4DXWA

Crystal structure of navrh, a voltage-gated sodium channel
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
227
structure length
210
Chain Sequence
TPFFSSLKDNRIFQFTVVSIIILNAVLIGATTYELDPLFLETIHLLDYGITIFFVIEILIRFIGSGWNIFDTVIVAISLIPVLRLLRIFRVLRLISVIPELKQIIEAILESVRRVFFVSLLLFIILYIYATMGAILFGNDDPSRWGDLGISLITLFQVLTLSSWETVMLPMQEIYWWSWVYFFSFIIICSITILNLVIAILVDVVIQKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an orthologue of the NaChBac voltage-gated sodium channel
pubmed doi rcsb
source organism Alpha proteobacterium himb114
molecule tags Transport protein
molecule keywords Ion transport protein
total genus 79
structure length 210
sequence length 227
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00520 Ion_trans Ion transport protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4dxwA02
1.20.120.350 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Voltage-gated potassium channels. Chain C 4dxwA01
2EIMC 1KKDA 5B1AC 3TETA 4PDLA 3F7YC 4R8CA 3T1CA 4MVOA 2DYSC 4BW5A 2OCCC 2K1EA 3OGCC 5B1BC 4H37A 2Q68A 1BL8A 3K0GA 4GX5A 2EIKC 3GB7C 1R3IC 1K4DC 2YEVA 1S5HC 3LDDA 1OCOC 3OR7C 4HZ3A 1R3KC 4I9WA 4MW8A 4DXWA 4GX1A 1LNQA 3TCUA 4P9PA 3VOUA 1XL4A 1OCZC 1R3LC 4RAIA 2R9RB 1ORQC 4R6ZA 4WFFA 3RW0A 1M56C 4MVSA 1OCRC 2Q67A 3AG2C 4WFHA 3OUFA 3E8HA 2Q69A 2P7TC 3F5WC 4LCUC 4ZBMA 4XDKA 3LUTB 2HVJC 2WLMA 3T4ZA 2AHYA 4JTDB 4X8AA 4PA9A 5CBHA 4RUFA 4KFMA 4LP8A 4PA4A 3SYAA 3F7VC 2H8PC 3K04A 4J9YB 4QE7A 4JTCB 2QKSA 3ASNC 4HYOA 5BZBA 5E1AC 3SPGA 2A79B 3AG3C 3RVZA 3T4DA 4J9ZB 3K03A 4P9OA 3ABMC 2ZD9A 5EBLC 4P2ZA 3IGAC 3STLC 4F4LA 5IY5C 3K08A 5B3SC 3AG1C 2AHZA 2DYRC 2W0FC 3FB5C 4LBEC 2BOBC 4PA7A 4R7CA 3ABLC 1M57C 2HFEC 3WG7C 1ZWIC 3LDEA 3SJQC 4QNHB 3HPLC 4QE9A 4G27B 4G28B 5EC2C 3E8GA 1J95A 2NLJC 4PDRA 3OR6C 3E89A 1P7BA 3SPCA 3SYOA 2DWDC 3UM7A 3T2MA 3SPJA 4MVQA 2JK5C 2Y69C 3BEHA 2WLIB 3RVYA 4MVMA 5EBWC 3JYCA 4PA6A 4MVRA 4GX0A 4MTGA 3LDCA 4PDVA 3X2QC 5KUKA 4WFGA 4MVUA 2WLLB 4PDMA 2QTOA 3IFXA 4JTAB 2HJFC 2A9HA 2ZXWC 3R65A 3PJSK 4RO2A 2Q6AA 5CBFA 3ZRSA 1XL6A 2EINC 2EILC 1K4CC 2X6BA 3KG2A 4XDLA 3AG4C 2HG5C 2X6CA 4TWKA 5CBGA 4XDJA 4MSWC 3ABKC 4OXSA 3E83A 5EBMC 2HVKC 1QLEC 4RUEA 2EIJC 1V54C 2DWEC 4MW3A 3ZJZA 3SYPA 4EKWA 1R3JC 2KB1A 3FB7C 3SPHA 1ORSC 3RBZA 4P30A 4R50A 3K0DA 4PA3A 3FB6C 4MS2A 3SPIA 2ITDC 3FB8C 3SYCA 4GX2A 3STZC 4MTOA 5J9PC 2WLJA 2WLHA 2A0LA 5EC1C 1G4YB 2WLIA 4MTFA 3E8FA 3K06A 4X88A 3UKMA 2ITCC 3SYQA 3E86A 4WFEA 2WLNA 1V55C 1JVMA 2ATKC 2IH3C 4MVZA 5EK0A 2X6AA 2WLKA 3E8BA 3ASOC 3LNMB 1OCCC 4UUJC 2IH1C 2WLLA 4H33A 4CBCA 3EFFK 3OUSA 5KUMA 4X89A 2BOCC 2KYHA
chains in the Genus database with same CATH superfamily
2PGGA 3FFQA 1VEWA 3TETA 1FXHA 1V54B 4TV9B 2JIZG 1Z5ZA 3L1MA 1BR4A 3CCUV 1VLSA 2OCCC 2DE0X 2QKAA 2C04A 2WA3A 1ZHZA 3K0GA 3N27A 5L0JA 4IARA 1XDCA 2QGNA 1I94O 3HB3B 5CA0A 3MYFA 4DXWA 2GUZA 5H9CA 3CEIA 1G8MA 2P22C 4HAMA 4YT4A 4JYBA 1RM1C 1D1BA 2LK4A 4TOIA 1FFTC 4JURI 1U89A 1XOUA 4LWSB 1VF7A 2B9ZA 3OAAG 256BA 3U10A 1N0NA 2EULA 2X51A 1QCEA 4CC6A 3EHNA 4PJLA 5DLJA 3F7VC 2GDSA 1V9PA 4J9YB 4IL6Z 4JF3A 4JTCB 3L71H 4FWVA 1GAXA 3FVYA 3O39A 3QZCA 1ZUQA 3RYIA 4H13B 1XMQB 2CH7A 1CGNA 4JASA 5B3SC 2XUMA 3OM3B 5J2UB 4R7CA 1AI4A 2VB6A 3ITFA 4CS2A 2OCCB 1HNXB 2ZKOA 3C62A 5COMA 1P4RA 4G27B 4JZAA 4YJ3A 1V55B 1MABG 1VYKA 3W4YA 1NTZH 3ETDA 1XMOB 3E89A 3OW2U 4KHPO 1G1XB 1NLXA 1ZZPA 3ABKB 4OIRF 4P9TA 2YL0A 1E85A 4EBBA 1XNQO 4O4JB 3DAFA 2UXCB 1AR1B 1LUWA 5LMUB 3I5QA 2HLDG 1R6NA 1YJ9V 4UVAA 2P67A 3K3WA 2PF4E 1JQ0A 1Q0KA 1GQAA 3ZMUA 4B3MO 4J32B 2ZXWC 4PK4A 5JP7A 5KYWA 1DK1A 4DR3B 4DV6O 3T6JA 4ZOLA 4IWBA 3NDBB 1NU7D 2IM9A 4RWUA 4FLTA 1AUEA 3J7AU 4NKGB 1M2VB 2EIJC 1HP8A 4J11A 4O6YA 3E2EA 3EJNA 3N2KB 4U5HA 1BCCH 4BJ6C 2VQEO 4FLZA 3K0DA 2L9JA 3U3FA 3OMIB 1JR8A 1TAEA 1XMOO 1ZL8A 2XL4A 5IY5B 1H8HG 4NTXA 4TV8B 3CC7V 1HNXO 2WLLA 3WB1A 3J80N 2QY9A 3JD4A 5JJEB 4U7OA 2EIMC 1KKDA 2J8WA 4NTAA 1NH2B 2R7XA 2JGDA 4BW5A 5DM6V 4GKKO 1N32B 4AK9A 4ANJA 2YI9A 3TJTA 2G38A 2MK3A 4PJJA 1R6KA 4JYAO 1UPGA 2ZXWB 4GX5A 3VQVA 1MNEA 4CS8C 4N06A 3DJUB 2YEVA 1DF4A 2JJ2G 2GV9A 4FLWA 1Z7Qc 4JIOA 3RF3A 1T9KA 3FAVA 4K0KO 4X66B 4LFCO 3EGXA 3QW1A 3A0BZ 1FNTc 4UDVA 1CXZB 1NBMG 4JCZA 1VF6A 3I5DA 5L3FA 2ADPA 5AGFA 4DRHB 3LNNA 4OIOF 2ZQMA 4X62B 5J2TA 3JZ0A 4H4KC 1FXKC 2M6YA 1OW8A 2ZIMA 4UCRA 1GMGA 3AG3C 1RMVA 3OEEG 4BJ6A 2KNHA 1KECA 3AG1C 3NXSA 1S7ZA 4B3RB 4U5CE 4EB6B 1GRJA 5L3CA 2QWNB 1FJGO 2B0HA 4FK5C 3EHBB 3DD7A 4HEAJ 5L3QA 3POVA 1DOWA 2UXXA 1CPYA 2XAGA 5KAFZ 1W2BU 4U9EA 1QVGU 4Q6GA 4F6EA 3VQXA 2ZXRA 3AK1A 1Y76A 2EZOA 3ZHUA 5L0DA 2CK3G 1OCRB 3D3QA 3B9QA 2QTOA 3HTKC 4DR1B 2HJDA 3H01A 1GN6A 3WB0A 5A9GA 1Z63A 2LP4A 2OCHA 3TK1A 4JI1O 2P4VA 5JH7B 4TWKA 4O6MA 1V54C 1IBLB 4EKWA 2YLIA 3SYPA 2ZPAA 3OEOA 4CZZA 2WZFA 2OKUA 3T1YB 1FFXA 1T5EA 1VQNV 2YS8A 5LXTB 2RJZA 1COWG 4UVBA 2YXHA 1GH6A 3GVMA 3C8GD 2DYSB 2WVNA 3B0UX 4AL1A 4UCOA 3SJQC 3A11A 2BOCC 4DV4O 2EILB 3RYHB 1ZW2A 2QWPB 1LKXA 5ITZB 1MNGA 3CD6V 1HNWB 2QA4V 2BE3A 2XAQA 5B1BC 1E2XA 2CNWA 3K1IC 5KYYB 3ASNB 2P61A 3IAYA 4BIZA 3U0ZA 1YZAA 2XLMA 2QDOA 3DAGA 2DN9A 2Q9CA 1S5LZ 2AP3A 2WVQA 4I9WA 5JLIA 1F23A 3JAMN 4W8PA 1SA0B 4PI2A 4JI5O 3L8JA 4JI3O 1EN6A 1BSMA 3RWRD 1XNRO 3FYEB 2Q4FA 3MHSC 3P32A 1HDJA 1DOVA 5B1NA 1WOLA 4XBFA 1N32O 4AHCA 1VQ6V 4ONSA 1PKXA 4PA9A 4DR2B 3SYAA 5HSWA 2AZ0A 3BHPA 3K04A 4I1MA 3NYJA 1R6TA 4DV3B 4IJJA 4DK1A 3V5YA 5A69A 2A6EF 2PBEA 3T4DA 4ZI7B 3JD3A 4J9ZB 4CDYA 4FZ0A 2ZD9A 3ABTA 1G4WR 1NR7A 3U8PA 1AI5A 2OWOA 3ZCCA 1GK9A 1TWAA 1EN4A 3H1KH 1EA8A 1G4US 1RJ9B 4QNHB 1SQGA 5L0HA 4LF4O 4LFAO 2Q7EA 3FKSG 1L0LH 3SPJA 1BQZA 2VASA 2NSGA 4ABMA 1BZKA 2JX0A 5IYZA 3ML0A 3JYCA 4KP4A 3KZIZ 4MVRA 2A06H 4DW0A 3EVKA 2NN4A 1R1BA 5KHHA 4JAVA 1I4YA 4RO2A 3FAPB 1HNZB 4JI0B 3QTHA 2X6BA 4AE4A 1EI7A 3ZTMA 2E75B 5GTIZ 5HFMA 3DM9B 2LFDA 1X59A 3AOUA 5D91A 4BEMJ 1PCXA 2GSMB 3OWTA 4DRJB 4O2BA 3HKEB 4TV8A 4W8KA 4X0RA 1M9NA 2WLHA 2P0NA 3L8IA 1YZCA 1I5XA 2ZR2A 1QU7A 4NTFA 2EBOA 4P9FA 1Q7YW 4LF7B 2QWOB 5L3EA 2KYHA 3U9JA 1AJPA 4G78A 1KD1W 3B4SA 2R7TA 5KMGB 4LF6O 1Q0DA 1VF5B 2LJ2A 1UFBA 2UXDO 2ZINA 4XLPF 4CX9A 2DOSA 2C2AA 4P9PA 4EB6A 4DR4O 1O3UA 3ZS8C 5FNVA 3GEEA 3ZN1A 4YJ2A 4IAOA 1Q6IA 1Y74B 1KYOF 2EZPA 3FD9A 3ZG1A 4MTXA 1YTFB 4O7GA 1VQLV 1PL4A 3ICXA 1JFFB 2R7OA 4Q5SF 4TUYB 3ZN0A 2GAQA 3G80A 2LIGA 2ZXOA 5E1AC 5B1BB 2BE5F 3TXSA 4U5EE 4L8JA 4LF5B 3SEOA 2Q7HA 1RKEB 3E35A 1K33A 1WB8A 1AI7A 5KHGA 3ABMC 2ILMA 4EUKB 2MW2B 4F4LA 3PDMP 2WZLA 3TOMA 1NG1A 1O9HA 1SETA 2FGYA 1SQQH 2G3KA 1YA9A 3OTOB 1DGSA 4DBRA 3D36C 5E79Z 5EZYA 5IJ9B 1DLBA 1P7BA 3N0TA 1P7GA 1MZEA 4X1IB 1EN5A 5COGA 1JX9A 4JZ2A 2O57A 2PI5A 3C7JA 4B3TB 5JUAA 1OZ0A 4DR6B 4W4LA 4CH6A 1SESA 1YVWA 3AG4B 2QWQB 2W9YA 1KMIZ 5KHJA 3DKAA 5F5FA 3BA8A 3OGIB 1PM9A 3UT5B 4JI4B 3KG2A 3NKDA 2G62A 4YL3A 3EFOB 2R9IA 3ZMTA 4BR6A 1QVFU 3ZMVA 4RUEA 3MHHC 4MW3A 3WU2Z 1QBZA 1KBHA 2NUPB 4LFAB 4UFZA 1OJHA 5EIBD 5JVDA 2OU6A 1ORJA 2MYSA 5B3IA 3AQBA 4IIJA 3K7DA 4WCEV 3LLIA 1KP2A 3FB8C 4DV1B 2GHYA 2GDCA 1GGQA 2P06A 5D92A 2IJHA 4X88A 2HEPA 1Q0FA 2ATKC 4JGSA 2F95B 2EPKX 1J5EB 5T1DB 2IYLD 3UR3C 4H0LB 1YITV 4LH7A 4DBQA 3K1HA 2QM8A 4B7EA 3WAQA 1K7DA 2Q5ZA 5A6JA 1S3JA 2YXLA 3ECSA 3BCCH 2Y69B 3WODF 4BJTA 3SGIA 2KQXA 2H7OA 3O55A 3G71V 1GN3A 3R66A 1R3IC 3DI5A 4DVZA 1H8EG 1US6A 3JAWA 4JI5B 4YHHO 3CSKA 4LF9O 2V7QG 2ARHA 1OCOB 4B6IA 1Q86W 3CB2A 2Q67A 4LH6A 4X20A 4LCUC 3SZRA 1AP6A 2WLMA 1M2OA 3S28A 3T4ZA 1XZPA 2LW7A 4JI8B 5CBHA 5IWAO 3U2MA 4FVMA 4LP8A 4PA4A 3IEEA 3GWKC 1NFNA 4C3EA 4DV7O 3MYIA 3ZHSA 2WB7A 2QKSA 1D2DA 4PD4F 3QVNA 5LGNA 5B3SB 1TWHA 1FMWA 4CS4A 2JPUA 4YIPA 2D3OW 2JRIA 3K59A 3CQZA 4U5FE 2DYRC 2Q7GA 4FZ1A 4EBKA 2CGNA 2IJKA 4GZRB 5LA6B 4K1OA 1WP8A 1VYIA 5H2FZ 3AK3A 1GM8A 3CZ6A 1O9GA 2IM8A 3FX7A 2HSQA 4Z2WA 2P5OA 5JCOA 1WN7A 4JJFA 1Q8IA 2DWDC 3OTFA 2ETNA 4NCQA 2NPUA 3BFRA 2WL8A 2Y69C 1AB3A 2UUBB 1K97A 5GONA 1J8YF 1Y4CA 5BQGA 4E7SA 3EPVA 1BHAA 3LNRA 3DXRA 5DS6A 3ZRWB 3UO3A 1TUEB 1IBKO 3DSQA 4TQFA 4NTWA 4JTAB 3L9DA 5IT9N 2IXNA 2J7PA 1IXMA 5L0CA 1FXKA 4I3MA 4TV9A 5KA6A 2TMVP 3VM6A 4XDLA 5CN0A 3M4CA 1Q5OA 2J0WA 2YL3A 3CMAV 2HVKC 3CCRV 1N34O 3SR2C 4Z9HA 3UMKA 4ZKIA 3FB7C 4ZIBA 3GM2A 1HMDA 1L0NH 1CGME 2J9BA 3K5MA 3CC2V 3A2FA 4YY3B 4G7HF 1TUBB 1ZAUA 4GX2A 5KX5B 1O5HA 1JPNA 3E8FA 4AX2A 1QLNA 4N6CA 3I5PA 2WLNA 1V55C 2ZDIC 5LL6Y 2E76B 2IH3C 1K9MW 1Y66A 3F46A 4DV2O 2EJRA 3ZMZA 2ETSA 2KG7A 4LDKA 4E0IA 4DR7B 2R9AA 4X1YB 2QJ1A 1YTFD 4DR4B 2D5RB 4P6IC 4R8CA 3DC6A 3T1CA 1YI2V 1Z5WA 2DMXA 1VQ9V 4JYYA 5F5HA 3CX5F 3P30A 3KKYA 3ETQA 4J30B 1V4AA 1BL8A 4WFAV 2HP8A 1NR1A 3KMIA 4FLVA 1H2GA 3HJCA 2CTPA 1TWGA 1EM1A 1SQBH 1OCZC 4LNUB 3A0RA 1AEPA 2YIBA 1F1MA 1NBBA 3DE9A 2Q9BA 1K05A 4GYTA 3IJ4A 4K7BA 2ZXPA 3TK0A 2GUZB 1YCIA 1R73A 4GCZA 1S5JA 1BMFG 1G5ZA 1QR9A 3N24A 1SZXA 2YIAA 2ZDIA 1QQ3A 3V5ZA 5BUOA 4X8AA 2Y3DA 4ZHQA 3W8HA 3BRCA 4E0HA 4AQYO 1RKEA 1N34B 3E22A 3G4ZA 3IQ6A 1Z5VA 2FB5A 3JARA 4EWCA 5BZBA 1PPJH 1FTSA 1OCCB 3VBBA 4DR5O 3HNIA 4MNDA 1HR0O 4QPKA 3BA9A 2PX3A 1W59A 3W2WA 5JH7A 4TSFG 2BOBC 4YK5A 3A0HZ 1DTOA 3SJBC 1D0ZA 2UUHA 3U11A 2UUBO 4JI0O 1HNZO 1EFRG 4DW1A 2M64A 3EGDB 3X1OA 5L3BA 1S76D 3Q4HB 3CCQV 3D36A 4MVMA 1MSDA 1SF9A 3FHDA 4JI6O 1K40A 2R7RA 5BQIA 1XZQA 1CGOA 1VQ5V 2L6HA 2IOQA 5GONB 2DB4A 4YT8A 1P49A 2Q6AA 2FKXA 4WGZA 1C03A 5DQZA 1YZBA 2OG2A 1FXVA 2RCVA 1YF2A 4LWSA 4HE8D 4MT8A 2XAHA 3UT5A 1NFOA 5IWAB 1VARA 4JYAB 4P30A 2PY5A 1LR1A 3SPIA 3JAWB 1SA0A 1XWJA 1I7FA 3STZC 2UUAB 4Q7CA 5H6RA 3CRCA 5BR8O 4IAQA 2YLGA 1N8RW 3SYQA 1VOMA 4XPWA 3H1LH 3TD7A 1A0BA 3CAXA 3QVZA 1XHZA 3T6GB 1LS4A 3CP1A 2UU9B 4U3JA 2CTRA 5DQTA 1Z6AA 3AG7A 1NU1H 1Y67A 3PN1A 2GWWA 1TR2A 1T6QA 5KYWB 1G8XA 2HKOA 3OGCC 3DC5A 4K8XA 1QHTA 1WP7A 3T6BA 2YKZA 1BQ0A 1SC5B 3LDDA 4C3BA 4CIPA 4I4TB 4O4JA 3UMHA 2DQ0A 3N2GA 4A5UB 3K5NA 2R9RB 1WN0A 3UNGC 4DR3O 1HNWO 4X1KB 1APCA 3ATPA 1ZSPA 2DQ3A 1FYJA 4WFHA 1ZHTA 4NVPA 2AGAA 4DV4B 3ABLB 3S84A 3L70H 1NTKH 1H6GA 2HSBA 4ULVA 4DRIB 2A6HF 3CMEV 1ROPA 1ZX3A 2XLOA 3OE7G 1SS3A 5B1AB 2H8PC 1WPXA 1AR5A 3KCYA 3THOA 1V74B 3S0XA 5CA3A 4U5GA 4ZLDA 2JGDB 3KYJA 3SPGA 2HKVA 4YY3O 1PNLA 5GTHZ 1TWCA 2JS3A 2UXNA 3QTCA 1FAFA 2MWQA 3Q6MA 1LI5A 2W4MA 1AJNA 2EX3A 3LSSA 1QQCA 1IZMA 2Q9AA 3ABLC 4YIOA 3G67A 3JALB 3U0CA 4IYIA 2YIDA 3OD4A 1SZTA 3CCJV 1SYQA 2R05A 3CXHF 1Q0GA 1XUQA 3OR6C 3UM7A 1L7CA 4DR1O 2ZR3A 2R02A 3S3XA 3W7SA 4CH3A 1AI6A 4PJ0Z 1IURA 2Q0OC 4IT5A 4LF8B 4UCSA 1WLEA 3L74H 3P3NA 4FAPB 3H9VA 4JKVA 2VH3A 3HKKA 5C93A 5F2VO 4ULWA 4J80A 3RQFA 4CSAA 3BABA 4BWAA 3X2QC 1N4CA 3ZDLA 5J2TB 3JATB 4EBJA 1GTOA 1H2NA 2X0LA 1EBOA 5JQGA 3K1IA 4UXNA 1GS9A 5AG2A 4B3RO 4DRXB 1U6HA 2L6LA 2PTMA 2IXPA 1D5NA 3OFNG 3ZC4A 1R3JC 5A6AA 3B0PA 2NUTA 2LQGA 1SQVH 2FL4A 4ZHQB 3QVYA 3NYLA 3OMAB 4X62O 3K57A 4F4BA 3SYCA 3RKOF 1E84A 2V1DA 2YZSA 1CP9A 3NMIA 4DOZA 5CB4A 3K9AA 1QPUA 3U9MA 5IYBO 2WLKA 2B1GA 2GFHA 3JYYA 1XBLA 2YICA 3VAYA 1SQXH 5DS5A 4UB8Z 2OEVA 5B1AC 1OR2A 1D1AA 3JT1A 1MG1A 2R25A 1B6QA 1BR2A 3HNLA 4CIHA 3EH1A 4X64O 3WG7B 4X66O 4A2NB 4JI2O 1Y4MA 3APQA 2W45A 4YL0A 2EIKC 3CC4V 4U9DA 1JAFA 4U5BE 1NH2D 4HZ3A 2J0XA 1THZA 1OW6A 1FD9A 3TCUA 4O2AB 4DUZO 2YI8A 2R03A 2ZE8A 1SKVA 4CS7A 4WFFA 1N1CA 4DV0B 4XTKA 4YJWA 4DV0O 5EHHA 1ST6A 3JD2A 5BR8B 5LP6B 1KU2A 4PFOA 1FXKB 2UUCO 5KAIZ 2J45A 2AHYA 5DS4A 1E83A 4JTDB 2R7WA 4H54A 3I55V 5KYUB 1F7YA 4N21A 5FL7G 3MAQA 3Q6NA 5EIBC 3X2QB 4FM2A 4B3SB 1OKKA 5FCLA 3LS1A 4FX5A 3RN4A 4O4HA 4CC5A 5KHKA 2KGOA 4G7ZF 3Q7LA 3AGTA 4LLEA 3U8VA 3W2VA 2LGWA 3MFNA 5CI9A 2AHZA 2R7QA 1ZWIC 3LDEA 3CCVV 4CDVA 2FTKA 3GORA 3G4SV 4G28B 4IIJB 1J95A 4CS3A 4U3JB 1MNDA 4LFBB 4K35A 3LEVA 1JA8A 4WBNB 2KQ9A 3WB2A 3S27A 1JR9A 1MMDA 3BEHA 1N36B 5LMUO 1WA8B 2IXOA 1PNMA 2VC9A 1VMAA 4BJ1A 1R5ID 1KUQA 4OPHA 3BVOA 4I1OB 4B3SO 2Y4UA 5FLXN 1A41A 2L81A 3AQCA 4JEBA 4WFGA 2VCAA 5GW7A 1OHHG 3IFXA 5IYZB 4KHPB 4JVSA 1NU9C 2EPMX 2PNOA 1IW7F 3SXYA 3CRMA 2GTAA 3AG4C 4M63A 4ER9A 4WF9V 5CBGA 2CNWD 2FMLA 2R70A 5KYYA 1XMQO 1ZTEA 4OX9O 3ZRXA 1I5YA 3C3SA 5COFA 1D0XA 5TISZ 2OIGA 1MQVA 2PI4A 1H2LA 1A7VA 2PP4A 2ASRA 4EIYA 4LF5O 4PI0A 4FMTA 3CWBH 4K8ZA 2WPDG 3C63A 3CPWU 3W7TA 1WTYA 5HFLA 2N04A 1OCCC 1YJNV 1K8AW 3NYMA 2CW0F 1QZXA 5K0IA 3F47A 2LFRA 4AI8A 4TUYA 2J9VA 1TFOB 5KYXA 3NG1A 4GUNA 3L72H 1BZ4A 3IC9A 1H2MA 4N6HA 1VP7A 5L3DA 1K4DC 1C02A 3HNJA 4QDLA 4QI2A 1R3LC 4YJ3B 3B29A 2XHBA 4OINF 1CPRA 4MVSA 2W0XA 5E2QA 5JRAA 2I15A 4UVCA 1Y6XA 3UGOA 1AROP 2Z5UA 5KA5A 3H1IH 1NI8A 1Q0MA 3CCEV 1MMMA 2QKCA 1O87A 1OQCA 1E1QG 4HYOA 4JI1B 1YA7O 4HBNA 4NC3A 1VQ7V 4X65O 3EH2A 3T4RA 5FPRA 2B0JA 4H44B 3TJ5A 3JATA 2WWWA 2LSEA 2CDYA 1WNSA 2IW5A 2KK1A 1LE2A 1TFKB 3FB5C 2UU9O 5CA0B 1B68A 3LSQA 2J9UA 5BMVB 1L3PA 3VRCA 4UB6Z 4Z1MG 1IBKB 5D5QA 1RXQA 3KH2A 1M57B 2LQTA 1TA8A 3RFRA 2XL8A 2X0CA 2NR5A 2RNBA 3KL4A 3B0VC 3ZEDA 4MVQA 5LXTA 1FJGB 2XAJA 1HE9A 2A69F 4PDVA 4FJCC 4J7KA 4F6RA 4J7TA 2LW1A 3GANA 1I4ZA 3DGEA 3KCXA 2PUSA 5LP6A 3R65A 1Q6HA 3LS0A 1YYJA 2QEXV 3H2UA 4YJ2B 4LR3A 2XL6A 4FM1A 2L6FA 2JJ1G 2P7VA 2JVDA 1B06A 4DV7B 4JI8O 3DM5A 2P90A 5EYPA 4R50A 4OIPF 3LESA 3VF0A 1YIJV 1ZU5A 4DV3O 1H2SB 3AG1B 1TQGA 3K58A 1AR4A 4MQ9F 3K5OA 1MSWD 3P3PA 1JVMA 4BG0A 3D8CA 4DR2O 3G6BA 4W4KA 3GWLA 1UFIA 3ASOC 4LF9B 5A6BA 4UUJC 2KKWA 3K5LA 5LMNB 2Z0AA 3T9OA 4JEAA 2GA0A 1VLTA 4U5DE 3F7YC 2CTQA 5L3GA 1BT8A 2XTAA 2V26A 3RQGA 4MVOA 1YJWV 1VQ8V 2UXBB 4KC9A 4UCTA 2QM7A 1EZVH 3G4XA 4O2AA 4E7ZA 2XS8A 3GB7C 2YC0A 4HFKB 1H9TA 3OR7C 1R3KC 2FAPB 3GWNA 1LNQA 1U97A 1RPRA 3RYCB 1J5EO 1XL4A 2B5UA 1WATA 3EG9B 4TT3G 2N74A 1M56C 1R4TA 3K79A 4EFEA 2LFFA 3E8HA 1FKAO 3QNEA 2R7UA 4HNAA 5A6BD 3J81N 1TGOA 4JCHA 1ZU4A 3TGUH 4IHJB 5ITZA 3DXRB 1WPBA 5LBQA 3ASNC 1H2KA 1MA1A 1T6IA 1I5NA 5CA1A 4D6TH 2LP7A 1LPEA 1JMKC 4PR9A 4AE4B 4NXNB 3CJHA 3AK2A 3SNHA 1YDIA 4YWQA 1K73W 2ICWG 4DV5B 5KLVH 4WBNA 1ORYA 3IHUA 3FDQA 4CDAA 1FFTB 2W6JG 2J7PD 1BDJB 1FFXB 2XLEA 4PDRA 3RYFB 3C8ZA 4FLYA 1RM1B 1H9GA 2AU5A 1IZ3A 5LYJA 2JD3A 4LF8O 1TUBA 5DEDA 1ZL8B 1PD1A 3W7WA 3HNKA 2VCCA 3D3IA 1GM5A 1XHXA 2IJJA 4MTGA 1JJ2U 1T5OA 2F4VO 5H5NA 2WLLB 3QF7A 4JV5B 1PV3A 3JCUZ 2XSEA 2A9HA 1JOGA 4NYKA 5IYCO 1XL6A 2EPLX 2LGQA 4NY3A 2XLHA 4JI7O 3OT7A 2VQFO 3E83A 2HS5A 1QR8A 4OD4A 2I8BA 3SPHA 2E74B 1NS1A 3S29A 4K3AA 4MS2A 3K9SA 4NB5A 2QNLA 5JT4A 2NG1A 2QWRB 4DV5O 3W7XA 3K33A 1YVIA 2WLIA 4O4LB 1K3EA 1PL0A 3E86A 1RSOA 4WFEA 4KI2A 3UMIA 4WABA 4ZLCA 4O4HB 1KQSU 3FYIB 2XLVA 5KYNA 3CHXA 3ETGA 4X89A 1FFHA 4G7OF 4UCVA 3LAYA 4BJ5C 1E86A 2A3QA 2PFDA 1IBMO 1AVOB 3C90A 1UG7A 3JCZA 2W6IG 4LF6B 2R7SA 5JJJB 2WA4A 2IBFA 4E2LA 2DGJA 4K0DA 2B1IA 3MD0A 4JZGA 4O4IA 4DUYO 2CCYA 2Y39A 1A7DA 2Y48A 4JAAA 5C8YA 4KNVA 4EFBA 5E3CA 1U0BB 3RW0A 4FLUA 2CDQA 5LGUA 3AG2B 2ZE6A 4BIOA 2WZGA 2P4KA 3OUFA 4X1IA 4GEHA 1SF8A 1OR3A 2F4VB 2XXAA 2HVJC 3WHNA 4NTYA 1JRAA 3M7MX 1S0VA 1OXBA 3UGPA 3HR0A 2EPOA 3C8GB 3HLZA 3L34A 4JI2B 2EJ7A 4F6RB 1JPJA 2A79B 2F1MA 2R72A 5FPOA 2OQMA 2YRFA 1JPXA 3IQ5A 4JJGA 1FS0G 3SJAC 3IGAC 1T01A 1YDXA 5JCOC 1EQ1A 2XS1A 3TQOA 3B09A 2JDIG 4X9QA 1F51A 1YAUO 4KUMA 2XOKG 1GM7A 1M5IA 2CGEA 1RPOA 1LS1A 2P6VA 2GTSA 4DK0A 2AWCA 1FR0A 2Y3HA 2EINB 2UXCO 4UCUA 1YLMA 4FFBA 3G6EV 3HKBA 2CAZC 1NZEA 5TJ5E 1AILA 3JARB 4PDMA 2YXYA 2RQ6A 5A2QN 2EILC 4CS9C 3ZRVA 2UUCB 1FPOA 4FPPA 1C17M 4DR6O 3L0IA 2H7VC 4D4XA 2E5LO 1NT2B 4AQYB 1TKNA 2EIJB 4PA3A 1QVXA 5EC1C 1M6TA 5J2UA 5DVWA 3K06A 2AZ2A 1Y74A 3ZMSA 3T1HB 1WJZA 2RSEB 5IJ0A 1XNRB 3LNMB 4X64B 2A0UA 4DO2A 3CRRA 4CS8A 5LHGA 1YHQV 1K5QA 4LACB 4YN0B 1GN2A 4LERA 2PZSA 4XEKA 4QPJA 3IQTA 2YL1A 3K66A 1MMAA 4Q20A 2Q68A 3RYIB 4B08A 2OTJV 1VQ4V 2R7VA 4ZI7A 1I94B 2F93B 5CI8A 2XM4A 3RGBA 4U3FH 1BBHA 4DR7O 2NNUA 4YL1A 5JS5A 2VWKA 4RAIA 3GM3A 1GM9A 5LP6C 4D7SA 1WASA 5AC4A 1Q90D 3B8NA 3RYFA 3AG2C 2F43G 2LO1A 4CH5A 2PYJA 1WA8A 1BR1A 2OOCA 2WVOA 2FFHA 5EGYA 5IDJA 4RUFA 3FAJA 3AJMA 1IBLO 3AGUA 4G0HA 3JSLA 2FYUH 2XAFA 1M4UA 4QE7A 3MLGA 4NQFA 2CH7B 3JSZA 1SR2A 1HMOA 4ZOLB 2VQFB 3TXQA 3ZX6A 2AXTZ 3ZHTA 1RSOB 1HW7A 4QIWF 1B3QA 4O79A 4JRZA 4QE9A 2C03A 2F23A 4HFFB 4Q4ZF 2NLJC 2ZNJA 5IE9A 2E5LB 2LD6A 4LDQA 4I44A 4RDAA 3U2LA 3CS5A 1S05A 3A9CA 3ZQVA 3HKEA 5LHHA 3SXZA 2J46A 5T3WA 1IVSA 3DMDA 3RVYA 3CCLV 4RBNA 2JS5A 3EZIA 3O65A 4PA6A 2RN9A 1HW1A 2HR3A 4NXMO 4CS9A 3DE8A 3LDCA 4J42A 2XASA 4I4TA 3CXCU 1MMGA 1K4CC 3VQYA 1N36O 5BQHA 2XLWA 4KBLA 2X6CA 1Q43A 4MSWC 5BXZA 5LA6A 5JQGB 1LI7A 4OPAA 4YT2A 2EIKB 2Q4PA 5L0FA 5B66Z 2IU3A 2KB1A 2XLDA 4XEVA 3HKDB 5LOVB 1ORSC 3ZQYA 3RBZA 4BIUA 4O4IB 1RCPA 2Q0AA 1Y6DA 5D5PA 3RFYA 5C8YB 2BCCH 4JAUA 1MOFA 2OEXA 2UXDB 2D2CB 3DZAA 5L0IA 3M8AA 1OV9A 4K0KB 5EK0A 3M15A 3AG3B 4LFCB 2DI3A 5LHIA 5FZTA 4H33A 1FMVA 2YLDA 3OUSA 5F28E 4U7NA 1F4NA 3L75H 3T1HO 4PDLA 2KJGA 2CE4A 1BE3H 4E4EA 4DR5B 2DYSC 1ZVZA 3RT3C 4KNWA 3BRJA 1M2VA 4H37A 3QW0A 3CCSV 1CEZA 3HKBB 3ABUA 2F66C 3UCSC 4WFBV 1S5HC 3RH3A 1OCOC 1YSCA 5JVDB 2UUAO 2UXBO 4IRUA 5BMVA 1JOYA 3JALA 1D1CA 5KX5A 3JRMO 1SRYA 3MDSA 4YT5A 1M1KW 2XXAB 1Z2GA 4OIQF 3BPZA 4EHPA 3LJBA 2VS0A 2V4DA 1W0JG 3PMRA 2DJVA 3F5WC 4ZBMA 3Q4HA 2BL2A 5DN6G 1JMWA 3C8GA 2KSDA 3LLKA 1TVKB 1IXBA 1X4TA 2CGOA 1ZHYA 3Q7GA 4UV9A 2WAMA 4DYLA 5HV9A 2P6JA 1ZW3A 3JTLO 1W0KG 2IU0A 2EPNA 3BAAA 2ZT9B 4DV6B 2BSKB 3B40A 4JI6B 1T6UA 2NSFA 3H2VA 3CSXA 3K03A 4I50B 5EBLC 4GT1A 3LEOA 3K08A 2YDEA 3SXMA 3EQLF 3RYHA 4PA7A 4BW9A 1M57C 5K1PA 4G2KA 1XEQA 4L6RA 1GO3F 1W2WA 2VRZA 1K34A 2NUTB 4B3TO 2ODMA 2LFSA 5JWPA 4J10A 4J7JA 3ZBHA 3T2MA 1IX9A 2OIEA 1Y76B 3C3TA 4N23A 5EBWC 1KB9F 1I0HA 3CRAA 1PD0A 4NTBA 4JV5O 4CJGA 1L8DA 4LC1A 3ZVRA 1H7IA 3F5TA 2EINC 1RFYA 2Y3BA 5CIVA 4DUZB 3CE2A 3V7OA 3ABKC 3L73H 4OXSA 4PJNA 2M7WA 3ZJZA 2K9PA 3O9OA 4CJOA 4C7OA 1EKYA 4JI3B 3RIPA 1Z23A 1NTMH 3LSUA 4PHZA 3EG9A 2L35A 1NKDA 4I7ZB 1N0JA 1YXBA 3VQWA 5J9PC 2YVKA 3HKDA 1G4YB 5LOVA 2HV7A 2CUGA 3IQCA 3UO2A 4NXNO 3QMKA 4GLXA 2P1AA 2QUPA 2VCBA 3UQ8A 4I55B 3CCMV 1VK5A 2HJ3A 2J9WA 3JSNA 3MBGA 3HKCB 4CBCA 5E33A 2Q9LA 5KYUA 1U96A 3IC7A 1WWPA 4QGPA 2L6GA 4UV8A 3H65A 2Y0IA 4YXWG 4DV2B 5CA1B 2K1EA 2QR4A 3ZIBA 3JD0A 4BEJA 2Q8VA 4OD5A 3N2ZB 1BHBA 1VQMV 3R2PA 4IYHA 2NUPA 4FESA 2YL7A 2OT5A 4J41A 4MW8A 1VQKV 1A7EA 4DVYP 3VOUA 1S72V 4IGGA 2HHHB 2DYRB 3EZHA 3T1YO 4FFBB 1ZHWA 1J8MF 2Z15A 3GEHA 4J7ZA 2VWJA 4ICGA 4WJ0A 3S90A 4FIPC 1OW7A 4LLCA 3PHF2 4Z1VA 2Y3GA 1PD3A 1G6UA 4EEQA 3ZRWA 2E3CA 3A8TA 1XILA 3JASA 3AEIA 4LDRA 2ZM6B 3U5SA 4ASUG 2YWAA 3S3WA 2QE7G 3FOOA 2BSKA 5IYDO 1FAPB 3O6XA 3V5XA 2HUJA 4PJMA 3GWOA 3M99B 1HY5A 2N05A 4C3DA 4I0XB 2ZE7A 1ZYRF 2XRHA 3CRQA 1MZFA 3SJCC 3ZWIA 3SYOA 1DF5A 3ETEA 3G50A 1QLEB 2HV6A 2Q73A 3TJ6A 1NQTA 1WB7A 1BS3A 4Z9IA 4CBEA 2IJIA 2JEUA 1E79G 2AW9A 2VQEB 4RD9A 1SMYF 2Q3TA 4LF4B 3DXJF 3K6BA 4GX0A 1QSPA 5LGTA 3B77A 5KUKA 2KG7B 2CTWA 3NRHA 1TVKA 3JD1A 5JJNB 1NVPB 4KXRA 5B5EZ 4N4WA 1VIBA 5KYXB 2HG5C 4O2BB 2L7AA 5EBMC 1RJ9A 3O10A 2OYQA 1BGYH 1VMGA 5IJ9A 1XNQB 1UJWB 3QG5A 4PV1B 2RD9A 4XWJA 1LUVA 1VTMP 1MMNA 1K5SA 1NSGB 5FNVB 5K1XA 2UUIA 2QSAA 4I50A 1SERA 3PCVA 3W7UA 3TULA 1HR0B 2HMQA 5A6KA 2X6AA 3E8BA 2YHSA 3NKEA 3EXAA 4X65B 4RQEA 5KUMA 4GKJO 2A7WA 4BAYA 2ZNIA 4BJ5A 4PACA 3OEHG 3GM1A 4FLXA 2BTOA 4Z9JA 1PV0A 2F22A 5T3TA 3M1CB 3SP1A 1NZ6A 4GX1A 1KP3A 4R32A 1IBMB 1AVMA 4FFKA 3EFOA 3ZHRA 1XI1A 1OCRC 1JFFA 2Z3YA 1D5AA 2Q69A 4D7TA 3EGDA 2KC3A 4QI0A 4PFPA 3H1JH 4NR1A 4XDKA 4JI4O 1SQPH 4KFMA 2YIBD 4JYCA 4J7YA 1KNYA 3KPHA 4X1YA 2GBOA 4XPXA 5AC5A 2BTQB 1URFA 4B7KA 5L0GA 5EYPB 4CH4A 3FXHA 3NR7A 2OJQA 3C18A 4BPMA 4P2ZA 4JC7A 3SXKA 4XLNF 3ZIAG 2ZE5A 2W0FC 4LF7O 3SYNA 3WFVA 2HFEC 4JI7B 3N2GB 2QLAA 5CMUA 3HPLC 2H94A 4AILC 4C7UA 2WSSG 3CJHB 3E8GA 4C7OB 2AVKA 3US6A 2QE9A 1NVPD 4OX9B 4L87A 1N33B 3OMNB 1E1RG 1SQFA 2JK5C 1N33O 2Y0PA 2WLIB 4O4LA 1PNKA 3B8MA 5IJ0B 1LM3B 2Q00A 4CSAC 1VQOV 1K04A 4IHJA 2H7BA 3EGXB 3JYHA 3E22B 5B1OA 1PP9H 1YEWA 4MVUA 4E17A 1I08A 2HZ8A 3EHMA 3PJSK 1SZIA 2G3VA 3N2KA 1XREA 2XM0A 3MX3A 4WGYA 1VF6C 1P84F 4RQFA 1A32A 2PYLA 4A4AA 4LFBO 3S9OA 2DW4A 1KU9A 5DECA 5BY1A 2DWEC 2W4BA 3B2EE 1KTMA 1HE1A 2CYDA 3JAKA 2KW3C 1YARO 3FB6C 2ITDC 3ASOB 3RYCA 5LYJB 3ZSUA 2HJMA 4AL0A 4MTOA 2A0LA 4D4NA 3CYOA 4X1KA 4JE9A 4I5SA 4JPRA 2QTSA 1HWYA 5L3VA 3JASB 2X7RB 1Z3IX 1H38A 3M4BA 4XEFA 4I0XA 2OTLV 2O9XA 2IH1C 2HFIA 3FMSA 3EFFK 1S77D 2YQYA 4O6NA 1M90W 3JRTA 2KSFA 1QNMA 3HKCA 1Q81W 1K92A 2PX0A 3J06A 2RMKB 3KKBA 4DRXA 2HMZA 3W8IA 2QM4A 4GKKB 3NMJA 3ZHQA 1RP3B 3DTUB 2D4UA 4GKJB 3BY6A 3ZHVA 3CEXA 2M4EA 4E18A 4OGQB 3JCUQ 2IXMA 5H6QA 4YHHB 1ORQC 3NMKA 4R6ZA 2MHRA 5GPGB 1VQPV 1LE4A 1OKKD 2YSUB 3M79A 5CB4B 2H8AA 2BC5A 3RQEA 2P7TC 3H1HH 5LMNO 3LUTB 3QO7A 5JSLA 3E70C 3APOA 5KHIA 4IB4A 4FM0A 2E87A 3DWWA 3I56V 1ZHXA 1LIHA 5JVEA 5KMGA 1Q82W 1L1FA 1GN4A 2ZCEA 4QJFB 3IPMO 3I4UA 1EZJA 3RVZA 1LVKA 2JEXA 3ZTZA 2RDCA 4P9OA 1M56B 2IBZH 2Q7RA 3STLC 2BTQA 5IY5C 2A68F 2LCHA 4KL1A 4LBEC 1HW2A 1XQ8A 1JJOA 1VB5A 4B3MB 4DV1O 3WG7C 4LNUA 3E9VA 3ABMB 3RYLA 1JCHA 4I55A 3QO8A 1AP5A 1KKCA 2ADQB 3DJNB 1GKFA 5EC2C 2EIMB 1M93A 3SPCA 4X20B 1WGWA 2YEVB 4DJ9A 2H3OA 4NXMB 3R7CA 1B04A 2YUAA 3TOLA 2A1DD 2ZIOA 1YJGA 3GEIA 2AWYA 2A0BA 4XQ1A 4GYCB 3FOPA 2HJFC 1QKRA 3KYIA 1ENVA 5CBFA 3ZRSA 4I9QA 2V3CC 3FAVB 2JGUA 4PELA 1IDSA 2ZM6O 1D0YA 3GODA 2OJED 4XDJA 3JSEO 1QLEC 1NJIW 5E3AA 3U3BA 3SDLA 4XPYA 1ZLZA 2QTVA 1WAZA 1OXKA 1AJQA 4TQDA 1Q6UA 1OCZB 3OTOO 5EZYB 4GQHA 2XT9A 1F4MA 2WLJA 3B71A 4MTFA 2Y4TA 1RKCA 3UKMA 3JAKB 2ITCC 3OA1A 1CPQA 3QO5A 1Q3EA 2HHHO 4HNAB 4MVZA 1KC8W 4DUYB 2XNDG 1YYXA 3VYWA 4JW1A
chains in the Genus database with same CATH topology
2LFRA 1S3JA 3TETA 1FXHA 1V54B 4PDLA 2JIZG 3CCUV 2Y69B 2DYSC 2OCCC 4H37A 3CCSV 1CEZA 3G71V 3ABUA 3K0GA 1R3IC 5L3DA 1K4DC 4WFBV 3HB3B 1S5HC 1H8EG 1OCOC 1YSCA 4DXWA 5H9CA 1G8MA 4HAMA 1JOYA 1R3LC 4JYBA 1SRYA 1RM1C 1M1KW 2V7QG 1OCOB 1Q86W 4MVSA 2Q67A 4UVCA 1W0JG 3OAAG 1AROP 2Z5UA 3F5WC 4LCUC 4ZBMA 5DN6G 5KA5A 2WLMA 1QCEA 3T4ZA 4U7NA 5CBHA 3CCEV 4LP8A 4PA4A 4UV9A 2WAMA 3F7VC 2P6JA 1W0KG 4J9YB 2IU0A 4JF3A 4JTCB 2QKSA 1E1QG 4HYOA 1VQ7V 5LGNA 5B3SB 2D3OW 2WWWA 2XNDG 3K03A 5EBLC 2IW5A 4GT1A 4JASA 3K08A 5B3SC 3OM3B 2DYRC 3FB5C 4R7CA 1AI4A 4PA7A 1M57C 2IJKA 2OCCB 4G2KA 3LSQA 1GO3F 1GM8A 1P4RA 4Z1MG 4G27B 1K34A 1V55B 1MABG 1M57B 2LFSA 3ETDA 3E89A 3OW2U 2DWDC 3T2MA 3ABKB 4MVQA 2Y69C 1K97A 4N23A 5EBWC 2XAJA 1AR1B 2HLDG 1BHAA 1R6NA 1YJ9V 4UVAA 3ZRWB 2P67A 4PDVA 3K3WA 1TUEB 4FJCC 1JQ0A 3ZMUA 4LC1A 4JTAB 3DGEA 2ZXWC 3R65A 1IXMA 1FXKA 2EINC 5KA6A 2QEXV 4XDLA 5CN0A 3ABKC 4OXSA 3CMAV 2HVKC 3CCRV 2M7WA 2EIJC 2JJ1G 3ZJZA 4ZKIA 3FB7C 3E2EA 2P90A 4R50A 3K0DA 3CC2V 1YIJV 1NKDA 4GX2A 3OMIB 5J9PC 1G4YB 3E8FA 3AG1B 1QLNA 5IY5B 2WLNA 1V55C 2ZDIC 1MSWD 1JVMA 2IH3C 1K9MW 1Y66A 1H8HG 3CCMV 3CC7V 3ASOC 4UUJC 2EJRA 3ZMZA 4CBCA 2WLLA 3JD4A 4U7OA 2EIMC 1KKDA 3IC7A 1NH2B 1YTFD 3F7YC 4UV8A 5L3GA 4R8CA 3T1CA 4MVOA 4BW5A 1YI2V 1YJWV 1VQ8V 4YXWG 5DM6V 1VQ9V 2QM7A 2K1EA 3JD0A 3P30A 2MK3A 1R6KA 1BL8A 1BHBA 4WFAV 1VQMV 2ZXWB 3GB7C 4GX5A 1NR1A 2YEVA 2OT5A 1DF4A 2JJ2G 1H2GA 3OR7C 1R3KC 4MW8A 1VQKV 1LNQA 1RPRA 3VOUA 1S72V 1XL4A 1OCZC 2B5UA 2DYRB 3A0RA 4TT3G 1M56C 3K79A 1R73A 3E8HA 4GCZA 3QNEA 1NBMG 1BMFG 4FIPC 1QR9A 2ZDIA 5L3FA 4X8AA 1PD3A 2ZQMA 3ZRWA 5LBQA 3ASNC 1FXKC 5BZBA 1GMGA 1OCCB 3AEIA 3AG3C 3VBBA 2LP7A 3OEEG 4QPKA 4ASUG 2QE7G 1KECA 4TSFG 3AG1C 3NXSA 2BOBC 5IYDO 1K73W 1DTOA 3GWOA 3M99B 5L3CA 1FFTB 2W6JG 4FK5C 4PDRA 1RM1B 1EFRG 3EHBB 3SYOA 1DF5A 3ETEA 1QLEB 1NQTA 5L3BA 1S76D 3CCQV 2UXXA 2IJIA 2JEUA 1E79G 3W7WA 3D36A 4MVMA 1CPYA 2XAGA 1W2BU 3D3IA 4GX0A 1QVGU 2IJJA 4MTGA 1JJ2U 5LGTA 1VQ5V 3B77A 5KUKA 2EZOA 2WLLB 2CK3G 1OCRB 2QTOA 3H01A 2A9HA 2Q6AA 5IYCO 1XL6A 3JD1A 1NVPB 3TK1A 2HG5C 4TWKA 5EBMC 1FXVA 3E83A 1QR8A 1V54C 4MT8A 2XAHA 4EKWA 3SYPA 3SPHA 4CZZA 4P30A 1UJWB 3SPIA 4MS2A 1K5SA 1VQNV 3STZC 3W7XA 1SERA 5H6RA 2WLIA 1K3EA 3W7UA 1PL0A 1N8RW 1COWG 3SYQA 3E86A 4WFEA 4UVBA 2X6AA 3E8BA 1KQSU 2DYSB 3FYIB 4RQEA 3CP1A 5KUMA 3ETGA 3SJQC 4X89A 2BOCC 4BAYA 2EILB 3OEHG 3CD6V 2QA4V 3JCZA 2W6IG 2HKOA 2XAQA 3OGCC 5B1BC 3ASNB 4E2LA 4BIZA 2B1IA 3MD0A 3LDDA 4I9WA 2Y48A 1F23A 2DQ0A 4GX1A 1KP3A 2R9RB 3RW0A 5LGUA 3AG2B 2DQ3A 3FYEB 1OCRC 4WFHA 3MHSC 3OUFA 2Z3YA 3P32A 2Q69A 5B1NA 3ABLB 4XDKA 2HVJC 4XBFA 1VQ6V 1PKXA 4PA9A 3CMEV 1ROPA 4KFMA 3SYAA 1S0VA 4JYCA 3OE7G 5B1AB 2H8PC 1WPXA 3K04A 5CA3A 3SPGA 1PNLA 2A79B 3T4DA 3JD3A 1JPXA 2UXNA 4J9ZB 1FS0G 2ZD9A 3ABTA 4P2ZA 3IGAC 1NR7A 1AI5A 1AJNA 3LSSA 2W0FC 3ZIAG 3ZCCA 1GK9A 3WFVA 3ABLC 2HFEC 5CMUA 4QNHB 2JDIG 1F51A 2H94A 3HPLC 4KUMA 1SZTA 3CCJV 2XOKG 2WSSG 1GM7A 3E8GA 3FKSG 3OR6C 3UM7A 1NVPD 2ZR3A 4L87A 3SPJA 3W7SA 1AI6A 3OMNB 1RPOA 1E1RG 2JK5C 1WLEA 2WLIB 1PNKA 3B8MA 3ML0A 3JYCA 4KP4A 2EINB 4MVRA 5C93A 1VQOV 3G6EV 5B1OA 3X2QC 4MVUA 4PDMA 4JAVA 4RO2A 1GTOA 2X0LA 3PJSK 1EBOA 4UXNA 2EILC 3ZRVA 2X6BA 4RQFA 4FPPA 5HFMA 2DW4A 3OFNG 2DWEC 1R3JC 2GSMB 2EIJB 4PA3A 3FB6C 2ITDC 3ASOB 3OMAB 3SYCA 2V1DA 4MTOA 1CP9A 1M9NA 2A0LA 2WLHA 5EC1C 3CYOA 3K06A 4I5SA 4JPRA 3ZMSA 1HWYA 3K9AA 2X7RB 1I5XA 2ZR2A 1H38A 5IYBO 2WLKA 3LNMB 2B1GA 4DO2A 2EBOA 2OTLV 2IH1C 5LHGA 3EFFK 1YHQV 1K5QA 1Q7YW 1S77D 2KYHA 5L3EA 1M90W 1AJPA 5B1AC 4QPJA 1KD1W 1MG1A 1B6QA 1Q81W 1K92A 3WG7B 4Q20A 2Q68A 2OTJV 1Y4MA 1VQ4V 3DTUB 2EIKC 3CC4V 3BY6A 1NH2D 4HZ3A 1THZA 2C2AA 2NNUA 3TCUA 4P9PA 5H6QA 4RAIA 1ORQC 1GM9A 4R6ZA 4WFFA 3B8NA 3ZN1A 1VQPV 2YSUB 3AG2C 2F43G 2EZPA 3JD2A 2P7TC 4MTXA 1FXKB 1YTFB 3LUTB 3QO7A 2AHYA 5IDJA 4JTDB 1VQLV 4RUFA 3I55V 4N21A 5FL7G 3ZN0A 3I56V 2XAFA 4QE7A 3X2QB 5E1AC 5B1BB 1Q82W 1L1FA 4QJFB 1EZJA 3E35A 3RVZA 1K33A 1AI7A 2JEXA 4P9OA 3ABMC 1M56B 3STLC 4F4LA 5IY5C 4LBEC 2AHZA 1SETA 3WG7C 1ZWIC 3LDEA 3CCVV 4QIWF 2FTKA 3ABMB 1JCHA 3QO8A 4QE9A 3G4SV 4G28B 1GKFA 5EC2C 1J95A 2NLJC 2EIMB 1DLBA 1P7BA 3SPCA 5LHHA 2YEVB 3BEHA 1JX9A 3RVYA 3CCLV 1PNMA 4PA6A 2PI5A 1OZ0A 2HR3A 3LDCA 2XASA 4WFGA 1SESA 5GW7A 1OHHG 3AG4B 3IFXA 2HJFC 3CXCU 1ENVA 5CBFA 3ZRSA 4PELA 1K4CC 3KG2A 3AG4C 4WF9V 2X6CA 5CBGA 2R9IA 4XDJA 4MSWC 3ZMTA 1QVFU 1QLEC 4RUEA 3ZMVA 3MHHC 2EIKB 1QBZA 4MW3A 3ZRXA 1I5YA 1NJIW 2IU3A 2KB1A 1ORSC 1AJQA 3RBZA 4BIUA 1OCZB 2PI4A 4WCEV 1KP2A 3FB8C 4FMTA 4JAUA 1F4MA 1MOFA 2GHYA 2WPDG 2WLJA 4MTFA 2IJHA 4X88A 3UKMA 3W7TA 3CPWU 2ITCC 3QO5A 2ATKC 4JGSA 4MVZA 5EK0A 5HFLA 1YITV 1OCCC 3AG3B 1YJNV 5LHIA 1K8AW 1KC8W 4H33A 3OUSA 2QM8A 1F4NA 1K7DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EIM C;  1KKD A;  5B1A C;  3TET A;  4PDL A;  3F7Y C;  4R8C A;  3T1C A;  4MVO A;  2DYS C;  4BW5 A;  2OCC C;  2K1E A;  3OGC C;  5B1B C;  4H37 A;  2Q68 A;  1BL8 A;  3K0G A;  4GX5 A;  2EIK C;  3GB7 C;  1R3I C;  1K4D C;  2YEV A;  1S5H C;  3LDD A;  1OCO C;  3OR7 C;  4HZ3 A;  1R3K C;  4I9W A;  4MW8 A;  4DXW A;  4GX1 A;  1LNQ A;  3TCU A;  4P9P A;  3VOU A;  1XL4 A;  1OCZ C;  1R3L C;  4RAI A;  2R9R B;  1ORQ C;  4R6Z A;  4WFF A;  3RW0 A;  1M56 C;  4MVS A;  1OCR C;  2Q67 A;  3AG2 C;  4WFH A;  3OUF A;  3E8H A;  2Q69 A;  2P7T C;  3F5W C;  4LCU C;  4ZBM A;  4XDK A;  3LUT B;  2HVJ C;  2WLM A;  3T4Z A;  2AHY A;  4JTD B;  4X8A A;  4PA9 A;  5CBH A;  4RUF A;  4KFM A;  4LP8 A;  4PA4 A;  3SYA A;  3F7V C;  2H8P C;  3K04 A;  4J9Y B;  4QE7 A;  4JTC B;  2QKS A;  3ASN C;  4HYO A;  5BZB A;  5E1A C;  3SPG A;  2A79 B;  3AG3 C;  3RVZ A;  3T4D A;  4J9Z B;  3K03 A;  4P9O A;  3ABM C;  2ZD9 A;  5EBL C;  4P2Z A;  3IGA C;  3STL C;  4F4L A;  5IY5 C;  3K08 A;  5B3S C;  3AG1 C;  2AHZ A;  2DYR C;  2W0F C;  3FB5 C;  4LBE C;  2BOB C;  4PA7 A;  4R7C A;  3ABL C;  1M57 C;  2HFE C;  3WG7 C;  1ZWI C;  3LDE A;  3SJQ C;  4QNH B;  3HPL C;  4QE9 A;  4G27 B;  4G28 B;  5EC2 C;  3E8G A;  1J95 A;  2NLJ C;  4PDR A;  3OR6 C;  3E89 A;  1P7B A;  3SPC A;  3SYO A;  2DWD C;  3UM7 A;  3T2M A;  3SPJ A;  4MVQ A;  2JK5 C;  2Y69 C;  3BEH A;  2WLI B;  3RVY A;  4MVM A;  5EBW C;  3JYC A;  4PA6 A;  4MVR A;  4GX0 A;  4MTG A;  3LDC A;  4PDV A;  3X2Q C;  5KUK A;  4WFG A;  4MVU A;  2WLL B;  4PDM A;  2QTO A;  3IFX A;  4JTA B;  2HJF C;  2A9H A;  2ZXW C;  3R65 A;  3PJS K;  4RO2 A;  2Q6A A;  5CBF A;  3ZRS A;  1XL6 A;  2EIN C;  2EIL C;  1K4C C;  2X6B A;  3KG2 A;  4XDL A;  3AG4 C;  2HG5 C;  2X6C A;  4TWK A;  5CBG A;  4XDJ A;  4MSW C;  3ABK C;  4OXS A;  3E83 A;  5EBM C;  2HVK C;  1QLE C;  4RUE A;  2EIJ C;  1V54 C;  2DWE C;  4MW3 A;  3ZJZ A;  3SYP A;  4EKW A;  1R3J C;  2KB1 A;  3FB7 C;  3SPH A;  1ORS C;  3RBZ A;  4P30 A;  4R50 A;  3K0D A;  4PA3 A;  3FB6 C;  4MS2 A;  3SPI A;  2ITD C;  3FB8 C;  3SYC A;  4GX2 A;  3STZ C;  4MTO A;  5J9P C;  2WLJ A;  2WLH A;  2A0L A;  5EC1 C;  1G4Y B;  2WLI A;  4MTF A;  3E8F A;  3K06 A;  4X88 A;  3UKM A;  2ITC C;  3SYQ A;  3E86 A;  4WFE A;  2WLN A;  1V55 C;  1JVM A;  2ATK C;  2IH3 C;  4MVZ A;  5EK0 A;  2X6A A;  2WLK A;  3E8B A;  3ASO C;  3LNM B;  1OCC C;  4UUJ C;  2IH1 C;  2WLL A;  4H33 A;  4CBC A;  3EFF K;  3OUS A;  5KUM A;  4X89 A;  2BOC C;  2KYH A; 
#chains in the Genus database with same CATH topology
 2PGG A;  3FFQ A;  1VEW A;  3TET A;  1FXH A;  1V54 B;  4TV9 B;  2JIZ G;  1Z5Z A;  3L1M A;  1BR4 A;  3CCU V;  1VLS A;  2OCC C;  2DE0 X;  2QKA A;  2C04 A;  2WA3 A;  1ZHZ A;  3K0G A;  3N27 A;  5L0J A;  4IAR A;  1XDC A;  2QGN A;  1I94 O;  3HB3 B;  5CA0 A;  3MYF A;  4DXW A;  2GUZ A;  5H9C A;  3CEI A;  1G8M A;  2P22 C;  4HAM A;  4YT4 A;  4JYB A;  1RM1 C;  1D1B A;  2LK4 A;  4TOI A;  1FFT C;  4JUR I;  1U89 A;  1XOU A;  4LWS B;  1VF7 A;  2B9Z A;  3OAA G;  256B A;  3U10 A;  1N0N A;  2EUL A;  2X51 A;  1QCE A;  4CC6 A;  3EHN A;  4PJL A;  5DLJ A;  3F7V C;  2GDS A;  1V9P A;  4J9Y B;  4IL6 Z;  4JF3 A;  4JTC B;  3L71 H;  4FWV A;  1GAX A;  3FVY A;  3O39 A;  3QZC A;  1ZUQ A;  3RYI A;  4H13 B;  1XMQ B;  2CH7 A;  1CGN A;  4JAS A;  5B3S C;  2XUM A;  3OM3 B;  5J2U B;  4R7C A;  1AI4 A;  2VB6 A;  3ITF A;  4CS2 A;  2OCC B;  1HNX B;  2ZKO A;  3C62 A;  5COM A;  1P4R A;  4G27 B;  4JZA A;  4YJ3 A;  1V55 B;  1MAB G;  1VYK A;  3W4Y A;  1NTZ H;  3ETD A;  1XMO B;  3E89 A;  3OW2 U;  4KHP O;  1G1X B;  1NLX A;  1ZZP A;  3ABK B;  4OIR F;  4P9T A;  2YL0 A;  1E85 A;  4EBB A;  1XNQ O;  4O4J B;  3DAF A;  2UXC B;  1AR1 B;  1LUW A;  5LMU B;  3I5Q A;  2HLD G;  1R6N A;  1YJ9 V;  4UVA A;  2P67 A;  3K3W A;  2PF4 E;  1JQ0 A;  1Q0K A;  1GQA A;  3ZMU A;  4B3M O;  4J32 B;  2ZXW C;  4PK4 A;  5JP7 A;  5KYW A;  1DK1 A;  4DR3 B;  4DV6 O;  3T6J A;  4ZOL A;  4IWB A;  3NDB B;  1NU7 D;  2IM9 A;  4RWU A;  4FLT A;  1AUE A;  3J7A U;  4NKG B;  1M2V B;  2EIJ C;  1HP8 A;  4J11 A;  4O6Y A;  3E2E A;  3EJN A;  3N2K B;  4U5H A;  1BCC H;  4BJ6 C;  2VQE O;  4FLZ A;  3K0D A;  2L9J A;  3U3F A;  3OMI B;  1JR8 A;  1TAE A;  1XMO O;  1ZL8 A;  2XL4 A;  5IY5 B;  1H8H G;  4NTX A;  4TV8 B;  3CC7 V;  1HNX O;  2WLL A;  3WB1 A;  3J80 N;  2QY9 A;  3JD4 A;  5JJE B;  4U7O A;  2EIM C;  1KKD A;  2J8W A;  4NTA A;  1NH2 B;  2R7X A;  2JGD A;  4BW5 A;  5DM6 V;  4GKK O;  1N32 B;  4AK9 A;  4ANJ A;  2YI9 A;  3TJT A;  2G38 A;  2MK3 A;  4PJJ A;  1R6K A;  4JYA O;  1UPG A;  2ZXW B;  4GX5 A;  3VQV A;  1MNE A;  4CS8 C;  4N06 A;  3DJU B;  2YEV A;  1DF4 A;  2JJ2 G;  2GV9 A;  4FLW A;  1Z7Q c;  4JIO A;  3RF3 A;  1T9K A;  3FAV A;  4K0K O;  4X66 B;  4LFC O;  3EGX A;  3QW1 A;  3A0B Z;  1FNT c;  4UDV A;  1CXZ B;  1NBM G;  4JCZ A;  1VF6 A;  3I5D A;  5L3F A;  2ADP A;  5AGF A;  4DRH B;  3LNN A;  4OIO F;  2ZQM A;  4X62 B;  5J2T A;  3JZ0 A;  4H4K C;  1FXK C;  2M6Y A;  1OW8 A;  2ZIM A;  4UCR A;  1GMG A;  3AG3 C;  1RMV A;  3OEE G;  4BJ6 A;  2KNH A;  1KEC A;  3AG1 C;  3NXS A;  1S7Z A;  4B3R B;  4U5C E;  4EB6 B;  1GRJ A;  5L3C A;  2QWN B;  1FJG O;  2B0H A;  4FK5 C;  3EHB B;  3DD7 A;  4HEA J;  5L3Q A;  3POV A;  1DOW A;  2UXX A;  1CPY A;  2XAG A;  5KAF Z;  1W2B U;  4U9E A;  1QVG U;  4Q6G A;  4F6E A;  3VQX A;  2ZXR A;  3AK1 A;  1Y76 A;  2EZO A;  3ZHU A;  5L0D A;  2CK3 G;  1OCR B;  3D3Q A;  3B9Q A;  2QTO A;  3HTK C;  4DR1 B;  2HJD A;  3H01 A;  1GN6 A;  3WB0 A;  5A9G A;  1Z63 A;  2LP4 A;  2OCH A;  3TK1 A;  4JI1 O;  2P4V A;  5JH7 B;  4TWK A;  4O6M A;  1V54 C;  1IBL B;  4EKW A;  2YLI A;  3SYP A;  2ZPA A;  3OEO A;  4CZZ A;  2WZF A;  2OKU A;  3T1Y B;  1FFX A;  1T5E A;  1VQN V;  2YS8 A;  5LXT B;  2RJZ A;  1COW G;  4UVB A;  2YXH A;  1GH6 A;  3GVM A;  3C8G D;  2DYS B;  2WVN A;  3B0U X;  4AL1 A;  4UCO A;  3SJQ C;  3A11 A;  2BOC C;  4DV4 O;  2EIL B;  3RYH B;  1ZW2 A;  2QWP B;  1LKX A;  5ITZ B;  1MNG A;  3CD6 V;  1HNW B;  2QA4 V;  2BE3 A;  2XAQ A;  5B1B C;  1E2X A;  2CNW A;  3K1I C;  5KYY B;  3ASN B;  2P61 A;  3IAY A;  4BIZ A;  3U0Z A;  1YZA A;  2XLM A;  2QDO A;  3DAG A;  2DN9 A;  2Q9C A;  1S5L Z;  2AP3 A;  2WVQ A;  4I9W A;  5JLI A;  1F23 A;  3JAM N;  4W8P A;  1SA0 B;  4PI2 A;  4JI5 O;  3L8J A;  4JI3 O;  1EN6 A;  1BSM A;  3RWR D;  1XNR O;  3FYE B;  2Q4F A;  3MHS C;  3P32 A;  1HDJ A;  1DOV A;  5B1N A;  1WOL A;  4XBF A;  1N32 O;  4AHC A;  1VQ6 V;  4ONS A;  1PKX A;  4PA9 A;  4DR2 B;  3SYA A;  5HSW A;  2AZ0 A;  3BHP A;  3K04 A;  4I1M A;  3NYJ A;  1R6T A;  4DV3 B;  4IJJ A;  4DK1 A;  3V5Y A;  5A69 A;  2A6E F;  2PBE A;  3T4D A;  4ZI7 B;  3JD3 A;  4J9Z B;  4CDY A;  4FZ0 A;  2ZD9 A;  3ABT A;  1G4W R;  1NR7 A;  3U8P A;  1AI5 A;  2OWO A;  3ZCC A;  1GK9 A;  1TWA A;  1EN4 A;  3H1K H;  1EA8 A;  1G4U S;  1RJ9 B;  4QNH B;  1SQG A;  5L0H A;  4LF4 O;  4LFA O;  2Q7E A;  3FKS G;  1L0L H;  3SPJ A;  1BQZ A;  2VAS A;  2NSG A;  4ABM A;  1BZK A;  2JX0 A;  5IYZ A;  3ML0 A;  3JYC A;  4KP4 A;  3KZI Z;  4MVR A;  2A06 H;  4DW0 A;  3EVK A;  2NN4 A;  1R1B A;  5KHH A;  4JAV A;  1I4Y A;  4RO2 A;  3FAP B;  1HNZ B;  4JI0 B;  3QTH A;  2X6B A;  4AE4 A;  1EI7 A;  3ZTM A;  2E75 B;  5GTI Z;  5HFM A;  3DM9 B;  2LFD A;  1X59 A;  3AOU A;  5D91 A;  4BEM J;  1PCX A;  2GSM B;  3OWT A;  4DRJ B;  4O2B A;  3HKE B;  4TV8 A;  4W8K A;  4X0R A;  1M9N A;  2WLH A;  2P0N A;  3L8I A;  1YZC A;  1I5X A;  2ZR2 A;  1QU7 A;  4NTF A;  2EBO A;  4P9F A;  1Q7Y W;  4LF7 B;  2QWO B;  5L3E A;  2KYH A;  3U9J A;  1AJP A;  4G78 A;  1KD1 W;  3B4S A;  2R7T A;  5KMG B;  4LF6 O;  1Q0D A;  1VF5 B;  2LJ2 A;  1UFB A;  2UXD O;  2ZIN A;  4XLP F;  4CX9 A;  2DOS A;  2C2A A;  4P9P A;  4EB6 A;  4DR4 O;  1O3U A;  3ZS8 C;  5FNV A;  3GEE A;  3ZN1 A;  4YJ2 A;  4IAO A;  1Q6I A;  1Y74 B;  1KYO F;  2EZP A;  3FD9 A;  3ZG1 A;  4MTX A;  1YTF B;  4O7G A;  1VQL V;  1PL4 A;  3ICX A;  1JFF B;  2R7O A;  4Q5S F;  4TUY B;  3ZN0 A;  2GAQ A;  3G80 A;  2LIG A;  2ZXO A;  5E1A C;  5B1B B;  2BE5 F;  3TXS A;  4U5E E;  4L8J A;  4LF5 B;  3SEO A;  2Q7H A;  1RKE B;  3E35 A;  1K33 A;  1WB8 A;  1AI7 A;  5KHG A;  3ABM C;  2ILM A;  4EUK B;  2MW2 B;  4F4L A;  3PDM P;  2WZL A;  3TOM A;  1NG1 A;  1O9H A;  1SET A;  2FGY A;  1SQQ H;  2G3K A;  1YA9 A;  3OTO B;  1DGS A;  4DBR A;  3D36 C;  5E79 Z;  5EZY A;  5IJ9 B;  1DLB A;  1P7B A;  3N0T A;  1P7G A;  1MZE A;  4X1I B;  1EN5 A;  5COG A;  1JX9 A;  4JZ2 A;  2O57 A;  2PI5 A;  3C7J A;  4B3T B;  5JUA A;  1OZ0 A;  4DR6 B;  4W4L A;  4CH6 A;  1SES A;  1YVW A;  3AG4 B;  2QWQ B;  2W9Y A;  1KMI Z;  5KHJ A;  3DKA A;  5F5F A;  3BA8 A;  3OGI B;  1PM9 A;  3UT5 B;  4JI4 B;  3KG2 A;  3NKD A;  2G62 A;  4YL3 A;  3EFO B;  2R9I A;  3ZMT A;  4BR6 A;  1QVF U;  3ZMV A;  4RUE A;  3MHH C;  4MW3 A;  3WU2 Z;  1QBZ A;  1KBH A;  2NUP B;  4LFA B;  4UFZ A;  1OJH A;  5EIB D;  5JVD A;  2OU6 A;  1ORJ A;  2MYS A;  5B3I A;  3AQB A;  4IIJ A;  3K7D A;  4WCE V;  3LLI A;  1KP2 A;  3FB8 C;  4DV1 B;  2GHY A;  2GDC A;  1GGQ A;  2P06 A;  5D92 A;  2IJH A;  4X88 A;  2HEP A;  1Q0F A;  2ATK C;  4JGS A;  2F95 B;  2EPK X;  1J5E B;  5T1D B;  2IYL D;  3UR3 C;  4H0L B;  1YIT V;  4LH7 A;  4DBQ A;  3K1H A;  2QM8 A;  4B7E A;  3WAQ A;  1K7D A;  2Q5Z A;  5A6J A;  1S3J A;  2YXL A;  3ECS A;  3BCC H;  2Y69 B;  3WOD F;  4BJT A;  3SGI A;  2KQX A;  2H7O A;  3O55 A;  3G71 V;  1GN3 A;  3R66 A;  1R3I C;  3DI5 A;  4DVZ A;  1H8E G;  1US6 A;  3JAW A;  4JI5 B;  4YHH O;  3CSK A;  4LF9 O;  2V7Q G;  2ARH A;  1OCO B;  4B6I A;  1Q86 W;  3CB2 A;  2Q67 A;  4LH6 A;  4X20 A;  4LCU C;  3SZR A;  1AP6 A;  2WLM A;  1M2O A;  3S28 A;  3T4Z A;  1XZP A;  2LW7 A;  4JI8 B;  5CBH A;  5IWA O;  3U2M A;  4FVM A;  4LP8 A;  4PA4 A;  3IEE A;  3GWK C;  1NFN A;  4C3E A;  4DV7 O;  3MYI A;  3ZHS A;  2WB7 A;  2QKS A;  1D2D A;  4PD4 F;  3QVN A;  5LGN A;  5B3S B;  1TWH A;  1FMW A;  4CS4 A;  2JPU A;  4YIP A;  2D3O W;  2JRI A;  3K59 A;  3CQZ A;  4U5F E;  2DYR C;  2Q7G A;  4FZ1 A;  4EBK A;  2CGN A;  2IJK A;  4GZR B;  5LA6 B;  4K1O A;  1WP8 A;  1VYI A;  5H2F Z;  3AK3 A;  1GM8 A;  3CZ6 A;  1O9G A;  2IM8 A;  3FX7 A;  2HSQ A;  4Z2W A;  2P5O A;  5JCO A;  1WN7 A;  4JJF A;  1Q8I A;  2DWD C;  3OTF A;  2ETN A;  4NCQ A;  2NPU A;  3BFR A;  2WL8 A;  2Y69 C;  1AB3 A;  2UUB B;  1K97 A;  5GON A;  1J8Y F;  1Y4C A;  5BQG A;  4E7S A;  3EPV A;  1BHA A;  3LNR A;  3DXR A;  5DS6 A;  3ZRW B;  3UO3 A;  1TUE B;  1IBK O;  3DSQ A;  4TQF A;  4NTW A;  4JTA B;  3L9D A;  5IT9 N;  2IXN A;  2J7P A;  1IXM A;  5L0C A;  1FXK A;  4I3M A;  4TV9 A;  5KA6 A;  2TMV P;  3VM6 A;  4XDL A;  5CN0 A;  3M4C A;  1Q5O A;  2J0W A;  2YL3 A;  3CMA V;  2HVK C;  3CCR V;  1N34 O;  3SR2 C;  4Z9H A;  3UMK A;  4ZKI A;  3FB7 C;  4ZIB A;  3GM2 A;  1HMD A;  1L0N H;  1CGM E;  2J9B A;  3K5M A;  3CC2 V;  3A2F A;  4YY3 B;  4G7H F;  1TUB B;  1ZAU A;  4GX2 A;  5KX5 B;  1O5H A;  1JPN A;  3E8F A;  4AX2 A;  1QLN A;  4N6C A;  3I5P A;  2WLN A;  1V55 C;  2ZDI C;  5LL6 Y;  2E76 B;  2IH3 C;  1K9M W;  1Y66 A;  3F46 A;  4DV2 O;  2EJR A;  3ZMZ A;  2ETS A;  2KG7 A;  4LDK A;  4E0I A;  4DR7 B;  2R9A A;  4X1Y B;  2QJ1 A;  1YTF D;  4DR4 B;  2D5R B;  4P6I C;  4R8C A;  3DC6 A;  3T1C A;  1YI2 V;  1Z5W A;  2DMX A;  1VQ9 V;  4JYY A;  5F5H A;  3CX5 F;  3P30 A;  3KKY A;  3ETQ A;  4J30 B;  1V4A A;  1BL8 A;  4WFA V;  2HP8 A;  1NR1 A;  3KMI A;  4FLV A;  1H2G A;  3HJC A;  2CTP A;  1TWG A;  1EM1 A;  1SQB H;  1OCZ C;  4LNU B;  3A0R A;  1AEP A;  2YIB A;  1F1M A;  1NBB A;  3DE9 A;  2Q9B A;  1K05 A;  4GYT A;  3IJ4 A;  4K7B A;  2ZXP A;  3TK0 A;  2GUZ B;  1YCI A;  1R73 A;  4GCZ A;  1S5J A;  1BMF G;  1G5Z A;  1QR9 A;  3N24 A;  1SZX A;  2YIA A;  2ZDI A;  1QQ3 A;  3V5Z A;  5BUO A;  4X8A A;  2Y3D A;  4ZHQ A;  3W8H A;  3BRC A;  4E0H A;  4AQY O;  1RKE A;  1N34 B;  3E22 A;  3G4Z A;  3IQ6 A;  1Z5V A;  2FB5 A;  3JAR A;  4EWC A;  5BZB A;  1PPJ H;  1FTS A;  1OCC B;  3VBB A;  4DR5 O;  3HNI A;  4MND A;  1HR0 O;  4QPK A;  3BA9 A;  2PX3 A;  1W59 A;  3W2W A;  5JH7 A;  4TSF G;  2BOB C;  4YK5 A;  3A0H Z;  1DTO A;  3SJB C;  1D0Z A;  2UUH A;  3U11 A;  2UUB O;  4JI0 O;  1HNZ O;  1EFR G;  4DW1 A;  2M64 A;  3EGD B;  3X1O A;  5L3B A;  1S76 D;  3Q4H B;  3CCQ V;  3D36 A;  4MVM A;  1MSD A;  1SF9 A;  3FHD A;  4JI6 O;  1K40 A;  2R7R A;  5BQI A;  1XZQ A;  1CGO A;  1VQ5 V;  2L6H A;  2IOQ A;  5GON B;  2DB4 A;  4YT8 A;  1P49 A;  2Q6A A;  2FKX A;  4WGZ A;  1C03 A;  5DQZ A;  1YZB A;  2OG2 A;  1FXV A;  2RCV A;  1YF2 A;  4LWS A;  4HE8 D;  4MT8 A;  2XAH A;  3UT5 A;  1NFO A;  5IWA B;  1VAR A;  4JYA B;  4P30 A;  2PY5 A;  1LR1 A;  3SPI A;  3JAW B;  1SA0 A;  1XWJ A;  1I7F A;  3STZ C;  2UUA B;  4Q7C A;  5H6R A;  3CRC A;  5BR8 O;  4IAQ A;  2YLG A;  1N8R W;  3SYQ A;  1VOM A;  4XPW A;  3H1L H;  3TD7 A;  1A0B A;  3CAX A;  3QVZ A;  1XHZ A;  3T6G B;  1LS4 A;  3CP1 A;  2UU9 B;  4U3J A;  2CTR A;  5DQT A;  1Z6A A;  3AG7 A;  1NU1 H;  1Y67 A;  3PN1 A;  2GWW A;  1TR2 A;  1T6Q A;  5KYW B;  1G8X A;  2HKO A;  3OGC C;  3DC5 A;  4K8X A;  1QHT A;  1WP7 A;  3T6B A;  2YKZ A;  1BQ0 A;  1SC5 B;  3LDD A;  4C3B A;  4CIP A;  4I4T B;  4O4J A;  3UMH A;  2DQ0 A;  3N2G A;  4A5U B;  3K5N A;  2R9R B;  1WN0 A;  3UNG C;  4DR3 O;  1HNW O;  4X1K B;  1APC A;  3ATP A;  1ZSP A;  2DQ3 A;  1FYJ A;  4WFH A;  1ZHT A;  4NVP A;  2AGA A;  4DV4 B;  3ABL B;  3S84 A;  3L70 H;  1NTK H;  1H6G A;  2HSB A;  4ULV A;  4DRI B;  2A6H F;  3CME V;  1ROP A;  1ZX3 A;  2XLO A;  3OE7 G;  1SS3 A;  5B1A B;  2H8P C;  1WPX A;  1AR5 A;  3KCY A;  3THO A;  1V74 B;  3S0X A;  5CA3 A;  4U5G A;  4ZLD A;  2JGD B;  3KYJ A;  3SPG A;  2HKV A;  4YY3 O;  1PNL A;  5GTH Z;  1TWC A;  2JS3 A;  2UXN A;  3QTC A;  1FAF A;  2MWQ A;  3Q6M A;  1LI5 A;  2W4M A;  1AJN A;  2EX3 A;  3LSS A;  1QQC A;  1IZM A;  2Q9A A;  3ABL C;  4YIO A;  3G67 A;  3JAL B;  3U0C A;  4IYI A;  2YID A;  3OD4 A;  1SZT A;  3CCJ V;  1SYQ A;  2R05 A;  3CXH F;  1Q0G A;  1XUQ A;  3OR6 C;  3UM7 A;  1L7C A;  4DR1 O;  2ZR3 A;  2R02 A;  3S3X A;  3W7S A;  4CH3 A;  1AI6 A;  4PJ0 Z;  1IUR A;  2Q0O C;  4IT5 A;  4LF8 B;  4UCS A;  1WLE A;  3L74 H;  3P3N A;  4FAP B;  3H9V A;  4JKV A;  2VH3 A;  3HKK A;  5C93 A;  5F2V O;  4ULW A;  4J80 A;  3RQF A;  4CSA A;  3BAB A;  4BWA A;  3X2Q C;  1N4C A;  3ZDL A;  5J2T B;  3JAT B;  4EBJ A;  1GTO A;  1H2N A;  2X0L A;  1EBO A;  5JQG A;  3K1I A;  4UXN A;  1GS9 A;  5AG2 A;  4B3R O;  4DRX B;  1U6H A;  2L6L A;  2PTM A;  2IXP A;  1D5N A;  3OFN G;  3ZC4 A;  1R3J C;  5A6A A;  3B0P A;  2NUT A;  2LQG A;  1SQV H;  2FL4 A;  4ZHQ B;  3QVY A;  3NYL A;  3OMA B;  4X62 O;  3K57 A;  4F4B A;  3SYC A;  3RKO F;  1E84 A;  2V1D A;  2YZS A;  1CP9 A;  3NMI A;  4DOZ A;  5CB4 A;  3K9A A;  1QPU A;  3U9M A;  5IYB O;  2WLK A;  2B1G A;  2GFH A;  3JYY A;  1XBL A;  2YIC A;  3VAY A;  1SQX H;  5DS5 A;  4UB8 Z;  2OEV A;  5B1A C;  1OR2 A;  1D1A A;  3JT1 A;  1MG1 A;  2R25 A;  1B6Q A;  1BR2 A;  3HNL A;  4CIH A;  3EH1 A;  4X64 O;  3WG7 B;  4X66 O;  4A2N B;  4JI2 O;  1Y4M A;  3APQ A;  2W45 A;  4YL0 A;  2EIK C;  3CC4 V;  4U9D A;  1JAF A;  4U5B E;  1NH2 D;  4HZ3 A;  2J0X A;  1THZ A;  1OW6 A;  1FD9 A;  3TCU A;  4O2A B;  4DUZ O;  2YI8 A;  2R03 A;  2ZE8 A;  1SKV A;  4CS7 A;  4WFF A;  1N1C A;  4DV0 B;  4XTK A;  4YJW A;  4DV0 O;  5EHH A;  1ST6 A;  3JD2 A;  5BR8 B;  5LP6 B;  1KU2 A;  4PFO A;  1FXK B;  2UUC O;  5KAI Z;  2J45 A;  2AHY A;  5DS4 A;  1E83 A;  4JTD B;  2R7W A;  4H54 A;  3I55 V;  5KYU B;  1F7Y A;  4N21 A;  5FL7 G;  3MAQ A;  3Q6N A;  5EIB C;  3X2Q B;  4FM2 A;  4B3S B;  1OKK A;  5FCL A;  3LS1 A;  4FX5 A;  3RN4 A;  4O4H A;  4CC5 A;  5KHK A;  2KGO A;  4G7Z F;  3Q7L A;  3AGT A;  4LLE A;  3U8V A;  3W2V A;  2LGW A;  3MFN A;  5CI9 A;  2AHZ A;  2R7Q A;  1ZWI C;  3LDE A;  3CCV V;  4CDV A;  2FTK A;  3GOR A;  3G4S V;  4G28 B;  4IIJ B;  1J95 A;  4CS3 A;  4U3J B;  1MND A;  4LFB B;  4K35 A;  3LEV A;  1JA8 A;  4WBN B;  2KQ9 A;  3WB2 A;  3S27 A;  1JR9 A;  1MMD A;  3BEH A;  1N36 B;  5LMU O;  1WA8 B;  2IXO A;  1PNM A;  2VC9 A;  1VMA A;  4BJ1 A;  1R5I D;  1KUQ A;  4OPH A;  3BVO A;  4I1O B;  4B3S O;  2Y4U A;  5FLX N;  1A41 A;  2L81 A;  3AQC A;  4JEB A;  4WFG A;  2VCA A;  5GW7 A;  1OHH G;  3IFX A;  5IYZ B;  4KHP B;  4JVS A;  1NU9 C;  2EPM X;  2PNO A;  1IW7 F;  3SXY A;  3CRM A;  2GTA A;  3AG4 C;  4M63 A;  4ER9 A;  4WF9 V;  5CBG A;  2CNW D;  2FML A;  2R70 A;  5KYY A;  1XMQ O;  1ZTE A;  4OX9 O;  3ZRX A;  1I5Y A;  3C3S A;  5COF A;  1D0X A;  5TIS Z;  2OIG A;  1MQV A;  2PI4 A;  1H2L A;  1A7V A;  2PP4 A;  2ASR A;  4EIY A;  4LF5 O;  4PI0 A;  4FMT A;  3CWB H;  4K8Z A;  2WPD G;  3C63 A;  3CPW U;  3W7T A;  1WTY A;  5HFL A;  2N04 A;  1OCC C;  1YJN V;  1K8A W;  3NYM A;  2CW0 F;  1QZX A;  5K0I A;  3F47 A;  2LFR A;  4AI8 A;  4TUY A;  2J9V A;  1TFO B;  5KYX A;  3NG1 A;  4GUN A;  3L72 H;  1BZ4 A;  3IC9 A;  1H2M A;  4N6H A;  1VP7 A;  5L3D A;  1K4D C;  1C02 A;  3HNJ A;  4QDL A;  4QI2 A;  1R3L C;  4YJ3 B;  3B29 A;  2XHB A;  4OIN F;  1CPR A;  4MVS A;  2W0X A;  5E2Q A;  5JRA A;  2I15 A;  4UVC A;  1Y6X A;  3UGO A;  1ARO P;  2Z5U A;  5KA5 A;  3H1I H;  1NI8 A;  1Q0M A;  3CCE V;  1MMM A;  2QKC A;  1O87 A;  1OQC A;  1E1Q G;  4HYO A;  4JI1 B;  1YA7 O;  4HBN A;  4NC3 A;  1VQ7 V;  4X65 O;  3EH2 A;  3T4R A;  5FPR A;  2B0J A;  4H44 B;  3TJ5 A;  3JAT A;  2WWW A;  2LSE A;  2CDY A;  1WNS A;  2IW5 A;  2KK1 A;  1LE2 A;  1TFK B;  3FB5 C;  2UU9 O;  5CA0 B;  1B68 A;  3LSQ A;  2J9U A;  5BMV B;  1L3P A;  3VRC A;  4UB6 Z;  4Z1M G;  1IBK B;  5D5Q A;  1RXQ A;  3KH2 A;  1M57 B;  2LQT A;  1TA8 A;  3RFR A;  2XL8 A;  2X0C A;  2NR5 A;  2RNB A;  3KL4 A;  3B0V C;  3ZED A;  4MVQ A;  5LXT A;  1FJG B;  2XAJ A;  1HE9 A;  2A69 F;  4PDV A;  4FJC C;  4J7K A;  4F6R A;  4J7T A;  2LW1 A;  3GAN A;  1I4Z A;  3DGE A;  3KCX A;  2PUS A;  5LP6 A;  3R65 A;  1Q6H A;  3LS0 A;  1YYJ A;  2QEX V;  3H2U A;  4YJ2 B;  4LR3 A;  2XL6 A;  4FM1 A;  2L6F A;  2JJ1 G;  2P7V A;  2JVD A;  1B06 A;  4DV7 B;  4JI8 O;  3DM5 A;  2P90 A;  5EYP A;  4R50 A;  4OIP F;  3LES A;  3VF0 A;  1YIJ V;  1ZU5 A;  4DV3 O;  1H2S B;  3AG1 B;  1TQG A;  3K58 A;  1AR4 A;  4MQ9 F;  3K5O A;  1MSW D;  3P3P A;  1JVM A;  4BG0 A;  3D8C A;  4DR2 O;  3G6B A;  4W4K A;  3GWL A;  1UFI A;  3ASO C;  4LF9 B;  5A6B A;  4UUJ C;  2KKW A;  3K5L A;  5LMN B;  2Z0A A;  3T9O A;  4JEA A;  2GA0 A;  1VLT A;  4U5D E;  3F7Y C;  2CTQ A;  5L3G A;  1BT8 A;  2XTA A;  2V26 A;  3RQG A;  4MVO A;  1YJW V;  1VQ8 V;  2UXB B;  4KC9 A;  4UCT A;  2QM7 A;  1EZV H;  3G4X A;  4O2A A;  4E7Z A;  2XS8 A;  3GB7 C;  2YC0 A;  4HFK B;  1H9T A;  3OR7 C;  1R3K C;  2FAP B;  3GWN A;  1LNQ A;  1U97 A;  1RPR A;  3RYC B;  1J5E O;  1XL4 A;  2B5U A;  1WAT A;  3EG9 B;  4TT3 G;  2N74 A;  1M56 C;  1R4T A;  3K79 A;  4EFE A;  2LFF A;  3E8H A;  1FKA O;  3QNE A;  2R7U A;  4HNA A;  5A6B D;  3J81 N;  1TGO A;  4JCH A;  1ZU4 A;  3TGU H;  4IHJ B;  5ITZ A;  3DXR B;  1WPB A;  5LBQ A;  3ASN C;  1H2K A;  1MA1 A;  1T6I A;  1I5N A;  5CA1 A;  4D6T H;  2LP7 A;  1LPE A;  1JMK C;  4PR9 A;  4AE4 B;  4NXN B;  3CJH A;  3AK2 A;  3SNH A;  1YDI A;  4YWQ A;  1K73 W;  2ICW G;  4DV5 B;  5KLV H;  4WBN A;  1ORY A;  3IHU A;  3FDQ A;  4CDA A;  1FFT B;  2W6J G;  2J7P D;  1BDJ B;  1FFX B;  2XLE A;  4PDR A;  3RYF B;  3C8Z A;  4FLY A;  1RM1 B;  1H9G A;  2AU5 A;  1IZ3 A;  5LYJ A;  2JD3 A;  4LF8 O;  1TUB A;  5DED A;  1ZL8 B;  1PD1 A;  3W7W A;  3HNK A;  2VCC A;  3D3I A;  1GM5 A;  1XHX A;  2IJJ A;  4MTG A;  1JJ2 U;  1T5O A;  2F4V O;  5H5N A;  2WLL B;  3QF7 A;  4JV5 B;  1PV3 A;  3JCU Z;  2XSE A;  2A9H A;  1JOG A;  4NYK A;  5IYC O;  1XL6 A;  2EPL X;  2LGQ A;  4NY3 A;  2XLH A;  4JI7 O;  3OT7 A;  2VQF O;  3E83 A;  2HS5 A;  1QR8 A;  4OD4 A;  2I8B A;  3SPH A;  2E74 B;  1NS1 A;  3S29 A;  4K3A A;  4MS2 A;  3K9S A;  4NB5 A;  2QNL A;  5JT4 A;  2NG1 A;  2QWR B;  4DV5 O;  3W7X A;  3K33 A;  1YVI A;  2WLI A;  4O4L B;  1K3E A;  1PL0 A;  3E86 A;  1RSO A;  4WFE A;  4KI2 A;  3UMI A;  4WAB A;  4ZLC A;  4O4H B;  1KQS U;  3FYI B;  2XLV A;  5KYN A;  3CHX A;  3ETG A;  4X89 A;  1FFH A;  4G7O F;  4UCV A;  3LAY A;  4BJ5 C;  1E86 A;  2A3Q A;  2PFD A;  1IBM O;  1AVO B;  3C90 A;  1UG7 A;  3JCZ A;  2W6I G;  4LF6 B;  2R7S A;  5JJJ B;  2WA4 A;  2IBF A;  4E2L A;  2DGJ A;  4K0D A;  2B1I A;  3MD0 A;  4JZG A;  4O4I A;  4DUY O;  2CCY A;  2Y39 A;  1A7D A;  2Y48 A;  4JAA A;  5C8Y A;  4KNV A;  4EFB A;  5E3C A;  1U0B B;  3RW0 A;  4FLU A;  2CDQ A;  5LGU A;  3AG2 B;  2ZE6 A;  4BIO A;  2WZG A;  2P4K A;  3OUF A;  4X1I A;  4GEH A;  1SF8 A;  1OR3 A;  2F4V B;  2XXA A;  2HVJ C;  3WHN A;  4NTY A;  1JRA A;  3M7M X;  1S0V A;  1OXB A;  3UGP A;  3HR0 A;  2EPO A;  3C8G B;  3HLZ A;  3L34 A;  4JI2 B;  2EJ7 A;  4F6R B;  1JPJ A;  2A79 B;  2F1M A;  2R72 A;  5FPO A;  2OQM A;  2YRF A;  1JPX A;  3IQ5 A;  4JJG A;  1FS0 G;  3SJA C;  3IGA C;  1T01 A;  1YDX A;  5JCO C;  1EQ1 A;  2XS1 A;  3TQO A;  3B09 A;  2JDI G;  4X9Q A;  1F51 A;  1YAU O;  4KUM A;  2XOK G;  1GM7 A;  1M5I A;  2CGE A;  1RPO A;  1LS1 A;  2P6V A;  2GTS A;  4DK0 A;  2AWC A;  1FR0 A;  2Y3H A;  2EIN B;  2UXC O;  4UCU A;  1YLM A;  4FFB A;  3G6E V;  3HKB A;  2CAZ C;  1NZE A;  5TJ5 E;  1AIL A;  3JAR B;  4PDM A;  2YXY A;  2RQ6 A;  5A2Q N;  2EIL C;  4CS9 C;  3ZRV A;  2UUC B;  1FPO A;  4FPP A;  1C17 M;  4DR6 O;  3L0I A;  2H7V C;  4D4X A;  2E5L O;  1NT2 B;  4AQY B;  1TKN A;  2EIJ B;  4PA3 A;  1QVX A;  5EC1 C;  1M6T A;  5J2U A;  5DVW A;  3K06 A;  2AZ2 A;  1Y74 A;  3ZMS A;  3T1H B;  1WJZ A;  2RSE B;  5IJ0 A;  1XNR B;  3LNM B;  4X64 B;  2A0U A;  4DO2 A;  3CRR A;  4CS8 A;  5LHG A;  1YHQ V;  1K5Q A;  4LAC B;  4YN0 B;  1GN2 A;  4LER A;  2PZS A;  4XEK A;  4QPJ A;  3IQT A;  2YL1 A;  3K66 A;  1MMA A;  4Q20 A;  2Q68 A;  3RYI B;  4B08 A;  2OTJ V;  1VQ4 V;  2R7V A;  4ZI7 A;  1I94 B;  2F93 B;  5CI8 A;  2XM4 A;  3RGB A;  4U3F H;  1BBH A;  4DR7 O;  2NNU A;  4YL1 A;  5JS5 A;  2VWK A;  4RAI A;  3GM3 A;  1GM9 A;  5LP6 C;  4D7S A;  1WAS A;  5AC4 A;  1Q90 D;  3B8N A;  3RYF A;  3AG2 C;  2F43 G;  2LO1 A;  4CH5 A;  2PYJ A;  1WA8 A;  1BR1 A;  2OOC A;  2WVO A;  2FFH A;  5EGY A;  5IDJ A;  4RUF A;  3FAJ A;  3AJM A;  1IBL O;  3AGU A;  4G0H A;  3JSL A;  2FYU H;  2XAF A;  1M4U A;  4QE7 A;  3MLG A;  4NQF A;  2CH7 B;  3JSZ A;  1SR2 A;  1HMO A;  4ZOL B;  2VQF B;  3TXQ A;  3ZX6 A;  2AXT Z;  3ZHT A;  1RSO B;  1HW7 A;  4QIW F;  1B3Q A;  4O79 A;  4JRZ A;  4QE9 A;  2C03 A;  2F23 A;  4HFF B;  4Q4Z F;  2NLJ C;  2ZNJ A;  5IE9 A;  2E5L B;  2LD6 A;  4LDQ A;  4I44 A;  4RDA A;  3U2L A;  3CS5 A;  1S05 A;  3A9C A;  3ZQV A;  3HKE A;  5LHH A;  3SXZ A;  2J46 A;  5T3W A;  1IVS A;  3DMD A;  3RVY A;  3CCL V;  4RBN A;  2JS5 A;  3EZI A;  3O65 A;  4PA6 A;  2RN9 A;  1HW1 A;  2HR3 A;  4NXM O;  4CS9 A;  3DE8 A;  3LDC A;  4J42 A;  2XAS A;  4I4T A;  3CXC U;  1MMG A;  1K4C C;  3VQY A;  1N36 O;  5BQH A;  2XLW A;  4KBL A;  2X6C A;  1Q43 A;  4MSW C;  5BXZ A;  5LA6 A;  5JQG B;  1LI7 A;  4OPA A;  4YT2 A;  2EIK B;  2Q4P A;  5L0F A;  5B66 Z;  2IU3 A;  2KB1 A;  2XLD A;  4XEV A;  3HKD B;  5LOV B;  1ORS C;  3ZQY A;  3RBZ A;  4BIU A;  4O4I B;  1RCP A;  2Q0A A;  1Y6D A;  5D5P A;  3RFY A;  5C8Y B;  2BCC H;  4JAU A;  1MOF A;  2OEX A;  2UXD B;  2D2C B;  3DZA A;  5L0I A;  3M8A A;  1OV9 A;  4K0K B;  5EK0 A;  3M15 A;  3AG3 B;  4LFC B;  2DI3 A;  5LHI A;  5FZT A;  4H33 A;  1FMV A;  2YLD A;  3OUS A;  5F28 E;  4U7N A;  1F4N A;  3L75 H;  3T1H O;  4PDL A;  2KJG A;  2CE4 A;  1BE3 H;  4E4E A;  4DR5 B;  2DYS C;  1ZVZ A;  3RT3 C;  4KNW A;  3BRJ A;  1M2V A;  4H37 A;  3QW0 A;  3CCS V;  1CEZ A;  3HKB B;  3ABU A;  2F66 C;  3UCS C;  4WFB V;  1S5H C;  3RH3 A;  1OCO C;  1YSC A;  5JVD B;  2UUA O;  2UXB O;  4IRU A;  5BMV A;  1JOY A;  3JAL A;  1D1C A;  5KX5 A;  3JRM O;  1SRY A;  3MDS A;  4YT5 A;  1M1K W;  2XXA B;  1Z2G A;  4OIQ F;  3BPZ A;  4EHP A;  3LJB A;  2VS0 A;  2V4D A;  1W0J G;  3PMR A;  2DJV A;  3F5W C;  4ZBM A;  3Q4H A;  2BL2 A;  5DN6 G;  1JMW A;  3C8G A;  2KSD A;  3LLK A;  1TVK B;  1IXB A;  1X4T A;  2CGO A;  1ZHY A;  3Q7G A;  4UV9 A;  2WAM A;  4DYL A;  5HV9 A;  2P6J A;  1ZW3 A;  3JTL O;  1W0K G;  2IU0 A;  2EPN A;  3BAA A;  2ZT9 B;  4DV6 B;  2BSK B;  3B40 A;  4JI6 B;  1T6U A;  2NSF A;  3H2V A;  3CSX A;  3K03 A;  4I50 B;  5EBL C;  4GT1 A;  3LEO A;  3K08 A;  2YDE A;  3SXM A;  3EQL F;  3RYH A;  4PA7 A;  4BW9 A;  1M57 C;  5K1P A;  4G2K A;  1XEQ A;  4L6R A;  1GO3 F;  1W2W A;  2VRZ A;  1K34 A;  2NUT B;  4B3T O;  2ODM A;  2LFS A;  5JWP A;  4J10 A;  4J7J A;  3ZBH A;  3T2M A;  1IX9 A;  2OIE A;  1Y76 B;  3C3T A;  4N23 A;  5EBW C;  1KB9 F;  1I0H A;  3CRA A;  1PD0 A;  4NTB A;  4JV5 O;  4CJG A;  1L8D A;  4LC1 A;  3ZVR A;  1H7I A;  3F5T A;  2EIN C;  1RFY A;  2Y3B A;  5CIV A;  4DUZ B;  3CE2 A;  3V7O A;  3ABK C;  3L73 H;  4OXS A;  4PJN A;  2M7W A;  3ZJZ A;  2K9P A;  3O9O A;  4CJO A;  4C7O A;  1EKY A;  4JI3 B;  3RIP A;  1Z23 A;  1NTM H;  3LSU A;  4PHZ A;  3EG9 A;  2L35 A;  1NKD A;  4I7Z B;  1N0J A;  1YXB A;  3VQW A;  5J9P C;  2YVK A;  3HKD A;  1G4Y B;  5LOV A;  2HV7 A;  2CUG A;  3IQC A;  3UO2 A;  4NXN O;  3QMK A;  4GLX A;  2P1A A;  2QUP A;  2VCB A;  3UQ8 A;  4I55 B;  3CCM V;  1VK5 A;  2HJ3 A;  2J9W A;  3JSN A;  3MBG A;  3HKC B;  4CBC A;  5E33 A;  2Q9L A;  5KYU A;  1U96 A;  3IC7 A;  1WWP A;  4QGP A;  2L6G A;  4UV8 A;  3H65 A;  2Y0I A;  4YXW G;  4DV2 B;  5CA1 B;  2K1E A;  2QR4 A;  3ZIB A;  3JD0 A;  4BEJ A;  2Q8V A;  4OD5 A;  3N2Z B;  1BHB A;  1VQM V;  3R2P A;  4IYH A;  2NUP A;  4FES A;  2YL7 A;  2OT5 A;  4J41 A;  4MW8 A;  1VQK V;  1A7E A;  4DVY P;  3VOU A;  1S72 V;  4IGG A;  2HHH B;  2DYR B;  3EZH A;  3T1Y O;  4FFB B;  1ZHW A;  1J8M F;  2Z15 A;  3GEH A;  4J7Z A;  2VWJ A;  4ICG A;  4WJ0 A;  3S90 A;  4FIP C;  1OW7 A;  4LLC A;  3PHF 2;  4Z1V A;  2Y3G A;  1PD3 A;  1G6U A;  4EEQ A;  3ZRW A;  2E3C A;  3A8T A;  1XIL A;  3JAS A;  3AEI A;  4LDR A;  2ZM6 B;  3U5S A;  4ASU G;  2YWA A;  3S3W A;  2QE7 G;  3FOO A;  2BSK A;  5IYD O;  1FAP B;  3O6X A;  3V5X A;  2HUJ A;  4PJM A;  3GWO A;  3M99 B;  1HY5 A;  2N05 A;  4C3D A;  4I0X B;  2ZE7 A;  1ZYR F;  2XRH A;  3CRQ A;  1MZF A;  3SJC C;  3ZWI A;  3SYO A;  1DF5 A;  3ETE A;  3G50 A;  1QLE B;  2HV6 A;  2Q73 A;  3TJ6 A;  1NQT A;  1WB7 A;  1BS3 A;  4Z9I A;  4CBE A;  2IJI A;  2JEU A;  1E79 G;  2AW9 A;  2VQE B;  4RD9 A;  1SMY F;  2Q3T A;  4LF4 B;  3DXJ F;  3K6B A;  4GX0 A;  1QSP A;  5LGT A;  3B77 A;  5KUK A;  2KG7 B;  2CTW A;  3NRH A;  1TVK A;  3JD1 A;  5JJN B;  1NVP B;  4KXR A;  5B5E Z;  4N4W A;  1VIB A;  5KYX B;  2HG5 C;  4O2B B;  2L7A A;  5EBM C;  1RJ9 A;  3O10 A;  2OYQ A;  1BGY H;  1VMG A;  5IJ9 A;  1XNQ B;  1UJW B;  3QG5 A;  4PV1 B;  2RD9 A;  4XWJ A;  1LUV A;  1VTM P;  1MMN A;  1K5S A;  1NSG B;  5FNV B;  5K1X A;  2UUI A;  2QSA A;  4I50 A;  1SER A;  3PCV A;  3W7U A;  3TUL A;  1HR0 B;  2HMQ A;  5A6K A;  2X6A A;  3E8B A;  2YHS A;  3NKE A;  3EXA A;  4X65 B;  4RQE A;  5KUM A;  4GKJ O;  2A7W A;  4BAY A;  2ZNI A;  4BJ5 A;  4PAC A;  3OEH G;  3GM1 A;  4FLX A;  2BTO A;  4Z9J A;  1PV0 A;  2F22 A;  5T3T A;  3M1C B;  3SP1 A;  1NZ6 A;  4GX1 A;  1KP3 A;  4R32 A;  1IBM B;  1AVM A;  4FFK A;  3EFO A;  3ZHR A;  1XI1 A;  1OCR C;  1JFF A;  2Z3Y A;  1D5A A;  2Q69 A;  4D7T A;  3EGD A;  2KC3 A;  4QI0 A;  4PFP A;  3H1J H;  4NR1 A;  4XDK A;  4JI4 O;  1SQP H;  4KFM A;  2YIB D;  4JYC A;  4J7Y A;  1KNY A;  3KPH A;  4X1Y A;  2GBO A;  4XPX A;  5AC5 A;  2BTQ B;  1URF A;  4B7K A;  5L0G A;  5EYP B;  4CH4 A;  3FXH A;  3NR7 A;  2OJQ A;  3C18 A;  4BPM A;  4P2Z A;  4JC7 A;  3SXK A;  4XLN F;  3ZIA G;  2ZE5 A;  2W0F C;  4LF7 O;  3SYN A;  3WFV A;  2HFE C;  4JI7 B;  3N2G B;  2QLA A;  5CMU A;  3HPL C;  2H94 A;  4AIL C;  4C7U A;  2WSS G;  3CJH B;  3E8G A;  4C7O B;  2AVK A;  3US6 A;  2QE9 A;  1NVP D;  4OX9 B;  4L87 A;  1N33 B;  3OMN B;  1E1R G;  1SQF A;  2JK5 C;  1N33 O;  2Y0P A;  2WLI B;  4O4L A;  1PNK A;  3B8M A;  5IJ0 B;  1LM3 B;  2Q00 A;  4CSA C;  1VQO V;  1K04 A;  4IHJ A;  2H7B A;  3EGX B;  3JYH A;  3E22 B;  5B1O A;  1PP9 H;  1YEW A;  4MVU A;  4E17 A;  1I08 A;  2HZ8 A;  3EHM A;  3PJS K;  1SZI A;  2G3V A;  3N2K A;  1XRE A;  2XM0 A;  3MX3 A;  4WGY A;  1VF6 C;  1P84 F;  4RQF A;  1A32 A;  2PYL A;  4A4A A;  4LFB O;  3S9O A;  2DW4 A;  1KU9 A;  5DEC A;  5BY1 A;  2DWE C;  2W4B A;  3B2E E;  1KTM A;  1HE1 A;  2CYD A;  3JAK A;  2KW3 C;  1YAR O;  3FB6 C;  2ITD C;  3ASO B;  3RYC A;  5LYJ B;  3ZSU A;  2HJM A;  4AL0 A;  4MTO A;  2A0L A;  4D4N A;  3CYO A;  4X1K A;  4JE9 A;  4I5S A;  4JPR A;  2QTS A;  1HWY A;  5L3V A;  3JAS B;  2X7R B;  1Z3I X;  1H38 A;  3M4B A;  4XEF A;  4I0X A;  2OTL V;  2O9X A;  2IH1 C;  2HFI A;  3FMS A;  3EFF K;  1S77 D;  2YQY A;  4O6N A;  1M90 W;  3JRT A;  2KSF A;  1QNM A;  3HKC A;  1Q81 W;  1K92 A;  2PX0 A;  3J06 A;  2RMK B;  3KKB A;  4DRX A;  2HMZ A;  3W8I A;  2QM4 A;  4GKK B;  3NMJ A;  3ZHQ A;  1RP3 B;  3DTU B;  2D4U A;  4GKJ B;  3BY6 A;  3ZHV A;  3CEX A;  2M4E A;  4E18 A;  4OGQ B;  3JCU Q;  2IXM A;  5H6Q A;  4YHH B;  1ORQ C;  3NMK A;  4R6Z A;  2MHR A;  5GPG B;  1VQP V;  1LE4 A;  1OKK D;  2YSU B;  3M79 A;  5CB4 B;  2H8A A;  2BC5 A;  3RQE A;  2P7T C;  3H1H H;  5LMN O;  3LUT B;  3QO7 A;  5JSL A;  3E70 C;  3APO A;  5KHI A;  4IB4 A;  4FM0 A;  2E87 A;  3DWW A;  3I56 V;  1ZHX A;  1LIH A;  5JVE A;  5KMG A;  1Q82 W;  1L1F A;  1GN4 A;  2ZCE A;  4QJF B;  3IPM O;  3I4U A;  1EZJ A;  3RVZ A;  1LVK A;  2JEX A;  3ZTZ A;  2RDC A;  4P9O A;  1M56 B;  2IBZ H;  2Q7R A;  3STL C;  2BTQ A;  5IY5 C;  2A68 F;  2LCH A;  4KL1 A;  4LBE C;  1HW2 A;  1XQ8 A;  1JJO A;  1VB5 A;  4B3M B;  4DV1 O;  3WG7 C;  4LNU A;  3E9V A;  3ABM B;  3RYL A;  1JCH A;  4I55 A;  3QO8 A;  1AP5 A;  1KKC A;  2ADQ B;  3DJN B;  1GKF A;  5EC2 C;  2EIM B;  1M93 A;  3SPC A;  4X20 B;  1WGW A;  2YEV B;  4DJ9 A;  2H3O A;  4NXM B;  3R7C A;  1B04 A;  2YUA A;  3TOL A;  2A1D D;  2ZIO A;  1YJG A;  3GEI A;  2AWY A;  2A0B A;  4XQ1 A;  4GYC B;  3FOP A;  2HJF C;  1QKR A;  3KYI A;  1ENV A;  5CBF A;  3ZRS A;  4I9Q A;  2V3C C;  3FAV B;  2JGU A;  4PEL A;  1IDS A;  2ZM6 O;  1D0Y A;  3GOD A;  2OJE D;  4XDJ A;  3JSE O;  1QLE C;  1NJI W;  5E3A A;  3U3B A;  3SDL A;  4XPY A;  1ZLZ A;  2QTV A;  1WAZ A;  1OXK A;  1AJQ A;  4TQD A;  1Q6U A;  1OCZ B;  3OTO O;  5EZY B;  4GQH A;  2XT9 A;  1F4M A;  2WLJ A;  3B71 A;  4MTF A;  2Y4T A;  1RKC A;  3UKM A;  3JAK B;  2ITC C;  3OA1 A;  1CPQ A;  3QO5 A;  1Q3E A;  2HHH O;  4HNA B;  4MVZ A;  1KC8 W;  4DUY B;  2XND G;  1YYX A;  3VYW A;  4JW1 A; 
#chains in the Genus database with same CATH homology
 2LFR A;  1S3J A;  3TET A;  1FXH A;  1V54 B;  4PDL A;  2JIZ G;  3CCU V;  2Y69 B;  2DYS C;  2OCC C;  4H37 A;  3CCS V;  1CEZ A;  3G71 V;  3ABU A;  3K0G A;  1R3I C;  5L3D A;  1K4D C;  4WFB V;  3HB3 B;  1S5H C;  1H8E G;  1OCO C;  1YSC A;  4DXW A;  5H9C A;  1G8M A;  4HAM A;  1JOY A;  1R3L C;  4JYB A;  1SRY A;  1RM1 C;  1M1K W;  2V7Q G;  1OCO B;  1Q86 W;  4MVS A;  2Q67 A;  4UVC A;  1W0J G;  3OAA G;  1ARO P;  2Z5U A;  3F5W C;  4LCU C;  4ZBM A;  5DN6 G;  5KA5 A;  2WLM A;  1QCE A;  3T4Z A;  4U7N A;  5CBH A;  3CCE V;  4LP8 A;  4PA4 A;  4UV9 A;  2WAM A;  3F7V C;  2P6J A;  1W0K G;  4J9Y B;  2IU0 A;  4JF3 A;  4JTC B;  2QKS A;  1E1Q G;  4HYO A;  1VQ7 V;  5LGN A;  5B3S B;  2D3O W;  2WWW A;  2XND G;  3K03 A;  5EBL C;  2IW5 A;  4GT1 A;  4JAS A;  3K08 A;  5B3S C;  3OM3 B;  2DYR C;  3FB5 C;  4R7C A;  1AI4 A;  4PA7 A;  1M57 C;  2IJK A;  2OCC B;  4G2K A;  3LSQ A;  1GO3 F;  1GM8 A;  1P4R A;  4Z1M G;  4G27 B;  1K34 A;  1V55 B;  1MAB G;  1M57 B;  2LFS A;  3ETD A;  3E89 A;  3OW2 U;  2DWD C;  3T2M A;  3ABK B;  4MVQ A;  2Y69 C;  1K97 A;  4N23 A;  5EBW C;  2XAJ A;  1AR1 B;  2HLD G;  1BHA A;  1R6N A;  1YJ9 V;  4UVA A;  3ZRW B;  2P67 A;  4PDV A;  3K3W A;  1TUE B;  4FJC C;  1JQ0 A;  3ZMU A;  4LC1 A;  4JTA B;  3DGE A;  2ZXW C;  3R65 A;  1IXM A;  1FXK A;  2EIN C;  5KA6 A;  2QEX V;  4XDL A;  5CN0 A;  3ABK C;  4OXS A;  3CMA V;  2HVK C;  3CCR V;  2M7W A;  2EIJ C;  2JJ1 G;  3ZJZ A;  4ZKI A;  3FB7 C;  3E2E A;  2P90 A;  4R50 A;  3K0D A;  3CC2 V;  1YIJ V;  1NKD A;  4GX2 A;  3OMI B;  5J9P C;  1G4Y B;  3E8F A;  3AG1 B;  1QLN A;  5IY5 B;  2WLN A;  1V55 C;  2ZDI C;  1MSW D;  1JVM A;  2IH3 C;  1K9M W;  1Y66 A;  1H8H G;  3CCM V;  3CC7 V;  3ASO C;  4UUJ C;  2EJR A;  3ZMZ A;  4CBC A;  2WLL A;  3JD4 A;  4U7O A;  2EIM C;  1KKD A;  3IC7 A;  1NH2 B;  1YTF D;  3F7Y C;  4UV8 A;  5L3G A;  4R8C A;  3T1C A;  4MVO A;  4BW5 A;  1YI2 V;  1YJW V;  1VQ8 V;  4YXW G;  5DM6 V;  1VQ9 V;  2QM7 A;  2K1E A;  3JD0 A;  3P30 A;  2MK3 A;  1R6K A;  1BL8 A;  1BHB A;  4WFA V;  1VQM V;  2ZXW B;  3GB7 C;  4GX5 A;  1NR1 A;  2YEV A;  2OT5 A;  1DF4 A;  2JJ2 G;  1H2G A;  3OR7 C;  1R3K C;  4MW8 A;  1VQK V;  1LNQ A;  1RPR A;  3VOU A;  1S72 V;  1XL4 A;  1OCZ C;  2B5U A;  2DYR B;  3A0R A;  4TT3 G;  1M56 C;  3K79 A;  1R73 A;  3E8H A;  4GCZ A;  3QNE A;  1NBM G;  1BMF G;  4FIP C;  1QR9 A;  2ZDI A;  5L3F A;  4X8A A;  1PD3 A;  2ZQM A;  3ZRW A;  5LBQ A;  3ASN C;  1FXK C;  5BZB A;  1GMG A;  1OCC B;  3AEI A;  3AG3 C;  3VBB A;  2LP7 A;  3OEE G;  4QPK A;  4ASU G;  2QE7 G;  1KEC A;  4TSF G;  3AG1 C;  3NXS A;  2BOB C;  5IYD O;  1K73 W;  1DTO A;  3GWO A;  3M99 B;  5L3C A;  1FFT B;  2W6J G;  4FK5 C;  4PDR A;  1RM1 B;  1EFR G;  3EHB B;  3SYO A;  1DF5 A;  3ETE A;  1QLE B;  1NQT A;  5L3B A;  1S76 D;  3CCQ V;  2UXX A;  2IJI A;  2JEU A;  1E79 G;  3W7W A;  3D36 A;  4MVM A;  1CPY A;  2XAG A;  1W2B U;  3D3I A;  4GX0 A;  1QVG U;  2IJJ A;  4MTG A;  1JJ2 U;  5LGT A;  1VQ5 V;  3B77 A;  5KUK A;  2EZO A;  2WLL B;  2CK3 G;  1OCR B;  2QTO A;  3H01 A;  2A9H A;  2Q6A A;  5IYC O;  1XL6 A;  3JD1 A;  1NVP B;  3TK1 A;  2HG5 C;  4TWK A;  5EBM C;  1FXV A;  3E83 A;  1QR8 A;  1V54 C;  4MT8 A;  2XAH A;  4EKW A;  3SYP A;  3SPH A;  4CZZ A;  4P30 A;  1UJW B;  3SPI A;  4MS2 A;  1K5S A;  1VQN V;  3STZ C;  3W7X A;  1SER A;  5H6R A;  2WLI A;  1K3E A;  3W7U A;  1PL0 A;  1N8R W;  1COW G;  3SYQ A;  3E86 A;  4WFE A;  4UVB A;  2X6A A;  3E8B A;  1KQS U;  2DYS B;  3FYI B;  4RQE A;  3CP1 A;  5KUM A;  3ETG A;  3SJQ C;  4X89 A;  2BOC C;  4BAY A;  2EIL B;  3OEH G;  3CD6 V;  2QA4 V;  3JCZ A;  2W6I G;  2HKO A;  2XAQ A;  3OGC C;  5B1B C;  3ASN B;  4E2L A;  4BIZ A;  2B1I A;  3MD0 A;  3LDD A;  4I9W A;  2Y48 A;  1F23 A;  2DQ0 A;  4GX1 A;  1KP3 A;  2R9R B;  3RW0 A;  5LGU A;  3AG2 B;  2DQ3 A;  3FYE B;  1OCR C;  4WFH A;  3MHS C;  3OUF A;  2Z3Y A;  3P32 A;  2Q69 A;  5B1N A;  3ABL B;  4XDK A;  2HVJ C;  4XBF A;  1VQ6 V;  1PKX A;  4PA9 A;  3CME V;  1ROP A;  4KFM A;  3SYA A;  1S0V A;  4JYC A;  3OE7 G;  5B1A B;  2H8P C;  1WPX A;  3K04 A;  5CA3 A;  3SPG A;  1PNL A;  2A79 B;  3T4D A;  3JD3 A;  1JPX A;  2UXN A;  4J9Z B;  1FS0 G;  2ZD9 A;  3ABT A;  4P2Z A;  3IGA C;  1NR7 A;  1AI5 A;  1AJN A;  3LSS A;  2W0F C;  3ZIA G;  3ZCC A;  1GK9 A;  3WFV A;  3ABL C;  2HFE C;  5CMU A;  4QNH B;  2JDI G;  1F51 A;  2H94 A;  3HPL C;  4KUM A;  1SZT A;  3CCJ V;  2XOK G;  2WSS G;  1GM7 A;  3E8G A;  3FKS G;  3OR6 C;  3UM7 A;  1NVP D;  2ZR3 A;  4L87 A;  3SPJ A;  3W7S A;  1AI6 A;  3OMN B;  1RPO A;  1E1R G;  2JK5 C;  1WLE A;  2WLI B;  1PNK A;  3B8M A;  3ML0 A;  3JYC A;  4KP4 A;  2EIN B;  4MVR A;  5C93 A;  1VQO V;  3G6E V;  5B1O A;  3X2Q C;  4MVU A;  4PDM A;  4JAV A;  4RO2 A;  1GTO A;  2X0L A;  3PJS K;  1EBO A;  4UXN A;  2EIL C;  3ZRV A;  2X6B A;  4RQF A;  4FPP A;  5HFM A;  2DW4 A;  3OFN G;  2DWE C;  1R3J C;  2GSM B;  2EIJ B;  4PA3 A;  3FB6 C;  2ITD C;  3ASO B;  3OMA B;  3SYC A;  2V1D A;  4MTO A;  1CP9 A;  1M9N A;  2A0L A;  2WLH A;  5EC1 C;  3CYO A;  3K06 A;  4I5S A;  4JPR A;  3ZMS A;  1HWY A;  3K9A A;  2X7R B;  1I5X A;  2ZR2 A;  1H38 A;  5IYB O;  2WLK A;  3LNM B;  2B1G A;  4DO2 A;  2EBO A;  2OTL V;  2IH1 C;  5LHG A;  3EFF K;  1YHQ V;  1K5Q A;  1Q7Y W;  1S77 D;  2KYH A;  5L3E A;  1M90 W;  1AJP A;  5B1A C;  4QPJ A;  1KD1 W;  1MG1 A;  1B6Q A;  1Q81 W;  1K92 A;  3WG7 B;  4Q20 A;  2Q68 A;  2OTJ V;  1Y4M A;  1VQ4 V;  3DTU B;  2EIK C;  3CC4 V;  3BY6 A;  1NH2 D;  4HZ3 A;  1THZ A;  2C2A A;  2NNU A;  3TCU A;  4P9P A;  5H6Q A;  4RAI A;  1ORQ C;  1GM9 A;  4R6Z A;  4WFF A;  3B8N A;  3ZN1 A;  1VQP V;  2YSU B;  3AG2 C;  2F43 G;  2EZP A;  3JD2 A;  2P7T C;  4MTX A;  1FXK B;  1YTF B;  3LUT B;  3QO7 A;  2AHY A;  5IDJ A;  4JTD B;  1VQL V;  4RUF A;  3I55 V;  4N21 A;  5FL7 G;  3ZN0 A;  3I56 V;  2XAF A;  4QE7 A;  3X2Q B;  5E1A C;  5B1B B;  1Q82 W;  1L1F A;  4QJF B;  1EZJ A;  3E35 A;  3RVZ A;  1K33 A;  1AI7 A;  2JEX A;  4P9O A;  3ABM C;  1M56 B;  3STL C;  4F4L A;  5IY5 C;  4LBE C;  2AHZ A;  1SET A;  3WG7 C;  1ZWI C;  3LDE A;  3CCV V;  4QIW F;  2FTK A;  3ABM B;  1JCH A;  3QO8 A;  4QE9 A;  3G4S V;  4G28 B;  1GKF A;  5EC2 C;  1J95 A;  2NLJ C;  2EIM B;  1DLB A;  1P7B A;  3SPC A;  5LHH A;  2YEV B;  3BEH A;  1JX9 A;  3RVY A;  3CCL V;  1PNM A;  4PA6 A;  2PI5 A;  1OZ0 A;  2HR3 A;  3LDC A;  2XAS A;  4WFG A;  1SES A;  5GW7 A;  1OHH G;  3AG4 B;  3IFX A;  2HJF C;  3CXC U;  1ENV A;  5CBF A;  3ZRS A;  4PEL A;  1K4C C;  3KG2 A;  3AG4 C;  4WF9 V;  2X6C A;  5CBG A;  2R9I A;  4XDJ A;  4MSW C;  3ZMT A;  1QVF U;  1QLE C;  4RUE A;  3ZMV A;  3MHH C;  2EIK B;  1QBZ A;  4MW3 A;  3ZRX A;  1I5Y A;  1NJI W;  2IU3 A;  2KB1 A;  1ORS C;  1AJQ A;  3RBZ A;  4BIU A;  1OCZ B;  2PI4 A;  4WCE V;  1KP2 A;  3FB8 C;  4FMT A;  4JAU A;  1F4M A;  1MOF A;  2GHY A;  2WPD G;  2WLJ A;  4MTF A;  2IJH A;  4X88 A;  3UKM A;  3W7T A;  3CPW U;  2ITC C;  3QO5 A;  2ATK C;  4JGS A;  4MVZ A;  5EK0 A;  5HFL A;  1YIT V;  1OCC C;  3AG3 B;  1YJN V;  5LHI A;  1K8A W;  1KC8 W;  4H33 A;  3OUS A;  2QM8 A;  1F4N A;  1K7D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...