4PA7 A;  1WAS A;  3I55 V;  2Q5Z A;  5LGN A;  1XHX A;  1W2B U;  5TIS Z;  2NN4 A;  3CCM V;  4QDL A;  1YDX A;  3DI5 A;  4ABM A;  2B5U A;  5HFL A;  2UU9 O;  1Q6U A;  1PNL A;  4U5D E;  5JQG B;  3FAJ A;  1NZE A;  4PA4 A;  1AUE A;  4GX2 A;  1WNS A;  4DV2 O;  3CE2 A;  1EQ1 A;  4KNW A;  1WPX A;  2QLA A;  1NVP D;  3O39 A;  1KKD A;  3LS1 A;  1H9T A;  2EIM B;  4NCQ A;  1HP8 A;  4GX1 A;  256B A;  2Y3D A;  3UT5 B;  1XZQ A;  5LHH A;  3CD6 V;  3P3P A;  2P06 A;  3KMI A;  2AZ0 A;  4C3D A;  4WFF A;  2MWQ A;  3D36 C;  4LP8 A;  2O9X A;  2KG7 B;  2R70 A;  3ZG1 A;  1HE9 A;  4N4W A;  1RCP A;  3U0C A;  4O4L A;  1IDS A;  2OIG A;  5L3G A;  1ZW2 A;  1FFX B;  1PL0 A;  3JAS A;  1Q7Y W;  4C3B A;  3G67 A;  1LI7 A;  2Q68 A;  4DUZ B;  4IT5 A;  1VQ7 V;  2HG5 C;  1V54 C;  4JV5 O;  1I94 O;  1JPX A;  3TK0 A;  1IXB A;  2UUI A;  3ASO C;  1NTZ H;  2N04 A;  1VQM V;  2QJ1 A;  4JYY A;  1H38 A;  1HW2 A;  1ZHX A;  1S5J A;  4U7O A;  4OIO F;  4OXS A;  1XI1 A;  2PUS A;  3TXQ A;  1YSC A;  2ZR3 A;  4PJ0 Z;  3JAK B;  3U9J A;  3L73 H;  1VLS A;  1D0Z A;  4YJ2 B;  3CRR A;  3UO2 A;  1V55 C;  2PGG A;  1KYO F;  4MTG A;  3ZSU A;  1TUE B;  3LDE A;  2OU6 A;  4B3R B;  5LMN O;  2UXB O;  5EZY A;  4RD9 A;  4L87 A;  1OV9 A;  3B29 A;  4Z9J A;  1WTY A;  3I4U A;  1ZHY A;  4JE9 A;  4JIO A;  4KI2 A;  4RO2 A;  3HKE A;  3FVY A;  2UUA B;  1LI5 A;  4PHZ A;  3OTO B;  1Q5O A;  4N6C A;  4E17 A;  4CSA C;  3QVZ A;  3N2Z B;  2WLI A;  1SET A;  2RQ6 A;  2EIK C;  1T6U A;  4X1Y B;  3TOL A;  3VAY A;  2B0J A;  2JS3 A;  3DWW A;  4LFA B;  3U10 A;  2QTS A;  1YJG A;  1ZHZ A;  2E87 A;  3D8C A;  1PP9 H;  4B7E A;  3S28 A;  4O2B A;  4DUY O;  4FLZ A;  5KHK A;  2LQT A;  5H6R A;  1AJP A;  1GN4 A;  2HJM A;  4U3J B;  1OW8 A;  4DK0 A;  5KYY B;  5B3S B;  2OCC C;  2M4E A;  4O79 A;  3X2Q B;  1TUB B;  1P7G A;  2J46 A;  2P0N A;  4EFB A;  4D7T A;  2BTO A;  3IQ6 A;  3CP1 A;  4PDR A;  3FOP A;  4NTA A;  4BR6 A;  4LF4 B;  3K57 A;  2VAS A;  1OCC C;  2V7Q G;  4DR3 O;  1AVO B;  1K5S A;  4H13 B;  3E83 A;  2R9R B;  4O4J A;  1ROP A;  5LP6 C;  4LNU A;  4RDA A;  2HP8 A;  3NYL A;  4IL6 Z;  1K7D A;  3GVM A;  3JD3 A;  3OEE G;  2PTM A;  4O4I A;  3TXS A;  4CS3 A;  1N34 O;  2YEV B;  4PA6 A;  3UNG C;  1VQ5 V;  3CCL V;  4LR3 A;  1AJQ A;  2L6F A;  4AHC A;  3AG4 B;  3OAA G;  4G7Z F;  1NTK H;  4Z1M G;  2R05 A;  2PYL A;  1SZI A;  4JEA A;  5COG A;  3AOU A;  1Y76 A;  3JAR B;  4JAS A;  5E1A C;  5FPR A;  5ITZ B;  4JI8 B;  4MSW C;  3T4R A;  4DUZ O;  4JI3 O;  3CSK A;  4IJJ A;  1GGQ A;  2IXN A;  4JAU A;  3K1I A;  1P7B A;  3ZMT A;  4B3S B;  2OEV A;  3CCJ V;  2ITD C;  3N2K A;  1FMW A;  3UKM A;  2UUB B;  2DMX A;  1MAB G;  4PJM A;  3M7M X;  3NYJ A;  2Q0A A;  3RH3 A;  3JRM O;  4HE8 D;  4RUF A;  1VAR A;  2RJZ A;  5KX5 A;  1SER A;  5L3F A;  3EFF K;  3DAG A;  4FPP A;  1RMV A;  3EZH A;  2QE9 A;  2TMV P;  1DF5 A;  1JVM A;  4FM2 A;  5FZT A;  1LUV A;  4UV8 A;  4D4N A;  4DYL A;  4U5G A;  5J2U A;  2JK5 C;  3ABL C;  1NR7 A;  4BIU A;  2UUA O;  2HVK C;  3DXR B;  1A0B A;  1V4A A;  4C7O A;  4J9Z B;  5JUA A;  2B9Z A;  5KYX B;  4O6N A;  4LDR A;  3FKS G;  3E70 C;  4WGZ A;  4PR9 A;  2DOS A;  2GUZ A;  3JAW A;  2YQY A;  3OUS A;  2ZM6 O;  2A7W A;  1T9K A;  4B3T O;  4R6Z A;  2XM0 A;  5IYB O;  4FAP B;  4K8X A;  4JTA B;  2H94 A;  4GQH A;  2L6H A;  1K9M W;  1WP8 A;  1I4Z A;  3S3W A;  4HEA J;  5GTH Z;  1NLX A;  4UCO A;  5LGT A;  5JH7 A;  4N6H A;  2VQF O;  2Q00 A;  1IBK O;  1GQA A;  3Q4H A;  1R3I C;  2Q7G A;  2OYQ A;  3RBZ A;  1ZSP A;  3BFR A;  1VF7 A;  4JEB A;  1L0N H;  3OFN G;  2NUP B;  3EXA A;  1QNM A;  3DD7 A;  3CQZ A;  1FJG B;  1PD3 A;  3SPC A;  4LF4 O;  1T01 A;  4Q4Z F;  2IW5 A;  3AG7 A;  3B4S A;  4OIQ F;  4X64 B;  1JCH A;  1KU9 A;  4DRX B;  1AVM A;  1N36 B;  4NXN O;  3C63 A;  3KL4 A;  3T1H B;  3TQO A;  4GX0 A;  1N4C A;  1RKE B;  1Y66 A;  4BJT A;  2HMQ A;  2EIN B;  4LC1 A;  4EUK B;  2J9V A;  3K6B A;  3MFN A;  1OW7 A;  3RYL A;  3VYW A;  3T1Y O;  2ZDI A;  2CTP A;  5AC5 A;  1BR2 A;  3GWL A;  2FML A;  3RYI B;  3E22 B;  4GCZ A;  5D92 A;  1SQF A;  5J2T B;  1NTM H;  2OQM A;  1UFI A;  1HR0 B;  4EKW A;  4XQ1 A;  1LS1 A;  1MND A;  3K58 A;  2YL1 A;  2CGO A;  5DVW A;  3I5Q A;  4PEL A;  2P67 A;  2OT5 A;  3F47 A;  4P2Z A;  5E2Q A;  4E2L A;  2BE5 F;  5BR8 O;  2DWD C;  1FFT C;  4F4B A;  4CH6 A;  1R6N A;  3DM9 B;  5BY1 A;  5JP7 A;  2P5O A;  3TET A;  2OJE D;  1VMG A;  5KAF Z;  1KUQ A;  1K4C C;  4M63 A;  2UUB O;  2EIJ B;  4FFB A;  2GA0 A;  3QMK A;  1K92 A;  3EG9 A;  2WZL A;  1BHA A;  3J06 A;  1M2V B;  2QWN B;  1NSG B;  3JSL A;  3U2L A;  4J7K A;  5DLJ A;  1UJW B;  1QQC A;  4JI5 B;  3K5L A;  1R3J C;  1WPB A;  1JAF A;  2Q6A A;  3BVO A;  2LW7 A;  3FB7 C;  3S29 A;  4O6M A;  4YT5 A;  1ZLZ A;  3ZHT A;  3OA1 A;  2XLO A;  4XBF A;  1XUQ A;  4XLN F;  2HMZ A;  1WA8 B;  3FYI B;  4HNA B;  4WAB A;  2PZS A;  1G6U A;  2WVN A;  1HE1 A;  1W59 A;  1SQG A;  3G6B A;  3HNJ A;  1NFN A;  3Q6N A;  3DJU B;  4DV7 O;  4UCU A;  1MA1 A;  2LCH A;  1VOM A;  2LJ2 A;  2N05 A;  3NMK A;  3ZRX A;  4DK1 A;  2DYR C;  4JZ2 A;  5L0H A;  1L0L H;  4YHH O;  3LES A;  3W7T A;  2CNW A;  2QWR B;  3IHU A;  5GTI Z;  4AK9 A;  3ABM B;  2KSF A;  5L3E A;  3FHD A;  4PA3 A;  3HR0 A;  5LBQ A;  1JFF B;  1GM7 A;  3F5T A;  5H2F Z;  5JCO C;  4NTF A;  3CRA A;  1AI6 A;  2FYU H;  3ZIB A;  4Z1V A;  1BL8 A;  2CAZ C;  1M90 W;  1ZWI C;  1SA0 A;  4O6Y A;  3U2M A;  1YTF D;  2LK4 A;  2KW3 C;  2RDC A;  4C3E A;  3H1K H;  3SJB C;  1CXZ B;  2JGD B;  3U0Z A;  5K1X A;  2P1A A;  4ZBM A;  1VMA A;  4XPW A;  4MVR A;  3CRQ A;  1TGO A;  1FJG O;  3EFO A;  4PDM A;  3A0R A;  4KNV A;  3US6 A;  5DS4 A;  4I44 A;  1PM9 A;  3AG3 B;  4QI2 A;  3WOD F;  3ZTZ A;  4IYH A;  3K9S A;  2P7T C;  5KHH A;  2CGN A;  3L9D A;  3T1H O;  3V7O A;  5D91 A;  2CTR A;  4ZLD A;  3B9Q A;  1MZF A;  1VQK V;  4FLX A;  3K08 A;  2QDO A;  3CX5 F;  1NH2 D;  3A9C A;  3JTL O;  2EBO A;  2A1D D;  1E85 A;  3H1L H;  1LIH A;  1MMD A;  3CRM A;  1Z6A A;  4WBN B;  4J7T A;  4X8A A;  4JCZ A;  1M9N A;  1TA8 A;  4PFP A;  2KGO A;  3UMH A;  1AP5 A;  3ZRW A;  5KMG B;  4MVZ A;  1O5H A;  1N32 O;  1SZT A;  2A06 H;  1OCO C;  3B0P A;  5T1D B;  2G62 A;  2QKS A;  1SR2 A;  2WLL B;  5LXT A;  4DR6 B;  1NR1 A;  1BBH A;  1ZHT A;  1OXK A;  3ZHQ A;  1NU9 C;  5B5E Z;  3BA8 A;  3EH2 A;  4BG0 A;  1D0X A;  2F1M A;  2GTS A;  3POV A;  3ABU A;  3ZC4 A;  3ETG A;  3DTU B;  4JI7 B;  4ZHQ B;  2R7Q A;  1DK1 A;  4CIP A;  2WLJ A;  4I7Z B;  1QLE C;  2A79 B;  4I0X A;  2AW9 A;  4I5S A;  3TOM A;  1V74 B;  1ST6 A;  1T6I A;  4DRJ B;  1Y74 A;  5IWA B;  4I55 A;  4B3M O;  4IAR A;  3QVY A;  2ILM A;  3EZI A;  3I56 V;  1L7C A;  2VRZ A;  2YI9 A;  4JF3 A;  1XMQ B;  1YVW A;  5E79 Z;  4DV5 B;  1D1C A;  5AG2 A;  2VH3 A;  4CIH A;  1JPJ A;  5IT9 N;  2AGA A;  4MQ9 F;  4NB5 A;  4YY3 B;  4MW8 A;  4H0L B;  4IAO A;  2YLI A;  1E1Q G;  3E89 A;  2OOC A;  4HFF B;  4YIP A;  2OKU A;  3TJT A;  4W8P A;  2JRI A;  3V5Y A;  2HHH B;  1YA9 A;  4MVO A;  2WLN A;  3U9M A;  2QA4 V;  1N8R W;  4I3M A;  1ZL8 B;  2LFS A;  1QZX A;  1Z5V A;  4G7O F;  1ENV A;  3OMI B;  2WVQ A;  1JOG A;  3BHP A;  1VYI A;  3RYH A;  1XNQ O;  1WN7 A;  1YJ9 V;  2UUC O;  2W0F C;  2PF4 E;  4YL3 A;  1H6G A;  1TWC A;  4NTY A;  1XOU A;  1NKD A;  4NY3 A;  3A2F A;  3VM6 A;  4LF9 B;  4CS9 A;  3CXC U;  3GWK C;  2ATK C;  2A0U A;  2AU5 A;  3THO A;  2R03 A;  1XQ8 A;  1E1R G;  5BZB A;  4G27 B;  3QO5 A;  2I15 A;  1KKC A;  2KSD A;  3FFQ A;  1Q0G A;  3ZHS A;  2XL8 A;  2YLD A;  5KUM A;  4G78 A;  2R72 A;  2NSG A;  2L9J A;  5CB4 B;  1B04 A;  4H37 A;  1NQT A;  1YVI A;  1YEW A;  4CS7 A;  2ZCE A;  4HYO A;  3T1C A;  3WB1 A;  4P30 A;  1TWH A;  1G1X B;  2DWE C;  5CA1 B;  1P84 F;  3SYA A;  4X65 O;  1MSW D;  3EGX A;  1Q0F A;  1IZM A;  3LNM B;  2IBF A;  1E83 A;  1EN6 A;  3DSQ A;  2YWA A;  3DC5 A;  1SF8 A;  1Q8I A;  3QF7 A;  2HV7 A;  4CDY A;  1QKR A;  1NS1 A;  4JC7 A;  1KD1 W;  3APQ A;  4DVZ A;  2R7U A;  2CH7 B;  3AG1 B;  2VQE B;  3AG3 C;  1ZYR F;  3N24 A;  5CI9 A;  2X6A A;  1FXH A;  1WOL A;  1YAU O;  5HSW A;  4RWU A;  1PD0 A;  4YJ3 A;  3NMI A;  1KEC A;  5COF A;  4JI7 O;  5IE9 A;  1XL4 A;  1OZ0 A;  3J81 N;  5JS5 A;  4G7H F;  1FXK C;  1R6T A;  1XMO O;  1K40 A;  2ZKO A;  1FAP B;  2XTA A;  1RP3 B;  2F93 B;  2MK3 A;  3CMA V;  1RM1 C;  4LF7 B;  1LE4 A;  4AIL C;  3MDS A;  3C7J A;  5HV9 A;  4DXW A;  4P6I C;  2JGU A;  1JQ0 A;  3RYC B;  2NG1 A;  2Q9C A;  2Y4T A;  5IWA O;  2BE3 A;  1VQ9 V;  4J80 A;  4DOZ A;  4X1I A;  3IQ5 A;  2W0X A;  1IX9 A;  4QPJ A;  1TFK B;  3E9V A;  2Q67 A;  1M4U A;  4DV0 O;  3A0B Z;  3UGP A;  4LCU C;  4FZ1 A;  5H5N A;  4ULW A;  2R7W A;  3I5P A;  2GAQ A;  5LYJ A;  2QNL A;  2JDI G;  3G4Z A;  1BT8 A;  2HSB A;  3HNI A;  3LUT B;  5COM A;  1RKC A;  1HNX O;  4IGG A;  1HNZ B;  2IH3 C;  3K03 A;  4X66 O;  3RQF A;  1RXQ A;  5EBW C;  5L3B A;  1SRY A;  1U96 A;  2QKA A;  4AL0 A;  4IIJ A;  1AI7 A;  2Y48 A;  3TK1 A;  2IJJ A;  3W2V A;  3AG2 C;  3Q6M A;  3IC7 A;  4BW5 A;  4JI2 B;  4LF9 O;  4DV1 B;  1PV0 A;  5KHI A;  5EC1 C;  3JAS B;  2ZD9 A;  2Y69 B;  1VQL V;  3K7D A;  3SZR A;  1YLM A;  2PY5 A;  3SXY A;  3JCZ A;  3VOU A;  2ZXW C;  3D36 A;  4UVB A;  5EBM C;  1OXB A;  4UDV A;  1BQZ A;  1WWP A;  2FAP B;  3G4X A;  1BZK A;  1BGY H;  1K4D C;  5EIB C;  3KZI Z;  5KA6 A;  4JTC B;  3OD4 A;  1Q6I A;  2EIL B;  3LSU A;  2Y0P A;  2DE0 X;  4CS4 A;  3CRC A;  3D3Q A;  3IC9 A;  4I4T A;  3JT1 A;  2XXA A;  3LLI A;  3G50 A;  1U97 A;  1LNQ A;  3ZMZ A;  4FES A;  2P7V A;  2ASR A;  5EZY B;  2ZIN A;  4KL1 A;  2L6G A;  2LQG A;  1NBB A;  4LF5 B;  3ZS8 C;  4GYT A;  2QTV A;  3CYO A;  4ONS A;  4DV4 B;  1I7F A;  3HKE B;  3ASN B;  3W7X A;  5H9C A;  3AJM A;  3ETD A;  2VQE O;  2EPL X;  2WLI B;  2VWK A;  4EWC A;  1GM8 A;  1GMG A;  3FOO A;  3FAV A;  2YID A;  4YIO A;  2LGQ A;  3DAF A;  3A0H Z;  2EZP A;  2NPU A;  2W6I G;  5B1A B;  2F4V O;  2NSF A;  4CSA A;  3CB2 A;  4X20 A;  3HKC A;  4O2B B;  1R3K C;  1C02 A;  2JPU A;  2F22 A;  2YL0 A;  3WG7 C;  3VF0 A;  3BCC H;  2R9A A;  1M56 C;  3ZHU A;  5A9G A;  4LF7 O;  2OTJ V;  2AXT Z;  3L1M A;  2A9H A;  2WSS G;  2XL6 A;  3HKB A;  4DR4 B;  3QNE A;  3SXK A;  2XAF A;  1LUW A;  2YXL A;  3ABT A;  3N27 A;  1EBO A;  3JD0 A;  3GEE A;  3B2E E;  3FD9 A;  3FXH A;  3Q7L A;  2XLD A;  2KQ9 A;  1V9P A;  1YJW V;  4LFB B;  1AI4 A;  3DJN B;  3EHN A;  3H9V A;  1T6Q A;  4O4J B;  4K3A A;  4LNU B;  2HUJ A;  1AR5 A;  3C8G A;  3TCU A;  1Z7Q c;  1Q0K A;  4O4I B;  2FL4 A;  3C8Z A;  4I1M A;  1F51 A;  5JVD A;  2JJ2 G;  5B1B B;  1EZJ A;  2CE4 A;  1BQ0 A;  4TUY A;  2AWY A;  3K04 A;  4NVP A;  3GWO A;  4FM0 A;  2Y3B A;  2Q9L A;  5LP6 A;  4PJL A;  3ZX6 A;  2QR4 A;  5JWP A;  3JAL A;  2JX0 A;  5L3C A;  3OTF A;  2DW4 A;  4O2A A;  4ZOL B;  4DR5 O;  5EBL C;  1OR3 A;  4ZLC A;  4LFC B;  2B0H A;  2NLJ C;  3PN1 A;  2X7R B;  4JYC A;  4ZKI A;  2HR3 A;  1WP7 A;  1RJ9 A;  2Z5U A;  4JI2 O;  5BUO A;  3DM5 A;  4KHP O;  1Y76 B;  4DV1 O;  3KG2 A;  2KC3 A;  1CGN A;  1FS0 G;  3MD0 A;  4X0R A;  2P4V A;  1VIB A;  1AEP A;  3EJN A;  2UUH A;  3HB3 B;  3SYP A;  3IEE A;  3UCS C;  3ABK B;  2XAS A;  3U8V A;  3LLK A;  1M6T A;  3RVZ A;  1VK5 A;  1GN6 A;  3M1C B;  3N2K B;  3N2G A;  4LH7 A;  2UXX A;  2W4M A;  4BEJ A;  5FNV A;  2EUL A;  5JJE B;  5KX5 B;  2K9P A;  4DV3 B;  3LSS A;  3SPJ A;  1DF4 A;  4X62 O;  1CGM E;  2QM7 A;  2IXM A;  2NR5 A;  3RQG A;  2W4B A;  5IYZ A;  3GM1 A;  4DBQ A;  1KP3 A;  3BEH A;  3BY6 A;  4PJJ A;  2UXD B;  2KK1 A;  1OQC A;  3ZDL A;  1JPN A;  5IJ9 A;  4DV4 O;  3AQC A;  4YJW A;  3UMK A;  1I5Y A;  1PNM A;  4Q7C A;  1MMM A;  4QJF B;  5JRA A;  4C7O B;  3E8F A;  3G71 V;  1Y6X A;  2Q7H A;  1WLE A;  1D1A A;  2GUZ B;  2P6J A;  3JAW B;  4G2K A;  3STL C;  1EKY A;  1SQX H;  1QLN A;  1TAE A;  4BIO A;  1OCZ B;  3ZRV A;  1LE2 A;  5DQT A;  3E8G A;  5EC2 C;  3T6G B;  2EPK X;  2H8P C;  2VCB A;  1CPR A;  3E35 A;  3DGE A;  3U3B A;  4QNH B;  5JVE A;  1DOV A;  1SQB H;  3CCS V;  5JH7 B;  1YYX A;  1BSM A;  1K05 A;  4DR4 O;  2J7P D;  2WZG A;  2XRH A;  4JJF A;  2DYS B;  1L8D A;  3EPV A;  3OT7 A;  2EIM C;  4CS2 A;  4J32 B;  4BIZ A;  1FKA O;  4LFB O;  5A69 A;  2NUT A;  5DM6 V;  3EGD A;  3QTC A;  5EHH A;  3P3N A;  4AI8 A;  3NKD A;  2J0W A;  2G3V A;  4BAY A;  1DLB A;  3QTH A;  4BJ5 A;  4DVY P;  1YJN V;  3MX3 A;  3W8H A;  2V4D A;  3JSN A;  1OKK D;  5DEC A;  4B3R O;  2QKC A;  4BEM J;  3NMJ A;  2YVK A;  3O10 A;  5DQZ A;  4LFC O;  2H7V C;  1FR0 A;  3S0X A;  1X59 A;  4Z2W A;  5IJ0 A;  4IHJ A;  4R7C A;  1U0B B;  3O65 A;  3AGU A;  5A2Q N;  3OTO O;  5CIV A;  4JI6 B;  2BSK B;  1VQO V;  3GB7 C;  3GAN A;  4NR1 A;  1IBL B;  4O4H A;  3AGT A;  3VRC A;  3H1J H;  3L8I A;  1APC A;  3AK3 A;  4LFA O;  2IM8 A;  4PD4 F;  3CC7 V;  2LFR A;  2R7O A;  4RAI A;  4PDL A;  3RW0 A;  3ZHV A;  3S84 A;  4FFB B;  5F5H A;  1JA8 A;  3MBG A;  1CPQ A;  1XDC A;  1S0V A;  3B0V C;  1KMI Z;  3OGC C;  3ZCC A;  3IPM O;  4UV9 A;  3EG9 B;  3QW0 A;  1K73 W;  4K1O A;  1FMV A;  3JAT A;  4UCS A;  3ICX A;  2LO1 A;  3G80 A;  5EIB D;  4P9T A;  5CBH A;  2OTL V;  5L0J A;  4BJ5 C;  4JYA B;  2Q73 A;  4F4L A;  2IBZ H;  1Z2G A;  1SF9 A;  3UO3 A;  3RFY A;  4DV6 B;  4BJ6 C;  3QW1 A;  5KLV H;  4B6I A;  3KKB A;  1EN4 A;  4EFE A;  3JAR A;  2G38 A;  1K34 A;  1C03 A;  2DQ0 A;  3L8J A;  3JYY A;  4I9Q A;  5F5F A;  5CA0 A;  1AIL A;  3I5D A;  2EPM X;  1XNR B;  4K0K B;  5B3S C;  2ICW G;  2C04 A;  1D1B A;  2FGY A;  3X2Q C;  5D5Q A;  2VS0 A;  4U7N A;  3K59 A;  2QWP B;  5LA6 A;  2ETN A;  2IYL D;  2R7R A;  1NFO A;  1M57 B;  1M1K W;  2ZPA A;  2XLE A;  3JYH A;  1FXV A;  4DRI B;  1Q6H A;  3H2U A;  4JI8 O;  1SA0 B;  4TOI A;  2YIB D;  5E3A A;  5CN0 A;  2DGJ A;  4WGY A;  2E5L B;  1PD1 A;  1VF6 C;  4B3S O;  4J41 A;  5JCO A;  1Q0M A;  3DMD A;  1ORQ C;  3B71 A;  3EFO B;  2HFI A;  5IY5 B;  2J45 A;  3JRT A;  1QPU A;  4MT8 A;  1IUR A;  4TV9 A;  3AG4 C;  2ADQ B;  2IJK A;  1GRJ A;  3UGO A;  3S27 A;  1TVK B;  1B6Q A;  1UPG A;  2QSA A;  2L7A A;  2WB7 A;  4GKK B;  3QZC A;  3BPZ A;  3ZTM A;  5GON B;  1D0Y A;  2V26 A;  1QVX A;  4FWV A;  5AGF A;  1EFR G;  4QI0 A;  4YT4 A;  3CCU V;  2OWO A;  4EHP A;  2Y3H A;  4J7Z A;  4JI0 B;  3W8I A;  1QVG U;  3E8H A;  1YYJ A;  4TQD A;  2PX3 A;  3V5Z A;  1G5Z A;  2XAQ A;  3ZRW B;  3BAB A;  4G28 B;  1YHQ V;  2CK3 G;  3LAY A;  3HTK C;  4J9Y B;  1P4R A;  1YI2 V;  5LXT B;  1Q43 A;  4QIW F;  2C03 A;  2NUP A;  2LGW A;  1N33 B;  5KYN A;  3CCV V;  4E0I A;  3H01 A;  2JS5 A;  3L72 H;  1GN3 A;  3K9A A;  1C17 M;  4OGQ B;  4X9Q A;  3S9O A;  4FZ0 A;  1J95 A;  4IB4 A;  2BOC C;  4LDK A;  3WB0 A;  4I0X B;  4XPX A;  2R9I A;  1H8E G;  1JX9 A;  2ZNJ A;  1LS4 A;  1RKE A;  2UXC B;  3SJQ C;  1Y74 B;  4JZG A;  4BWA A;  3JCU Z;  1KQS U;  4I55 B;  4Z9I A;  2RCV A;  3CCR V;  4N23 A;  2KQX A;  1OCR B;  2CYD A;  2F95 B;  3F46 A;  2NNU A;  1BMF G;  5BXZ A;  3M15 A;  1YZB A;  3ML0 A;  4X64 O;  4DW0 A;  1N36 O;  2XUM A;  4DV6 O;  1XL6 A;  4CZZ A;  2XLW A;  4CJO A;  2A6H F;  4Q20 A;  1XZP A;  1VEW A;  2HV6 A;  2ZE7 A;  3ZIA G;  5KHJ A;  3GM2 A;  2D4U A;  2YXY A;  1EI7 A;  1BZ4 A;  2F66 C;  4TQF A;  1XNR O;  1H7I A;  4J42 A;  1B68 A;  2H7O A;  5KYW A;  1I4Y A;  3EVK A;  1HDJ A;  3GOD A;  3RYF A;  3KH2 A;  4IWB A;  4Q5S F;  1E84 A;  5C8Y A;  3RYH B;  5T3T A;  4R32 A;  2VC9 A;  4FLW A;  3E8B A;  3SJC C;  1HR0 O;  5BMV A;  1CEZ A;  4K7B A;  1R3L C;  4FK5 C;  2IXP A;  3ZVR A;  1YAR O;  1BHB A;  2HS5 A;  3OR6 C;  2WZF A;  2E5L O;  2VCA A;  2LFD A;  3CS5 A;  1I5N A;  4CX9 A;  1RSO A;  1HMO A;  2EIN C;  1KBH A;  1K97 A;  4OX9 B;  2WWW A;  1GAX A;  4PFO A;  2ZR2 A;  5B1N A;  4DR1 B;  2A0B A;  1H2S B;  2GFH A;  4LF6 B;  1VQN V;  2GTA A;  5A6B D;  3R65 A;  4JI5 O;  3SYN A;  1LPE A;  4WCE V;  4NKG B;  4XEF A;  3CEX A;  3U3F A;  3EGX B;  3OM3 B;  4A5U B;  2HLD G;  2HKV A;  4JPR A;  2EJ7 A;  1VTM P;  4XDL A;  1GO3 F;  4PAC A;  3OEO A;  1K3E A;  2MHR A;  3F5W C;  4U9D A;  4PI0 A;  4H33 A;  2WLM A;  3C3T A;  4I50 A;  4P9P A;  3SR2 C;  3IAY A;  2EIJ C;  1PV3 A;  3X1O A;  1LM3 B;  1KB9 F;  4ZI7 A;  4UFZ A;  3DE9 A;  1K33 A;  1NT2 B;  3HKD B;  2HJF C;  1H2M A;  1L1F A;  4FLV A;  4JI4 B;  2CDQ A;  2HJ3 A;  2R7S A;  1R4T A;  2ITC C;  1GKF A;  1D2D A;  4EB6 A;  1K04 A;  2WLH A;  4YJ3 B;  2OEX A;  1XRE A;  3EH1 A;  1J8M F;  4HBN A;  4OIP F;  3DC6 A;  3K66 A;  2A0L A;  3MYF A;  3IFX A;  1Q3E A;  3SP1 A;  3OEH G;  3OWT A;  4CBC A;  2J8W A;  3T4D A;  3JD1 A;  1JOY A;  4ICG A;  4TSF G;  1HNW B;  1BE3 H;  2QUP A;  4XTK A;  3ZHR A;  4FLU A;  2YIA A;  1FXK A;  4X1I B;  3VQX A;  3WFV A;  2AVK A;  3KPH A;  4OIN F;  4R50 A;  2H7B A;  3K33 A;  1WN0 A;  3E2E A;  2KKW A;  1OJH A;  1J5E B;  4UXN A;  1Z5W A;  3W7W A;  4XDJ A;  4J7Y A;  4I9W A;  1GN2 A;  2O57 A;  2YDE A;  1GM5 A;  2E74 B;  1T5O A;  4E7S A;  2JD3 A;  5LYJ B;  3J80 N;  2Q4P A;  3ABM C;  4MVM A;  3GEI A;  1S5H C;  3W7U A;  1EZV H;  1MOF A;  4LF8 B;  5KYU A;  3L0I A;  2WLL A;  2Y39 A;  4EIY A;  3AEI A;  2JEU A;  2CW0 F;  3H1I H;  1WB7 A;  1B06 A;  4JI1 B;  2PP4 A;  3SEO A;  3J7A U;  3B40 A;  4IIJ B;  4GKJ B;  5LOV A;  4FX5 A;  2JJ1 G;  2QE7 G;  1H2N A;  5FCL A;  3B8M A;  2EX3 A;  2ZIO A;  4NXM B;  4XLP F;  3LJB A;  2X6C A;  4JUR I;  2P90 A;  2XLV A;  4F6R A;  2C2A A;  4XEK A;  4DR6 O;  4DO2 A;  2BTQ A;  2HKO A;  2ZE8 A;  2VCC A;  4DRH B;  4WJ0 A;  1NZ6 A;  2B1G A;  4JGS A;  1MMG A;  3SXM A;  1NU7 D;  2ZXP A;  4UB6 Z;  4ANJ A;  1YDI A;  3VBB A;  4AE4 A;  4DR1 O;  3SPH A;  4WFA V;  4DV2 B;  2CUG A;  3Q7G A;  1A32 A;  1V54 B;  4LF6 O;  2Z0A A;  1VQ8 V;  4W4K A;  4I4T B;  2XXA B;  3QVN A;  3ASO B;  2AWC A;  5EGY A;  5LGU A;  5BQH A;  1GH6 A;  4ULV A;  3W4Y A;  2DN9 A;  1XMQ O;  4RUE A;  1OR2 A;  4DV5 O;  4L6R A;  1F23 A;  4YT8 A;  3QG5 A;  3VQV A;  2Q9B A;  4WFG A;  2V1D A;  1V55 B;  2P6V A;  4YY3 O;  3CAX A;  3L34 A;  3ZQY A;  2K1E A;  1E86 A;  2IH1 C;  4DR2 B;  1M5I A;  5EK0 A;  3FAP B;  4A4A A;  2HHH O;  3QO7 A;  4JV5 B;  1N1C A;  3O6X A;  3U5S A;  1AJN A;  3BRC A;  2LSE A;  2D5R B;  2PNO A;  4X1K A;  2YLG A;  1Z63 A;  1YZA A;  1F4N A;  4X20 B;  3HKC B;  4MVS A;  4O4L B;  4MVQ A;  3NDB B;  3LSQ A;  2EIK B;  1FTS A;  2QGN A;  1Q90 D;  3SPG A;  1ZU5 A;  2YIB A;  2OJQ A;  1RPR A;  2AZ2 A;  3HKB B;  1PL4 A;  3WB2 A;  4FLY A;  2EPN A;  5DS5 A;  3C3S A;  5EYP A;  3KKY A;  1SKV A;  2Z15 A;  2D2C B;  2UXB B;  3RGB A;  1TKN A;  5IYC O;  4NTX A;  1HY5 A;  3K5M A;  2OCC B;  2YSU B;  3MLG A;  5LMU B;  4MW3 A;  3C8G B;  4GUN A;  4RQF A;  1BDJ B;  1MNG A;  1ZZP A;  1Q86 W;  4FJC C;  2BC5 A;  3FMS A;  3HNK A;  5JVD B;  3OMN B;  1OCC B;  3BAA A;  4CH3 A;  2WA4 A;  1N0N A;  1B3Q A;  4TUY B;  3M4C A;  2CDY A;  3LDD A;  2LP7 A;  5LP6 B;  4DBR A;  3ZMV A;  3JAL B;  1A7E A;  1G8X A;  4NC3 A;  4GKJ O;  2LW1 A;  3ZMS A;  2LP4 A;  4O2A B;  4FIP C;  4DUY B;  3MHH C;  1LVK A;  1WGW A;  5JT4 A;  4N21 A;  5B3I A;  5A6K A;  1RJ9 B;  1K5Q A;  4PDV A;  2PI4 A;  3FB6 C;  1VB5 A;  1DOW A;  1KP2 A;  1O9G A;  4B7K A;  3NKE A;  4NYK A;  3D3I A;  4ASU G;  3GEH A;  1KNY A;  4LWS A;  1O87 A;  1S3J A;  4DR3 B;  3RWR D;  3WHN A;  1Y4M A;  3N2G B;  1R73 A;  4FMT A;  1PCX A;  2XLM A;  5FNV B;  1QU7 A;  4JVS A;  4NTB A;  2XAG A;  2B1I A;  4CBE A;  5CMU A;  1N34 B;  3K5O A;  1HW7 A;  3SDL A;  5KAI Z;  2JVD A;  4RBN A;  3DXJ F;  2PFD A;  4CC6 A;  3AG1 C;  3DKA A;  2D3O W;  5IYZ B;  1COW G;  3OGI B;  3OR7 C;  3K1H A;  4JKV A;  4HFK B;  5BQG A;  4CS8 C;  4GX5 A;  2ETS A;  4K0D A;  2HSQ A;  5FPO A;  3CJH A;  4YXW G;  4I1O B;  5A6A A;  2CNW D;  5L0C A;  4GT1 A;  5IJ9 B;  3CZ6 A;  2Y0I A;  1TFO B;  1W0K G;  1VYK A;  1DGS A;  5LHG A;  3N0T A;  4DR2 O;  2YKZ A;  4JI3 B;  3TGU H;  1HNZ O;  2RNB A;  3FB8 C;  4PJN A;  3ABL B;  4XEV A;  2ARH A;  1ORS C;  3DE8 A;  1I5X A;  2L35 A;  4E4E A;  4Q6G A;  1W2W A;  3T2M A;  5AC4 A;  5F2V O;  3TJ5 A;  5L3D A;  2R7V A;  3M99 B;  3IGA C;  3RFR A;  4TV8 A;  2XT9 A;  2Q9A A;  4LLE A;  2PI5 A;  1YCI A;  4LDQ A;  3BRJ A;  4UCR A;  3NR7 A;  2AHZ A;  2Q7R A;  1QR8 A;  4J7J A;  2I8B A;  3T4Z A;  2BCC H;  1YA7 O;  2J9U A;  4CH5 A;  4DW1 A;  4RQE A;  1G4U S;  5JQG A;  5KUK A;  2W6J G;  1PPJ H;  2NUT B;  5LMU O;  3EGD B;  5CBF A;  2BOB C;  5A6B A;  2WVO A;  4PI2 A;  2JEX A;  5B66 Z;  5A6J A;  4D4X A;  3JSZ A;  2AP3 A;  3V5X A;  1GTO A;  5LL6 Y;  4HAM A;  2R7X A;  3UT5 A;  4TT3 G;  1VQP V;  2ZM6 B;  4JW1 A;  4EEQ A;  2Y69 C;  3M79 A;  1QCE A;  3RF3 A;  4B3T B;  2PBE A;  1NJI W;  1UFB A;  3CC4 V;  1K8A W;  1IVS A;  3JD2 A;  2KG7 A;  1IW7 F;  2ZT9 B;  1FPO A;  3WU2 Z;  4LF5 O;  4JAV A;  5J2U B;  5IJ0 B;  2HJD A;  4IHJ B;  1FFX A;  3ZN1 A;  2BL2 A;  2VQF B;  1IBK B;  5JJN B;  4XDK A;  1LKX A;  1JMW A;  1RFY A;  4PV1 B;  1AP6 A;  2EIL C;  1WAZ A;  1Y4C A;  4O4H B;  1R5I D;  3B09 A;  2YL7 A;  2CTQ A;  4JTD B;  1JJ2 U;  2E75 B;  1T5E A;  3CHX A;  4NXN B;  2GDC A;  2Q8V A;  3H2V A;  3SYQ A;  3ETE A;  3K0D A;  5K1P A;  3C18 A;  4MND A;  3JAK A;  4U5H A;  3RVY A;  4YJ2 A;  3RT3 C;  2J9W A;  3T6B A;  2A3Q A;  1FFT B;  3R7C A;  3Q4H B;  2XLH A;  3ASN C;  1Q0D A;  2QM8 A;  3JAT B;  2RMK B;  5DS6 A;  3T1Y B;  3KYJ A;  1ZAU A;  4NQF A;  1PNK A;  4H54 A;  2YXH A;  4ZOL A;  5C93 A;  2IXO A;  4DJ9 A;  5JSL A;  4AQY B;  3HLZ A;  3S3X A;  3LNN A;  1R1B A;  1I08 A;  5B1A C;  1MG1 A;  3UM7 A;  2PYJ A;  1MNE A;  5L0F A;  4CDV A;  1BS3 A;  4YL0 A;  1IZ3 A;  1WJZ A;  5CA0 B;  1ORJ A;  1A7V A;  4X1Y A;  3R2P A;  2F23 A;  4G0H A;  5BR8 B;  2M6Y A;  1OHH G;  4W4L A;  4BJ6 A;  5JLI A;  4KP4 A;  1S76 D;  1Z5Z A;  3LNR A;  1XHZ A;  1MMN A;  5LA6 B;  3M8A A;  1URF A;  4U3J A;  5KYY A;  2DYR B;  1TUB A;  2P4K A;  1NG1 A;  3FYE B;  5B1O A;  4N06 A;  4GLX A;  3KCX A;  1TWG A;  4OD4 A;  4YT2 A;  4JAA A;  4J10 A;  4KXR A;  5F28 E;  2GV9 A;  3DZA A;  2Q69 A;  5B1B C;  2XM4 A;  4IAQ A;  2X0C A;  1TQG A;  2WL8 A;  4WF9 V;  3LEO A;  3ITF A;  1H2K A;  3SXZ A;  4AL1 A;  1HMD A;  4A2N B;  5DN6 G;  2R25 A;  3KCY A;  4TV9 B;  4LBE C;  4DV7 B;  1MSD A;  1VF6 A;  2YEV A;  4DV3 O;  3NYM A;  1GS9 A;  2M64 A;  2OIE A;  1O3U A;  4EBB A;  3EHB B;  2RSE B;  4H44 B;  4YHH B;  2A69 F;  3R66 A;  2UXD O;  3FX7 A;  2Y4U A;  3K1I C;  2KJG A;  1LR1 A;  5GPG B;  2XOK G;  4U5E E;  4IYI A;  3ABK C;  1VP7 A;  3K3W A;  4MTO A;  1NVP B;  4U5F E;  5ITZ A;  1XBL A;  4E18 A;  1M93 A;  3H65 A;  2X0L A;  4BJ1 A;  2HFE C;  4OPH A;  2A68 F;  1FYJ A;  2XL4 A;  5KHG A;  4KUM A;  1YIT V;  5CA3 A;  1MZE A;  1OCO B;  3CEI A;  1QBZ A;  2YUA A;  3H1H H;  3PMR A;  3IJ4 A;  4IRU A;  1JMK C;  1G4Y B;  2DQ3 A;  4ZIB A;  1TWA A;  5CBG A;  4UVC A;  2VB6 A;  2JIZ G;  4YN0 B;  3JCU Q;  3K79 A;  2Y3G A;  2CTW A;  3RKO F;  1H8H G;  4O7G A;  3TUL A;  2X6B A;  1QLE B;  3CSX A;  5E3C A;  1ZU4 A;  5L3Q A;  1XWJ A;  2YRF A;  3VQW A;  2EJR A;  4AQY O;  3MHS C;  1OCZ C;  4FFK A;  1SZX A;  5IYD O;  1N32 B;  1WAT A;  3IQC A;  3JZ0 A;  3DXR A;  5CI8 A;  2P61 A;  2BSK A;  2GDS A;  2EZO A;  3RN4 A;  2CGE A;  3KYI A;  5KYX A;  4QE9 A;  1FAF A;  5L0G A;  1H2L A;  3F7V C;  1A7D A;  3PDM P;  4U5B E;  1SQQ H;  3ZRS A;  5KYW B;  1F1M A;  3B77 A;  1Y67 A;  5BQI A;  1JRA A;  2DYS C;  3RYF B;  2IU0 A;  2LIG A;  5C8Y B;  2QY9 A;  3HKK A;  3SNH A;  1BCC H;  2ZIM A;  4QE7 A;  4QPK A;  3CPW U;  3RIP A;  1F4M A;  1CP9 A;  4JYB A;  1ARO P;  1FNT c;  1ZVZ A;  5BMV B;  5KA5 A;  4BW9 A;  4JI6 O;  3C90 A;  4B3M B;  3JYC A;  3ZN0 A;  1NI8 A;  2ODM A;  3STZ C;  2YL3 A;  4UVA A;  1MMA A;  3CCQ V;  2ZE5 A;  3ECS A;  3B8N A;  1IBL O;  4OIR F;  3SPI A;  3U8P A;  4BPM A;  3ZJZ A;  1RSO B;  3T9O A;  2W45 A;  4LAC B;  3L70 H;  1SMY F;  4DRX A;  2MW2 B;  2H3O A;  2ZDI C;  4KBL A;  4E7Z A;  3MAQ A;  2CCY A;  4U9E A;  4PK4 A;  2J9B A;  3NXS A;  3U11 A;  2ZQM A;  1HW1 A;  1THZ A;  3OE7 G;  4OD5 A;  3GOR A;  1X4T A;  3G6E V;  3K5N A;  4JYA O;  3RYI A;  1XNQ B;  3E22 A;  3EHM A;  1ZTE A;  1AR4 A;  2YZS A;  3BA9 A;  2UUC B;  5J2T A;  3QO8 A;  2ADP A;  2VWJ A;  3LDC A;  4I50 B;  1Y6D A;  4GZR B;  2UXN A;  2E76 B;  4ZI7 B;  2Z3Y A;  4K0K O;  2IJH A;  2ZNI A;  2ZXR A;  1R6K A;  4EB6 B;  4GYC B;  2XND G;  1CGO A;  2X51 A;  3HNL A;  3F7Y C;  1G4W R;  3JSE O;  4P9O A;  2EPO A;  3B0U X;  2XS8 A;  1BR1 A;  4Z9H A;  3TJ6 A;  3A8T A;  1M2V A;  3RQE A;  4UB8 Z;  3SJA C;  3C8G D;  2RN9 A;  1TVK A;  4FVM A;  3ATP A;  5HFM A;  3LS0 A;  1ZHW A;  4F6E A;  5GON A;  4X65 B;  1D5N A;  1FXK B;  3M4B A;  1RM1 B;  2LD6 A;  3IQT A;  1WA8 A;  4HNA A;  3CME V;  3T6J A;  4LLC A;  2YIC A;  1DTO A;  4EBJ A;  2XSE A;  3MYI A;  2YHS A;  1S5L Z;  4FM1 A;  4MTX A;  2QEX V;  1M57 C;  5KYU B;  2HEP A;  4D7S A;  2XAJ A;  4GKK O;  3LEV A;  1D5A A;  4C7U A;  1AB3 A;  1SQP H;  3P32 A;  3AK2 A;  4R8C A;  4DR7 B;  2ZE6 A;  1QVF U;  4LER A;  1VQ4 V;  2WPD G;  1S77 D;  1E2X A;  5LOV B;  4JI0 O;  4ER9 A;  1XMO B;  1S05 A;  4K35 A;  1JFF A;  2FKX A;  2N74 A;  3TD7 A;  2KNH A;  2YC0 A;  1P49 A;  2GSM B;  4J11 A;  2L6L A;  4MVU A;  3K0G A;  5IY5 C;  3GWN A;  1H2G A;  4B08 A;  1Q81 W;  4FLT A;  4F6R B;  4JCH A;  3AK1 A;  1N33 O;  2JGD A;  2BTQ B;  4P9F A;  1AI5 A;  3AG2 B;  3ZQV A;  1JJO A;  4DV0 B;  1ZX3 A;  5FLX N;  3ZWI A;  2PX0 A;  4W8K A;  3OMA B;  1W0J G;  2GBO A;  2L81 A;  2AHY A;  3OW2 U;  2XS1 A;  4AE4 B;  2ZXW B;  1J8Y F;  2J7P A;  1TR2 A;  2UXC O;  1HNX B;  4YL1 A;  4X66 B;  2R7T A;  4D6T H;  3L74 H;  3HJC A;  4CDA A;  2WLK A;  4WBN A;  3WAQ A;  1FD9 A;  4WFE A;  4GEH A;  3L71 H;  1EA8 A;  5KMG A;  2R02 A;  4WFH A;  1E79 G;  2OCH A;  4YK5 A;  2IJI A;  2V3C C;  1YXB A;  4AX2 A;  1OW6 A;  3APO A;  3NG1 A;  1US6 A;  1VF5 B;  1OKK A;  1ZUQ A;  2IM9 A;  2YI8 A;  1IBM B;  3CCE V;  4WFB V;  3PCV A;  4UCT A;  2KYH A;  3A11 A;  1SQV H;  5IDJ A;  1MQV A;  2QWQ B;  4CH4 A;  1WB8 A;  4X1K B;  4ZHQ A;  1ORY A;  3SYC A;  1OCR C;  4K8Z A;  3K06 A;  2E3C A;  4JJG A;  2HZ8 A;  2XAH A;  4JZA A;  1QQ3 A;  3S90 A;  1SC5 B;  3ZED A;  3PJS K;  4L8J A;  1JR8 A;  1IXM A;  4YWQ A;  5EYP B;  4CC5 A;  4XPY A;  1JR9 A;  2M7W A;  3FB5 C;  5H6Q A;  3SYO A;  3WG7 B;  1I0H A;  1M56 B;  2UU9 B;  3O55 A;  4OX9 O;  5L3V A;  3CC2 V;  2F43 G;  1S72 V;  3VQY A;  5J9P C;  5LHI A;  5E33 A;  2LFF A;  1Z3I X;  4UCV A;  5L0I A;  2FTK A;  2IU3 A;  3HPL C;  1Z23 A;  4JRZ A;  2FB5 A;  1H9G A;  1HWY A;  4TWK A;  3HKD A;  3O9O A;  2J0X A;  4CS9 C;  1ZL8 A;  2Q4F A;  2G3K A;  3EQL F;  1YZC A;  3C62 A;  1QHT A;  4QGP A;  4DR7 O;  2F4V B;  4UUJ C;  2YS8 A;  1AR1 B;  5DED A;  2Q0O C;  3L75 H;  3SGI A;  3ZBH A;  1RPO A;  2WA3 A;  4OPA A;  4E0H A;  3FDQ A;  2QM4 A;  2XHB A;  1L3P A;  2Q7E A;  3NRH A;  1BR4 A;  4CJG A;  3CXH F;  3W7S A;  1CPY A;  3CWB H;  1KTM A;  1EM1 A;  2W9Y A;  3UQ8 A;  4LH6 A;  5L0D A;  1I94 B;  1PKX A;  1VQ6 V;  4JI4 O;  3UMI A;  3W2W A;  3FAV B;  3JD4 A; 
#chains in the Genus database with same CATH homology
 1NR1 A;  5KUK A;  2DQ0 A;  2W6J G;  3E86 A;  4HZ3 A;  1SES A;  5FL7 G;  3ZMU A;  5CBF A;  2BOB C;  3ABU A;  3ETG A;  5B3S C;  3DTU B;  2JEX A;  3X2Q C;  4U7N A;  1GTO A;  4HAM A;  2WLJ A;  1QLE C;  2A79 B;  4TT3 G;  1VQP V;  1YTF B;  2Y69 C;  1QCE A;  1GK9 A;  4I5S A;  1NJI W;  1KC8 W;  3CC4 V;  1K8A W;  1M57 B;  1M1K W;  4PA9 A;  3JD2 A;  4MTF A;  1Q82 W;  1NBM G;  1FXV A;  4KFM A;  4JAV A;  3I56 V;  4JF3 A;  3ZN1 A;  1QR9 A;  5CN0 A;  4XDK A;  2HVJ C;  4X88 A;  2QTO A;  4MW8 A;  1ORQ C;  2EIL C;  1NH2 B;  1E1Q G;  3E89 A;  5IY5 B;  4X89 A;  4MT8 A;  4JTD B;  1JJ2 U;  1GM9 A;  5GW7 A;  3AG4 C;  4MVO A;  2GHY A;  2IJK A;  2WLN A;  3OUF A;  3SYQ A;  2QA4 V;  1N8R W;  3ETE A;  2LFS A;  3K0D A;  1G8M A;  4MS2 A;  1B6Q A;  2KB1 A;  1ENV A;  3RVY A;  3OMI B;  2WAM A;  1FFT B;  3P30 A;  1EFR G;  1YIJ V;  3CCU V;  1YJ9 V;  3ASN C;  2W0F C;  2QM8 A;  1NKD A;  3G4S V;  1QVG U;  4PA7 A;  3E8H A;  3CXC U;  1PNK A;  3I55 V;  5LGN A;  2ATK C;  2XAQ A;  3ZRW B;  5C93 A;  1W2B U;  4G28 B;  5BZB A;  1E1R G;  1YHQ V;  2CK3 G;  3CCM V;  4G27 B;  2B5U A;  3QO5 A;  4J9Y B;  5B1A C;  1MG1 A;  1P4R A;  5HFL A;  3UM7 A;  1YI2 V;  1PNL A;  4QIW F;  3CCV V;  5KUM A;  4PA4 A;  4GX2 A;  3H01 A;  1WPX A;  4H37 A;  1NQT A;  1NVP D;  3K9A A;  1KKD A;  2EIM B;  1OHH G;  4KP4 A;  1S76 D;  4HYO A;  4GX1 A;  3T1C A;  1J95 A;  2BOC C;  4P30 A;  5LHH A;  3CD6 V;  2R9I A;  1H8E G;  1JX9 A;  2DWE C;  4WFF A;  3SYA A;  2DYR B;  4LP8 A;  3SJQ C;  1MSW D;  1KQS U;  3LNM B;  3FYE B;  5L3G A;  3CCR V;  4N23 A;  5B1O A;  1OCR B;  1PL0 A;  1Q7Y W;  2NNU A;  1BMF G;  2Q68 A;  1KD1 W;  1VQ7 V;  2Q69 A;  3ML0 A;  2HG5 C;  5B1B C;  1V54 C;  3AG1 B;  3AG3 C;  1XL6 A;  1JPX A;  4CZZ A;  4WF9 V;  4Q20 A;  3ASO C;  2X6A A;  1FXH A;  5DN6 G;  3ZIA G;  1VQM V;  1H38 A;  4LBE C;  4U7O A;  4OXS A;  1KEC A;  2YEV A;  1YSC A;  1XL4 A;  1OZ0 A;  2ZR3 A;  1FXK C;  1V55 C;  3EHB B;  1RM1 C;  2MK3 A;  3CMA V;  4MTG A;  1TUE B;  3E8B A;  3LDE A;  4DXW A;  1JQ0 A;  2XOK G;  1VQ9 V;  4L87 A;  3ABK C;  1CEZ A;  1R3L C;  4FK5 C;  3K3W A;  4MTO A;  1NVP B;  1BHB A;  4QPJ A;  4RO2 A;  2Q67 A;  3OR6 C;  2X0L A;  4LCU C;  2HFE C;  2EIN C;  1K97 A;  2WLI A;  1SET A;  4KUM A;  2JDI G;  2WWW A;  2EIK C;  2ZR2 A;  3LUT B;  5B1N A;  1YIT V;  5CA3 A;  1OCO B;  2IH3 C;  3K03 A;  1QBZ A;  5EBW C;  5L3B A;  1VQN V;  1SRY A;  1G4Y B;  2DQ3 A;  3R65 A;  4UVC A;  5CBG A;  2JIZ G;  4WCE V;  5H6R A;  1AJP A;  1AI7 A;  2Y48 A;  3K79 A;  3TK1 A;  2IJJ A;  5B3S B;  2OCC C;  1H8H G;  3OM3 B;  2HLD G;  3AG2 C;  3X2Q B;  4JPR A;  3IC7 A;  4BW5 A;  2X6B A;  4XDL A;  1GO3 F;  1K3E A;  1QLE B;  5EC1 C;  3F5W C;  2ZD9 A;  2Y69 B;  3CP1 A;  1VQL V;  4H33 A;  2WLM A;  4PDR A;  4P9P A;  2EJR A;  3JCZ A;  3VOU A;  2EIJ C;  2ZXW C;  3D36 A;  3MHS C;  4UVB A;  1OCC C;  1OCZ C;  2V7Q G;  5EBM C;  5IYD O;  1K5S A;  3E83 A;  1K33 A;  1L1F A;  2HJF C;  1K4D C;  2EZO A;  2R9R B;  1ROP A;  2ITC C;  1GKF A;  5KA6 A;  4QE9 A;  1K7D A;  3JD3 A;  2WLH A;  3F7V C;  3OEE G;  4JTC B;  2YEV B;  3ZRS A;  3B77 A;  2A0L A;  2EIL B;  2DYS C;  4PA6 A;  1VQ5 V;  3IFX A;  3CCL V;  2IU0 A;  3OEH G;  4CBC A;  3T4D A;  1AJQ A;  3JD1 A;  1JOY A;  4QE7 A;  4QPK A;  3CPW U;  1F4M A;  1CP9 A;  4TSF G;  3AG4 B;  3OAA G;  4JYB A;  1LNQ A;  3ZMZ A;  1ARO P;  4Z1M G;  5KA5 A;  3WFV A;  1FXK A;  3JYC A;  4R50 A;  3ZN0 A;  3STZ C;  4JAS A;  4UVA A;  5E1A C;  3E2E A;  3CCQ V;  3CYO A;  3B8N A;  4MSW C;  4UXN A;  3SPI A;  3ASN B;  3W7X A;  3W7W A;  3ZJZ A;  5H9C A;  4XDJ A;  4I9W A;  4JAU A;  3ETD A;  1P7B A;  2WLI B;  3ZMT A;  3ABM C;  2ZDI C;  4MVM A;  1S5H C;  1GM8 A;  3W7U A;  3CCJ V;  1GMG A;  1MOF A;  2ITD C;  3UKM A;  2WLL A;  1MAB G;  2EZP A;  2W6I G;  3AEI A;  2JEU A;  4RUF A;  5B1A B;  3NXS A;  1SER A;  2ZQM A;  1R3K C;  1THZ A;  3OE7 G;  3WG7 C;  2JJ1 G;  5L3F A;  1M56 C;  3EFF K;  2QE7 G;  3G6E V;  4FPP A;  2OTJ V;  2A9H A;  2WSS G;  3QNE A;  1DF5 A;  1JVM A;  2XAF A;  3B8M A;  3ABT A;  3QO8 A;  1EBO A;  3JD0 A;  4UV8 A;  2X6C A;  2P90 A;  3LDC A;  2C2A A;  2JK5 C;  3ABL C;  4DO2 A;  2UXN A;  2HKO A;  1YJW V;  1NR7 A;  4BIU A;  2Z3Y A;  1AI4 A;  2HVK C;  2B1G A;  4JGS A;  4J9Z B;  2IJH A;  3TCU A;  1R6K A;  3FKS G;  2XND G;  3VBB A;  3SPH A;  4WFA V;  1F51 A;  3OUS A;  2JJ2 G;  3F7Y C;  5B1B B;  1EZJ A;  1V54 B;  4R6Z A;  4P9O A;  5IYB O;  4JTA B;  2H94 A;  1VQ8 V;  3K04 A;  3GWO A;  3ASO B;  1K9M W;  5LGU A;  5L3C A;  2DW4 A;  5HFM A;  5EBL C;  2NLJ C;  2X7R B;  4RUE A;  5LGT A;  4JYC A;  4ZKI A;  2HR3 A;  1F23 A;  1FXK B;  2Z5U A;  1R3I C;  3RBZ A;  4WFG A;  2V1D A;  3KG2 A;  1V55 B;  3OFN G;  1RM1 B;  1FS0 G;  2K1E A;  3MD0 A;  3CME V;  2IH1 C;  1PD3 A;  3SPC A;  1DTO A;  5EK0 A;  2IW5 A;  3HB3 B;  3SYP A;  1JCH A;  3ABK B;  2XAS A;  3QO7 A;  3RVZ A;  4MTX A;  2QEX V;  1M57 C;  1AJN A;  4GX0 A;  2XAJ A;  2UXX A;  1Y66 A;  1F4N A;  3P32 A;  2EIN B;  4LC1 A;  4R8C A;  3LSS A;  4MVS A;  3SPJ A;  4MVQ A;  2WPD G;  1VQ4 V;  1QVF U;  1DF4 A;  2ZDI A;  1S77 D;  3LSQ A;  2EIK B;  2QM7 A;  3SPG A;  1RPR A;  4GCZ A;  1KP3 A;  2GSM B;  3BEH A;  3BY6 A;  4MVU A;  3K0G A;  5IY5 C;  1H2G A;  1Q81 W;  5IYC O;  4EKW A;  4PEL A;  2OCC B;  2P67 A;  2OT5 A;  4P2Z A;  1I5Y A;  1PNM A;  1AI5 A;  3AG2 B;  4E2L A;  2YSU B;  4QJF B;  2DWD C;  3E8F A;  3OMA B;  1W0J G;  4MW3 A;  1R6N A;  3G71 V;  4RQF A;  3TET A;  1WLE A;  1Q86 W;  1K4C C;  4FJC C;  2AHY A;  2P6J A;  4G2K A;  3STL C;  3OW2 U;  2EIJ B;  2ZXW B;  3OMN B;  1QLN A;  1OCZ B;  1OCC B;  3ZRV A;  1K92 A;  1BHA A;  3E8G A;  3LDD A;  5EC2 C;  2LP7 A;  3ZMV A;  2H8P C;  3E35 A;  3ZMS A;  3DGE A;  1UJW B;  4FIP C;  4QNH B;  1R3J C;  3MHH C;  2WLK A;  2Q6A A;  4N21 A;  3CCS V;  3FB7 C;  1K5Q A;  4PDV A;  4WFE A;  2DYS B;  2PI4 A;  3FB6 C;  4WFH A;  4XBF A;  1E79 G;  3FYI B;  2EIM C;  1KP2 A;  2IJI A;  3D3I A;  4ASU G;  4BIZ A;  1S3J A;  3CCE V;  3ZRX A;  5DM6 V;  2DYR C;  1Y4M A;  4WFB V;  1R73 A;  4FMT A;  2KYH A;  5IDJ A;  4BAY A;  1DLB A;  2XAG A;  2B1I A;  1YJN V;  5CMU A;  3SYC A;  3W7T A;  1OCR C;  3K06 A;  3ABM B;  5L3E A;  2XAH A;  4PA3 A;  5LBQ A;  1GM7 A;  3AG1 C;  3PJS K;  2D3O W;  1AI6 A;  1IXM A;  1COW G;  3OR7 C;  1BL8 A;  1M90 W;  1ZWI C;  4GX5 A;  4R7C A;  4YXW G;  2M7W A;  1YTF D;  3FB5 C;  5H6Q A;  3SYO A;  1VQO V;  3WG7 B;  4GT1 A;  3GB7 C;  1M56 B;  1W0K G;  4ZBM A;  3CC2 V;  2F43 G;  1S72 V;  4MVR A;  5J9P C;  5LHI A;  4PDM A;  3A0R A;  5LHG A;  2FTK A;  2IU3 A;  3AG3 B;  3HPL C;  3CC7 V;  2LFR A;  4RAI A;  2P7T C;  4PDL A;  3FB8 C;  3RW0 A;  1HWY A;  3ABL B;  4TWK A;  1ORS C;  1I5X A;  3T2M A;  1S0V A;  1VQK V;  3OGC C;  3ZCC A;  4UV9 A;  3K08 A;  1K73 W;  5L3D A;  1NH2 D;  3M99 B;  2EBO A;  3IGA C;  4UUJ C;  1AR1 B;  1RPO A;  2PI5 A;  5CBH A;  2OTL V;  2AHZ A;  4X8A A;  1M9N A;  1QR8 A;  3W7S A;  1CPY A;  3ZRW A;  4F4L A;  3T4Z A;  4MVZ A;  1SZT A;  1OCO C;  1PKX A;  2QKS A;  1VQ6 V;  3JD4 A;  2WLL B;  1K34 A;  4RQE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...