4DXWA

Crystal structure of navrh, a voltage-gated sodium channel
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
227
structure length
210
Chain Sequence
TPFFSSLKDNRIFQFTVVSIIILNAVLIGATTYELDPLFLETIHLLDYGITIFFVIEILIRFIGSGWNIFDTVIVAISLIPVLRLLRIFRVLRLISVIPELKQIIEAILESVRRVFFVSLLLFIILYIYATMGAILFGNDDPSRWGDLGISLITLFQVLTLSSWETVMLPMQEIYWWSWVYFFSFIIICSITILNLVIAILVDVVIQKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an orthologue of the NaChBac voltage-gated sodium channel
pubmed doi rcsb
source organism Alpha proteobacterium himb114
molecule tags Transport protein
molecule keywords Ion transport protein
total genus 79
structure length 210
sequence length 227
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00520 Ion_trans Ion transport protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4dxwA02
1.20.120.350 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Voltage-gated potassium channels. Chain C 4dxwA01
1OCZC 5CBHA 3K0DA 4PDLA 4R7CA 3KG2A 4MVRA 3FB7C 4QE9A 4H33A 4MVZA 3RW0A 3TETA 3LDEA 3RVYA 3F5WC 2HVKC 3AG3C 4MVSA 4J9ZB 1BL8A 3LDDA 3ASNC 2QTOA 4MVMA 4R50A 3RVZA 1K4CC 3SPJA 2ZD9A 4R8CA 4XDLA 5J9PC 2R9RB 1XL6A 3GB7C 2OCCC 1M57C 5B1AC 5KUMA 1OCRC 2A79B 4UUJC 3OGCC 3OR7C 1JVMA 4HYOA 3SYCA 4CBCA 4MTGA 4PA4A 3T4ZA 3VOUA 2KYHA 1KKDA 4GX2A 4EKWA 1QLEC 4X88A 4WFEA 5EBMC 2X6AA 3RBZA 3LNMB 4TWKA 5BZBA 2WLNA 1V55C 2WLKA 5KUKA 5CBGA 3SJQC 1ORQC 4RUFA 2X6BA 3IGAC 3EFFK 1J95A 2WLIB 3OR6C 4PA3A 4ZBMA 3SPGA 4BW5A 4G28B 2AHZA 2BOCC 2A0LA 3R65A 2WLIA 2YEVA 2JK5C 4R6ZA 1LNQA 2BOBC 2DYSC 1ORSC 3E8FA 4MVQA 2IH1C 4WFHA 2X6CA 3SYPA 4MW3A 4GX1A 4XDJA 2NLJC 4WFFA 3IFXA 4LP8A 4P9OA 3K0GA 3T1CA 3E8BA 3ABKC 3K08A 3OUSA 3AG2C 4JTDB 4X89A 4MS2A 1M56C 3AG4C 4QE7A 3SYOA 4F4LA 3K03A 3F7VC 2WLLB 3E83A 4HZ3A 3PJSK 4RO2A 3TCUA 3E8GA 2ITDC 2ITCC 2QKSA 2WLLA 4RAIA 5B1BC 3UKMA 4P9PA 1R3IC 2HFEC 5EK0A 3F7YC 4MVUA 4P2ZA 2HVJC 3AG1C 2Q68A 3BEHA 2WLJA 4H37A 2EIKC 2P7TC 2W0FC 4PA6A 1R3LC 3E86A 4WFGA 5EC2C 1XL4A 4MW8A 5EC1C 3FB8C 4OXSA 4RUEA 3OUFA 1G4YB 4XDKA 2K1EA 4LBEC 3STLC 4G27B 3ABMC 2HG5C 4MTOA 1V54C 3STZC 2A9HA 5EBLC 3SYAA 4QNHB 4GX5A 2IH3C 4I9WA 3T4DA 3E89A 3UM7A 1R3JC 4GX0A 2Q6AA 1P7BA 3K06A 4JTCB 3LDCA 4PDRA 2Q69A 2KB1A 1R3KC 3ABLC 3FB6C 1ZWIC 3SPHA 1OCOC 4MTFA 1OCCC 4KFMA 4P30A 4PDMA 4J9YB 3SPIA 5B3SC 3E8HA 2EINC 4X8AA 2Q67A 3ASOC 4MVOA 4PA7A 2ATKC 4MSWC 3HPLC 5EBWC 3T2MA 2WLMA 1S5HC 3ZRSA 1K4DC 3JYCA 2HJFC 2EILC 2EIMC 5E1AC 2H8PC 4JTAB 2Y69C 3SPCA 2WLHA 3LUTB 2EIJC 3FB5C 4LCUC 5IY5C 4PA9A 5CBFA 4DXWA 3X2QC 2DWDC 4PDVA 2DWEC 2AHYA 2ZXWC 3K04A 3SYQA 3WG7C 3ZJZA 2DYRC
chains in the Genus database with same CATH superfamily
2QM4A 2VASA 4YT8A 2CH7A 3B8NA 3C3SA 4DV2O 1S76D 3DM5A 3BFRA 2H3OA 4LF4O 4LFAO 2IJIA 1FMWA 3EFOB 5IYZA 5LOVA 4X1IB 3LLKA 4MVZA 4P6IC 1E83A 2ARHA 4I50A 3L73H 1TWAA 3MYIA 1MNEA 1H9GA 3CJHB 4UVBA 2EIMB 4FVMA 1A7EA 1N33O 3L72H 5B1NA 1A32A 3AOUA 4RWUA 2QDOA 3SYCA 1VQLV 5GONB 4PA4A 2P4VA 2HV7A 5BXZA 5L3VA 3SXKA 2X6AA 2WVQA 1L8DA 1N36O 1NSGB 1K97A 3RYHB 2X6BA 2XXAB 2WLIB 4K8ZA 4BIUA 2DI3A 5JVEA 2GHYA 3SJBC 3HLZA 4NXMO 1GM5A 2F66C 2DYSC 3DAGA 4X62O 4BJ5C 3H2VA 2A0BA 1ZHWA 3TJTA 1JFFA 5A6JA 1I94O 1ZU5A 4CH3A 5D91A 4X89A 1RM1B 2CTRA 2R9AA 3F7VC 5IYZB 1LUWA 4N21A 1HNZB 2ZQMA 4DR4O 1AI5A 1I08A 2RNBA 3B0UX 2CE4A 2XAJA 3S9OA 2LJ2A 1JX9A 4OIOF 2MK3A 4XPXA 5DLJA 5KYUB 5GPGB 2Z0AA 1XREA 3FFQA 2JS3A 1B6QA 2D4UA 4AQYO 3LS0A 256BA 3GM2A 3QMKA 3CMAV 1VF6C 4X66B 2XNDG 4JV5O 1K04A 5IYDO 1HR0B 3RYHA 4GX5A 4U5CE 1R3JC 4GX0A 1SC5B 4QPJA 4TOIA 3EXAA 1KQSU 2A0UA 2J45A 1VQNV 3TXQA 1FJGB 2QJ1A 4CZZA 4IL6Z 5AG2A 2PUSA 1CPQA 3GM3A 4MTXA 4CIHA 2QA4V 3V5YA 2F4VO 4PFOA 4WABA 5JCOC 2NNUA 4PJLA 1FAPB 4MVOA 2ATKC 5EBWC 4OIQF 1XMQO 2DQ0A 1K4DC 5EZYA 1IXBA 1XEQA 4X65O 4GEHA 2UUAO 3SNHA 2XSEA 3SPCA 2XL8A 3NMJA 3JASA 3M79A 3DSQA 4PA9A 4KP4A 1EN6A 4UCTA 3KPHA 2P67A 2LO1A 1DOVA 2DWEC 5F28E 2JEXA 4JAUA 4E0IA 1OQCA 1XNQO 1ZHXA 1MQVA 1G5ZA 3E70C 4LDRA 3QO5A 1O3UA 3LEOA 3UO3A 3FB7C 3WB2A 3IQ6A 1FKAO 1GKFA 3TOLA 3ZWIA 4FMTA 4JI8B 4J9ZB 1YZBA 3LDDA 1NU7D 4MVMA 5KHHA 3E2EA 1WJZA 1NBBA 3CSKA 3S29A 1UFIA 1VQMV 3LAYA 2UXDB 4FFKA 4HYOA 3L8IA 1SKVA 2E87A 2HS5A 3U2LA 4CJGA 1GTOA 3ZHRA 2RQ6A 1MA1A 2P90A 2YDEA 4DR5O 4NB5A 1W0JG 3ETDA 1NH2D 5E33A 2L6FA 3NYMA 4G28B 2NUTB 3JASB 1Y4MA 4DVZA 5JVDA 1NVPB 1VLSA 4KHPO 1BDJB 4G0HA 4O6YA 5JJNB 4DV7B 5L3CA 3T4RA 3AK1A 4KL1A 4JI3B 4FLUA 4DW0A 4J42A 4JTDB 2OYQA 3CD6V 2J9VA 2WZLA 1GH6A 5LMNO 3ZX6A 3GWKC 2OWOA 2D5RB 3ZMVA 2HLDG 2ITDC 5JRAA 4J30B 4K0KB 3B71A 2Y39A 2YVKA 4X20B 4N23A 2GDSA 2XUMA 3V5XA 1O87A 4EWCA 4IYIA 4DV3O 4KNVA 4JYBA 2DYSB 4NXNO 1Q6HA 2HKOA 2HZ8A 2PX0A 3P3PA 2ZPAA 3G4XA 4J41A 4JZGA 2VC9A 3SJAC 1N36B 3GEHA 5IDJA 1LVKA 2XS8A 3ZVRA 1D1CA 3STLC 2F23A 4G27B 1NU1H 3K9SA 1QKRA 3VQXA 4YWQA 1RJ9A 3QVZA 2NUTA 1QCEA 1Q6IA 4D7SA 3MBGA 3N27A 4P30A 5JVDB 1PM9A 3NYJA 3JD4A 3VQWA 1N1CA 4JI1O 4KNWA 5JJEB 1B06A 1YF2A 4TV9A 3J80N 2PBEA 4KUMA 3JYCA 1Q0KA 2H7VC 1XZQA 2GDCA 1HNZO 5LL6Y 4IIJA 3US6A 2FB5A 1MMMA 3DE8A 1WLEA 1ZHTA 4DXWA 2EPOA 1JJ2U 1UJWB 1SR2A 2FYUH 4DR1B 3AEIA 1PL0A 3U9JA 4GZRB 4DUZB 5EHHA 5CA1A 1SA0B 4DOZA 4C7OA 3G4ZA 4I55A 1Z5ZA 4O4LB 4WFBV 4PJJA 3G71V 2J8WA 4B3MO 3U8PA 4LWSB 3OTOB 5DEDA 1PD3A 2KW3C 3H1HH 4LF8B 2ZXRA 2LSEA 2Q7HA 1IBKB 2ZDIA 1FJGO 3U8VA 4G7ZF 4DR2O 3AK3A 1XL6A 3DE9A 3KYIA 1M57C 5B1AC 3DZAA 2F4VB 1QR8A 3ABTA 5DECA 2A6HF 1FXKA 2ADQB 3TJ5A 4NTYA 4E7ZA 1WGWA 5EBMC 5L0DA 2OIGA 2Z5UA 4XEKA 2LFSA 5KUKA 4ZOLA 4QI2A 4PA3A 5D5PA 2XAFA 3GODA 2WLIA 3T9OA 1LNQA 5L0JA 2IJKA 1GO3F 4D4NA 3B0VC 2R25A 3APOA 1IZMA 3PMRA 4C7OB 1GRJA 1OXBA 2YLIA 5GTIZ 3HNIA 3KKBA 5KYYA 3A9CA 2A06H 1CXZB 1J5EO 1K92A 3OA1A 2Q9LA 5A6KA 3UKMA 2A68F 1YTFD 4JYYA 5K1PA 3AQCA 3TOMA 5EGYA 2G62A 3FYIB 4TQDA 3H2UA 2MWQA 2P7TC 4J7JA 1M2VA 3C90A 1RCPA 2LFDA 1FXKB 1M6TA 4EUKB 4WFGA 2PX3A 4MW8A 2QWQB 5L3GA 4IJJA 5IWAB 2DMXA 4CC6A 5IY5B 4LBEC 1DTOA 4I50B 2WA3A 4CS7A 2R03A 2IM9A 2UUIA 3CJHA 5EBLC 2IXMA 3O65A 1P7BA 4JJGA 4QGPA 1K9MW 2H7OA 1QLNA 2WVOA 3M4BA 4QDLA 5GONA 5KYXB 4FZ1A 4J10A 5BMVB 1IW7F 1Y76A 3HPLC 3RYCB 3WG7B 1PPJH 2UUBO 4Q4ZF 1IBLB 3E22A 3SZRA 4GCZA 3FAPB 4UCRA 5EZYB 5CB4B 2CTWA 5H2FZ 4K0KO 4LFAB 3ZRVA 5IY5C 4AK9A 3U9MA 1A0BA 3O9OA 3KL4A 2ZINA 1HW7A 4FESA 3ASNB 3ZJZA 3SXMA 2ASRA 3W7XA 1NTZH 1AI4A 1E85A 4GUNA 1TA8A 2O57A 3TETA 1RPRA 3SR2C 3DC5A 2KGOA 2EULA 1GAXA 2LFRA 3Q7LA 4JI1B 4A5UB 4OD5A 4RD9A 1KTMA 3OGCC 1YLMA 3LNRA 2XM0A 3GORA 1WB7A 2YXHA 1U97A 4YL1A 4TWKA 3RYFB 4JYAO 4CIPA 4HBNA 1Z7Qc 1FXVA 2XAQA 4FLWA 2MHRA 1D1BA 3VQYA 2C03A 4DUZO 1QHTA 2QM8A 4WFAV 3GWNA 2OOCA 1PL4A 4H13B 2J0WA 2ZR2A 1NFOA 3IQCA 3WHNA 3E8BA 3IQ5A 4OIPF 1H2KA 1D2DA 2JVDA 1KB9F 4RO2A 3M4CA 4CJOA 4J7KA 1HNWO 3JYYA 2LQTA 3B2EE 3GWLA 3HNKA 5JH7B 1N34B 1VQ8V 5L3FA 1NFNA 4JC7A 1X59A 1TFKB 3ZC4A 4BJ5A 1PD1A 3FAVB 4JF3A 2GBOA 4E18A 1F4MA 2W0FC 1AVMA 2QWOB 2KG7A 4PJMA 1LI5A 4AHCA 1Y66A 4L8JA 2RMKB 2OKUA 3K1HA 4U9EA 4I9WA 1DLBA 4XPWA 3CXCU 1VK5A 2DB4A 2B5UA 1JAFA 2UUAB 4EBJA 3SPHA 4U5HA 5DS5A 3APQA 3T1HB 2AVKA 1MZEA 4DW1A 5COGA 3AG7A 1O9HA 3KKYA 5BUOA 4D6TH 4TV9B 1VF6A 1D1AA 5L3EA 1YIJV 3WB1A 1RM1C 4LLEA 1VQ6V 4DR3O 1WOLA 3CCUV 2Q9AA 4JI4O 1T5OA 1I7FA 3T6JA 3RF3A 5COFA 3AGTA 3HKKA 4G2KA 4JI8O 1BZKA 3MDSA 2FKXA 1PNKA 1SERA 3K1IC 3K0DA 3G80A 3Q6NA 1SA0A 1T9KA 4MVRA 2Y0IA 1BT8A 4H33A 1HNXB 3C62A 3IPMO 3JSLA 2V3CC 1K40A 1BL8A 3OMAB 3C3TA 2PFDA 4E4EA 2CUGA 3W7TA 2KC3A 4XLNF 2J9WA 2GFHA 4Z9IA 2LGQA 4ZI7B 3ABLB 4MTGA 4GX2A 3DTUB 5T3WA 4CSAC 1RFYA 2KQXA 4B3TB 4QIWF 4KHPB 4YT4A 4ZHQA 3PCVA 3RQGA 3IJ4A 3RQEA 3EFFK 1RJ9B 3OR6C 1NVPD 3U2MA 3IQTA 4F6RA 3E8FA 3FXHA 4MT8A 3ZRWB 4ER9A 1AJQA 4LF5O 4ZIBA 1BQ0A 4OGQB 4XDJA 1K33A 4DV2B 1NH2B 4BJ1A 4LP8A 1Q86W 2R7QA 5LHIA 4PI0A 5B3IA 4CBEA 1URFA 1FPOA 1OZ0A 1C17M 2W4BA 3JAWA 3JRMO 4BPMA 3BY6A 4DV3B 1OXKA 4CH5A 1KP2A 2YI9A 1J8MF 1FXHA 1SQFA 4FPPA 4TT3G 4W8PA 1K7DA 4N06A 3UMIA 3ZTZA 1EM1A 2J9BA 2D2CB 2HFEC 1I5XA 1W0KG 4UFZA 3TGUH 5LMUB 4XWJA 1SS3A 4LFCB 3DWWA 5CIVA 2Q68A 3D3IA 4Q7CA 4I55B 4PJNA 1A41A 1MMDA 4LWSA 3MHSC 4OXSA 3K7DA 3EGXB 2NSGA 2YIBA 1NI8A 2B1IA 1T5EA 5GTHZ 4JRZA 1ZVZA 4JTCB 2QWRB 5KMGA 5A2QN 1VLTA 2Q69A 2AWCA 3MLGA 3S28A 3MAQA 2FMLA 1I94B 4F6RB 5FZTA 3ZMZA 1M5IA 1JPXA 5B3SC 1MSWD 1ORJA 2YS8A 4O79A 2M64A 3EQLF 1AILA 2Q3TA 5J2UB 1Q5OA 3OEEG 4Z1MG 2UXCO 2L7AA 3J06A 3UR3C 3G50A 4ZOLB 4B3RB 5KHJA 1HNWB 1Y76B 5COMA 2BTQA 3ZEDA 3CAXA 2OU6A 3RYCA 1YJWV 2RD9A 5KAFZ 2WLHA 2EIJC 1N34O 3UO2A 1M57B 1R1BA 1OCOB 4YIPA 4IARA 3OTOO 1FYJA 2W4MA 4IWBA 2L6LA 4LDQA 1CGNA 4NVPA 4PELA 3ZRXA 2RDCA 4R32A 1DF4A 4AQYB 1FFTB 4QE9A 5KYYB 4EB6B 2JDIG 3H01A 2CW0F 1HR0O 3C63A 3JCUQ 4JZAA 3LJBA 1GN4A 1SZXA 4X1IA 4JASA 3LEVA 1K4CC 2XTAA 5KMGB 4EBKA 3W8IA 2XS1A 2YXYA 1M2VB 2I8BA 3JATA 1BR2A 4DV4B 2WWWA 3TJ6A 4DK1A 4OIRF 1KKDA 1OR2A 3WAQA 4X65B 1TKNA 2EPMX 2E5LB 3OTFA 2E74B 3SEOA 4JCZA 4JVSA 2XASA 2ZE8A 4AX2A 3SJQC 2Q7EA 4RUFA 3RYFA 1ZL8A 2EZOA 3B4SA 3SXYA 4J11A 4JI4B 1US6A 4X1YB 4R6ZA 1PP9H 3CP1A 3JCUZ 2IH1C 2IOQA 1J5EB 1VARA 1S05A 1F1MA 4WFFA 3IFXA 4NTWA 1JFFB 4LF6O 3FYEB 2V26A 4ICGA 1Q7YW 2HUJA 1V54B 1HNXO 4U9DA 3AG2C 1XHXA 2P61A 4K1OA 1SQVH 4BEMJ 2OIEA 4FK5C 4J80A 2KQ9A 3ZHUA 1FAFA 1OHHG 3L70H 1BBHA 2R7VA 3ABMB 3S27A 4PI2A 1B04A 2XOKG 3U0CA 3K66A 1BS3A 2P1AA 2IJJA 3FAVA 2EIKC 2GTAA 3HTKC 1OKKA 2WZFA 2QKCA 5HFMA 4LR3A 2VCBA 5L0HA 5LYJB 3ZQYA 4J7ZA 3ABKB 3FDQA 3OUFA 3AGUA 1PD0A 4WGYA 2A9HA 5DS6A 4B7KA 2YUAA 1VQ5V 2NUPB 4EEQA 5CA0A 4X1YA 4LF5B 2EPNA 2PTMA 4DYLA 2L9JA 1CPRA 4CS8A 4UCOA 1P49A 3E8HA 1RKEB 1Q0GA 1GK9A 2QE7G 1X4TA 4UB8Z 2PYLA 3T2MA 4BIZA 1XWJA 3FAJA 1S5LZ 5LMNB 3QVYA 2E75B 3H1KH 3UCSC 3A0RA 3LSSA 3P30A 3RYIB 2CTQA 2Z3YA 1SZIA 1HW2A 3SXZA 1WPXA 5B3SB 2C04A 2Y69B 3OMNB 2ZIOA 1PNLA 2F95B 3DXRB 3QO8A 3JCZA 1E2XA 2HJMA 5A69A 4FZ0A 5BQGA 2HP8A 2W0XA 4PACA 5LYJA 1NR7A 2YI8A 1N4CA 2Z15A 1VOMA 2EILB 1T01A 1H38A 4YHHO 2UUCO 2XLEA 4BG0A 2YICA 2ZD9A 4TUYA 2YZSA 4JI6O 3DXJF 4DVYP 1Q8IA 2XLOA 1KP3A 3WFVA 4NTFA 2MYSA 5FL7G 2QWPB 2ZE5A 1XNRO 3TK1A 4NXMB 2UXCB 2KG7B 2OG2A 4UCSA 3HR0A 2RN9A 1G8MA 3NYLA 2AXTZ 3ECSA 3JARA 2PZSA 2ZDIC 4IT5A 3B40A 4AE4A 2YEVB 4ZHQB 3MD0A 3R65A 4DR1O 3M15A 1K5QA 4YT2A 3BRJA 1MNDA 4K3AA 3KCYA 5AC5A 3NR7A 1JRAA 4C3DA 5KYNA 1AVOB 5F2VO 1ZUQA 1DOWA 3DXRA 3K0GA 5DN6G 3G4SV 1D0ZA 3CRQA 1RPOA 3OUSA 1VMGA 2PP4A 1G1XB 3SYOA 1Q0FA 2ILMA 3KMIA 2GAQA 4CS9A 1CPYA 2LW7A 1S0VA 4JIOA 1VP7A 2ZNIA 3JAWB 2AGAA 3X1OA 4DR2B 1QBZA 1E79G 2LW1A 4DK0A 3VM6A 2HVJC 1HMDA 5BY1A 3QG5A 2KK1A 4DRIB 3ZIBA 1R5ID 1S3JA 4HAMA 3T1YO 3TQOA 2WLJA 1WB8A 1KNYA 4A4AA 2J9UA 2R02A 2E5LO 3E86A 3MHHC 1D0YA 1QZXA 1W59A 2CGOA 2KNHA 4XTKA 1D5NA 1IX9A 3ABMC 3A2FA 3I5DA 3EGXA 3JARB 1ROPA 4JI0B 1PNMA 3FOOA 3S84A 1NZ6A 2CCYA 1YSCA 4DBRA 2Y4UA 5LGUA 3ITFA 4N6CA 5LP6C 2Q4FA 1YDXA 1RSOA 1S5HC 3GWOA 4M63A 2B9ZA 2YL0A 3CEXA 5B66Z 2HJFC 4DUYB 2ZKOA 4YJWA 2EIMC 3SJCC 2IBFA 4J32B 3OW2U 3JALA 3ZHSA 5LBQA 2XLWA 1U89A 1Y74A 1MZFA 1FTSA 3ZRWA 4CS2A 5T3TA 3JSZA 3LSUA 1VB5A 5KHKA 4EBBA 3K79A 1JOGA 2R7TA 4UDVA 5LA6B 3EH2A 2HEPA 4O4LA 2XT9A 2UXDO 3ASOB 3OGIB 2QTVA 3AG3C 4UVAA 4I4TB 2J7PD 5AC4A 1SMYF 3OE7G 4H54A 3KCXA 3SPJA 4BJ6C 1NKDA 1O9GA 2R9RB 2L81A 3GANA 4GT1A 4CS8C 4Z9JA 1FFTC 1H2GA 1WPBA 5KA5A 4YT5A 3OFNG 3OR7C 1H2MA 2OT5A 1TAEA 3M1CB 1XMOO 1G4US 5IT9N 1RP3B 5BR8B 1BGYH 4H44B 3J81N 3JALB 3GEIA 2KSDA 4U5EE 3BA8A 4CS4A 1IBMB 3EHBB 5IYCO 2VH3A 4WJ0A 2X6CA 1H2LA 3K5NA 2OEVA 1S7ZA 5J2UA 4GYTA 4CX9A 3PHF2 3PN1A 5LMUO 3ABKC 2I15A 3B9QA 4BIOA 1TWGA 1M4UA 3K03A 1ZAUA 3BHPA 5LA6A 2J7PA 4JPRA 4DR6O 2ZE7A 1SYQA 3Q6MA 1YEWA 2LGWA 4JI6B 1YZCA 1ZZPA 5DQTA 3ZQVA 2CGNA 5H9CA 1MMNA 3G6BA 4ONSA 1YA9A 1XNRB 3HJCA 3D36C 1SQGA 2DW4A 3POVA 2XM4A 2NG1A 3GM1A 4PA6A 4DRHB 3KH2A 3RKOF 5EC2C 1G4YB 4I1OB 1EZJA 1MABG 1OV9A 2A7WA 4FIPC 2CYDA 1M1KW 3ZHVA 3B77A 3K06A 4B3RO 1COWG 3C8GB 1HDJA 1L0LH 3FB6C 3I4UA 4KBLA 2NUPA 1PV3A 4FLTA 3I5QA 3HNJA 2OQMA 5KYXA 4TV8A 4PA7A 2ZM6O 4Q6GA 2JD3A 2VQEO 1O5HA 1NT2B 2CAZC 2QLAA 1E84A 1R6TA 1WP8A 2B0HA 4AL0A 2LP4A 1F4NA 1AR4A 1E1RG 3E22B 5JT4A 4B3MB 3CRRA 3TULA 4YXWG 2IXNA 2P4KA 1YJGA 4CS3A 1THZA 4JGSA 1BE3H 3CRCA 2PY5A 2CTPA 2ZXWC 1YYJA 1T6UA 1VQOV 1NR1A 2V4DA 1N8RW 2WPDG 2P7VA 3EHNA 2NSFA 1SQBH 3GVMA 4NTBA 4LFBO 2Y4TA 1OW8A 1NTMH 3ETGA 4R50A 2W9YA 4X0RA 1VQ4V 4XDLA 5J9PC 1TGOA 3HKCA 3T1HO 4YIOA 1KC8W 1Z63A 1ORYA 3CC7V 2PF4E 4NY3A 2F43G 4LNUA 2UXBB 1JJOA 4LF9B 2RJZA 3LNMB 4PR9A 5KX5B 2WLKA 3KZIZ 4LF6B 3BCCH 2W45A 2HV6A 2Y48A 5CA0B 2A0LA 2Q7GA 4AE4B 2YQYA 2CGEA 2Q7RA 3W4YA 1M93A 1SF8A 4D4XA 2ZE6A 2HSQA 3ZHQA 2JRIA 3CCVV 4B3SO 2WB7A 2KSFA 4DV6O 2AZ2A 1Q3EA 3U11A 2WA4A 1I0HA 2F93B 3E83A 4X9QA 3IHUA 4OINF 5F5HA 3W8HA 3U3FA 4MNDA 2QKSA 4DV5O 3EZHA 5FLXN 4ASUG 3K9AA 1FS0G 2XLHA 1E86A 3ZHTA 3CCSV 1AI6A 3F5TA 3F7YC 4EFBA 1HP8A 4ABMA 1AUEA 5JWPA 2JX0A 1XL4A 1RKCA 4IYHA 1OKKD 3CEIA 3R66A 2XAHA 2IH3C 1FR0A 3RYLA 2EIKB 3ZBHA 3AQBA 1MG1A 1VIBA 1K8AW 1K05A 1OCCC 1YJ9V 5E3CA 1TFOB 2JIZG 2P0NA 2QE9A 3ZIAG 3L8JA 1JMWA 5B5EZ 2M4EA 3NMKA 3CE2A 3CCEV 2BE3A 2EZPA 3JTLO 3CX5F 3QVNA 3QW1A 2QM7A 5CBFA 1QQCA 2QUPA 2DWDC 4LFCO 3V5ZA 2RCVA 1BHAA 3NKDA 3HKBA 4GYCB 2HMQA 3H1LH 1HE9A 2R7WA 3W7SA 3D8CA 1QLEB 2G38A 4WBNB 3OD4A 2BSKA 1EA8A 5IJ0A 1QQ3A 2LIGA 4UXNA 4B08A 4BW9A 2HVKC 2X0CA 4O2BB 2QTOA 3N0TA 1Z3IX 4OPAA 4I4TA 2ICWG 1LIHA 5DM6V 1YDIA 4NQFA 4H0LB 4OPHA 5C93A 3W7UA 2YHSA 3FKSG 1AR1B 3T4ZA 1TR2A 1EQ1A 4ZI7A 4ULWA 1TVKA 2WLNA 4JEBA 2G3VA 2JGDA 4YJ2A 2GTSA 2JPUA 2P5OA 4BW5A 1F23A 4IRUA 2AHZA 1W2WA 1GM8A 1U6HA 2JK5C 3UNGC 3VF0A 3WODF 2BOBC 4YY3B 4XEVA 2EBOA 3HKBB 5CN0A 2VQFO 4NC3A 1KU9A 4G7HF 2GWWA 3I5PA 3T1CA 2Y3DA 4PK4A 4BJ6A 3ATPA 3RN4A 1ZSPA 2GSMB 4F4LA 1EN4A 4BR6A 5KYWA 3FD9A 2YLDA 1JPNA 3F46A 3QF7A 1M56B 1Z2GA 1AR5A 1H6GA 3B8MA 2L6GA 4PJ0Z 1K73W 5L0CA 2JJ1G 5H6QA 4IAQA 3T6BA 4JI2B 1Y67A 3BABA 1IZ3A 1N32B 2CDQA 3L9DA 4IGGA 4JURI 1S5JA 3RGBA 1LS4A 1KMIZ 4JW1A 4PV1B 3JD1A 1RMVA 1ZTEA 1XBLA 3Q7GA 4RUEA 1EZVH 1TVKB 2UU9O 2OEXA 2HG5C 2J0XA 2R7XA 2JGDB 1Q43A 4YJ2B 4CDVA 2Q6AA 1HWYA 2VS0A 3LDCA 3OT7A 4DR7O 4OX9O 1LPEA 1Z5VA 3W7WA 2CNWA 5CI8A 3N2ZB 3S90A 1S77D 3K5OA 2KJGA 4MSWC 4U5FE 3FOPA 2WLMA 5C8YA 4LERA 4U5BE 2PI4A 4E17A 5E1AC 2CK3G 4JI5O 2Y69C 2OTLV 2Y3GA 2EJ7A 4W8KA 1QSPA 3AG3B 3ICXA 4FLVA 1R6NA 3SP1A 2YIAA 3CWBH 2Y3BA 1OW6A 1MOFA 1G8XA 1L3PA 4N4WA 3DC6A 3ZTMA 5CBHA 4PDLA 4YN0B 4XEFA 1P84F 2XAGA 3NKEA 1GN3A 1VTMP 1KKCA 4G7OF 5LGTA 3QO7A 5JUAA 5IYBO 4MVSA 4EB6A 3Q4HA 5KA6A 1PCXA 2ZXOA 4ZLCA 3ASNC 2OCCB 4JCHA 2R9IA 2R7RA 4J7YA 5L3QA 2ETSA 4I9QA 1JVMA 3VOUA 5EIBC 5H5NA 5HFLA 1EFRG 2IXPA 3MX3A 1YA7O 3JATB 4EKWA 1V9PA 3CS5A 1OCZB 2TMVP 3EPVA 2QSAA 4K0DA 5LGNA 3DKAA 1OCRB 2AP3A 2K9PA 5LHHA 5KX5A 2IW5A 4Z1VA 3SPGA 2N04A 2HJDA 3AG2B 2DN9A 3C8GA 2IU3A 1P7GA 1ZL8B 3DJUB 5J2TB 4MVQA 1EI7A 4TV8B 1TWHA 2ZNJA 2PI5A 5EYPB 2A6EF 3DM9B 1WTYA 4MS2A 3AG4C 4LH7A 4HZ3A 4YHHB 2UUCB 3TCUA 1L7CA 3U5SA 4KC9A 5AGFA 4DJ9A 3OAAG 4DV0O 4U5DE 1I5YA 4MVUA 5A6AA 1Q6UA 1QU7A 3UMHA 1AP5A 1U96A 1A7VA 2O9XA 2X0LA 2DGJA 5EC1C 4LACB 5L0FA 2NN4A 2X51A 5L0GA 2QWNB 2WZGA 1WASA 3LS1A 4MTOA 4U3JA 5A6BD 1MSDA 1VYKA 4U7NA 1LI7A 5CI9A 3CZ6A 1YJNV 1Y6DA 2VQEB 4O4IA 4E2LA 2IU0A 1HE1A 2VB6A 4WF9V 4LNUB 3LSQA 1QVGU 3ASOC 5E2QA 3RFYA 3NG1A 2EINB 1RKEA 4TSFG 1Z6AA 2AWYA 3A11A 3MFNA 4BEJA 3H65A 3HKEB 5LHGA 2DQ3A 2H8PC 1FFHA 3JSNA 1FFXB 3FB5C 2FL4A 4LLCA 4LFBB 2IM8A 3RYIA 2ETNA 2QY9A 1APCA 2Q8VA 1BQZA 2DE0X 3FHDA 2V7QG 2YC0A 2W6IG 2HHHB 1ZLZA 4R7CA 4X64O 4PD4F 2IXOA 3A0HZ 2UU9B 2M7WA 1UPGA 5HSWA 1XILA 4L6RA 3C18A 2UXBO 4FLYA 5FNVA 4U3JB 3K58A 1LE4A 4DR7B 1GGQA 4LF9O 3O39A 4OX9B 3U3BA 5B1OA 4GQHA 2FTKA 3GB7C 1JMKC 4TUYB 4UV9A 3EGDB 4UUJC 4OD4A 4CBCA 1WN7A 2VCCA 3CCMV 2A69F 3O6XA 2AZ0A 1BR1A 4K7BA 4DUYO 3I56V 5BZBA 3CCJV 4FWVA 1V55C 4JYCA 5CBGA 1LKXA 1ORQC 3B09A 4ZBMA 2YWAA 3BAAA 1C03A 4JKVA 3V7OA 2L35A 4W4LA 4BAYA 3OWTA 3HNLA 3VAYA 3G67A 4B6IA 2YEVA 2VRZA 4HNAB 5JQGA 3DGEA 4MW3A 4DBQA 2NLJC 2YLGA 2JS5A 4UB6Z 5KLVH 3CQZA 3A8TA 3EVKA 3K08A 3EH1A 3CSXA 1YZAA 4LDKA 2Q0AA 3B29A 4QI0A 5BQHA 5KYWB 3CXHF 2BL2A 4UCVA 4NKGB 3ZDLA 5LP6A 4FM1A 5FNVB 3UT5B 3S0XA 5EK0A 3OM3B 4P9TA 1KECA 4JI3O 1N0JA 3BPZA 4BJTA 5TISZ 1GMGA 1BZ4A 2BSKB 2A1DD 3QW0A 5A9GA 4U5GA 4RBNA 1JQ0A 5BR8O 2ZXPA 1ZX3A 1U0BB 1OR3A 3CPWU 1IVSA 3WU2Z 4O2BA 3L0IA 4YL0A 5L3DA 4GKKO 3UM7A 3RQFA 4RQEA 1IBMO 4O6MA 1YHQV 2KB1A 3CC2V 1OCOC 3K59A 4HNAA 3SPIA 4J9YB 2P22C 2JJ2G 2B0JA 3E9VA 1H8EG 1NTKH 1V55B 4C3EA 3P32A 3JYHA 4Q5SF 1ZW2A 2J46A 4NYKA 1RSOB 2EILC 3U0ZA 1MMGA 4IAOA 1I4YA 5K1XA 3KYJA 2A3QA 4KXRA 3O55A 3UT5A 3L75H 1Y74B 4HEAJ 3SYNA 3CRMA 3SYQA 2YIBD 3ZN1A 1HY5A 3JAKA 1CGME 2Q9CA 3H1IH 2VWKA 1H2NA 5H6RA 4XQ1A 4O4HB 1DK1A 2P6JA 3E35A 4EFEA 1XQ8A 3R7CA 5L0IA 1WN0A 1Z5WA 1A7DA 1H9TA 3JT1A 1JCHA 4W4KA 2XHBA 3NRHA 3CCRV 1NJIW 1TUBB 3HKDB 3EG9B 2XL6A 2HR3A 4PHZA 2A79B 3BA9A 3N2GA 2ZM6B 2F1MA 5JS5A 3QTHA 2Q0OC 3RBZA 1WATA 1IBKO 3IC9A 1N0NA 2LCHA 2OJQA 2OJED 3IGAC 4X66O 3THOA 4YL3A 2BOCC 4NR1A 1XDCA 1LS1A 3EZIA 5IE9A 2PGGA 2DJVA 3DI5A 5E3AA 3TK0A 5JP7A 3M99B 5DS4A 2HHHO 1FNTc 4CH6A 3ZS8C 1NBMG 4X64B 5IJ9B 3A0BZ 4FJCC 4I3MA 1ZU4A 3TD7A 1AROP 4FFBA 3ABUA 4ZKIA 5E79Z 1Q0DA 1V4AA 4O4JB 3T1YB 4O4HA 1E1QG 4JI7B 3O10A 3N24A 4U3FH 2ITCC 3ZMUA 2WL8A 5FPOA 4RAIA 1D5AA 1W2BU 1R6KA 1H8HG 3EJNA 1NG1A 3FX7A 3AG1C 1IXMA 2GA0A 3LESA 1WNSA 1YARO 4JI0O 3L1MA 1CEZA 3S3XA 2Y0PA 3ZMSA 1C02A 3K5LA 1K5SA 4XDKA 3M8AA 2HKVA 3Q4HB 1L1FA 4JEAA 4B7EA 2W6JG 4QNHB 3T4DA 4BWAA 3JD3A 5GW7A 4U7OA 4Z9HA 4PDRA 4GKJB 1FMVA 3LNNA 5KHGA 1TUEB 1VQPV 2NPUA 3PDMP 1ZWIC 2YIDA 4D7TA 2BTOA 1OCCB 2QNLA 1FD9A 1JA8A 3ZRSA 4NTXA 1DGSA 4FFBB 4IIJB 1K3EA 5BQIA 2CDYA 3H1JH 4DV5B 4DRXB 2YL7A 4TQFA 3UGPA 1AJPA 2EPLX 4YJ3A 2LK4A 1FFXA 5J2TA 3RH3A 2D3OW 5CA1B 1SETA 1KYOF 1YXBA 3EHMA 3P3NA 3WG7C 2UUBB 1NS1A 5CA3A 3AJMA 3VRCA 5EYPA 1MMAA 2EPKX 4QPKA 4L87A 2FGYA 1QR9A 4QJFB 3L71H 4F6EA 1TQGA 3LDEA 4CS9C 4IHJA 3I55V 3R2PA 3K33A 1XMOB 3HB3B 4J7TA 4R8CA 1BSMA 1TWCA 3S3WA 4LF4B 1GM7A 1M2OA 3HKCB 1H7IA 3EGDA 2KYHA 2DYRB 2E76B 2GV9A 3GEEA 4JJFA 2QR4A 2IBZH 2WSSG 3H9VA 4WFEA 4X88A 4X1KB 1VMAA 3W2VA 1I4ZA 3DJNB 1J8YF 3SYPA 1WA8A 3DD7A 4ANJA 4CSAA 2H94A 4O4IB 2VWJA 1XZPA 3ZSUA 3ETQA 1ORSC 3UGOA 3N2KA 5B1BB 1ENVA 4DR6B 3D3QA 4JYAB 1QNMA 5JQGB 4K35A 3C8ZA 2XLDA 4HE8D 4F4BA 4P9OA 4DV0B 2YKZA 4LH6A 2YXLA 4QE7A 1LR1A 3EFOA 2WLLB 3B0PA 1ZHYA 3PJSK 2YL3A 1DF5A 2X7RB 1T6IA 2P6VA 1BR4A 2QKAA 5JJJB 3DAFA 4P9PA 2Q5ZA 4P2ZA 1GS9A 5HV9A 5LP6B 2OCHA 3NXSA 3M7MX 3BEHA 2YL1A 1XOUA 4H37A 5B1AB 1Y6XA 5JLIA 3IEEA 2JGUA 3CCQV 3FB8C 1R73A 2K1EA 4E0HA 1AJNA 2MW2B 4G78A 3FMSA 1V54C 3SYAA 5LXTB 1Z23A 2F22A 2GUZA 3E89A 1NQTA 4YY3O 4LF8O 3TXSA 1JOYA 3MYFA 3L34A 2EX3A 3ABLC 2VQFB 5BMVA 3N2KB 1RXQA 3AG4B 1K34A 4JV5B 2Q00A 4WGZA 1B68A 3IC7A 4P9FA 4I0XA 4JAVA 5CB4A 1YAUO 4NCQA 5JCOA 4JTAB 1WP7A 3LUTB 4LCUC 3JZ0A 1JR9A 3K57A 1JPJA 2UXXA 1VQ9V 4RQFA 3ML0A 4JI2O 4IB4A 2AHYA 3FVYA 2CH7B 3CMEV 1N32O 4FAPB 1OCZC 3JD0A 5KYUA 1Q90D 4CDAA 5LOVB 1Q0MA 4DR3B 4KI2A 2LD6A 1UFBA 2H7BA 4JAAA 4WBNA 1QVFU 1M90W 4ZLDA 1YTFB 5IJ0B 3ETEA 3RVZA 1EKYA 1XNQB 3K6BA 4FLZA 2GUZB 4GLXA 4DV1B 2OCCC 5KUMA 1GQAA 1P4RA 2ZR3A 4DRJB 2YRFA 1S72V 2R7OA 1IURA 2N74A 1AEPA 1H2SB 2EJRA 3UMKA 3QZCA 5IWAO 4B3SB 3OEHG 5ITZB 4DV6B 3K1IA 2XRHA 1BCCH 1VQKV 2YSUB 2UXNA 4E7SA 5FPRA 3UQ8A 2ZT9B 4HFFB 2WAMA 2R7UA 2ZCEA 4O2AB 1PKXA 1HW1A 4DR5B 1V74B 2R05A 1QVXA 1SZTA 4CH4A 3VQVA 5IJ9A 1SQQH 4AILC 3DMDA 1M56C 3ZN0A 2Q73A 3OMIB 4Q20A 2HSBA 2E3CA 2XLVA 1CGOA 4LF7B 2Q9BA 4EIYA 3AK2A 5K0IA 2PNOA 5F5FA 5D92A 3E8GA 4O4JA 5JH7A 1UG7A 4UV8A 2HJ3A 3JRTA 5B1BC 2LFFA 1YYXA 2V1DA 4DV7O 4XBFA 2VCAA 2WVNA 1ZW3A 1BHBA 4GKKB 3SGIA 2JEUA 3JAMN 4NTAA 3RFRA 3JAKB 2M6YA 1LUVA 1SESA 1SQPH 3CC4V 2AU5A 4XLPF 1F51A 4K8XA 4O7GA 1KUQA 1YITV 2XLMA 3STZC 5ITZA 5L3BA 1TUBA 3HKDA 3RT3C 4NXNB 3EG9A 4I44A 1R3KC 4MTFA 3N2GB 4O2AA 1N33B 1AB3A 5T1DB 1YI2V 4C3BA 3L74H 4I1MA 2Q67A 1EBOA 3NMIA 3RWRD 1VQ7V 1OW7A 2LP7A 1WWPA 2KKWA 5TJ5E 3T6GB 1JR8A 5C8YB 5FCLA 3ZMTA 2LQGA 2R7SA 5DQZA 2L6HA 4DRXA 3U10A 2NR5A 3QTCA 3VYWA 4PDVA 4YJ3B 5A6BA 2QGNA 4X20A 3CRAA 1SF9A 3WB0A 4X62B 1VEWA 2QEXV 1IDSA 2DYRC 1LM3B 4A2NB 1R4TA 1BMFG 2B1GA 2IJHA 3AG1B 3KG2A 1NLXA 3CHXA 2ZXWB 3QNEA 1XI1A 1NZEA 3NDBB 5D5QA 2Y3HA 1PV0A 2BCCH 3RW0A 5KAIZ 4O6NA 4JE9A 3RVYA 3F5WC 5CMUA 2AW9A 3D36A 2HFIA 3CB2A 4CC5A 1GN2A 1CP9A 1YCIA 4DR4B 3JSEO 4FX5A 4ULVA 1ZHZA 1OJHA 1OCRC 3F47A 1EN5A 1F7YA 2FFHA 2P06A 5JSLA 3G6EV 4CDYA 1AI7A 5EIBD 4AL1A 1QLEC 4XPYA 2PYJA 1ST6A 2XL4A 2BC5A 1J95A 1YVWA 1B3QA 4YK5A 4DV4O 1XUQA 4JI7O 3BRCA 4WFHA 3BVOA 3SDLA 3RIPA 4GX1A 1QPUA 1VYIA 2FAPB 2C2AA 3K5MA 3IAYA 1GM9A 2BE5F 3C8GD 3JD2A 2H8AA 1XMQB 3CCLV 1NU9C 4Z2WA 1LE2A 2ZIMA 4FM2A 1VF5B 1KU2A 2WLLA 4AI8A 4DV1O 1T6QA 4RDAA 3W2WA 1HMOA 2QTSA 4DO2A 4EHPA 1R3IC 2DOSA 1G4WR 2R70A 2N05A 3ZG1A 1YVIA 4HFKB 3K3WA 3X2QB 1FXKC 4UVCA 4GKJO 4UCUA 4WCEV 4I7ZB 4FLXA 1R3LC 1Q82W 1KD1W 1ZYRF 1M9NA 1WAZA 3LLIA 4IHJB 1SRYA 5DVWA 4N6HA 2ODMA 3VBBA 2HMZA 4LC1A 1L0NH 2EIJB 1KBHA 5LXTA 4JI5B 2RSEB 4PFPA 4KFMA 1AP6A 4PDMA 2UUHA 2EINC 4FM0A 4X8AA 1MNGA 4C7UA 2G3KA 1D0XA 2Q4PA 4X1KA 2IYLD 2BTQB 1G6UA 4JZ2A 2OTJV 1XHZA 4LF7O 4I0XB 4MQ9F 1Y4CA 2CNWD 1WA8B 2XXAA 5KHIA 4B3TO 1GN6A 4H4KC 4I5SA 3HKEA 1I5NA 3OEOA 3CYOA 1SQXH 3X2QC 1VF7A 3C7JA 1Q81W 3J7AU 3K04A 3ZCCA 2R72A 1IBLO 2ADPA
chains in the Genus database with same CATH topology
1PNKA 1N8RW 2WPDG 3B8NA 3K0DA 1S76D 4MVRA 2IJIA 5H6RA 2P6JA 3E35A 4H33A 4MVZA 3ETGA 1BL8A 4R50A 3OMAB 1VQ4V 4UVBA 1JCHA 4XDLA 2EIMB 5J9PC 3CCRV 1NJIW 1KC8W 3W7TA 5B1NA 3CC7V 2HR3A 2A79B 2F43G 3SYCA 1VQLV 3ABLB 4MTGA 4PA4A 4GX2A 3DTUB 3RBZA 2X6AA 3LNMB 4QIWF 2WLKA 1K97A 2X6BA 3IGAC 3EFFK 2WLIB 3OR6C 4BIUA 2GHYA 2Y48A 2BOCC 2A0LA 1NVPD 2DYSC 3E8FA 3M99B 4MT8A 3ZRWB 1AJQA 4XDJA 1K33A 1NBMG 1NH2B 4LP8A 3CCVV 1Q86W 4FJCC 5LHIA 1AROP 4X89A 3ABUA 4ZKIA 1RM1B 1OZ0A 3BY6A 3F7VC 3E83A 1E1QG 1KP2A 2ITCC 1FXHA 4FPPA 2QKSA 4TT3G 3ZMUA 1K7DA 4RAIA 4N21A 3K9AA 1FS0G 2ZQMA 1AI5A 4ASUG 1R6KA 1W2BU 1H8HG 2XAJA 3CCSV 1AI6A 1I5XA 1W0KG 2HFEC 3F7YC 1JX9A 2MK3A 3AG1C 1IXMA 2Q68A 3D3IA 1CEZA 1B6QA 1XL4A 3ZMSA 3MHSC 4OXSA 1K5SA 4XDKA 3CMAV 1L1FA 2XNDG 5IYDO 2B1IA 2W6JG 4QNHB 2XAHA 4GX5A 2IH3C 3T4DA 3JD3A 1R3JC 4GX0A 4QPJA 4U7OA 2EIKB 4JTCB 5GW7A 1KQSU 4PDRA 1TUEB 2Q69A 1VQPV 1VQNV 4CZZA 1MG1A 1ZWIC 1K8AW 3ZMZA 5B3SC 1JPXA 1OCCC 1MSWD 4MTXA 2QA4V 1YJ9V 2JIZG 1OCCB 2NNUA 4MVOA 3ZIAG 2ATKC 3OEEG 5EBWC 3ZRSA 4Z1MG 2DQ0A 1K4DC 3ZN1A 3CCEV 1K3EA 1YJWV 3SPCA 2WLHA 2EIJC 2EZPA 1AJPA 2QM7A 4PA9A 5CBFA 4KP4A 1M57B 2DWDC 1OCOB 1BHAA 2P67A 2D3OW 1SETA 2DWEC 2JEXA 4JAUA 3WG7C 5CA3A 3W7SA 4PELA 3ZRXA 3QO5A 1QLEB 4L87A 4QPKA 1DF4A 3FB7C 1FFTB 1QR9A 4QE9A 4QJFB 2JDIG 3H01A 1GKFA 4UXNA 3LDEA 2HVKC 4FMTA 4JASA 4J9ZB 3I55V 3LDDA 2QTOA 4MVMA 1K4CC 3HB3B 4R8CA 3E2EA 5DM6V 1GM7A 5C93A 1VQMV 4HYOA 3W7UA 3FKSG 1AR1B 3T4ZA 2WWWA 2KYHA 2DYRB 1KKDA 1GTOA 2WSSG 4X88A 2P90A 4WFEA 2WLNA 2XASA 3SJQC 3ETDA 1W0JG 4RUFA 3SYPA 1NH2D 2EZOA 2H94A 4BW5A 1F23A 4G28B 2AHZA 1GM8A 2JK5C 1Y4MA 4R6ZA 2BOBC 1ORSC 5B1BB 3CP1A 1ENVA 2IH1C 1NVPB 2EBOA 5CN0A 4WFFA 3IFXA 4P9OA 5L3CA 3FYEB 3T1CA 1Q7YW 1V54B 2GSMB 3AG2C 4JTDB 4F4LA 4QE7A 3CD6V 2WLLB 3PJSK 1DF5A 4FK5C 3ZMVA 2X7RB 2HLDG 2ITDC 1OHHG 1M56B 3ABMB 3B8MA 4P9PA 4P2ZA 1K73W 4N23A 2JJ1G 2XOKG 3NXSA 3BEHA 5H6QA 2IJJA 4H37A 5B1AB 2EIKC 4JYBA 2DYSB 2HKOA 5HFMA 3CCQV 3JD1A 3FB8C 3ABKB 1R73A 3OUFA 4RUEA 5IDJA 2K1EA 1AJNA 3STLC 4G27B 2HG5C 1V54C 2A9HA 3SYAA 3E89A 1NQTA 1JOYA 2Q6AA 1HWYA 1VQ5V 3LDCA 1QCEA 3ABLC 4P30A 3W7WA 3JD4A 3E8HA 3AG4B 1K34A 1GK9A 2QE7G 1S77D 3IC7A 4MSWC 4JAVA 3T2MA 4BIZA 2WLMA 4KUMA 3JYCA 2PI4A 5E1AC 2CK3G 4JTAB 2Y69C 3A0RA 3LSSA 2OTLV 3P30A 3LUTB 2Z3YA 4LCUC 3AG3B 1WLEA 4DXWA 1R6NA 2UXXA 1WPXA 5B3SB 1VQ9V 1JJ2U 2Y69B 1UJWB 3OMNB 4RQFA 3ML0A 3AEIA 1PL0A 2AHYA 1MOFA 3CMEV 1PNLA 3QO8A 1OCZC 5CBHA 3JD0A 4PDLA 3JCZA 4WFBV 3G71V 2XAGA 1QVFU 5LGTA 1M90W 3QO7A 1NR7A 1YTFB 1PD3A 4MVSA 5IYBO 2EILB 5KA6A 3ETEA 1H38A 3RVZA 3ASNC 2OCCB 2ZDIA 2ZD9A 2R9IA 1XL6A 2OCCC 1M57C 5B1AC 1KP3A 5KUMA 3WFVA 1QR8A 3ABTA 1P4RA 5FL7G 2ZR3A 1JVMA 3TK1A 1FXKA 3VOUA 5HFLA 1S72V 1EFRG 4EKWA 1G8MA 5EBMC 2Z5UA 1OCZB 2EJRA 2LFSA 5KUKA 5LGNA 2ZDIC 1OCRB 3OEHG 5LHHA 2IW5A 2YEVB 4PA3A 3SPGA 1VQKV 2YSUB 2UXNA 2XAFA 3AG2B 3MD0A 3R65A 2IU3A 2WLIA 1K5QA 1LNQA 2WAMA 2IJKA 4MVQA 1GO3F 1PKXA 1SZTA 2PI5A 3K0GA 5DN6G 3G4SV 1RPOA 3OUSA 4MS2A 1M56C 3AG4C 3SYOA 3ZN0A 3OMIB 4Q20A 1CPYA 4HZ3A 1S0VA 3TCUA 3E8GA 4UV8A 1K92A 1QBZA 5B1BC 3UKMA 2V1DA 1YTFD 3OAAG 1E79G 4XBFA 1I5YA 4MVUA 2HVJC 1BHBA 2JEUA 1S3JA 4HAMA 3FYIB 2WLJA 2P7TC 2X0LA 1SESA 1FXKB 3E86A 3MHHC 4WFGA 4MW8A 5EC1C 5L3GA 3CC4V 5IY5B 4LBEC 1DTOA 1F51A 3ABMC 4MTOA 1YITV 3STZC 5EBLC 1ROPA 4U7NA 1PNMA 1P7BA 1YJNV 5L3BA 1YSCA 1K9MW 4E2LA 2IU0A 5LGUA 1R3KC 1QLNA 4WF9V 4MTFA 1YI2V 3LSQA 1QVGU 2Q67A 3ASOC 1EBOA 2EINB 3HPLC 1S5HC 3GWOA 2LP7A 4TSFG 1VQ7V 3WG7B 2HJFC 4GCZA 2EIMC 5LHGA 2DQ3A 2H8PC 3OW2U 3FB5C 3ZMTA 5LBQA 3ZRVA 5IY5C 3ZRWA 4PDVA 3ASNB 2V7QG 2W6IG 2QEXV 3ZJZA 2DYRC 3W7XA 1BMFG 2B1GA 2IJHA 3AG1B 4R7CA 3K79A 1AI4A 3KG2A 2ZXWB 3QNEA 3RW0A 3TETA 1RPRA 2M7WA 3ASOB 5CMUA 3F5WC 3RVYA 3AG3C 4UVAA 3D36A 3OE7G 3SPJA 1NKDA 5B1OA 2R9RB 2FTKA 3GB7C 1CP9A 2LFRA 4GT1A 4UV9A 1OCRC 1H2GA 4UUJC 5KA5A 3OFNG 3OGCC 3OR7C 4CBCA 3CCMV 2OT5A 3G6EV 1AI7A 1QLEC 3I56V 5BZBA 3CCJV 4TWKA 1V55C 4JYCA 5CBGA 1ORQC 1FXVA 4ZBMA 2XAQA 1J95A 4BAYA 2YEVA 3EHBB 3DGEA 5IYCO 4WFHA 2QM8A 4WFAV 2X6CA 4MW3A 4GX1A 2NLJC 2C2AA 2ZR2A 3E8BA 1GM9A 3ABKC 3K08A 3JD2A 3K03A 3CCLV 4JPRA 4RO2A 2WLLA 4DO2A 1VQ8V 5L3FA 1R3IC 5EK0A 3OM3B 1KECA 5H9CA 3K3WA 3X2QB 2DW4A 1GMGA 1FXKC 4JF3A 1F4MA 2W0FC 4PA6A 4UVCA 4WCEV 1R3LC 5EC2C 1Q82W 1JQ0A 1KD1W 1M9NA 1G4YB 1EZJA 1MABG 3CPWU 1SRYA 1Y66A 5L3DA 4FIPC 3VBBA 4I9WA 1DLBA 4LC1A 3UM7A 3B77A 1M1KW 4RQEA 3K06A 2EIJB 3CXCU 1COWG 2B5UA 1YHQV 2KB1A 3CC2V 3FB6C 3SPHA 1OCOC 4KFMA 4PDMA 3SPIA 4J9YB 2JJ2G 2EINC 4X8AA 1H8EG 1V55B 3P32A 4PA7A 2OTJV 2EILC 5L3EA 1YIJV 1RM1C 1F4NA 1E1RG 4I5SA 1VQ6V 3CYOA 4YXWG 3CCUV 3X2QC 1THZA 4JGSA 1Q81W 2ZXWC 4G2KA 3K04A 3SYQA 3ZCCA 1VQOV 1NR1A 1SERA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OCZ C;  5CBH A;  3K0D A;  4PDL A;  4R7C A;  3KG2 A;  4MVR A;  3FB7 C;  4QE9 A;  4H33 A;  4MVZ A;  3RW0 A;  3TET A;  3LDE A;  3RVY A;  3F5W C;  2HVK C;  3AG3 C;  4MVS A;  4J9Z B;  1BL8 A;  3LDD A;  3ASN C;  2QTO A;  4MVM A;  4R50 A;  3RVZ A;  1K4C C;  3SPJ A;  2ZD9 A;  4R8C A;  4XDL A;  5J9P C;  2R9R B;  1XL6 A;  3GB7 C;  2OCC C;  1M57 C;  5B1A C;  5KUM A;  1OCR C;  2A79 B;  4UUJ C;  3OGC C;  3OR7 C;  1JVM A;  4HYO A;  3SYC A;  4CBC A;  4MTG A;  4PA4 A;  3T4Z A;  3VOU A;  2KYH A;  1KKD A;  4GX2 A;  4EKW A;  1QLE C;  4X88 A;  4WFE A;  5EBM C;  2X6A A;  3RBZ A;  3LNM B;  4TWK A;  5BZB A;  2WLN A;  1V55 C;  2WLK A;  5KUK A;  5CBG A;  3SJQ C;  1ORQ C;  4RUF A;  2X6B A;  3IGA C;  3EFF K;  1J95 A;  2WLI B;  3OR6 C;  4PA3 A;  4ZBM A;  3SPG A;  4BW5 A;  4G28 B;  2AHZ A;  2BOC C;  2A0L A;  3R65 A;  2WLI A;  2YEV A;  2JK5 C;  4R6Z A;  1LNQ A;  2BOB C;  2DYS C;  1ORS C;  3E8F A;  4MVQ A;  2IH1 C;  4WFH A;  2X6C A;  3SYP A;  4MW3 A;  4GX1 A;  4XDJ A;  2NLJ C;  4WFF A;  3IFX A;  4LP8 A;  4P9O A;  3K0G A;  3T1C A;  3E8B A;  3ABK C;  3K08 A;  3OUS A;  3AG2 C;  4JTD B;  4X89 A;  4MS2 A;  1M56 C;  3AG4 C;  4QE7 A;  3SYO A;  4F4L A;  3K03 A;  3F7V C;  2WLL B;  3E83 A;  4HZ3 A;  3PJS K;  4RO2 A;  3TCU A;  3E8G A;  2ITD C;  2ITC C;  2QKS A;  2WLL A;  4RAI A;  5B1B C;  3UKM A;  4P9P A;  1R3I C;  2HFE C;  5EK0 A;  3F7Y C;  4MVU A;  4P2Z A;  2HVJ C;  3AG1 C;  2Q68 A;  3BEH A;  2WLJ A;  4H37 A;  2EIK C;  2P7T C;  2W0F C;  4PA6 A;  1R3L C;  3E86 A;  4WFG A;  5EC2 C;  1XL4 A;  4MW8 A;  5EC1 C;  3FB8 C;  4OXS A;  4RUE A;  3OUF A;  1G4Y B;  4XDK A;  2K1E A;  4LBE C;  3STL C;  4G27 B;  3ABM C;  2HG5 C;  4MTO A;  1V54 C;  3STZ C;  2A9H A;  5EBL C;  3SYA A;  4QNH B;  4GX5 A;  2IH3 C;  4I9W A;  3T4D A;  3E89 A;  3UM7 A;  1R3J C;  4GX0 A;  2Q6A A;  1P7B A;  3K06 A;  4JTC B;  3LDC A;  4PDR A;  2Q69 A;  2KB1 A;  1R3K C;  3ABL C;  3FB6 C;  1ZWI C;  3SPH A;  1OCO C;  4MTF A;  1OCC C;  4KFM A;  4P30 A;  4PDM A;  4J9Y B;  3SPI A;  5B3S C;  3E8H A;  2EIN C;  4X8A A;  2Q67 A;  3ASO C;  4MVO A;  4PA7 A;  2ATK C;  4MSW C;  3HPL C;  5EBW C;  3T2M A;  2WLM A;  1S5H C;  3ZRS A;  1K4D C;  3JYC A;  2HJF C;  2EIL C;  2EIM C;  5E1A C;  2H8P C;  4JTA B;  2Y69 C;  3SPC A;  2WLH A;  3LUT B;  2EIJ C;  3FB5 C;  4LCU C;  5IY5 C;  4PA9 A;  5CBF A;  4DXW A;  3X2Q C;  2DWD C;  4PDV A;  2DWE C;  2AHY A;  2ZXW C;  3K04 A;  3SYQ A;  3WG7 C;  3ZJZ A;  2DYR C; 
#chains in the Genus database with same CATH topology
 2QM4 A;  2VAS A;  4YT8 A;  2CH7 A;  3B8N A;  3C3S A;  4DV2 O;  1S76 D;  3DM5 A;  3BFR A;  2H3O A;  4LF4 O;  4LFA O;  2IJI A;  1FMW A;  3EFO B;  5IYZ A;  5LOV A;  4X1I B;  3LLK A;  4MVZ A;  4P6I C;  1E83 A;  2ARH A;  4I50 A;  3L73 H;  1TWA A;  3MYI A;  1MNE A;  1H9G A;  3CJH B;  4UVB A;  2EIM B;  4FVM A;  1A7E A;  1N33 O;  3L72 H;  5B1N A;  1A32 A;  3AOU A;  4RWU A;  2QDO A;  3SYC A;  1VQL V;  5GON B;  4PA4 A;  2P4V A;  2HV7 A;  5BXZ A;  5L3V A;  3SXK A;  2X6A A;  2WVQ A;  1L8D A;  1N36 O;  1NSG B;  1K97 A;  3RYH B;  2X6B A;  2XXA B;  2WLI B;  4K8Z A;  4BIU A;  2DI3 A;  5JVE A;  2GHY A;  3SJB C;  3HLZ A;  4NXM O;  1GM5 A;  2F66 C;  2DYS C;  3DAG A;  4X62 O;  4BJ5 C;  3H2V A;  2A0B A;  1ZHW A;  3TJT A;  1JFF A;  5A6J A;  1I94 O;  1ZU5 A;  4CH3 A;  5D91 A;  4X89 A;  1RM1 B;  2CTR A;  2R9A A;  3F7V C;  5IYZ B;  1LUW A;  4N21 A;  1HNZ B;  2ZQM A;  4DR4 O;  1AI5 A;  1I08 A;  2RNB A;  3B0U X;  2CE4 A;  2XAJ A;  3S9O A;  2LJ2 A;  1JX9 A;  4OIO F;  2MK3 A;  4XPX A;  5DLJ A;  5KYU B;  5GPG B;  2Z0A A;  1XRE A;  3FFQ A;  2JS3 A;  1B6Q A;  2D4U A;  4AQY O;  3LS0 A;  256B A;  3GM2 A;  3QMK A;  3CMA V;  1VF6 C;  4X66 B;  2XND G;  4JV5 O;  1K04 A;  5IYD O;  1HR0 B;  3RYH A;  4GX5 A;  4U5C E;  1R3J C;  4GX0 A;  1SC5 B;  4QPJ A;  4TOI A;  3EXA A;  1KQS U;  2A0U A;  2J45 A;  1VQN V;  3TXQ A;  1FJG B;  2QJ1 A;  4CZZ A;  4IL6 Z;  5AG2 A;  2PUS A;  1CPQ A;  3GM3 A;  4MTX A;  4CIH A;  2QA4 V;  3V5Y A;  2F4V O;  4PFO A;  4WAB A;  5JCO C;  2NNU A;  4PJL A;  1FAP B;  4MVO A;  2ATK C;  5EBW C;  4OIQ F;  1XMQ O;  2DQ0 A;  1K4D C;  5EZY A;  1IXB A;  1XEQ A;  4X65 O;  4GEH A;  2UUA O;  3SNH A;  2XSE A;  3SPC A;  2XL8 A;  3NMJ A;  3JAS A;  3M79 A;  3DSQ A;  4PA9 A;  4KP4 A;  1EN6 A;  4UCT A;  3KPH A;  2P67 A;  2LO1 A;  1DOV A;  2DWE C;  5F28 E;  2JEX A;  4JAU A;  4E0I A;  1OQC A;  1XNQ O;  1ZHX A;  1MQV A;  1G5Z A;  3E70 C;  4LDR A;  3QO5 A;  1O3U A;  3LEO A;  3UO3 A;  3FB7 C;  3WB2 A;  3IQ6 A;  1FKA O;  1GKF A;  3TOL A;  3ZWI A;  4FMT A;  4JI8 B;  4J9Z B;  1YZB A;  3LDD A;  1NU7 D;  4MVM A;  5KHH A;  3E2E A;  1WJZ A;  1NBB A;  3CSK A;  3S29 A;  1UFI A;  1VQM V;  3LAY A;  2UXD B;  4FFK A;  4HYO A;  3L8I A;  1SKV A;  2E87 A;  2HS5 A;  3U2L A;  4CJG A;  1GTO A;  3ZHR A;  2RQ6 A;  1MA1 A;  2P90 A;  2YDE A;  4DR5 O;  4NB5 A;  1W0J G;  3ETD A;  1NH2 D;  5E33 A;  2L6F A;  3NYM A;  4G28 B;  2NUT B;  3JAS B;  1Y4M A;  4DVZ A;  5JVD A;  1NVP B;  1VLS A;  4KHP O;  1BDJ B;  4G0H A;  4O6Y A;  5JJN B;  4DV7 B;  5L3C A;  3T4R A;  3AK1 A;  4KL1 A;  4JI3 B;  4FLU A;  4DW0 A;  4J42 A;  4JTD B;  2OYQ A;  3CD6 V;  2J9V A;  2WZL A;  1GH6 A;  5LMN O;  3ZX6 A;  3GWK C;  2OWO A;  2D5R B;  3ZMV A;  2HLD G;  2ITD C;  5JRA A;  4J30 B;  4K0K B;  3B71 A;  2Y39 A;  2YVK A;  4X20 B;  4N23 A;  2GDS A;  2XUM A;  3V5X A;  1O87 A;  4EWC A;  4IYI A;  4DV3 O;  4KNV A;  4JYB A;  2DYS B;  4NXN O;  1Q6H A;  2HKO A;  2HZ8 A;  2PX0 A;  3P3P A;  2ZPA A;  3G4X A;  4J41 A;  4JZG A;  2VC9 A;  3SJA C;  1N36 B;  3GEH A;  5IDJ A;  1LVK A;  2XS8 A;  3ZVR A;  1D1C A;  3STL C;  2F23 A;  4G27 B;  1NU1 H;  3K9S A;  1QKR A;  3VQX A;  4YWQ A;  1RJ9 A;  3QVZ A;  2NUT A;  1QCE A;  1Q6I A;  4D7S A;  3MBG A;  3N27 A;  4P30 A;  5JVD B;  1PM9 A;  3NYJ A;  3JD4 A;  3VQW A;  1N1C A;  4JI1 O;  4KNW A;  5JJE B;  1B06 A;  1YF2 A;  4TV9 A;  3J80 N;  2PBE A;  4KUM A;  3JYC A;  1Q0K A;  2H7V C;  1XZQ A;  2GDC A;  1HNZ O;  5LL6 Y;  4IIJ A;  3US6 A;  2FB5 A;  1MMM A;  3DE8 A;  1WLE A;  1ZHT A;  4DXW A;  2EPO A;  1JJ2 U;  1UJW B;  1SR2 A;  2FYU H;  4DR1 B;  3AEI A;  1PL0 A;  3U9J A;  4GZR B;  4DUZ B;  5EHH A;  5CA1 A;  1SA0 B;  4DOZ A;  4C7O A;  3G4Z A;  4I55 A;  1Z5Z A;  4O4L B;  4WFB V;  4PJJ A;  3G71 V;  2J8W A;  4B3M O;  3U8P A;  4LWS B;  3OTO B;  5DED A;  1PD3 A;  2KW3 C;  3H1H H;  4LF8 B;  2ZXR A;  2LSE A;  2Q7H A;  1IBK B;  2ZDI A;  1FJG O;  3U8V A;  4G7Z F;  4DR2 O;  3AK3 A;  1XL6 A;  3DE9 A;  3KYI A;  1M57 C;  5B1A C;  3DZA A;  2F4V B;  1QR8 A;  3ABT A;  5DEC A;  2A6H F;  1FXK A;  2ADQ B;  3TJ5 A;  4NTY A;  4E7Z A;  1WGW A;  5EBM C;  5L0D A;  2OIG A;  2Z5U A;  4XEK A;  2LFS A;  5KUK A;  4ZOL A;  4QI2 A;  4PA3 A;  5D5P A;  2XAF A;  3GOD A;  2WLI A;  3T9O A;  1LNQ A;  5L0J A;  2IJK A;  1GO3 F;  4D4N A;  3B0V C;  2R25 A;  3APO A;  1IZM A;  3PMR A;  4C7O B;  1GRJ A;  1OXB A;  2YLI A;  5GTI Z;  3HNI A;  3KKB A;  5KYY A;  3A9C A;  2A06 H;  1CXZ B;  1J5E O;  1K92 A;  3OA1 A;  2Q9L A;  5A6K A;  3UKM A;  2A68 F;  1YTF D;  4JYY A;  5K1P A;  3AQC A;  3TOM A;  5EGY A;  2G62 A;  3FYI B;  4TQD A;  3H2U A;  2MWQ A;  2P7T C;  4J7J A;  1M2V A;  3C90 A;  1RCP A;  2LFD A;  1FXK B;  1M6T A;  4EUK B;  4WFG A;  2PX3 A;  4MW8 A;  2QWQ B;  5L3G A;  4IJJ A;  5IWA B;  2DMX A;  4CC6 A;  5IY5 B;  4LBE C;  1DTO A;  4I50 B;  2WA3 A;  4CS7 A;  2R03 A;  2IM9 A;  2UUI A;  3CJH A;  5EBL C;  2IXM A;  3O65 A;  1P7B A;  4JJG A;  4QGP A;  1K9M W;  2H7O A;  1QLN A;  2WVO A;  3M4B A;  4QDL A;  5GON A;  5KYX B;  4FZ1 A;  4J10 A;  5BMV B;  1IW7 F;  1Y76 A;  3HPL C;  3RYC B;  3WG7 B;  1PPJ H;  2UUB O;  4Q4Z F;  1IBL B;  3E22 A;  3SZR A;  4GCZ A;  3FAP B;  4UCR A;  5EZY B;  5CB4 B;  2CTW A;  5H2F Z;  4K0K O;  4LFA B;  3ZRV A;  5IY5 C;  4AK9 A;  3U9M A;  1A0B A;  3O9O A;  3KL4 A;  2ZIN A;  1HW7 A;  4FES A;  3ASN B;  3ZJZ A;  3SXM A;  2ASR A;  3W7X A;  1NTZ H;  1AI4 A;  1E85 A;  4GUN A;  1TA8 A;  2O57 A;  3TET A;  1RPR A;  3SR2 C;  3DC5 A;  2KGO A;  2EUL A;  1GAX A;  2LFR A;  3Q7L A;  4JI1 B;  4A5U B;  4OD5 A;  4RD9 A;  1KTM A;  3OGC C;  1YLM A;  3LNR A;  2XM0 A;  3GOR A;  1WB7 A;  2YXH A;  1U97 A;  4YL1 A;  4TWK A;  3RYF B;  4JYA O;  4CIP A;  4HBN A;  1Z7Q c;  1FXV A;  2XAQ A;  4FLW A;  2MHR A;  1D1B A;  3VQY A;  2C03 A;  4DUZ O;  1QHT A;  2QM8 A;  4WFA V;  3GWN A;  2OOC A;  1PL4 A;  4H13 B;  2J0W A;  2ZR2 A;  1NFO A;  3IQC A;  3WHN A;  3E8B A;  3IQ5 A;  4OIP F;  1H2K A;  1D2D A;  2JVD A;  1KB9 F;  4RO2 A;  3M4C A;  4CJO A;  4J7K A;  1HNW O;  3JYY A;  2LQT A;  3B2E E;  3GWL A;  3HNK A;  5JH7 B;  1N34 B;  1VQ8 V;  5L3F A;  1NFN A;  4JC7 A;  1X59 A;  1TFK B;  3ZC4 A;  4BJ5 A;  1PD1 A;  3FAV B;  4JF3 A;  2GBO A;  4E18 A;  1F4M A;  2W0F C;  1AVM A;  2QWO B;  2KG7 A;  4PJM A;  1LI5 A;  4AHC A;  1Y66 A;  4L8J A;  2RMK B;  2OKU A;  3K1H A;  4U9E A;  4I9W A;  1DLB A;  4XPW A;  3CXC U;  1VK5 A;  2DB4 A;  2B5U A;  1JAF A;  2UUA B;  4EBJ A;  3SPH A;  4U5H A;  5DS5 A;  3APQ A;  3T1H B;  2AVK A;  1MZE A;  4DW1 A;  5COG A;  3AG7 A;  1O9H A;  3KKY A;  5BUO A;  4D6T H;  4TV9 B;  1VF6 A;  1D1A A;  5L3E A;  1YIJ V;  3WB1 A;  1RM1 C;  4LLE A;  1VQ6 V;  4DR3 O;  1WOL A;  3CCU V;  2Q9A A;  4JI4 O;  1T5O A;  1I7F A;  3T6J A;  3RF3 A;  5COF A;  3AGT A;  3HKK A;  4G2K A;  4JI8 O;  1BZK A;  3MDS A;  2FKX A;  1PNK A;  1SER A;  3K1I C;  3K0D A;  3G80 A;  3Q6N A;  1SA0 A;  1T9K A;  4MVR A;  2Y0I A;  1BT8 A;  4H33 A;  1HNX B;  3C62 A;  3IPM O;  3JSL A;  2V3C C;  1K40 A;  1BL8 A;  3OMA B;  3C3T A;  2PFD A;  4E4E A;  2CUG A;  3W7T A;  2KC3 A;  4XLN F;  2J9W A;  2GFH A;  4Z9I A;  2LGQ A;  4ZI7 B;  3ABL B;  4MTG A;  4GX2 A;  3DTU B;  5T3W A;  4CSA C;  1RFY A;  2KQX A;  4B3T B;  4QIW F;  4KHP B;  4YT4 A;  4ZHQ A;  3PCV A;  3RQG A;  3IJ4 A;  3RQE A;  3EFF K;  1RJ9 B;  3OR6 C;  1NVP D;  3U2M A;  3IQT A;  4F6R A;  3E8F A;  3FXH A;  4MT8 A;  3ZRW B;  4ER9 A;  1AJQ A;  4LF5 O;  4ZIB A;  1BQ0 A;  4OGQ B;  4XDJ A;  1K33 A;  4DV2 B;  1NH2 B;  4BJ1 A;  4LP8 A;  1Q86 W;  2R7Q A;  5LHI A;  4PI0 A;  5B3I A;  4CBE A;  1URF A;  1FPO A;  1OZ0 A;  1C17 M;  2W4B A;  3JAW A;  3JRM O;  4BPM A;  3BY6 A;  4DV3 B;  1OXK A;  4CH5 A;  1KP2 A;  2YI9 A;  1J8M F;  1FXH A;  1SQF A;  4FPP A;  4TT3 G;  4W8P A;  1K7D A;  4N06 A;  3UMI A;  3ZTZ A;  1EM1 A;  2J9B A;  2D2C B;  2HFE C;  1I5X A;  1W0K G;  4UFZ A;  3TGU H;  5LMU B;  4XWJ A;  1SS3 A;  4LFC B;  3DWW A;  5CIV A;  2Q68 A;  3D3I A;  4Q7C A;  4I55 B;  4PJN A;  1A41 A;  1MMD A;  4LWS A;  3MHS C;  4OXS A;  3K7D A;  3EGX B;  2NSG A;  2YIB A;  1NI8 A;  2B1I A;  1T5E A;  5GTH Z;  4JRZ A;  1ZVZ A;  4JTC B;  2QWR B;  5KMG A;  5A2Q N;  1VLT A;  2Q69 A;  2AWC A;  3MLG A;  3S28 A;  3MAQ A;  2FML A;  1I94 B;  4F6R B;  5FZT A;  3ZMZ A;  1M5I A;  1JPX A;  5B3S C;  1MSW D;  1ORJ A;  2YS8 A;  4O79 A;  2M64 A;  3EQL F;  1AIL A;  2Q3T A;  5J2U B;  1Q5O A;  3OEE G;  4Z1M G;  2UXC O;  2L7A A;  3J06 A;  3UR3 C;  3G50 A;  4ZOL B;  4B3R B;  5KHJ A;  1HNW B;  1Y76 B;  5COM A;  2BTQ A;  3ZED A;  3CAX A;  2OU6 A;  3RYC A;  1YJW V;  2RD9 A;  5KAF Z;  2WLH A;  2EIJ C;  1N34 O;  3UO2 A;  1M57 B;  1R1B A;  1OCO B;  4YIP A;  4IAR A;  3OTO O;  1FYJ A;  2W4M A;  4IWB A;  2L6L A;  4LDQ A;  1CGN A;  4NVP A;  4PEL A;  3ZRX A;  2RDC A;  4R32 A;  1DF4 A;  4AQY B;  1FFT B;  4QE9 A;  5KYY B;  4EB6 B;  2JDI G;  3H01 A;  2CW0 F;  1HR0 O;  3C63 A;  3JCU Q;  4JZA A;  3LJB A;  1GN4 A;  1SZX A;  4X1I A;  4JAS A;  3LEV A;  1K4C C;  2XTA A;  5KMG B;  4EBK A;  3W8I A;  2XS1 A;  2YXY A;  1M2V B;  2I8B A;  3JAT A;  1BR2 A;  4DV4 B;  2WWW A;  3TJ6 A;  4DK1 A;  4OIR F;  1KKD A;  1OR2 A;  3WAQ A;  4X65 B;  1TKN A;  2EPM X;  2E5L B;  3OTF A;  2E74 B;  3SEO A;  4JCZ A;  4JVS A;  2XAS A;  2ZE8 A;  4AX2 A;  3SJQ C;  2Q7E A;  4RUF A;  3RYF A;  1ZL8 A;  2EZO A;  3B4S A;  3SXY A;  4J11 A;  4JI4 B;  1US6 A;  4X1Y B;  4R6Z A;  1PP9 H;  3CP1 A;  3JCU Z;  2IH1 C;  2IOQ A;  1J5E B;  1VAR A;  1S05 A;  1F1M A;  4WFF A;  3IFX A;  4NTW A;  1JFF B;  4LF6 O;  3FYE B;  2V26 A;  4ICG A;  1Q7Y W;  2HUJ A;  1V54 B;  1HNX O;  4U9D A;  3AG2 C;  1XHX A;  2P61 A;  4K1O A;  1SQV H;  4BEM J;  2OIE A;  4FK5 C;  4J80 A;  2KQ9 A;  3ZHU A;  1FAF A;  1OHH G;  3L70 H;  1BBH A;  2R7V A;  3ABM B;  3S27 A;  4PI2 A;  1B04 A;  2XOK G;  3U0C A;  3K66 A;  1BS3 A;  2P1A A;  2IJJ A;  3FAV A;  2EIK C;  2GTA A;  3HTK C;  1OKK A;  2WZF A;  2QKC A;  5HFM A;  4LR3 A;  2VCB A;  5L0H A;  5LYJ B;  3ZQY A;  4J7Z A;  3ABK B;  3FDQ A;  3OUF A;  3AGU A;  1PD0 A;  4WGY A;  2A9H A;  5DS6 A;  4B7K A;  2YUA A;  1VQ5 V;  2NUP B;  4EEQ A;  5CA0 A;  4X1Y A;  4LF5 B;  2EPN A;  2PTM A;  4DYL A;  2L9J A;  1CPR A;  4CS8 A;  4UCO A;  1P49 A;  3E8H A;  1RKE B;  1Q0G A;  1GK9 A;  2QE7 G;  1X4T A;  4UB8 Z;  2PYL A;  3T2M A;  4BIZ A;  1XWJ A;  3FAJ A;  1S5L Z;  5LMN B;  3QVY A;  2E75 B;  3H1K H;  3UCS C;  3A0R A;  3LSS A;  3P30 A;  3RYI B;  2CTQ A;  2Z3Y A;  1SZI A;  1HW2 A;  3SXZ A;  1WPX A;  5B3S B;  2C04 A;  2Y69 B;  3OMN B;  2ZIO A;  1PNL A;  2F95 B;  3DXR B;  3QO8 A;  3JCZ A;  1E2X A;  2HJM A;  5A69 A;  4FZ0 A;  5BQG A;  2HP8 A;  2W0X A;  4PAC A;  5LYJ A;  1NR7 A;  2YI8 A;  1N4C A;  2Z15 A;  1VOM A;  2EIL B;  1T01 A;  1H38 A;  4YHH O;  2UUC O;  2XLE A;  4BG0 A;  2YIC A;  2ZD9 A;  4TUY A;  2YZS A;  4JI6 O;  3DXJ F;  4DVY P;  1Q8I A;  2XLO A;  1KP3 A;  3WFV A;  4NTF A;  2MYS A;  5FL7 G;  2QWP B;  2ZE5 A;  1XNR O;  3TK1 A;  4NXM B;  2UXC B;  2KG7 B;  2OG2 A;  4UCS A;  3HR0 A;  2RN9 A;  1G8M A;  3NYL A;  2AXT Z;  3ECS A;  3JAR A;  2PZS A;  2ZDI C;  4IT5 A;  3B40 A;  4AE4 A;  2YEV B;  4ZHQ B;  3MD0 A;  3R65 A;  4DR1 O;  3M15 A;  1K5Q A;  4YT2 A;  3BRJ A;  1MND A;  4K3A A;  3KCY A;  5AC5 A;  3NR7 A;  1JRA A;  4C3D A;  5KYN A;  1AVO B;  5F2V O;  1ZUQ A;  1DOW A;  3DXR A;  3K0G A;  5DN6 G;  3G4S V;  1D0Z A;  3CRQ A;  1RPO A;  3OUS A;  1VMG A;  2PP4 A;  1G1X B;  3SYO A;  1Q0F A;  2ILM A;  3KMI A;  2GAQ A;  4CS9 A;  1CPY A;  2LW7 A;  1S0V A;  4JIO A;  1VP7 A;  2ZNI A;  3JAW B;  2AGA A;  3X1O A;  4DR2 B;  1QBZ A;  1E79 G;  2LW1 A;  4DK0 A;  3VM6 A;  2HVJ C;  1HMD A;  5BY1 A;  3QG5 A;  2KK1 A;  4DRI B;  3ZIB A;  1R5I D;  1S3J A;  4HAM A;  3T1Y O;  3TQO A;  2WLJ A;  1WB8 A;  1KNY A;  4A4A A;  2J9U A;  2R02 A;  2E5L O;  3E86 A;  3MHH C;  1D0Y A;  1QZX A;  1W59 A;  2CGO A;  2KNH A;  4XTK A;  1D5N A;  1IX9 A;  3ABM C;  3A2F A;  3I5D A;  3EGX A;  3JAR B;  1ROP A;  4JI0 B;  1PNM A;  3FOO A;  3S84 A;  1NZ6 A;  2CCY A;  1YSC A;  4DBR A;  2Y4U A;  5LGU A;  3ITF A;  4N6C A;  5LP6 C;  2Q4F A;  1YDX A;  1RSO A;  1S5H C;  3GWO A;  4M63 A;  2B9Z A;  2YL0 A;  3CEX A;  5B66 Z;  2HJF C;  4DUY B;  2ZKO A;  4YJW A;  2EIM C;  3SJC C;  2IBF A;  4J32 B;  3OW2 U;  3JAL A;  3ZHS A;  5LBQ A;  2XLW A;  1U89 A;  1Y74 A;  1MZF A;  1FTS A;  3ZRW A;  4CS2 A;  5T3T A;  3JSZ A;  3LSU A;  1VB5 A;  5KHK A;  4EBB A;  3K79 A;  1JOG A;  2R7T A;  4UDV A;  5LA6 B;  3EH2 A;  2HEP A;  4O4L A;  2XT9 A;  2UXD O;  3ASO B;  3OGI B;  2QTV A;  3AG3 C;  4UVA A;  4I4T B;  2J7P D;  5AC4 A;  1SMY F;  3OE7 G;  4H54 A;  3KCX A;  3SPJ A;  4BJ6 C;  1NKD A;  1O9G A;  2R9R B;  2L81 A;  3GAN A;  4GT1 A;  4CS8 C;  4Z9J A;  1FFT C;  1H2G A;  1WPB A;  5KA5 A;  4YT5 A;  3OFN G;  3OR7 C;  1H2M A;  2OT5 A;  1TAE A;  3M1C B;  1XMO O;  1G4U S;  5IT9 N;  1RP3 B;  5BR8 B;  1BGY H;  4H44 B;  3J81 N;  3JAL B;  3GEI A;  2KSD A;  4U5E E;  3BA8 A;  4CS4 A;  1IBM B;  3EHB B;  5IYC O;  2VH3 A;  4WJ0 A;  2X6C A;  1H2L A;  3K5N A;  2OEV A;  1S7Z A;  5J2U A;  4GYT A;  4CX9 A;  3PHF 2;  3PN1 A;  5LMU O;  3ABK C;  2I15 A;  3B9Q A;  4BIO A;  1TWG A;  1M4U A;  3K03 A;  1ZAU A;  3BHP A;  5LA6 A;  2J7P A;  4JPR A;  4DR6 O;  2ZE7 A;  1SYQ A;  3Q6M A;  1YEW A;  2LGW A;  4JI6 B;  1YZC A;  1ZZP A;  5DQT A;  3ZQV A;  2CGN A;  5H9C A;  1MMN A;  3G6B A;  4ONS A;  1YA9 A;  1XNR B;  3HJC A;  3D36 C;  1SQG A;  2DW4 A;  3POV A;  2XM4 A;  2NG1 A;  3GM1 A;  4PA6 A;  4DRH B;  3KH2 A;  3RKO F;  5EC2 C;  1G4Y B;  4I1O B;  1EZJ A;  1MAB G;  1OV9 A;  2A7W A;  4FIP C;  2CYD A;  1M1K W;  3ZHV A;  3B77 A;  3K06 A;  4B3R O;  1COW G;  3C8G B;  1HDJ A;  1L0L H;  3FB6 C;  3I4U A;  4KBL A;  2NUP A;  1PV3 A;  4FLT A;  3I5Q A;  3HNJ A;  2OQM A;  5KYX A;  4TV8 A;  4PA7 A;  2ZM6 O;  4Q6G A;  2JD3 A;  2VQE O;  1O5H A;  1NT2 B;  2CAZ C;  2QLA A;  1E84 A;  1R6T A;  1WP8 A;  2B0H A;  4AL0 A;  2LP4 A;  1F4N A;  1AR4 A;  1E1R G;  3E22 B;  5JT4 A;  4B3M B;  3CRR A;  3TUL A;  4YXW G;  2IXN A;  2P4K A;  1YJG A;  4CS3 A;  1THZ A;  4JGS A;  1BE3 H;  3CRC A;  2PY5 A;  2CTP A;  2ZXW C;  1YYJ A;  1T6U A;  1VQO V;  1NR1 A;  2V4D A;  1N8R W;  2WPD G;  2P7V A;  3EHN A;  2NSF A;  1SQB H;  3GVM A;  4NTB A;  4LFB O;  2Y4T A;  1OW8 A;  1NTM H;  3ETG A;  4R50 A;  2W9Y A;  4X0R A;  1VQ4 V;  4XDL A;  5J9P C;  1TGO A;  3HKC A;  3T1H O;  4YIO A;  1KC8 W;  1Z63 A;  1ORY A;  3CC7 V;  2PF4 E;  4NY3 A;  2F43 G;  4LNU A;  2UXB B;  1JJO A;  4LF9 B;  2RJZ A;  3LNM B;  4PR9 A;  5KX5 B;  2WLK A;  3KZI Z;  4LF6 B;  3BCC H;  2W45 A;  2HV6 A;  2Y48 A;  5CA0 B;  2A0L A;  2Q7G A;  4AE4 B;  2YQY A;  2CGE A;  2Q7R A;  3W4Y A;  1M93 A;  1SF8 A;  4D4X A;  2ZE6 A;  2HSQ A;  3ZHQ A;  2JRI A;  3CCV V;  4B3S O;  2WB7 A;  2KSF A;  4DV6 O;  2AZ2 A;  1Q3E A;  3U11 A;  2WA4 A;  1I0H A;  2F93 B;  3E83 A;  4X9Q A;  3IHU A;  4OIN F;  5F5H A;  3W8H A;  3U3F A;  4MND A;  2QKS A;  4DV5 O;  3EZH A;  5FLX N;  4ASU G;  3K9A A;  1FS0 G;  2XLH A;  1E86 A;  3ZHT A;  3CCS V;  1AI6 A;  3F5T A;  3F7Y C;  4EFB A;  1HP8 A;  4ABM A;  1AUE A;  5JWP A;  2JX0 A;  1XL4 A;  1RKC A;  4IYH A;  1OKK D;  3CEI A;  3R66 A;  2XAH A;  2IH3 C;  1FR0 A;  3RYL A;  2EIK B;  3ZBH A;  3AQB A;  1MG1 A;  1VIB A;  1K8A W;  1K05 A;  1OCC C;  1YJ9 V;  5E3C A;  1TFO B;  2JIZ G;  2P0N A;  2QE9 A;  3ZIA G;  3L8J A;  1JMW A;  5B5E Z;  2M4E A;  3NMK A;  3CE2 A;  3CCE V;  2BE3 A;  2EZP A;  3JTL O;  3CX5 F;  3QVN A;  3QW1 A;  2QM7 A;  5CBF A;  1QQC A;  2QUP A;  2DWD C;  4LFC O;  3V5Z A;  2RCV A;  1BHA A;  3NKD A;  3HKB A;  4GYC B;  2HMQ A;  3H1L H;  1HE9 A;  2R7W A;  3W7S A;  3D8C A;  1QLE B;  2G38 A;  4WBN B;  3OD4 A;  2BSK A;  1EA8 A;  5IJ0 A;  1QQ3 A;  2LIG A;  4UXN A;  4B08 A;  4BW9 A;  2HVK C;  2X0C A;  4O2B B;  2QTO A;  3N0T A;  1Z3I X;  4OPA A;  4I4T A;  2ICW G;  1LIH A;  5DM6 V;  1YDI A;  4NQF A;  4H0L B;  4OPH A;  5C93 A;  3W7U A;  2YHS A;  3FKS G;  1AR1 B;  3T4Z A;  1TR2 A;  1EQ1 A;  4ZI7 A;  4ULW A;  1TVK A;  2WLN A;  4JEB A;  2G3V A;  2JGD A;  4YJ2 A;  2GTS A;  2JPU A;  2P5O A;  4BW5 A;  1F23 A;  4IRU A;  2AHZ A;  1W2W A;  1GM8 A;  1U6H A;  2JK5 C;  3UNG C;  3VF0 A;  3WOD F;  2BOB C;  4YY3 B;  4XEV A;  2EBO A;  3HKB B;  5CN0 A;  2VQF O;  4NC3 A;  1KU9 A;  4G7H F;  2GWW A;  3I5P A;  3T1C A;  2Y3D A;  4PK4 A;  4BJ6 A;  3ATP A;  3RN4 A;  1ZSP A;  2GSM B;  4F4L A;  1EN4 A;  4BR6 A;  5KYW A;  3FD9 A;  2YLD A;  1JPN A;  3F46 A;  3QF7 A;  1M56 B;  1Z2G A;  1AR5 A;  1H6G A;  3B8M A;  2L6G A;  4PJ0 Z;  1K73 W;  5L0C A;  2JJ1 G;  5H6Q A;  4IAQ A;  3T6B A;  4JI2 B;  1Y67 A;  3BAB A;  1IZ3 A;  1N32 B;  2CDQ A;  3L9D A;  4IGG A;  4JUR I;  1S5J A;  3RGB A;  1LS4 A;  1KMI Z;  4JW1 A;  4PV1 B;  3JD1 A;  1RMV A;  1ZTE A;  1XBL A;  3Q7G A;  4RUE A;  1EZV H;  1TVK B;  2UU9 O;  2OEX A;  2HG5 C;  2J0X A;  2R7X A;  2JGD B;  1Q43 A;  4YJ2 B;  4CDV A;  2Q6A A;  1HWY A;  2VS0 A;  3LDC A;  3OT7 A;  4DR7 O;  4OX9 O;  1LPE A;  1Z5V A;  3W7W A;  2CNW A;  5CI8 A;  3N2Z B;  3S90 A;  1S77 D;  3K5O A;  2KJG A;  4MSW C;  4U5F E;  3FOP A;  2WLM A;  5C8Y A;  4LER A;  4U5B E;  2PI4 A;  4E17 A;  5E1A C;  2CK3 G;  4JI5 O;  2Y69 C;  2OTL V;  2Y3G A;  2EJ7 A;  4W8K A;  1QSP A;  3AG3 B;  3ICX A;  4FLV A;  1R6N A;  3SP1 A;  2YIA A;  3CWB H;  2Y3B A;  1OW6 A;  1MOF A;  1G8X A;  1L3P A;  4N4W A;  3DC6 A;  3ZTM A;  5CBH A;  4PDL A;  4YN0 B;  4XEF A;  1P84 F;  2XAG A;  3NKE A;  1GN3 A;  1VTM P;  1KKC A;  4G7O F;  5LGT A;  3QO7 A;  5JUA A;  5IYB O;  4MVS A;  4EB6 A;  3Q4H A;  5KA6 A;  1PCX A;  2ZXO A;  4ZLC A;  3ASN C;  2OCC B;  4JCH A;  2R9I A;  2R7R A;  4J7Y A;  5L3Q A;  2ETS A;  4I9Q A;  1JVM A;  3VOU A;  5EIB C;  5H5N A;  5HFL A;  1EFR G;  2IXP A;  3MX3 A;  1YA7 O;  3JAT B;  4EKW A;  1V9P A;  3CS5 A;  1OCZ B;  2TMV P;  3EPV A;  2QSA A;  4K0D A;  5LGN A;  3DKA A;  1OCR B;  2AP3 A;  2K9P A;  5LHH A;  5KX5 A;  2IW5 A;  4Z1V A;  3SPG A;  2N04 A;  2HJD A;  3AG2 B;  2DN9 A;  3C8G A;  2IU3 A;  1P7G A;  1ZL8 B;  3DJU B;  5J2T B;  4MVQ A;  1EI7 A;  4TV8 B;  1TWH A;  2ZNJ A;  2PI5 A;  5EYP B;  2A6E F;  3DM9 B;  1WTY A;  4MS2 A;  3AG4 C;  4LH7 A;  4HZ3 A;  4YHH B;  2UUC B;  3TCU A;  1L7C A;  3U5S A;  4KC9 A;  5AGF A;  4DJ9 A;  3OAA G;  4DV0 O;  4U5D E;  1I5Y A;  4MVU A;  5A6A A;  1Q6U A;  1QU7 A;  3UMH A;  1AP5 A;  1U96 A;  1A7V A;  2O9X A;  2X0L A;  2DGJ A;  5EC1 C;  4LAC B;  5L0F A;  2NN4 A;  2X51 A;  5L0G A;  2QWN B;  2WZG A;  1WAS A;  3LS1 A;  4MTO A;  4U3J A;  5A6B D;  1MSD A;  1VYK A;  4U7N A;  1LI7 A;  5CI9 A;  3CZ6 A;  1YJN V;  1Y6D A;  2VQE B;  4O4I A;  4E2L A;  2IU0 A;  1HE1 A;  2VB6 A;  4WF9 V;  4LNU B;  3LSQ A;  1QVG U;  3ASO C;  5E2Q A;  3RFY A;  3NG1 A;  2EIN B;  1RKE A;  4TSF G;  1Z6A A;  2AWY A;  3A11 A;  3MFN A;  4BEJ A;  3H65 A;  3HKE B;  5LHG A;  2DQ3 A;  2H8P C;  1FFH A;  3JSN A;  1FFX B;  3FB5 C;  2FL4 A;  4LLC A;  4LFB B;  2IM8 A;  3RYI A;  2ETN A;  2QY9 A;  1APC A;  2Q8V A;  1BQZ A;  2DE0 X;  3FHD A;  2V7Q G;  2YC0 A;  2W6I G;  2HHH B;  1ZLZ A;  4R7C A;  4X64 O;  4PD4 F;  2IXO A;  3A0H Z;  2UU9 B;  2M7W A;  1UPG A;  5HSW A;  1XIL A;  4L6R A;  3C18 A;  2UXB O;  4FLY A;  5FNV A;  4U3J B;  3K58 A;  1LE4 A;  4DR7 B;  1GGQ A;  4LF9 O;  3O39 A;  4OX9 B;  3U3B A;  5B1O A;  4GQH A;  2FTK A;  3GB7 C;  1JMK C;  4TUY B;  4UV9 A;  3EGD B;  4UUJ C;  4OD4 A;  4CBC A;  1WN7 A;  2VCC A;  3CCM V;  2A69 F;  3O6X A;  2AZ0 A;  1BR1 A;  4K7B A;  4DUY O;  3I56 V;  5BZB A;  3CCJ V;  4FWV A;  1V55 C;  4JYC A;  5CBG A;  1LKX A;  1ORQ C;  3B09 A;  4ZBM A;  2YWA A;  3BAA A;  1C03 A;  4JKV A;  3V7O A;  2L35 A;  4W4L A;  4BAY A;  3OWT A;  3HNL A;  3VAY A;  3G67 A;  4B6I A;  2YEV A;  2VRZ A;  4HNA B;  5JQG A;  3DGE A;  4MW3 A;  4DBQ A;  2NLJ C;  2YLG A;  2JS5 A;  4UB6 Z;  5KLV H;  3CQZ A;  3A8T A;  3EVK A;  3K08 A;  3EH1 A;  3CSX A;  1YZA A;  4LDK A;  2Q0A A;  3B29 A;  4QI0 A;  5BQH A;  5KYW B;  3CXH F;  2BL2 A;  4UCV A;  4NKG B;  3ZDL A;  5LP6 A;  4FM1 A;  5FNV B;  3UT5 B;  3S0X A;  5EK0 A;  3OM3 B;  4P9T A;  1KEC A;  4JI3 O;  1N0J A;  3BPZ A;  4BJT A;  5TIS Z;  1GMG A;  1BZ4 A;  2BSK B;  2A1D D;  3QW0 A;  5A9G A;  4U5G A;  4RBN A;  1JQ0 A;  5BR8 O;  2ZXP A;  1ZX3 A;  1U0B B;  1OR3 A;  3CPW U;  1IVS A;  3WU2 Z;  4O2B A;  3L0I A;  4YL0 A;  5L3D A;  4GKK O;  3UM7 A;  3RQF A;  4RQE A;  1IBM O;  4O6M A;  1YHQ V;  2KB1 A;  3CC2 V;  1OCO C;  3K59 A;  4HNA A;  3SPI A;  4J9Y B;  2P22 C;  2JJ2 G;  2B0J A;  3E9V A;  1H8E G;  1NTK H;  1V55 B;  4C3E A;  3P32 A;  3JYH A;  4Q5S F;  1ZW2 A;  2J46 A;  4NYK A;  1RSO B;  2EIL C;  3U0Z A;  1MMG A;  4IAO A;  1I4Y A;  5K1X A;  3KYJ A;  2A3Q A;  4KXR A;  3O55 A;  3UT5 A;  3L75 H;  1Y74 B;  4HEA J;  3SYN A;  3CRM A;  3SYQ A;  2YIB D;  3ZN1 A;  1HY5 A;  3JAK A;  1CGM E;  2Q9C A;  3H1I H;  2VWK A;  1H2N A;  5H6R A;  4XQ1 A;  4O4H B;  1DK1 A;  2P6J A;  3E35 A;  4EFE A;  1XQ8 A;  3R7C A;  5L0I A;  1WN0 A;  1Z5W A;  1A7D A;  1H9T A;  3JT1 A;  1JCH A;  4W4K A;  2XHB A;  3NRH A;  3CCR V;  1NJI W;  1TUB B;  3HKD B;  3EG9 B;  2XL6 A;  2HR3 A;  4PHZ A;  2A79 B;  3BA9 A;  3N2G A;  2ZM6 B;  2F1M A;  5JS5 A;  3QTH A;  2Q0O C;  3RBZ A;  1WAT A;  1IBK O;  3IC9 A;  1N0N A;  2LCH A;  2OJQ A;  2OJE D;  3IGA C;  4X66 O;  3THO A;  4YL3 A;  2BOC C;  4NR1 A;  1XDC A;  1LS1 A;  3EZI A;  5IE9 A;  2PGG A;  2DJV A;  3DI5 A;  5E3A A;  3TK0 A;  5JP7 A;  3M99 B;  5DS4 A;  2HHH O;  1FNT c;  4CH6 A;  3ZS8 C;  1NBM G;  4X64 B;  5IJ9 B;  3A0B Z;  4FJC C;  4I3M A;  1ZU4 A;  3TD7 A;  1ARO P;  4FFB A;  3ABU A;  4ZKI A;  5E79 Z;  1Q0D A;  1V4A A;  4O4J B;  3T1Y B;  4O4H A;  1E1Q G;  4JI7 B;  3O10 A;  3N24 A;  4U3F H;  2ITC C;  3ZMU A;  2WL8 A;  5FPO A;  4RAI A;  1D5A A;  1W2B U;  1R6K A;  1H8H G;  3EJN A;  1NG1 A;  3FX7 A;  3AG1 C;  1IXM A;  2GA0 A;  3LES A;  1WNS A;  1YAR O;  4JI0 O;  3L1M A;  1CEZ A;  3S3X A;  2Y0P A;  3ZMS A;  1C02 A;  3K5L A;  1K5S A;  4XDK A;  3M8A A;  2HKV A;  3Q4H B;  1L1F A;  4JEA A;  4B7E A;  2W6J G;  4QNH B;  3T4D A;  4BWA A;  3JD3 A;  5GW7 A;  4U7O A;  4Z9H A;  4PDR A;  4GKJ B;  1FMV A;  3LNN A;  5KHG A;  1TUE B;  1VQP V;  2NPU A;  3PDM P;  1ZWI C;  2YID A;  4D7T A;  2BTO A;  1OCC B;  2QNL A;  1FD9 A;  1JA8 A;  3ZRS A;  4NTX A;  1DGS A;  4FFB B;  4IIJ B;  1K3E A;  5BQI A;  2CDY A;  3H1J H;  4DV5 B;  4DRX B;  2YL7 A;  4TQF A;  3UGP A;  1AJP A;  2EPL X;  4YJ3 A;  2LK4 A;  1FFX A;  5J2T A;  3RH3 A;  2D3O W;  5CA1 B;  1SET A;  1KYO F;  1YXB A;  3EHM A;  3P3N A;  3WG7 C;  2UUB B;  1NS1 A;  5CA3 A;  3AJM A;  3VRC A;  5EYP A;  1MMA A;  2EPK X;  4QPK A;  4L87 A;  2FGY A;  1QR9 A;  4QJF B;  3L71 H;  4F6E A;  1TQG A;  3LDE A;  4CS9 C;  4IHJ A;  3I55 V;  3R2P A;  3K33 A;  1XMO B;  3HB3 B;  4J7T A;  4R8C A;  1BSM A;  1TWC A;  3S3W A;  4LF4 B;  1GM7 A;  1M2O A;  3HKC B;  1H7I A;  3EGD A;  2KYH A;  2DYR B;  2E76 B;  2GV9 A;  3GEE A;  4JJF A;  2QR4 A;  2IBZ H;  2WSS G;  3H9V A;  4WFE A;  4X88 A;  4X1K B;  1VMA A;  3W2V A;  1I4Z A;  3DJN B;  1J8Y F;  3SYP A;  1WA8 A;  3DD7 A;  4ANJ A;  4CSA A;  2H94 A;  4O4I B;  2VWJ A;  1XZP A;  3ZSU A;  3ETQ A;  1ORS C;  3UGO A;  3N2K A;  5B1B B;  1ENV A;  4DR6 B;  3D3Q A;  4JYA B;  1QNM A;  5JQG B;  4K35 A;  3C8Z A;  2XLD A;  4HE8 D;  4F4B A;  4P9O A;  4DV0 B;  2YKZ A;  4LH6 A;  2YXL A;  4QE7 A;  1LR1 A;  3EFO A;  2WLL B;  3B0P A;  1ZHY A;  3PJS K;  2YL3 A;  1DF5 A;  2X7R B;  1T6I A;  2P6V A;  1BR4 A;  2QKA A;  5JJJ B;  3DAF A;  4P9P A;  2Q5Z A;  4P2Z A;  1GS9 A;  5HV9 A;  5LP6 B;  2OCH A;  3NXS A;  3M7M X;  3BEH A;  2YL1 A;  1XOU A;  4H37 A;  5B1A B;  1Y6X A;  5JLI A;  3IEE A;  2JGU A;  3CCQ V;  3FB8 C;  1R73 A;  2K1E A;  4E0H A;  1AJN A;  2MW2 B;  4G78 A;  3FMS A;  1V54 C;  3SYA A;  5LXT B;  1Z23 A;  2F22 A;  2GUZ A;  3E89 A;  1NQT A;  4YY3 O;  4LF8 O;  3TXS A;  1JOY A;  3MYF A;  3L34 A;  2EX3 A;  3ABL C;  2VQF B;  5BMV A;  3N2K B;  1RXQ A;  3AG4 B;  1K34 A;  4JV5 B;  2Q00 A;  4WGZ A;  1B68 A;  3IC7 A;  4P9F A;  4I0X A;  4JAV A;  5CB4 A;  1YAU O;  4NCQ A;  5JCO A;  4JTA B;  1WP7 A;  3LUT B;  4LCU C;  3JZ0 A;  1JR9 A;  3K57 A;  1JPJ A;  2UXX A;  1VQ9 V;  4RQF A;  3ML0 A;  4JI2 O;  4IB4 A;  2AHY A;  3FVY A;  2CH7 B;  3CME V;  1N32 O;  4FAP B;  1OCZ C;  3JD0 A;  5KYU A;  1Q90 D;  4CDA A;  5LOV B;  1Q0M A;  4DR3 B;  4KI2 A;  2LD6 A;  1UFB A;  2H7B A;  4JAA A;  4WBN A;  1QVF U;  1M90 W;  4ZLD A;  1YTF B;  5IJ0 B;  3ETE A;  3RVZ A;  1EKY A;  1XNQ B;  3K6B A;  4FLZ A;  2GUZ B;  4GLX A;  4DV1 B;  2OCC C;  5KUM A;  1GQA A;  1P4R A;  2ZR3 A;  4DRJ B;  2YRF A;  1S72 V;  2R7O A;  1IUR A;  2N74 A;  1AEP A;  1H2S B;  2EJR A;  3UMK A;  3QZC A;  5IWA O;  4B3S B;  3OEH G;  5ITZ B;  4DV6 B;  3K1I A;  2XRH A;  1BCC H;  1VQK V;  2YSU B;  2UXN A;  4E7S A;  5FPR A;  3UQ8 A;  2ZT9 B;  4HFF B;  2WAM A;  2R7U A;  2ZCE A;  4O2A B;  1PKX A;  1HW1 A;  4DR5 B;  1V74 B;  2R05 A;  1QVX A;  1SZT A;  4CH4 A;  3VQV A;  5IJ9 A;  1SQQ H;  4AIL C;  3DMD A;  1M56 C;  3ZN0 A;  2Q73 A;  3OMI B;  4Q20 A;  2HSB A;  2E3C A;  2XLV A;  1CGO A;  4LF7 B;  2Q9B A;  4EIY A;  3AK2 A;  5K0I A;  2PNO A;  5F5F A;  5D92 A;  3E8G A;  4O4J A;  5JH7 A;  1UG7 A;  4UV8 A;  2HJ3 A;  3JRT A;  5B1B C;  2LFF A;  1YYX A;  2V1D A;  4DV7 O;  4XBF A;  2VCA A;  2WVN A;  1ZW3 A;  1BHB A;  4GKK B;  3SGI A;  2JEU A;  3JAM N;  4NTA A;  3RFR A;  3JAK B;  2M6Y A;  1LUV A;  1SES A;  1SQP H;  3CC4 V;  2AU5 A;  4XLP F;  1F51 A;  4K8X A;  4O7G A;  1KUQ A;  1YIT V;  2XLM A;  3STZ C;  5ITZ A;  5L3B A;  1TUB A;  3HKD A;  3RT3 C;  4NXN B;  3EG9 A;  4I44 A;  1R3K C;  4MTF A;  3N2G B;  4O2A A;  1N33 B;  1AB3 A;  5T1D B;  1YI2 V;  4C3B A;  3L74 H;  4I1M A;  2Q67 A;  1EBO A;  3NMI A;  3RWR D;  1VQ7 V;  1OW7 A;  2LP7 A;  1WWP A;  2KKW A;  5TJ5 E;  3T6G B;  1JR8 A;  5C8Y B;  5FCL A;  3ZMT A;  2LQG A;  2R7S A;  5DQZ A;  2L6H A;  4DRX A;  3U10 A;  2NR5 A;  3QTC A;  3VYW A;  4PDV A;  4YJ3 B;  5A6B A;  2QGN A;  4X20 A;  3CRA A;  1SF9 A;  3WB0 A;  4X62 B;  1VEW A;  2QEX V;  1IDS A;  2DYR C;  1LM3 B;  4A2N B;  1R4T A;  1BMF G;  2B1G A;  2IJH A;  3AG1 B;  3KG2 A;  1NLX A;  3CHX A;  2ZXW B;  3QNE A;  1XI1 A;  1NZE A;  3NDB B;  5D5Q A;  2Y3H A;  1PV0 A;  2BCC H;  3RW0 A;  5KAI Z;  4O6N A;  4JE9 A;  3RVY A;  3F5W C;  5CMU A;  2AW9 A;  3D36 A;  2HFI A;  3CB2 A;  4CC5 A;  1GN2 A;  1CP9 A;  1YCI A;  4DR4 B;  3JSE O;  4FX5 A;  4ULV A;  1ZHZ A;  1OJH A;  1OCR C;  3F47 A;  1EN5 A;  1F7Y A;  2FFH A;  2P06 A;  5JSL A;  3G6E V;  4CDY A;  1AI7 A;  5EIB D;  4AL1 A;  1QLE C;  4XPY A;  2PYJ A;  1ST6 A;  2XL4 A;  2BC5 A;  1J95 A;  1YVW A;  1B3Q A;  4YK5 A;  4DV4 O;  1XUQ A;  4JI7 O;  3BRC A;  4WFH A;  3BVO A;  3SDL A;  3RIP A;  4GX1 A;  1QPU A;  1VYI A;  2FAP B;  2C2A A;  3K5M A;  3IAY A;  1GM9 A;  2BE5 F;  3C8G D;  3JD2 A;  2H8A A;  1XMQ B;  3CCL V;  1NU9 C;  4Z2W A;  1LE2 A;  2ZIM A;  4FM2 A;  1VF5 B;  1KU2 A;  2WLL A;  4AI8 A;  4DV1 O;  1T6Q A;  4RDA A;  3W2W A;  1HMO A;  2QTS A;  4DO2 A;  4EHP A;  1R3I C;  2DOS A;  1G4W R;  2R70 A;  2N05 A;  3ZG1 A;  1YVI A;  4HFK B;  3K3W A;  3X2Q B;  1FXK C;  4UVC A;  4GKJ O;  4UCU A;  4WCE V;  4I7Z B;  4FLX A;  1R3L C;  1Q82 W;  1KD1 W;  1ZYR F;  1M9N A;  1WAZ A;  3LLI A;  4IHJ B;  1SRY A;  5DVW A;  4N6H A;  2ODM A;  3VBB A;  2HMZ A;  4LC1 A;  1L0N H;  2EIJ B;  1KBH A;  5LXT A;  4JI5 B;  2RSE B;  4PFP A;  4KFM A;  1AP6 A;  4PDM A;  2UUH A;  2EIN C;  4FM0 A;  4X8A A;  1MNG A;  4C7U A;  2G3K A;  1D0X A;  2Q4P A;  4X1K A;  2IYL D;  2BTQ B;  1G6U A;  4JZ2 A;  2OTJ V;  1XHZ A;  4LF7 O;  4I0X B;  4MQ9 F;  1Y4C A;  2CNW D;  1WA8 B;  2XXA A;  5KHI A;  4B3T O;  1GN6 A;  4H4K C;  4I5S A;  3HKE A;  1I5N A;  3OEO A;  3CYO A;  1SQX H;  3X2Q C;  1VF7 A;  3C7J A;  1Q81 W;  3J7A U;  3K04 A;  3ZCC A;  2R72 A;  1IBL O;  2ADP A; 
#chains in the Genus database with same CATH homology
 1PNK A;  1N8R W;  2WPD G;  3B8N A;  3K0D A;  1S76 D;  4MVR A;  2IJI A;  5H6R A;  2P6J A;  3E35 A;  4H33 A;  4MVZ A;  3ETG A;  1BL8 A;  4R50 A;  3OMA B;  1VQ4 V;  4UVB A;  1JCH A;  4XDL A;  2EIM B;  5J9P C;  3CCR V;  1NJI W;  1KC8 W;  3W7T A;  5B1N A;  3CC7 V;  2HR3 A;  2A79 B;  2F43 G;  3SYC A;  1VQL V;  3ABL B;  4MTG A;  4PA4 A;  4GX2 A;  3DTU B;  3RBZ A;  2X6A A;  3LNM B;  4QIW F;  2WLK A;  1K97 A;  2X6B A;  3IGA C;  3EFF K;  2WLI B;  3OR6 C;  4BIU A;  2GHY A;  2Y48 A;  2BOC C;  2A0L A;  1NVP D;  2DYS C;  3E8F A;  3M99 B;  4MT8 A;  3ZRW B;  1AJQ A;  4XDJ A;  1K33 A;  1NBM G;  1NH2 B;  4LP8 A;  3CCV V;  1Q86 W;  4FJC C;  5LHI A;  1ARO P;  4X89 A;  3ABU A;  4ZKI A;  1RM1 B;  1OZ0 A;  3BY6 A;  3F7V C;  3E83 A;  1E1Q G;  1KP2 A;  2ITC C;  1FXH A;  4FPP A;  2QKS A;  4TT3 G;  3ZMU A;  1K7D A;  4RAI A;  4N21 A;  3K9A A;  1FS0 G;  2ZQM A;  1AI5 A;  4ASU G;  1R6K A;  1W2B U;  1H8H G;  2XAJ A;  3CCS V;  1AI6 A;  1I5X A;  1W0K G;  2HFE C;  3F7Y C;  1JX9 A;  2MK3 A;  3AG1 C;  1IXM A;  2Q68 A;  3D3I A;  1CEZ A;  1B6Q A;  1XL4 A;  3ZMS A;  3MHS C;  4OXS A;  1K5S A;  4XDK A;  3CMA V;  1L1F A;  2XND G;  5IYD O;  2B1I A;  2W6J G;  4QNH B;  2XAH A;  4GX5 A;  2IH3 C;  3T4D A;  3JD3 A;  1R3J C;  4GX0 A;  4QPJ A;  4U7O A;  2EIK B;  4JTC B;  5GW7 A;  1KQS U;  4PDR A;  1TUE B;  2Q69 A;  1VQP V;  1VQN V;  4CZZ A;  1MG1 A;  1ZWI C;  1K8A W;  3ZMZ A;  5B3S C;  1JPX A;  1OCC C;  1MSW D;  4MTX A;  2QA4 V;  1YJ9 V;  2JIZ G;  1OCC B;  2NNU A;  4MVO A;  3ZIA G;  2ATK C;  3OEE G;  5EBW C;  3ZRS A;  4Z1M G;  2DQ0 A;  1K4D C;  3ZN1 A;  3CCE V;  1K3E A;  1YJW V;  3SPC A;  2WLH A;  2EIJ C;  2EZP A;  1AJP A;  2QM7 A;  4PA9 A;  5CBF A;  4KP4 A;  1M57 B;  2DWD C;  1OCO B;  1BHA A;  2P67 A;  2D3O W;  1SET A;  2DWE C;  2JEX A;  4JAU A;  3WG7 C;  5CA3 A;  3W7S A;  4PEL A;  3ZRX A;  3QO5 A;  1QLE B;  4L87 A;  4QPK A;  1DF4 A;  3FB7 C;  1FFT B;  1QR9 A;  4QE9 A;  4QJF B;  2JDI G;  3H01 A;  1GKF A;  4UXN A;  3LDE A;  2HVK C;  4FMT A;  4JAS A;  4J9Z B;  3I55 V;  3LDD A;  2QTO A;  4MVM A;  1K4C C;  3HB3 B;  4R8C A;  3E2E A;  5DM6 V;  1GM7 A;  5C93 A;  1VQM V;  4HYO A;  3W7U A;  3FKS G;  1AR1 B;  3T4Z A;  2WWW A;  2KYH A;  2DYR B;  1KKD A;  1GTO A;  2WSS G;  4X88 A;  2P90 A;  4WFE A;  2WLN A;  2XAS A;  3SJQ C;  3ETD A;  1W0J G;  4RUF A;  3SYP A;  1NH2 D;  2EZO A;  2H94 A;  4BW5 A;  1F23 A;  4G28 B;  2AHZ A;  1GM8 A;  2JK5 C;  1Y4M A;  4R6Z A;  2BOB C;  1ORS C;  5B1B B;  3CP1 A;  1ENV A;  2IH1 C;  1NVP B;  2EBO A;  5CN0 A;  4WFF A;  3IFX A;  4P9O A;  5L3C A;  3FYE B;  3T1C A;  1Q7Y W;  1V54 B;  2GSM B;  3AG2 C;  4JTD B;  4F4L A;  4QE7 A;  3CD6 V;  2WLL B;  3PJS K;  1DF5 A;  4FK5 C;  3ZMV A;  2X7R B;  2HLD G;  2ITD C;  1OHH G;  1M56 B;  3ABM B;  3B8M A;  4P9P A;  4P2Z A;  1K73 W;  4N23 A;  2JJ1 G;  2XOK G;  3NXS A;  3BEH A;  5H6Q A;  2IJJ A;  4H37 A;  5B1A B;  2EIK C;  4JYB A;  2DYS B;  2HKO A;  5HFM A;  3CCQ V;  3JD1 A;  3FB8 C;  3ABK B;  1R73 A;  3OUF A;  4RUE A;  5IDJ A;  2K1E A;  1AJN A;  3STL C;  4G27 B;  2HG5 C;  1V54 C;  2A9H A;  3SYA A;  3E89 A;  1NQT A;  1JOY A;  2Q6A A;  1HWY A;  1VQ5 V;  3LDC A;  1QCE A;  3ABL C;  4P30 A;  3W7W A;  3JD4 A;  3E8H A;  3AG4 B;  1K34 A;  1GK9 A;  2QE7 G;  1S77 D;  3IC7 A;  4MSW C;  4JAV A;  3T2M A;  4BIZ A;  2WLM A;  4KUM A;  3JYC A;  2PI4 A;  5E1A C;  2CK3 G;  4JTA B;  2Y69 C;  3A0R A;  3LSS A;  2OTL V;  3P30 A;  3LUT B;  2Z3Y A;  4LCU C;  3AG3 B;  1WLE A;  4DXW A;  1R6N A;  2UXX A;  1WPX A;  5B3S B;  1VQ9 V;  1JJ2 U;  2Y69 B;  1UJW B;  3OMN B;  4RQF A;  3ML0 A;  3AEI A;  1PL0 A;  2AHY A;  1MOF A;  3CME V;  1PNL A;  3QO8 A;  1OCZ C;  5CBH A;  3JD0 A;  4PDL A;  3JCZ A;  4WFB V;  3G71 V;  2XAG A;  1QVF U;  5LGT A;  1M90 W;  3QO7 A;  1NR7 A;  1YTF B;  1PD3 A;  4MVS A;  5IYB O;  2EIL B;  5KA6 A;  3ETE A;  1H38 A;  3RVZ A;  3ASN C;  2OCC B;  2ZDI A;  2ZD9 A;  2R9I A;  1XL6 A;  2OCC C;  1M57 C;  5B1A C;  1KP3 A;  5KUM A;  3WFV A;  1QR8 A;  3ABT A;  1P4R A;  5FL7 G;  2ZR3 A;  1JVM A;  3TK1 A;  1FXK A;  3VOU A;  5HFL A;  1S72 V;  1EFR G;  4EKW A;  1G8M A;  5EBM C;  2Z5U A;  1OCZ B;  2EJR A;  2LFS A;  5KUK A;  5LGN A;  2ZDI C;  1OCR B;  3OEH G;  5LHH A;  2IW5 A;  2YEV B;  4PA3 A;  3SPG A;  1VQK V;  2YSU B;  2UXN A;  2XAF A;  3AG2 B;  3MD0 A;  3R65 A;  2IU3 A;  2WLI A;  1K5Q A;  1LNQ A;  2WAM A;  2IJK A;  4MVQ A;  1GO3 F;  1PKX A;  1SZT A;  2PI5 A;  3K0G A;  5DN6 G;  3G4S V;  1RPO A;  3OUS A;  4MS2 A;  1M56 C;  3AG4 C;  3SYO A;  3ZN0 A;  3OMI B;  4Q20 A;  1CPY A;  4HZ3 A;  1S0V A;  3TCU A;  3E8G A;  4UV8 A;  1K92 A;  1QBZ A;  5B1B C;  3UKM A;  2V1D A;  1YTF D;  3OAA G;  1E79 G;  4XBF A;  1I5Y A;  4MVU A;  2HVJ C;  1BHB A;  2JEU A;  1S3J A;  4HAM A;  3FYI B;  2WLJ A;  2P7T C;  2X0L A;  1SES A;  1FXK B;  3E86 A;  3MHH C;  4WFG A;  4MW8 A;  5EC1 C;  5L3G A;  3CC4 V;  5IY5 B;  4LBE C;  1DTO A;  1F51 A;  3ABM C;  4MTO A;  1YIT V;  3STZ C;  5EBL C;  1ROP A;  4U7N A;  1PNM A;  1P7B A;  1YJN V;  5L3B A;  1YSC A;  1K9M W;  4E2L A;  2IU0 A;  5LGU A;  1R3K C;  1QLN A;  4WF9 V;  4MTF A;  1YI2 V;  3LSQ A;  1QVG U;  2Q67 A;  3ASO C;  1EBO A;  2EIN B;  3HPL C;  1S5H C;  3GWO A;  2LP7 A;  4TSF G;  1VQ7 V;  3WG7 B;  2HJF C;  4GCZ A;  2EIM C;  5LHG A;  2DQ3 A;  2H8P C;  3OW2 U;  3FB5 C;  3ZMT A;  5LBQ A;  3ZRV A;  5IY5 C;  3ZRW A;  4PDV A;  3ASN B;  2V7Q G;  2W6I G;  2QEX V;  3ZJZ A;  2DYR C;  3W7X A;  1BMF G;  2B1G A;  2IJH A;  3AG1 B;  4R7C A;  3K79 A;  1AI4 A;  3KG2 A;  2ZXW B;  3QNE A;  3RW0 A;  3TET A;  1RPR A;  2M7W A;  3ASO B;  5CMU A;  3F5W C;  3RVY A;  3AG3 C;  4UVA A;  3D36 A;  3OE7 G;  3SPJ A;  1NKD A;  5B1O A;  2R9R B;  2FTK A;  3GB7 C;  1CP9 A;  2LFR A;  4GT1 A;  4UV9 A;  1OCR C;  1H2G A;  4UUJ C;  5KA5 A;  3OFN G;  3OGC C;  3OR7 C;  4CBC A;  3CCM V;  2OT5 A;  3G6E V;  1AI7 A;  1QLE C;  3I56 V;  5BZB A;  3CCJ V;  4TWK A;  1V55 C;  4JYC A;  5CBG A;  1ORQ C;  1FXV A;  4ZBM A;  2XAQ A;  1J95 A;  4BAY A;  2YEV A;  3EHB B;  3DGE A;  5IYC O;  4WFH A;  2QM8 A;  4WFA V;  2X6C A;  4MW3 A;  4GX1 A;  2NLJ C;  2C2A A;  2ZR2 A;  3E8B A;  1GM9 A;  3ABK C;  3K08 A;  3JD2 A;  3K03 A;  3CCL V;  4JPR A;  4RO2 A;  2WLL A;  4DO2 A;  1VQ8 V;  5L3F A;  1R3I C;  5EK0 A;  3OM3 B;  1KEC A;  5H9C A;  3K3W A;  3X2Q B;  2DW4 A;  1GMG A;  1FXK C;  4JF3 A;  1F4M A;  2W0F C;  4PA6 A;  4UVC A;  4WCE V;  1R3L C;  5EC2 C;  1Q82 W;  1JQ0 A;  1KD1 W;  1M9N A;  1G4Y B;  1EZJ A;  1MAB G;  3CPW U;  1SRY A;  1Y66 A;  5L3D A;  4FIP C;  3VBB A;  4I9W A;  1DLB A;  4LC1 A;  3UM7 A;  3B77 A;  1M1K W;  4RQE A;  3K06 A;  2EIJ B;  3CXC U;  1COW G;  2B5U A;  1YHQ V;  2KB1 A;  3CC2 V;  3FB6 C;  3SPH A;  1OCO C;  4KFM A;  4PDM A;  3SPI A;  4J9Y B;  2JJ2 G;  2EIN C;  4X8A A;  1H8E G;  1V55 B;  3P32 A;  4PA7 A;  2OTJ V;  2EIL C;  5L3E A;  1YIJ V;  1RM1 C;  1F4N A;  1E1R G;  4I5S A;  1VQ6 V;  3CYO A;  4YXW G;  3CCU V;  3X2Q C;  1THZ A;  4JGS A;  1Q81 W;  2ZXW C;  4G2K A;  3K04 A;  3SYQ A;  3ZCC A;  1VQO V;  1NR1 A;  1SER A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...