4DXWA

Crystal structure of navrh, a voltage-gated sodium channel
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
227
structure length
210
Chain Sequence
TPFFSSLKDNRIFQFTVVSIIILNAVLIGATTYELDPLFLETIHLLDYGITIFFVIEILIRFIGSGWNIFDTVIVAISLIPVLRLLRIFRVLRLISVIPELKQIIEAILESVRRVFFVSLLLFIILYIYATMGAILFGNDDPSRWGDLGISLITLFQVLTLSSWETVMLPMQEIYWWSWVYFFSFIIICSITILNLVIAILVDVVIQKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ion transport protein
publication title Crystal structure of an orthologue of the NaChBac voltage-gated sodium channel
pubmed doi rcsb
source organism Alpha proteobacterium himb114
molecule tags Transport protein
total genus 79
structure length 210
sequence length 227
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00520 Ion_trans Ion transport protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4dxwA02
1.20.120.350 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Voltage-gated potassium channels. Chain C 4dxwA01
4WFGA 4F4LA 4P9OA 3SPHA 3TCUA 4MVSA 4QE9A 2Q68A 3LNMB 4MVUA 1R3JC 4MW3A 4PDRA 3T2MA 5KUKA 4BW5A 2WLKA 3AG2C 3FB7C 4X89A 3LDEA 5B1AC 2ATKC 3RVYA 3K0DA 3AG3C 3E8BA 1XL4A 3EFFK 2WLIB 2HVKC 2HJFC 5EBLC 3OGCC 3UKMA 4R50A 4X8AA 3K06A 4WFFA 3F7YC 2WLLA 4LP8A 3ASNC 3FB5C 4PDVA 2IH1C 4I9WA 1ORQC 4WFHA 1V55C 2AHZA 2X6AA 3LDDA 4KFMA 3E8GA 4MVZA 4XDKA 2BOCC 2BOBC 4UUJC 3IFXA 4X88A 3ZRSA 2DYSC 2JK5C 3K08A 5CBGA 3SYOA 1ORSC 4RUEA 3E8FA 3ABKC 4PA3A 4PA4A 1OCZC 2ZD9A 1M56C 3OR6C 2A79B 4P9PA 1R3LC 1BL8A 2WLHA 5CBHA 3RW0A 2EIKC 4G27B 1P7BA 2IH3C 4JTCB 2A0LA 4XDJA 4P30A 3SPJA 3STZC 5B3SC 1JVMA 3K04A 3JYCA 5EBMC 3HPLC 3T1CA 3E83A 4DXWA 4PA6A 3RBZA 2QKSA 4H33A 4EKWA 2Q6AA 3TETA 2X6CA 4J9YB 3LDCA 1K4DC 3SYQA 2WLJA 2QTOA 2X6BA 3PJSK 2Y69C 4MTOA 4RUFA 4GX2A 2WLNA 1OCCC 2Q69A 2WLMA 4LBEC 1S5HC 4MVMA 2W0FC 4H37A 4JTAB 4LCUC 3WG7C 4P2ZA 5EC1C 2WLIA 2DYRC 4GX0A 4RAIA 5EBWC 5CBFA 4QE7A 5EC2C 3LUTB 3SYCA 1M57C 2EILC 2R9RB 1G4YB 1KKDA 3OUSA 5BZBA 4CBCA 4QNHB 3F7VC 4HZ3A 3SYAA 3IGAC 4PDMA 1ZWIC 4MTFA 4GX1A 2A9HA 4MTGA 3BEHA 2K1EA 3ZJZA 3FB6C 4MVOA 4MVRA 2DWDC 3SJQC 2NLJC 3SPCA 2EIJC 4MW8A 2ITCC 4RO2A 2HG5C 5E1AC 3ABLC 3E89A 2AHYA 2HFEC 3K03A 5J9PC 3SPGA 3SPIA 4PA7A 5B1BC 5KUMA 1LNQA 1OCRC 3R65A 3UM7A 5IY5C 2YEVA 2DWEC 2WLLB 2ZXWC 3RVZA 2P7TC 3T4ZA 1R3KC 3KG2A 4PDLA 3STLC 1K4CC 1QLEC 4MS2A 1V54C 3ABMC 4TWKA 4G28B 4J9ZB 3FB8C 3GB7C 4XDLA 2KB1A 3ASOC 1R3IC 3E86A 3K0GA 4JTDB 3OUFA 4MSWC 4OXSA 4PA9A 4ZBMA 3VOUA 2KYHA 4R7CA 4R8CA 3F5WC 4GX5A 5EK0A 4HYOA 4MVQA 3SYPA 2HVJC 3E8HA 3AG4C 1J95A 2H8PC 3X2QC 1XL6A 2Q67A 3T4DA 4R6ZA 1OCOC 2ITDC 3AG1C 4WFEA 2EINC 3OR7C 2EIMC 2OCCC
chains in the Genus database with same CATH superfamily
5C8YB 3TCUA 3ZQYA 1TUBA 3NR7A 3FD9A 3LNMB 2GAQA 1G8MA 1ZX3A 5LGTA 5JCOC 2F4VB 1FMVA 2J9UA 3VBBA 3K0DA 1RPOA 1S05A 5KA6A 2FB5A 3JATA 2HEPA 1EZVH 3HKDB 3GWNA 3C63A 1LE4A 4K8ZA 4W4LA 3T4RA 2IJHA 2RDCA 4JZ2A 2H7OA 1H2MA 3K06A 1XDCA 4PACA 1KP2A 3JT1A 3DXRA 4I55A 4PDVA 2CUGA 4ZLDA 2BOBC 5B1NA 4UUJC 1VQ6V 4UB8Z 1L3PA 2NSFA 3ZRSA 2A6EF 3B9QA 3GORA 1ENVA 3BCCH 2YZSA 2UXDO 4O4JA 2ETNA 4PA4A 4WFBV 1HNZB 2Y3HA 1LI7A 2ZD9A 4OPHA 2YXHA 3IQCA 2IH3C 4XDJA 5C93A 5L3DA 2PF4E 2PI4A 3ICXA 2KQXA 1YJWV 3H1HH 4YWQA 1YSCA 3Q4HB 2UXDB 3UMIA 4JCHA 1JX9A 3OFNG 4UVBA 4YT8A 4TQFA 3SYQA 3QO8A 2Y69C 2W9YA 1RSOB 3SXYA 4J30B 2AXTZ 1D0ZA 3ABTA 5LMUO 4FLWA 2ZM6O 4JTAB 1Z6AA 3NRHA 4JI1O 3CC2V 4P2ZA 4UXNA 3CMAV 5DQTA 4IGGA 1GAXA 4CDVA 4G7OF 3ZX6A 1M57C 1NZ6A 1FAPB 3CC7V 4PDMA 2NR5A 1ZWIC 2J46A 1SA0A 2QE9A 1NH2B 2R7TA 1Q8IA 5BY1A 3EFOB 4NTXA 1OW6A 3DC5A 1FJGO 3DAFA 3SPCA 4Q4ZF 5KAIZ 2R7QA 5LBQA 1A7EA 256BA 4JF3A 3L9DA 2CGNA 3K03A 2Q9LA 5DM6V 2ICWG 1C17M 1PM9A 2A0BA 5LA6A 1D5NA 1DF5A 4GT1A 1A7VA 3AG2B 2VH3A 2WLLB 5LGNA 2P7TC 3GEIA 3CRCA 3KH2A 1NVPD 3HLZA 1WPXA 1Y4CA 2KK1A 3C8GB 1KQSU 3HB3B 3K0GA 4PA9A 4U5CE 1NQTA 5L0HA 1Z5WA 2ZR3A 3SYPA 5EK0A 3NYJA 4CH4A 4EB6A 1NTKH 3X2QC 4LF6O 3CD6V 4C3BA 3E9VA 2ITDC 3D36A 2R02A 3FXHA 2OTJV 3IEEA 2OOCA 5HV9A 1BE3H 2ZCEA 4X65O 4WCEV 2QR4A 2QKCA 4PJMA 4YHHB 5GPGB 1KYOF 1PPJH 3IC9A 3EHMA 2X0LA 1K5SA 4X89A 3HKCB 1R73A 2ZPAA 3NG1A 2ASRA 1JR8A 2UUBB 3A2FA 4FLVA 3N27A 5CA1A 1GO3F 1OW8A 4O79A 4YXWG 2HV7A 2ZIMA 2D3OW 4B3MB 4DV6B 1PCXA 2CK3G 1ORQC 2D4UA 3Q7GA 3LEVA 2YKZA 1NU9C 5D91A 4X88A 1YJ9V 1QU7A 1WB7A 4DRXB 1OCZC 3B8NA 3QG5A 1ZW2A 5IE9A 3FX7A 4YIOA 2XT9A 3I55V 3SJCC 2L35A 1CXZB 2P0NA 5EZYA 1EM1A 2XSEA 2R25A 1MNGA 1AI6A 1HNWB 3CZ6A 4ULWA 5C8YA 3RBZA 3KKBA 2YXYA 2LSEA 4XLNF 3EHBB 3C3SA 5KLVH 3QO7A 3K79A 1RMVA 2Z15A 2WVNA 1BMFG 2W0FC 4WGZA 5D92A 4C3EA 3CRRA 3HKDA 4RAIA 4AQYO 1K34A 1ZHTA 3LAYA 3ZHUA 1BHAA 4XEVA 2IYLD 2Q0OC 2GUZB 1GS9A 1QLEB 2IXNA 3OMNB 4CBCA 1YYXA 1X4TA 2XASA 4MTFA 3US6A 4PV1B 5FZTA 1US6A 1G4WR 2OQMA 4TSFG 2DWDC 1H2KA 3P3NA 4AQYB 5E79Z 2KQ9A 2R7RA 4RO2A 4QIWF 1G6UA 2HG5C 4RQFA 2YIDA 1ZL8B 3QVNA 3FDQA 2WZLA 2P7VA 1ORYA 1YAUO 2YL0A 3VYWA 3ZQVA 2DI3A 2BTOA 3Q4HA 4JYCA 2UXXA 4PDLA 3H2UA 4JYAB 4Z1MG 1D1BA 4TWKA 3AQBA 4JE9A 1RSOA 3GB7C 1SQXH 4AK9A 1R3IC 3R7CA 3I5DA 4FVMA 3B0VC 4JAVA 4R8CA 1V55B 3AG4C 1NTMH 3RN4A 2LD6A 1FXKC 1NVPB 4OD4A 4UVAA 4YJ3B 2LK4A 2NUTB 2A7WA 4EFEA 1XILA 2EIMC 1JJOA 2Q8VA 3T1YO 5L0DA 2VCBA 4U5DE 3T2MA 4FFKA 1Y76A 4W4KA 3CB2A 3EFOA 2ZKOA 5EIBD 1NBBA 3ML0A 2PTMA 4G7ZF 2EIJB 2WLIB 4FM0A 5IWAO 1BR4A 2Y4TA 1YA7O 1DK1A 2YI9A 1N36O 4NTWA 5FNVA 1VQPV 2WPDG 4K8XA 1LM3B 4HNAB 1KTMA 2WLLA 4KHPO 2ZXRA 2ZE6A 3K3WA 3W8IA 2MW2B 4WFHA 1K05A 1CEZA 1XHXA 3IFXA 1JMWA 2AZ0A 1G4US 3C8GA 5DQZA 4LDRA 4PI2A 1R3LC 2P06A 1HR0O 2XAHA 3H1KH 1PL0A 1QVGU 4LFBO 1FPOA 2JRIA 3BRCA 3QZCA 4JZGA 2P61A 3T1CA 4OIOF 3U0ZA 1NU1H 3WHNA 2X6CA 2XNDG 1BR1A 2R7SA 1AVMA 1RPRA 1KKCA 4LFBB 5L3BA 3HKCA 2Q69A 3FKSG 2PYJA 4LFAO 3BABA 1A41A 4HAMA 5DEDA 2YIBD 2LP7A 1N33O 3BA8A 4KP4A 1GRJA 1TWAA 1KKDA 1ZW3A 2CE4A 4JI2O 2W6IG 1W2WA 5A2QN 1SF9A 3A0HZ 3BEHA 2A1DD 1SS3A 5DS6A 4HEAJ 2OYQA 1RKEB 2XLHA 3PDMP 4DRXA 3QVZA 1M9NA 5A6JA 4ZKIA 3J06A 1JA8A 1S5JA 3ABKB 1SQFA 5B1BC 4BEMJ 1E85A 5AG2A 2ZT9B 3RQGA 3R65A 4DR5O 4BJ5C 4I9QA 2HLDG 2EIKB 3S9OA 1AROP 4RDAA 1VQ5V 3KG2A 1P84F 1WJZA 4H13B 2D5RB 4U5GA 3B40A 1OKKD 4P9FA 2XLOA 2IU0A 4HYOA 1PD0A 3OW2U 4EBJA 4I50B 1MMGA 4YK5A 3MDSA 2GUZA 1OCOC 4DW1A 5KA5A 1KC8W 4JVSA 4WBNB 1Q6UA 5JSLA 1Y67A 4P6IC 2MK3A 3MFNA 1P7GA 2E75B 2VQEB 2WLKA 3BVOA 3GM2A 1I0HA 3LDEA 3AG3C 5F2VO 1NZEA 3J7AU 2R03A 4Q7CA 1R5ID 4D4XA 1O5HA 3LESA 1ZL8A 3S3XA 5KYUB 3ZIAG 1AUEA 1Q0GA 3KCXA 4Z1VA 5JH7B 2XM0A 3MYIA 3N2GB 1OCRB 3OMIB 1YDIA 1VQ8V 1YCIA 1WA8B 4DK0A 2KSFA 3T9OA 1TVKB 1ZZPA 2DYSC 2W45A 4AI8A 4ABMA 5KHKA 4LERA 3NDBB 4XPYA 2XAQA 4LF7O 2QY9A 3CCRV 4DRIB 3U0CA 3ZMSA 1H7IA 4DK1A 3STZC 1SZTA 4DO2A 2HHHO 2D2CB 4A5UB 1H2SB 4YJ3A 1K40A 2CAZC 2NUTA 4FM1A 5IT9N 5LYJB 3I5QA 1I7FA 3LLIA 4I1OB 1K9MW 1GQAA 3LDCA 1K4DC 3D3QA 1RM1B 3PJSK 4DR4O 4J7JA 5BR8O 1XZPA 5CI9A 3UGOA 4JI6O 1GM7A 1NTZH 3RIPA 2Y3GA 4JEAA 2WLIA 3FFQA 3I56V 4X66B 3V5ZA 4LF4B 4EBKA 2F22A 3DTUB 4UV8A 3TGUH 1AR4A 1MNEA 4HZ3A 4HNAA 2HJ3A 1U0BB 2CW0F 4DV2O 3OT7A 3HNJA 2CDYA 3CCJV 1Q0FA 1B04A 3CRQA 3TXSA 2DN9A 3TOLA 2ITCC 4OGQB 4DUYB 4WF9V 3F47A 4DV0B 1JFFB 2YICA 4F6RA 1Y6DA 1Z5ZA 3ZDLA 3DE9A 1NSGB 4BAYA 1AJQA 4FIPC 3CXHF 3IC7A 2VCCA 3ATPA 1OJHA 2P4KA 3VRCA 1BZ4A 3RYIB 3FB8C 3ZSUA 2QWRB 5IY5C 4YL0A 4DJ9A 5A69A 2XL8A 1XL6A 4R6ZA 3GODA 4PR9A 4JAUA 2IXPA 3VF0A 3OWTA 3F5TA 4JYYA 4PDRA 4W8KA 4FX5A 1QVFU 4C7OB 5B3SB 2QDOA 1YZCA 2W6JG 4GKJO 1RKEA 2M4EA 3ZTZA 2XTAA 3JD1A 1M6TA 4E0HA 2ADQB 2Q7GA 3OGCC 2JDIG 3WFVA 2EPKX 2AWCA 2EPNA 5IYCO 1BQZA 4JI7B 3BFRA 3KZIZ 3K1HA 4LWSB 4O6YA 2ADPA 2UUCO 2OTLV 4OX9B 5E3CA 1IBLO 4LF5O 2ZNIA 1K3EA 3ZTMA 4X1IB 4Z9JA 2LFDA 2LFRA 2RJZA 2JIZG 1N34O 2EZPA 3BA9A 1TR2A 3ETQA 4FFBB 1YITV 1LIHA 4NYKA 2P67A 4ICGA 4I50A 3EH1A 3MLGA 1FFTB 1XNRB 2C2AA 2KGOA 3JARA 3QO5A 2QTOA 5JJEB 3ETDA 3SDLA 2XL4A 2XM4A 1QZXA 4DV1O 3TOMA 4RUFA 4GX2A 2IXOA 4CS9A 2J8WA 1ZHZA 2Q7EA 2ZE5A 5CBFA 1AB3A 3F46A 3V5XA 3JAKB 2F66C 4FLUA 2Q5ZA 5KYUA 4QNHB 3ABMB 2BE3A 3DM9B 5JH7A 3N2GA 3OD4A 4JI8O 3GVMA 1G1XB 4X62B 1WA8A 4FLXA 2QUPA 1TVKA 2YSUB 3SJQC 2NLJC 4YT2A 5JQGA 4GKKO 4JI5B 4AL0A 3A0RA 1YZBA 3SZRA 4O2BB 4PA7A 3NMKA 2LO1A 3JRTA 2CGOA 3CEXA 2CTQA 1W0KG 1CGME 3K66A 2HKOA 3W7UA 5LYJA 2Y0IA 1WTYA 3DXJF 2QKAA 4O6MA 1XMOB 3QMKA 4LF8B 1XI1A 5HFMA 3FOPA 4G28B 3EXAA 4O4IB 1M1KW 5A6KA 4MSWC 2Y69B 2A68F 3IQ5A 5JLIA 1LUVA 2OEXA 5IDJA 4R7CA 2A3QA 3RFRA 4DR2O 4YJWA 3AG7A 1XREA 1JOYA 3JSNA 4CSAA 3JAMN 5H2FZ 4XEFA 5T1DB 4MVUA 1ZSPA 5LOVB 4B3SB 4WGYA 2YVKA 2YIBA 3GEEA 4DR2B 4JCZA 1NI8A 4CS7A 2HSQA 4KUMA 3HJCA 4GQHA 3W7WA 4PJJA 3P30A 3N2KB 5LP6B 2WA3A 4TV9B 2F4VO 4N23A 1AI7A 1D5AA 1VMAA 2Q9BA 1HY5A 4U5HA 1SYQA 1GN6A 1VQNV 1UJWB 1ORSC 4RUEA 4KL1A 3I5PA 5L3VA 3RYIA 1MABG 1YVIA 5KHHA 3AK1A 4FZ0A 4EUKB 1WP7A 2RD9A 1P7BA 3S27A 1JMKC 4P30A 3VQWA 3ZRVA 5K1XA 1Q86W 4JI3B 1WWPA 1Q3EA 3JALB 1KP3A 3X2QB 2XS1A 3E83A 4H33A 3H1IH 3K58A 3K7DA 1HNZO 3VQYA 5L3CA 4TUYB 2WLJA 2Q0AA 3NXSA 1TWHA 1OKKA 2YLIA 2XLDA 5DS4A 1VF5B 4MTOA 2YDEA 4NC3A 2WLMA 2HZ8A 1T5OA 5L0FA 3KKYA 1VQMV 1QR9A 1XEQA 1XMQB 3ZHVA 1KB9F 3CCMV 3L8IA 1SRYA 3SYAA 2F43G 2XHBA 2GSMB 3IGAC 2HMZA 4ANJA 1BZKA 1AVOB 2AW9A 4JGSA 1GKFA 4LWSA 4MW8A 2HSBA 1Q5OA 4UCSA 1YA9A 3E70C 3O6XA 2OCCB 3E89A 1XNQB 2PBEA 3Q6MA 3JCUQ 1CPQA 3B09A 1I08A 2XRHA 4ZOLA 1PV3A 1F4NA 4FFBA 4U5EE 3TJ5A 1S77D 1COWG 3L34A 1MNDA 2DWEC 3RVZA 1NLXA 4XWJA 3TJTA 3CCLV 2YI8A 1DOVA 1H2NA 4JPRA 5KAFZ 5GONB 3DD7A 3AJMA 1K4CC 2UXCB 1VIBA 1RJ9B 2XL6A 5JJNB 3D36C 4FLZA 5DN6G 3ZC4A 4WJ0A 1YF2A 2YRFA 2V3CC 2KYHA 4LNUB 3VOUA 4F6EA 3ZMZA 1BSMA 1OR3A 2MYSA 3I4UA 4IARA 2A6HF 1EFRG 1AR1B 4YJ2B 3T4DA 3JAKA 1H38A 3N0TA 1SQGA 3AG1C 4WFEA 1J5EB 2EINC 2KW3C 4LACB 4H4KC 3SXKA 1AP5A 3IJ4A 2QTVA 2QEXV 2MWQA 4LFCB 2XAFA 4BJ1A 3V7OA 3CRAA 3UMKA 2J7PD 3W2WA 4JV5B 4ZIBA 4B3TB 2CYDA 3D3IA 1VOMA 4FPPA 3SXMA 1VTMP 2HVKC 3FMSA 5EBLC 4O2BA 4QI2A 1T9KA 4YHHO 1KD1W 5F5HA 4E7SA 1I5YA 3ASNC 1YJNV 3JRMO 1HNXB 1TKNA 2Y4UA 3DGEA 3H1JH 3CCEV 2UUBO 1BS3A 3SP1A 3L1MA 2GA0A 1QLNA 2EILB 2WL8A 4DRJB 5GTIZ 5IYZB 4PA3A 4O4IA 1QPUA 4B3MO 4IAOA 4DV6O 1R6TA 3P3PA 1YI2V 1I94O 1D0YA 5F28E 3EPVA 5JRAA 4H54A 2A0LA 1DGSA 2UU9B 2DB4A 4CH6A 3LSSA 3TJ6A 3RYFB 4KBLA 3VAYA 3LSQA 1D0XA 2J9BA 2WSSG 5LOVA 1I94B 5GW7A 3S28A 2NUPB 2IBFA 3S84A 3RF3A 3CSKA 3W4YA 1SQBH 1K73W 5CI8A 1AILA 4CS2A 4LCUC 2IJIA 3W8HA 2DGJA 2CTPA 1HNWO 4JJGA 4A2NB 1XZQA 5EBWC 1E86A 3DWWA 3GEHA 1Y74B 4DV7B 1K8AW 1G4YB 2V7QG 5A9GA 5BZBA 3DAGA 4YN0B 5DVWA 3N2KA 3ZHSA 5LP6A 4TV9A 1Q81W 1GM5A 1VQOV 2F23A 3KYIA 4MTGA 2YL3A 3EGDB 2AU5A 3L72H 1TGOA 3KCYA 1XHZA 1T6QA 2L6LA 4UB6Z 5E1AC 1WNSA 4U9DA 1R1BA 1T5EA 2QA4V 3LLKA 3MX3A 1EN4A 3E35A 1LNQA 2H7VC 1M4UA 4NTYA 5B1AB 2HP8A 2WZFA 3JALA 4KNVA 2Q73A 3RYCB 4TUYA 3K5LA 3ZWIA 2CTRA 2XLEA 2IBZH 4J9ZB 3P32A 2J9WA 3JZ0A 3EHNA 3OUFA 1SETA 1QKRA 2Q9CA 3LS0A 1SR2A 5LHIA 5KHJA 1OQCA 1M2VB 4JYAO 2TMVP 2AWYA 2F1MA 3FOOA 1Q7YW 4MTXA 3M1CB 4LH7A 2Q68A 1PV0A 1N0JA 3AG2C 1W2BU 1N32B 1BR2A 1T01A 1OXKA 4JAAA 4J10A 1XL4A 3K1IA 3EFFK 4QDLA 2PI5A 3KYJA 3H01A 1VQLV 4OINF 2Z0AA 2F95B 2Q9AA 3ABUA 2RCVA 4WFFA 1NBMG 3HNKA 5B1BB 2RNBA 3TK0A 1FFXB 3CS5A 3L75H 2AHZA 2Q7RA 1N4CA 2LP4A 5GONA 2BOCC 1B68A 2P22C 1RJ9A 5BXZA 4N6HA 3AOUA 5E33A 4TT3G 5CBGA 1ST6A 3S29A 1PL4A 3ZCCA 1FXVA 4LNUA 4DUZO 3WB0A 5CB4B 1I5XA 3JD0A 1HP8A 1GN2A 4I44A 3OEOA 3SR2C 3K04A 2PZSA 2KJGA 1B06A 2DJVA 4DV5B 4PA6A 3VQVA 1E84A 4MNDA 5E2QA 4FZ1A 3MHSC 4DUZB 4DVZA 2DW4A 3OE7G 1SZXA 2YXLA 1TFKB 3NYMA 5CMUA 4JYBA 2K9PA 2DMXA 5EC1C 3PMRA 3AG3B 3LUTB 5AGFA 5IJ0B 4O2AB 1F23A 2EJ7A 5GTHZ 3WB1A 3CXCU 4AHCA 1A0BA 1X59A 3FYIB 4XQ1A 5H5NA 2ZDIA 3U5SA 3RQEA 2K1EA 5B5EZ 1CP9A 1Z5VA 2PGGA 2XLWA 2CNWD 5KYNA 3M4CA 1VYIA 4ZHQB 3SJAC 2LGQA 5IYZA 3WU2Z 3E2EA 1U97A 1VARA 2E76B 2R7OA 3HTKC 4QJFB 4B3RB 4ASUG 3K57A 2M6YA 2UUAB 2GHYA 1TAEA 2ZXWC 4JW1A 4RD9A 2JS5A 3RYFA 4PJNA 3K5NA 3HR0A 4N06A 1IURA 1E1QG 3WODF 2P6VA 3POVA 5CIVA 2OT5A 1YJGA 1QLEC 3W2VA 2V4DA 2JPUA 5J2TB 3CWBH 1L1FA 2FAPB 2NUPA 1HW1A 1RKCA 2Q4FA 1HE9A 3ECSA 3GANA 1SERA 1AEPA 1IW7F 1J8YF 2RQ6A 1RCPA 4LF9B 1Y74A 3UMHA 1QBZA 2OIGA 4JI0O 3RH3A 1R4TA 4CS8A 1VEWA 1VMGA 1ZVZA 3EGDA 2R7UA 1IZ3A 3PN1A 5L0CA 2E87A 1S3JA 1K7DA 1S72V 3JCUZ 3A0BZ 4IYHA 1NG1A 2Y39A 4NTBA 4IIJB 4JI0B 4Q5SF 4IHJB 4QPKA 3N24A 1G8XA 2VQEO 1FMWA 4O4LB 1BHBA 1NFNA 1OCCB 4I9WA 1OR2A 2WA4A 1V55C 3WG7B 3DJNB 2H94A 1DLBA 3RYCA 2DYRB 1K92A 2IM9A 4GLXA 4PK4A 2KG7B 2VWJA 3OAAG 1SMYF 2A0UA 3OR6C 2H7BA 2RN9A 1KMIZ 3NMIA 1Q43A 4Z9HA 3SEOA 4X20B 5CBHA 3RW0A 2V26A 3J80N 3M7MX 2ZXPA 1FFHA 5IY5B 1M2VA 2UXBB 5L3FA 1RP3B 2Q6AA 4BJTA 5CN0A 2VB6A 1VF7A 4H0LB 4DR3B 5CA3A 1Q0KA 4GCZA 3EGXB 2WLNA 3CRMA 1S5HC 4GX0A 3CEIA 3EVKA 4I4TB 3V5YA 2GFHA 3RYHB 3OM3B 1H6GA 4IAQA 4KC9A 2J7PA 4UFZA 1FFXA 1HMDA 1E2XA 4BJ5A 2I8BA 1H9TA 1YVWA 2VASA 1IVSA 3C18A 5B66Z 1YYJA 2ILMA 4X66O 3R2PA 4E7ZA 4LF4O 1ZU5A 4JI4B 4BJ6A 1WP8A 2JEXA 3SPIA 4IRUA 1KBHA 1WN7A 5CB4A 1MOFA 3UM7A 1TWGA 2GWWA 1D2DA 4JIOA 4CC6A 5ITZB 1TUEB 5FPRA 4E17A 2QWOB 2A06H 1ZTEA 4DUYO 2W4BA 1PP9H 4DV0O 2R05A 3UO3A 2JGDB 5KX5B 3JYYA 4NQFA 2FYUH 3ASOC 3U8PA 3JASB 4QGPA 5K0IA 2XLVA 4HBNA 1RFYA 4PHZA 2ETSA 3U3FA 1DOWA 2H8PC 5IJ0A 3G6EV 1LUWA 1MSDA 4O2AA 3CCQV 4DR7O 4WFGA 3EJNA 4I3MA 1XUQA 1WB8A 4IJJA 3QTHA 4J7YA 4BG0A 4QE9A 4PJ0Z 3C8ZA 2YL1A 3U11A 1FYJA 4N4WA 3THOA 3M79A 2JJ2G 1EA8A 4J80A 1V9PA 4DR7B 1GN3A 3UKMA 1XWJA 1APCA 1JOGA 2FTKA 3FAVB 3O9OA 2G3VA 3VQXA 1VQKV 3U9MA 2X6AA 1R6NA 4DR6O 4M63A 1RXQA 3IPMO 2J0WA 5J2TA 4NXNB 5FL7G 4D7SA 3J81N 4O7GA 2ZXOA 3B2EE 3SPJA 4JI7O 3LS1A 4X1YB 4J7TA 4JC7A 4CS9C 1YDXA 2YEVB 4U3JB 2P90A 4DR6B 4YL3A 1A7DA 2MHRA 2PX0A 1YZAA 3DKAA 4OX9O 3FAJA 1I4YA 4UCRA 3TETA 3GWOA 1MMNA 2FGYA 3U3BA 4B7EA 4BIZA 3B29A 2LJ2A 1SC5B 5EIBC 4Z9IA 4NB5A 3ZN0A 3JSZA 2WWWA 3C7JA 4FAPB 2EBOA 3HNIA 5D5QA 5EC2C 1XNRO 4IIJA 3SYCA 3TXQA 3JAWB 5E3AA 4OIQF 1V54B 2QWNB 4PELA 4A4AA 1K33A 4O4LA 1I4ZA 4ER9A 5A6BA 2EULA 3FB6C 4IT5A 3W7SA 4WBNA 4CIHA 3CYOA 3G67A 4J41A 2KG7A 1EZJA 3UO2A 3ABLC 2BL2A 4BIUA 4XEKA 1Y6XA 5T3TA 3HKEB 1RM1C 2HR3A 3JSLA 4K3AA 4X62O 2LGWA 3L73H 5COGA 1GH6A 4GYCB 1W0JG 2WVQA 4JI5O 2YUAA 4B6IA 2Y3BA 2HV6A 3G6BA 4DW0A 1KUQA 3QW1A 1VF6C 3EGXA 3ZVRA 1MMAA 2Q7HA 4X64B 2ZIOA 4CS3A 1MZEA 5HFLA 4NR1A 3Q7LA 4I4TA 1H2GA 4CH3A 3MD0A 1TA8A 1XMOO 3OR7C 3RYHA 2PNOA 2R72A 4LF8O 3OA1A 3T6JA 1S5LZ 3IHUA 4D4NA 2OJQA 4XPWA 4MW3A 3NKEA 1JAFA 2IW5A 3CAXA 1FKAO 3U9JA 1OHHG 3CMEV 2J9VA 3FB7C 2QNLA 3CJHB 4KXRA 3RFYA 5B1OA 5H6RA 3D8CA 4CX9A 2P5OA 1V4AA 3QNEA 4DBQA 2HKVA 4CC5A 3SJBC 4ZI7B 1KU9A 3DI5A 3OTOB 4OIPF 4X8AA 3JYHA 4B3SO 1CGOA 3KL4A 4DOZA 4E18A 2CNWA 1UFIA 3B77A 2X0CA 3L70H 4E4EA 2QLAA 3UT5B 1YARO 3O10A 1JPXA 1M57B 1Z2GA 2XLMA 4N6CA 2QE7G 3APOA 5KX5A 3QVYA 4AE4B 4FLTA 3JASA 1HMOA 3U8VA 1D1CA 5CA0B 1HW7A 2WLHA 1IBKB 2LQTA 5B3SC 3RQFA 1XOUA 1G5ZA 4DR1B 4DV3O 5EBMC 4YT4A 1JFFA 4UCUA 3LEOA 4K0DA 3AG1B 1Q82W 4J9YB 4DV4B 4U5FE 4AILC 1CGNA 4K7BA 3M8AA 2VQFB 1OW7A 3L74H 1SQVH 2NN4A 2OJED 1JPNA 1ZUQA 1L8DA 2F93B 3FHDA 1PKXA 4DYLA 5KMGB 1C02A 1IXMA 1ZAUA 4DV3B 4NCQA 4JI3O 1VQ9V 1Y4MA 3CCVV 4XLPF 1LI5A 1F51A 3ZHTA 2JGUA 5DLJA 3FAVA 1UG7A 5L0IA 1GMGA 3UR3C 4HE8D 1ZHWA 2IJKA 3TULA 2ZQMA 1NJIW 4GEHA 2KKWA 4IL6Z 2BC5A 1XMQO 1SZIA 2B0JA 1FFTC 1Q0DA 4U7OA 3G4ZA 1ZU4A 4C7OA 4P9TA 5DECA 3SPGA 5KUMA 2NNUA 5JT4A 4X1YA 2P1AA 4QPJA 2M64A 4LDQA 2YEVA 4U3JA 4OIRF 2E5LB 1VYKA 1S0VA 1R3KC 1TFOB 3NYLA 3EQLF 2ARHA 1HW2A 1XNQO 3ABMC 1PD1A 2PUSA 2EZOA 2B1IA 3FAPB 3KPHA 4EFBA 4NVPA 3E8HA 5D5PA 4NXMO 2XAJA 3JAWA 4X1IA 2FMLA 2UXCO 3K6BA 4DBRA 2BCCH 5EHHA 4P9OA 1QCEA 3C62A 1OCZB 1P4RA 3KMIA 1GM9A 3NMJA 2HMQA 1LS1A 1LR1A 4J7KA 2IXMA 3ZMVA 4NXMB 5DS5A 2YC0A 4O6NA 3QF7A 2L6GA 3G80A 1J5EO 4U7NA 2BSKB 3TQOA 1KU2A 3HKEA 4F4BA 4IWBA 3CX5F 4CS4A 2Y0PA 4LFCO 5JCOA 4B08A 1PNLA 4IB4A 2J45A 2IH1C 4JV5O 3EZHA 3GM3A 4B3TO 3GM1A 1Z63A 3OEHG 4XDKA 2HJMA 2NPUA 4FLYA 2XAGA 1S76D 4GUNA 4K0KO 3DM5A 3BRJA 4LLCA 2VC9A 1M56C 4XTKA 3B0UX 3PCVA 5BQIA 4LLEA 3ETGA 3GWKC 2B1GA 1M5IA 1HNXO 3EG9B 4N21A 1SQQH 2XS8A 1PNMA 3O39A 4LH6A 2XXAB 5LMUB 2ZM6B 1Y76B 2QM8A 3JYCA 4G2KA 4JI1B 5K1PA 2W4MA 1Q90D 4K0KB 4DXWA 2QKSA 2LCHA 2C04A 3R66A 5KYYB 2WVOA 4PJLA 5FCLA 5LP6C 5FNVB 2LFSA 1U96A 3CJHA 4AX2A 4JZAA 1E1RG 1PNKA 2UU9O 5IJ9B 2J0XA 5COFA 1FJGB 1YIJV 4QE7A 5KHIA 1IZMA 1FXHA 4ZI7A 2YWAA 1GN4A 3TK1A 5T3WA 2H8AA 2RSEB 4ULVA 4FESA 4GX1A 2A9HA 3G4SV 3ZJZA 4EWCA 4LDKA 3UT5A 1WOLA 5BQGA 3AG4B 3DC6A 1FXKB 3ZMUA 3HKKA 3M15A 4DV7O 1BCCH 3IAYA 1VLSA 4AE4A 2PP4A 2EIMB 4J32B 2QJ1A 5KYXB 2AGAA 5CA0A 4FMTA 5J9PC 2IM8A 1NT2B 2L6FA 1B6QA 3EH2A 1MQVA 5COMA 2WB7A 4LF6B 2FKXA 5BMVB 2AZ2A 1MA1A 2OKUA 3DZAA 4X65B 4L87A 1IXBA 4OD5A 2KB1A 5KHGA 3E86A 5KMGA 1WN0A 2NG1A 4G0HA 1J95A 1YXBA 2G3KA 3MBGA 4UCOA 3ZHQA 3UQ8A 3K1IC 2OCCC 1JPJA 2YLDA 4F4LA 5TJ5E 2ZINA 4O4HB 1UPGA 2CH7B 2GTAA 4JEBA 1W59A 2L9JA 2ZE7A 3QTCA 5IYBO 4XPXA 3BAAA 3ZRWB 1VK5A 4WFAV 3IQ6A 2YS8A 4BPMA 2HJFC 1VQ7V 3X1OA 2A69F 4TQDA 4TV8B 1EI7A 2Q4PA 4E0IA 1N32O 4YIPA 1Z23A 1THZA 3K59A 3S3WA 1L7CA 3AQCA 2ZXWB 3BPZA 2Y3DA 3CPWU 2B5UA 3K08A 5IYDO 3NKDA 4JRZA 4EIYA 3Q6NA 3ZRXA 1K97A 2NSGA 3AGTA 1FTSA 1ZLZA 3WB2A 1QVXA 1VLTA 5A6BD 3ZMTA 1LE2A 2L7AA 5L3QA 3HPLC 1WATA 2GDCA 5LXTB 1DTOA 1S7ZA 2B9ZA 4D7TA 2IOQA 1R6KA 4H44B 2ZDIC 2LW1A 3S90A 4H37A 4RBNA 2R7WA 2BSKA 1K04A 2H3OA 3B4SA 4DV5O 3SXZA 4Q6GA 1YEWA 1U89A 3T1HO 2R9RB 2EILC 3G4XA 3K33A 5LMNO 4HFKB 3DE8A 1LVKA 3VM6A 4CJGA 2OIEA 4Q20A 4BR6A 4YJ2A 4ONSA 4FWVA 3A9CA 2DQ0A 3CQZA 3W7XA 1YHQV 5JVDB 3FVYA 3T1HB 1OCOB 1J8MF 5LMNB 2CCYA 4I7ZB 2VWKA 5EYPB 3U10A 2XXAA 3EG9A 4CJOA 3A11A 1DF4A 2FFHA 2LFFA 1PD3A 2UXNA 2JVDA 1N0NA 1I5NA 3STLC 5KYYA 1MSWD 2R7XA 4J11A 4X1KB 4PFPA 3HNLA 1AI5A 3T1YB 4B3RO 3ZEDA 4OXSA 4CS8C 2UUAO 5IJ9A 1K5QA 3JD3A 3F5WC 3K5MA 1TWCA 3U2LA 1B3QA 3ETEA 3HKBB 2HJDA 1Y66A 2DYSB 2W0XA 4NY3A 4BEJA 1BQ0A 5L0JA 5IWAB 1EN6A 1H2LA 1N36B 4JKVA 3MYFA 3CE2A 4I0XB 1XQ8A 3K9AA 4F6RB 4KHPB 1BDJB 5B1AC 1L0NH 3RVYA 1FXKA 4LF9O 4YL1A 3UNGC 3K9SA 2VCAA 5KYXA 4X0RA 3ZHRA 1N8RW 1WLEA 5TISZ 1TQGA 1BBHA 4GYTA 1QR8A 4J7ZA 4Z2WA 2ZNJA 2QWPB 3UGPA 1HR0B 2R9IA 3MHHC 2LQGA 5A6AA 3LDDA 5BMVA 3H2VA 3RT3C 3MAQA 4RWUA 3L0IA 2V1DA 1WPBA 3SYOA 1GM8A 1ROPA 3ZG1A 2C03A 1QNMA 1AR5A 1BL8A 2GTSA 2CDQA 1O87A 2B0HA 5JUAA 3ASOB 4I5SA 1O9GA 5JP7A 1JVMA 2YLGA 4LFAB 1O3UA 1BT8A 1N33B 1NR7A 4EKWA 3LNRA 4O4HA 2CH7A 4FM2A 2Y48A 2JJ1G 2AVKA 4JI2B 3ZRWA 3W7TA 4D6TH 3ZS8C 1BGYH 4LBEC 4MQ9F 4MVMA 4TOIA 1H9GA 2UXBO 2EPOA 4CIPA 4AL1A 4EBBA 1NS1A 1SF8A 2WAMA 4J42A 4NTFA 2FL4A 3M4BA 1VP7A 3F7VC 4TV8A 4BJ6C 4DR3O 2UUIA 5FPOA 4UCVA 4JJFA 2Z5UA 4DR5B 2QM7A 1EBOA 4MVOA 2P4VA 4MVRA 1SESA 1AJPA 3EZIA 1LPEA 1OXBA 4R32A 1EKYA 2EIJC 1SQPH 1FS0G 2DE0X 2EPMX 3JD4A 3SNHA 3SYNA 2HFEC 3CHXA 3JARB 3SGIA 3GWLA 1H8EG 1MMMA 5AC5A 1E83A 5KYWB 2EPLX 2JD3A 1ZHXA 1H8HG 5BQHA 5LXTA 3RKOF 3IQTA 4JI4O 5LL6Y 2I15A 5JWPA 3G50A 4B7KA 1D1AA 2X51A 3T6GB 4QI0A 5HSWA 5JS5A 3H65A 2Q67A 4UV9A 2XOKG 2CGEA 4DVYP 3LJBA 5JQGB 3T6BA 4WABA 2CTWA 3AEIA 3OGIB 4MVSA 4UCTA 4BWAA 2QWQB 5KUKA 4X9QA 1MMDA 3U2MA 3OMAB 5JVDA 2P6JA 4IYIA 1A32A 4DRHB 5EGYA 3DSQA 3LSUA 3CCUV 3O55A 4CDAA 5LGUA 4OPAA 2OU6A 3LNNA 3K5OA 3ABLB 5EYPA 2BE5F 4LF7B 3DMDA 4ZLCA 3ZN1A 1LS4A 1NFOA 1L0LH 3N2ZB 4JURI 4LP8A 3OEEG 3FB5C 4MT8A 1IBMO 4NTAA 2HHHB 3B71A 3E8GA 1IDSA 1HWYA 1M90W 4LR3A 2LIGA 1WAZA 1KECA 1CPRA 4X1KA 3E8FA 3ABKC 4CBEA 1JRAA 1OZ0A 4FK5C 2PX3A 4P9PA 2A79B 2JEUA 4DR4B 2Z3YA 1HDJA 1YTFD 2RMKB 2EIKC 1IBMB 5BR8B 1NKDA 4JTCB 3HKBA 3B8MA 4BIOA 4ZHQA 4JI6B 3CSXA 5FLXN 4W8PA 4G7HF 3RWRD 3E22B 3L71H 2BTQB 3OTFA 4C7UA 5J2UB 1M2OA 1Q6HA 4NXNO 3S0XA 5B3IA 2XUMA 3CP1A 1GTOA 1O9HA 4I0XA 4XBFA 1F7YA 4DV2B 1OCCC 2AP3A 2ODMA 3WG7C 2N74A 2DYRC 2YQYA 3H1LH 3C3TA 2YIAA 5L3EA 4YY3O 2G62A 5LHHA 1E79G 1Z3IX 1TUBB 5L0GA 2M7WA 2R7VA 1IX9A 1V74B 3RGBA 1CPYA 2E74B 3TD7A 2PYLA 3PHF2 2L6HA 2L81A 3JATB 2AHYA 4YY3B 3L8JA 1N1CA 4JASA 4PI0A 3CC4V 2EX3A 1OCRC 2PFDA 4I1MA 2QM4A 5JVEA 2Q00A 1JJ2U 3DXRB 4I55B 4L6RA 2QTSA 1XBLA 1FR0A 4IHJA 1GK9A 1QQ3A 1SKVA 1FNTc 2OG2A 1JQ0A 4O4JB 4XDLA 2KNHA 3AGUA 1Q6IA 3BY6A 4ZBMA 5LHGA 4RQEA 2LW7A 1ZHYA 4GX5A 4U5BE 4MVQA 1HE1A 4GKJB 1JCHA 4EHPA 4X20A 1FD9A 3SPHA 1UFBA 1YLMA 1R3JC 4X64O 1KNYA 4HFFB 1QHTA 4BW5A 4KI2A 4ZOLB 3ZBHA 1U6HA 1WASA 2ATKC 3ITFA 1JR9A 2HS5A 3E8BA 2Q3TA 1EN5A 2VS0A 2UUCB 2PY5A 2X7RB 3JCZA 2E3CA 2WZGA 4CSAC 1IBLB 4LF5B 2YL7A 4R50A 4NKGB 2ZE8A 2GBOA 3QW0A 5AC4A 3JD2A 3BHPA 1VB5A 3F7YC 1N34B 2R9AA 5KYWA 5F5FA 1SA0B 4KFMA 4MVZA 1AP6A 1NU7D 4GZRB 2G38A 2QGNA 2N05A 1ZYRF 3RYLA 2JK5C 1QSPA 2OEVA 2YHSA 1FAFA 1QQCA 1GGQA 3OTOO 2EJRA 3FYEB 4DV1B 2UUHA 1WGWA 3JTLO 4G27B 2JS3A 5LA6B 3A8TA 4PFOA 4U9EA 3UCSC 2R70A 2DOSA 2VRZA 3AK2A 2QSAA 1ORJA 2ZR2A 2JX0A 4E2LA 2HUJA 2X6BA 5L3GA 1YTFB 1MG1A 1IBKO 1P49A 2KSDA 5ITZA 2IU3A 4JI8B 1Z7Qc 1OV9A 1NH2D 4DR1O 3M99B 1AJNA 4C3DA 4EB6B 2GDSA 3WAQA 4GKKB 4UDVA 3DJUB 2JGDA 4KNWA 2N04A 1MZFA 3OUSA 3AK3A 4DV4O 4CDYA 2VQFO 2KC3A 1NR1A 2O9XA 4G78A 3C90A 2IJJA 3CCSV 4K1OA 1T6IA 5H6QA 4YT5A 1EQ1A 1T6UA 4PD4F 4UVCA 3ZIBA 4K35A 2EINB 3B0PA 4U3FH 1VF6A 5CA1B 1LKXA 3C8GD 1M56B 1URFA 4CH5A 1F1MA 5BUOA 3E22A 2GV9A 2BTQA 5J2UA 3H9VA 3T4ZA 4EEQA 5JJJB 2OWOA 2OCHA 5H9CA 3APQA 4MS2A 1V54C 2O57A 3O65A 2DQ3A 4FJCC 2HFIA 3G71V 1F4MA 4JTDB 3ASNB 1M93A 4LC1A 2E5LO 1AI4A 3JSEO 1VQ4V 2HVJC 4L8JA 5EZYB 1Q0MA 1C03A 4CZZA 4BW9A
chains in the Genus database with same CATH topology
4F4LA 1QBZA 3TCUA 3LNMB 4PDRA 1G8MA 5LGTA 1QVFU 5IYBO 5B3SB 3ZRWB 3VBBA 2W6JG 3K0DA 1RPOA 1S3JA 5KA6A 1K7DA 4WFAV 1S72V 3JD1A 2HJFC 3OGCC 1VQ7V 2IJHA 2JDIG 3WFVA 4QPKA 3K06A 1KP2A 1BHBA 1OCCB 4PDVA 5IYCO 4I9WA 1V55C 3WG7B 1THZA 2H94A 1DLBA 2ZXWB 2BOBC 2DYRB 1K92A 4UUJC 5B1NA 1VQ6V 3ZRSA 3CPWU 2B5UA 3K08A 5IYDO 2OTLV 1ENVA 1K3EA 4PA4A 4WFBV 3OAAG 2LFRA 1K97A 2ZD9A 3ZRXA 3OR6C 2JIZG 2EZPA 5CBHA 3RW0A 2IH3C 4XDJA 1YITV 2P67A 5C93A 5L3DA 3ZMTA 5IY5B 2PI4A 3HPLC 1YJWV 1FFTB 1YSCA 5L3FA 2C2AA 1JX9A 2Q6AA 3OFNG 1DTOA 4UVBA 3SYQA 3QO5A 5CN0A 2QTOA 3ETDA 3QO8A 2Y69C 5CA3A 4GCZA 4RUFA 4GX2A 1R6KA 2WLNA 2ZDIC 3ABTA 1S5HC 4H37A 4JTAB 3CC2V 4P2ZA 4UXNA 4GX0A 3CMAV 5CBFA 1M57C 2EILC 2R9RB 4QNHB 3ABMB 3OM3B 3CC7V 4PDMA 1ZWIC 1NH2B 4Q20A 2DQ0A 3W7XA 2YSUB 3SJQC 2NLJC 3SPCA 1YHQV 1OCOB 5LBQA 3A0RA 4JF3A 3K03A 5DM6V 2JEXA 3SPIA 4PA7A 1MOFA 1DF5A 3UM7A 4GT1A 3AG2B 1W0KG 2WLLB 1DF4A 2HKOA 5LGNA 3W7UA 1PD3A 1TUEB 2P7TC 2UXNA 3STLC 1NVPD 1MSWD 1WPXA 5HFMA 1KQSU 4G28B 1AI5A 1M1KW 3ASOC 3HB3B 3K0GA 4OXSA 4PA9A 1NQTA 4MSWC 2Y69B 2ZR3A 1K5QA 3JD3A 4R7CA 3F5WC 5EK0A 3SYPA 5IDJA 3ETEA 2H8PC 3X2QC 3G6EV 1Y66A 2DYSB 3CD6V 2ITDC 3D36A 2OTJV 3CCQV 1JOYA 4WFGA 4QE9A 4WCEV 4MVUA 2X0LA 3K9AA 1K5SA 4X89A 5B1AC 3RVYA 1R73A 1FXKA 2JJ2G 1N8RW 4KUMA 1WLEA 1GO3F 4YXWG 3UKMA 3W7WA 2D3OW 1QR8A 2FTKA 3P30A 2R9IA 3MHHC 2CK3G 1VQKV 1ORQC 4N23A 3LDDA 1AI7A 2X6AA 1R6NA 4X88A 1YJ9V 1VQNV 2V1DA 3SYOA 1UJWB 1GM8A 1ROPA 4RUEA 1ORSC 5FL7G 1MABG 1OCZC 3B8NA 1BL8A 3I55V 1P7BA 3ASOB 3SPJA 4P30A 3ZRVA 4I5SA 1Q86W 1JVMA 2YEVB 2P90A 1AI6A 1KP3A 1NR7A 3X2QB 3E83A 3RBZA 4EKWA 4H33A 3TETA 5L3CA 3GWOA 2WLJA 3NXSA 2Y48A 2JJ1G 3EHBB 4BIZA 4MTOA 3QO7A 3K79A 3ZRWA 3W7TA 2WLMA 4LBEC 3ZN0A 1BMFG 2W0FC 4MVMA 2WWWA 1VQMV 4RAIA 1QR9A 2EBOA 1K34A 5EC2C 1BHAA 2WAMA 3SYCA 1QLEB 3CCMV 3OMNB 4CBCA 1V54B 3F7VC 4PELA 1SRYA 3SYAA 2F43G 1K33A 2GSMB 3IGAC 2XASA 4MTFA 2Z5UA 2QM7A 1EBOA 4JGSA 3FB6C 1GKFA 4MVOA 4TSFG 4MVRA 1SESA 1AJPA 3W7SA 2DWDC 2EIJC 3CYOA 4MW8A 1FS0G 4RO2A 4QIWF 1EZJA 2HG5C 3ABLC 3JD4A 2OCCB 3E89A 4BIUA 4RQFA 2HFEC 1RM1C 1F4NA 2HR3A 1S77D 1COWG 1H8EG 2DWEC 3RVZA 1W0JG 3CCLV 1H8HG 4JPRA 4JYCA 2UXXA 4PDLA 1K4CC 4Z1MG 5DN6G 4TWKA 3GB7C 1R3IC 2KYHA 3VOUA 3ZMZA 4JAVA 4R8CA 1V55B 5HFLA 3AG4C 1H2GA 1EFRG 1AR1B 2Q67A 3MD0A 1FXKC 4UV9A 3T4DA 4UVAA 2XOKG 3AG1C 4WFEA 1NVPB 1H38A 2EINC 3OR7C 2EIMC 2QEXV 3AEIA 4MVSA 2XAFA 4MW3A 3T2MA 2IW5A 5KUKA 3OMAB 1OHHG 3CMEV 3FB7C 5B1OA 5H6RA 3ML0A 2P6JA 3D3IA 4FPPA 2EIJB 2WLIB 3QNEA 3CCUV 2HVKC 5LGUA 5EBLC 3ABLB 1VQPV 3ZN1A 2WPDG 1KD1W 4X8AA 1I5YA 2WLLA 3ASNC 3FB5C 3K3WA 3B77A 3OEEG 4LP8A 4MT8A 1YJNV 4WFHA 3DGEA 1CEZA 3E8GA 3CCEV 1HWYA 1M90W 3IFXA 1KECA 1JPXA 1M57B 2EILB 1QLNA 2QE7G 3ABKC 3E8FA 4PA3A 1OZ0A 4FK5C 2A79B 2JEUA 1R3LC 4P9PA 1YI2V 2XAHA 2WLHA 2Z3YA 1YTFD 1PL0A 1QVGU 2EIKC 1NKDA 4JTCB 2A0LA 3B8MA 5B3SC 3LSSA 5EBMC 3T1CA 3LSQA 3AG1B 2X6CA 4J9YB 1Q82W 2XNDG 2WSSG 3CP1A 1RPRA 1GTOA 4XBFA 5GW7A 5L3BA 1OCCC 2Q69A 1PKXA 3FKSG 1K73W 1IXMA 3WG7C 4LCUC 2IJIA 1VQ9V 4HAMA 2DYRC 1Y4MA 5EBWC 2LP7A 3CCVV 4KP4A 1F51A 1K8AW 1G4YB 1KKDA 5L3EA 2V7QG 5BZBA 1GMGA 1Q81W 5LHHA 1VQOV 1E79G 2IJKA 2W6IG 2ZQMA 1NJIW 4MTGA 3BEHA 2M7WA 1CPYA 1M9NA 5E1AC 4ZKIA 4U7OA 2AHYA 2QA4V 3ABKB 4JASA 3CC4V 3SPGA 3E35A 5B1BC 5KUMA 2NNUA 1LNQA 1OCRC 3R65A 4QPJA 2HLDG 2YEVA 5B1AB 2EIKB 1JJ2U 1AROP 1S0VA 1R3KC 1VQ5V 3KG2A 1GK9A 3ABMC 1JQ0A 4J9ZB 4XDLA 3P32A 2EZOA 2B1IA 3BY6A 4ZBMA 3OUFA 1SETA 5LHGA 4RQEA 2IU0A 4GX5A 5LHIA 4HYOA 4MVQA 3OW2U 3E8HA 1JCHA 2XAJA 1OCOC 5KA5A 1KC8W 1Q7YW 4MTXA 4P9OA 1QCEA 3SPHA 1OCZB 1P4RA 2Q68A 1GM9A 2MK3A 1R3JC 4BW5A 2WLKA 3AG2C 1W2BU 3LDEA 3ZMVA 2ATKC 3AG3C 3E8BA 4U7NA 1XL4A 3EFFK 2X7RB 3JCZA 2PI5A 3H01A 1VQLV 4R50A 3ZIAG 3JD2A 3ABUA 1PNLA 3F7YC 1NBMG 4WFFA 5B1BB 1OCRB 2IH1C 3OMIB 2AHZA 4KFMA 3OEHG 4XDKA 1VQ8V 4MVZA 2BOCC 2DYSC 2XAGA 2JK5C 1S76D 4TT3G 5CBGA 2XAQA 2EJRA 3CCRV 3ZCCA 1FXVA 1M56C 3FYEB 3ETGA 3ZMSA 1I5XA 2B1GA 4G27B 3STZC 1SZTA 3JD0A 4N21A 1PNMA 4DO2A 3K04A 2QM8A 3JYCA 4G2KA 4DXWA 4PA6A 2QKSA 1K9MW 2ZR2A 1K4DC 3LDCA 3MHSC 4E2LA 1RM1B 2X6BA 3PJSK 5L3GA 1YTFB 1MG1A 2IU3A 2LFSA 2DW4A 3OE7G 1E1RG 1NH2D 1GM7A 1PNKA 3M99B 5CMUA 4JYBA 5EC1C 2WLIA 1YIJV 1AJNA 3AG3B 4QE7A 3I56V 3LUTB 1FXHA 1F23A 3OUSA 3CXCU 3DTUB 4UV8A 4HZ3A 3TK1A 3FYIB 2ZDIA 1NR1A 4GX1A 2A9HA 3G4SV 3ZJZA 2K1EA 1CP9A 3CCJV 2IJJA 3CCSV 3AG4B 5H6QA 1FXKB 4UVCA 2ITCC 3ZMUA 2EINB 2EIMB 3E2EA 4WF9V 4FMTA 5J9PC 4QJFB 4ASUG 1B6QA 1M56B 4BAYA 1AJQA 4FIPC 2GHYA 2ZXWC 3IC7A 3T4ZA 1E1QG 2OT5A 5H9CA 1QLEC 4MS2A 1V54C 2DQ3A 4L87A 3FB8C 4FJCC 1L1FA 3G71V 1F4MA 2KB1A 3E86A 4JTDB 3ASNB 4LC1A 1SERA 5IY5C 1AI4A 1VQ4V 2HVJC 1J95A 1XL6A 4R6ZA 4JAUA 4CZZA 2OCCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WFG A;  4F4L A;  4P9O A;  3SPH A;  3TCU A;  4MVS A;  4QE9 A;  2Q68 A;  3LNM B;  4MVU A;  1R3J C;  4MW3 A;  4PDR A;  3T2M A;  5KUK A;  4BW5 A;  2WLK A;  3AG2 C;  3FB7 C;  4X89 A;  3LDE A;  5B1A C;  2ATK C;  3RVY A;  3K0D A;  3AG3 C;  3E8B A;  1XL4 A;  3EFF K;  2WLI B;  2HVK C;  2HJF C;  5EBL C;  3OGC C;  3UKM A;  4R50 A;  4X8A A;  3K06 A;  4WFF A;  3F7Y C;  2WLL A;  4LP8 A;  3ASN C;  3FB5 C;  4PDV A;  2IH1 C;  4I9W A;  1ORQ C;  4WFH A;  1V55 C;  2AHZ A;  2X6A A;  3LDD A;  4KFM A;  3E8G A;  4MVZ A;  4XDK A;  2BOC C;  2BOB C;  4UUJ C;  3IFX A;  4X88 A;  3ZRS A;  2DYS C;  2JK5 C;  3K08 A;  5CBG A;  3SYO A;  1ORS C;  4RUE A;  3E8F A;  3ABK C;  4PA3 A;  4PA4 A;  1OCZ C;  2ZD9 A;  1M56 C;  3OR6 C;  2A79 B;  4P9P A;  1R3L C;  1BL8 A;  2WLH A;  5CBH A;  3RW0 A;  2EIK C;  4G27 B;  1P7B A;  2IH3 C;  4JTC B;  2A0L A;  4XDJ A;  4P30 A;  3SPJ A;  3STZ C;  5B3S C;  1JVM A;  3K04 A;  3JYC A;  5EBM C;  3HPL C;  3T1C A;  3E83 A;  4DXW A;  4PA6 A;  3RBZ A;  2QKS A;  4H33 A;  4EKW A;  2Q6A A;  3TET A;  2X6C A;  4J9Y B;  3LDC A;  1K4D C;  3SYQ A;  2WLJ A;  2QTO A;  2X6B A;  3PJS K;  2Y69 C;  4MTO A;  4RUF A;  4GX2 A;  2WLN A;  1OCC C;  2Q69 A;  2WLM A;  4LBE C;  1S5H C;  4MVM A;  2W0F C;  4H37 A;  4JTA B;  4LCU C;  3WG7 C;  4P2Z A;  5EC1 C;  2WLI A;  2DYR C;  4GX0 A;  4RAI A;  5EBW C;  5CBF A;  4QE7 A;  5EC2 C;  3LUT B;  3SYC A;  1M57 C;  2EIL C;  2R9R B;  1G4Y B;  1KKD A;  3OUS A;  5BZB A;  4CBC A;  4QNH B;  3F7V C;  4HZ3 A;  3SYA A;  3IGA C;  4PDM A;  1ZWI C;  4MTF A;  4GX1 A;  2A9H A;  4MTG A;  3BEH A;  2K1E A;  3ZJZ A;  3FB6 C;  4MVO A;  4MVR A;  2DWD C;  3SJQ C;  2NLJ C;  3SPC A;  2EIJ C;  4MW8 A;  2ITC C;  4RO2 A;  2HG5 C;  5E1A C;  3ABL C;  3E89 A;  2AHY A;  2HFE C;  3K03 A;  5J9P C;  3SPG A;  3SPI A;  4PA7 A;  5B1B C;  5KUM A;  1LNQ A;  1OCR C;  3R65 A;  3UM7 A;  5IY5 C;  2YEV A;  2DWE C;  2WLL B;  2ZXW C;  3RVZ A;  2P7T C;  3T4Z A;  1R3K C;  3KG2 A;  4PDL A;  3STL C;  1K4C C;  1QLE C;  4MS2 A;  1V54 C;  3ABM C;  4TWK A;  4G28 B;  4J9Z B;  3FB8 C;  3GB7 C;  4XDL A;  2KB1 A;  3ASO C;  1R3I C;  3E86 A;  3K0G A;  4JTD B;  3OUF A;  4MSW C;  4OXS A;  4PA9 A;  4ZBM A;  3VOU A;  2KYH A;  4R7C A;  4R8C A;  3F5W C;  4GX5 A;  5EK0 A;  4HYO A;  4MVQ A;  3SYP A;  2HVJ C;  3E8H A;  3AG4 C;  1J95 A;  2H8P C;  3X2Q C;  1XL6 A;  2Q67 A;  3T4D A;  4R6Z A;  1OCO C;  2ITD C;  3AG1 C;  4WFE A;  2EIN C;  3OR7 C;  2EIM C;  2OCC C; 
#chains in the Genus database with same CATH topology
 5C8Y B;  3TCU A;  3ZQY A;  1TUB A;  3NR7 A;  3FD9 A;  3LNM B;  2GAQ A;  1G8M A;  1ZX3 A;  5LGT A;  5JCO C;  2F4V B;  1FMV A;  2J9U A;  3VBB A;  3K0D A;  1RPO A;  1S05 A;  5KA6 A;  2FB5 A;  3JAT A;  2HEP A;  1EZV H;  3HKD B;  3GWN A;  3C63 A;  1LE4 A;  4K8Z A;  4W4L A;  3T4R A;  2IJH A;  2RDC A;  4JZ2 A;  2H7O A;  1H2M A;  3K06 A;  1XDC A;  4PAC A;  1KP2 A;  3JT1 A;  3DXR A;  4I55 A;  4PDV A;  2CUG A;  4ZLD A;  2BOB C;  5B1N A;  4UUJ C;  1VQ6 V;  4UB8 Z;  1L3P A;  2NSF A;  3ZRS A;  2A6E F;  3B9Q A;  3GOR A;  1ENV A;  3BCC H;  2YZS A;  2UXD O;  4O4J A;  2ETN A;  4PA4 A;  4WFB V;  1HNZ B;  2Y3H A;  1LI7 A;  2ZD9 A;  4OPH A;  2YXH A;  3IQC A;  2IH3 C;  4XDJ A;  5C93 A;  5L3D A;  2PF4 E;  2PI4 A;  3ICX A;  2KQX A;  1YJW V;  3H1H H;  4YWQ A;  1YSC A;  3Q4H B;  2UXD B;  3UMI A;  4JCH A;  1JX9 A;  3OFN G;  4UVB A;  4YT8 A;  4TQF A;  3SYQ A;  3QO8 A;  2Y69 C;  2W9Y A;  1RSO B;  3SXY A;  4J30 B;  2AXT Z;  1D0Z A;  3ABT A;  5LMU O;  4FLW A;  2ZM6 O;  4JTA B;  1Z6A A;  3NRH A;  4JI1 O;  3CC2 V;  4P2Z A;  4UXN A;  3CMA V;  5DQT A;  4IGG A;  1GAX A;  4CDV A;  4G7O F;  3ZX6 A;  1M57 C;  1NZ6 A;  1FAP B;  3CC7 V;  4PDM A;  2NR5 A;  1ZWI C;  2J46 A;  1SA0 A;  2QE9 A;  1NH2 B;  2R7T A;  1Q8I A;  5BY1 A;  3EFO B;  4NTX A;  1OW6 A;  3DC5 A;  1FJG O;  3DAF A;  3SPC A;  4Q4Z F;  5KAI Z;  2R7Q A;  5LBQ A;  1A7E A;  256B A;  4JF3 A;  3L9D A;  2CGN A;  3K03 A;  2Q9L A;  5DM6 V;  2ICW G;  1C17 M;  1PM9 A;  2A0B A;  5LA6 A;  1D5N A;  1DF5 A;  4GT1 A;  1A7V A;  3AG2 B;  2VH3 A;  2WLL B;  5LGN A;  2P7T C;  3GEI A;  3CRC A;  3KH2 A;  1NVP D;  3HLZ A;  1WPX A;  1Y4C A;  2KK1 A;  3C8G B;  1KQS U;  3HB3 B;  3K0G A;  4PA9 A;  4U5C E;  1NQT A;  5L0H A;  1Z5W A;  2ZR3 A;  3SYP A;  5EK0 A;  3NYJ A;  4CH4 A;  4EB6 A;  1NTK H;  3X2Q C;  4LF6 O;  3CD6 V;  4C3B A;  3E9V A;  2ITD C;  3D36 A;  2R02 A;  3FXH A;  2OTJ V;  3IEE A;  2OOC A;  5HV9 A;  1BE3 H;  2ZCE A;  4X65 O;  4WCE V;  2QR4 A;  2QKC A;  4PJM A;  4YHH B;  5GPG B;  1KYO F;  1PPJ H;  3IC9 A;  3EHM A;  2X0L A;  1K5S A;  4X89 A;  3HKC B;  1R73 A;  2ZPA A;  3NG1 A;  2ASR A;  1JR8 A;  2UUB B;  3A2F A;  4FLV A;  3N27 A;  5CA1 A;  1GO3 F;  1OW8 A;  4O79 A;  4YXW G;  2HV7 A;  2ZIM A;  2D3O W;  4B3M B;  4DV6 B;  1PCX A;  2CK3 G;  1ORQ C;  2D4U A;  3Q7G A;  3LEV A;  2YKZ A;  1NU9 C;  5D91 A;  4X88 A;  1YJ9 V;  1QU7 A;  1WB7 A;  4DRX B;  1OCZ C;  3B8N A;  3QG5 A;  1ZW2 A;  5IE9 A;  3FX7 A;  4YIO A;  2XT9 A;  3I55 V;  3SJC C;  2L35 A;  1CXZ B;  2P0N A;  5EZY A;  1EM1 A;  2XSE A;  2R25 A;  1MNG A;  1AI6 A;  1HNW B;  3CZ6 A;  4ULW A;  5C8Y A;  3RBZ A;  3KKB A;  2YXY A;  2LSE A;  4XLN F;  3EHB B;  3C3S A;  5KLV H;  3QO7 A;  3K79 A;  1RMV A;  2Z15 A;  2WVN A;  1BMF G;  2W0F C;  4WGZ A;  5D92 A;  4C3E A;  3CRR A;  3HKD A;  4RAI A;  4AQY O;  1K34 A;  1ZHT A;  3LAY A;  3ZHU A;  1BHA A;  4XEV A;  2IYL D;  2Q0O C;  2GUZ B;  1GS9 A;  1QLE B;  2IXN A;  3OMN B;  4CBC A;  1YYX A;  1X4T A;  2XAS A;  4MTF A;  3US6 A;  4PV1 B;  5FZT A;  1US6 A;  1G4W R;  2OQM A;  4TSF G;  2DWD C;  1H2K A;  3P3N A;  4AQY B;  5E79 Z;  2KQ9 A;  2R7R A;  4RO2 A;  4QIW F;  1G6U A;  2HG5 C;  4RQF A;  2YID A;  1ZL8 B;  3QVN A;  3FDQ A;  2WZL A;  2P7V A;  1ORY A;  1YAU O;  2YL0 A;  3VYW A;  3ZQV A;  2DI3 A;  2BTO A;  3Q4H A;  4JYC A;  2UXX A;  4PDL A;  3H2U A;  4JYA B;  4Z1M G;  1D1B A;  4TWK A;  3AQB A;  4JE9 A;  1RSO A;  3GB7 C;  1SQX H;  4AK9 A;  1R3I C;  3R7C A;  3I5D A;  4FVM A;  3B0V C;  4JAV A;  4R8C A;  1V55 B;  3AG4 C;  1NTM H;  3RN4 A;  2LD6 A;  1FXK C;  1NVP B;  4OD4 A;  4UVA A;  4YJ3 B;  2LK4 A;  2NUT B;  2A7W A;  4EFE A;  1XIL A;  2EIM C;  1JJO A;  2Q8V A;  3T1Y O;  5L0D A;  2VCB A;  4U5D E;  3T2M A;  4FFK A;  1Y76 A;  4W4K A;  3CB2 A;  3EFO A;  2ZKO A;  5EIB D;  1NBB A;  3ML0 A;  2PTM A;  4G7Z F;  2EIJ B;  2WLI B;  4FM0 A;  5IWA O;  1BR4 A;  2Y4T A;  1YA7 O;  1DK1 A;  2YI9 A;  1N36 O;  4NTW A;  5FNV A;  1VQP V;  2WPD G;  4K8X A;  1LM3 B;  4HNA B;  1KTM A;  2WLL A;  4KHP O;  2ZXR A;  2ZE6 A;  3K3W A;  3W8I A;  2MW2 B;  4WFH A;  1K05 A;  1CEZ A;  1XHX A;  3IFX A;  1JMW A;  2AZ0 A;  1G4U S;  3C8G A;  5DQZ A;  4LDR A;  4PI2 A;  1R3L C;  2P06 A;  1HR0 O;  2XAH A;  3H1K H;  1PL0 A;  1QVG U;  4LFB O;  1FPO A;  2JRI A;  3BRC A;  3QZC A;  4JZG A;  2P61 A;  3T1C A;  4OIO F;  3U0Z A;  1NU1 H;  3WHN A;  2X6C A;  2XND G;  1BR1 A;  2R7S A;  1AVM A;  1RPR A;  1KKC A;  4LFB B;  5L3B A;  3HKC A;  2Q69 A;  3FKS G;  2PYJ A;  4LFA O;  3BAB A;  1A41 A;  4HAM A;  5DED A;  2YIB D;  2LP7 A;  1N33 O;  3BA8 A;  4KP4 A;  1GRJ A;  1TWA A;  1KKD A;  1ZW3 A;  2CE4 A;  4JI2 O;  2W6I G;  1W2W A;  5A2Q N;  1SF9 A;  3A0H Z;  3BEH A;  2A1D D;  1SS3 A;  5DS6 A;  4HEA J;  2OYQ A;  1RKE B;  2XLH A;  3PDM P;  4DRX A;  3QVZ A;  1M9N A;  5A6J A;  4ZKI A;  3J06 A;  1JA8 A;  1S5J A;  3ABK B;  1SQF A;  5B1B C;  4BEM J;  1E85 A;  5AG2 A;  2ZT9 B;  3RQG A;  3R65 A;  4DR5 O;  4BJ5 C;  4I9Q A;  2HLD G;  2EIK B;  3S9O A;  1ARO P;  4RDA A;  1VQ5 V;  3KG2 A;  1P84 F;  1WJZ A;  4H13 B;  2D5R B;  4U5G A;  3B40 A;  1OKK D;  4P9F A;  2XLO A;  2IU0 A;  4HYO A;  1PD0 A;  3OW2 U;  4EBJ A;  4I50 B;  1MMG A;  4YK5 A;  3MDS A;  2GUZ A;  1OCO C;  4DW1 A;  5KA5 A;  1KC8 W;  4JVS A;  4WBN B;  1Q6U A;  5JSL A;  1Y67 A;  4P6I C;  2MK3 A;  3MFN A;  1P7G A;  2E75 B;  2VQE B;  2WLK A;  3BVO A;  3GM2 A;  1I0H A;  3LDE A;  3AG3 C;  5F2V O;  1NZE A;  3J7A U;  2R03 A;  4Q7C A;  1R5I D;  4D4X A;  1O5H A;  3LES A;  1ZL8 A;  3S3X A;  5KYU B;  3ZIA G;  1AUE A;  1Q0G A;  3KCX A;  4Z1V A;  5JH7 B;  2XM0 A;  3MYI A;  3N2G B;  1OCR B;  3OMI B;  1YDI A;  1VQ8 V;  1YCI A;  1WA8 B;  4DK0 A;  2KSF A;  3T9O A;  1TVK B;  1ZZP A;  2DYS C;  2W45 A;  4AI8 A;  4ABM A;  5KHK A;  4LER A;  3NDB B;  4XPY A;  2XAQ A;  4LF7 O;  2QY9 A;  3CCR V;  4DRI B;  3U0C A;  3ZMS A;  1H7I A;  4DK1 A;  3STZ C;  1SZT A;  4DO2 A;  2HHH O;  2D2C B;  4A5U B;  1H2S B;  4YJ3 A;  1K40 A;  2CAZ C;  2NUT A;  4FM1 A;  5IT9 N;  5LYJ B;  3I5Q A;  1I7F A;  3LLI A;  4I1O B;  1K9M W;  1GQA A;  3LDC A;  1K4D C;  3D3Q A;  1RM1 B;  3PJS K;  4DR4 O;  4J7J A;  5BR8 O;  1XZP A;  5CI9 A;  3UGO A;  4JI6 O;  1GM7 A;  1NTZ H;  3RIP A;  2Y3G A;  4JEA A;  2WLI A;  3FFQ A;  3I56 V;  4X66 B;  3V5Z A;  4LF4 B;  4EBK A;  2F22 A;  3DTU B;  4UV8 A;  3TGU H;  1AR4 A;  1MNE A;  4HZ3 A;  4HNA A;  2HJ3 A;  1U0B B;  2CW0 F;  4DV2 O;  3OT7 A;  3HNJ A;  2CDY A;  3CCJ V;  1Q0F A;  1B04 A;  3CRQ A;  3TXS A;  2DN9 A;  3TOL A;  2ITC C;  4OGQ B;  4DUY B;  4WF9 V;  3F47 A;  4DV0 B;  1JFF B;  2YIC A;  4F6R A;  1Y6D A;  1Z5Z A;  3ZDL A;  3DE9 A;  1NSG B;  4BAY A;  1AJQ A;  4FIP C;  3CXH F;  3IC7 A;  2VCC A;  3ATP A;  1OJH A;  2P4K A;  3VRC A;  1BZ4 A;  3RYI B;  3FB8 C;  3ZSU A;  2QWR B;  5IY5 C;  4YL0 A;  4DJ9 A;  5A69 A;  2XL8 A;  1XL6 A;  4R6Z A;  3GOD A;  4PR9 A;  4JAU A;  2IXP A;  3VF0 A;  3OWT A;  3F5T A;  4JYY A;  4PDR A;  4W8K A;  4FX5 A;  1QVF U;  4C7O B;  5B3S B;  2QDO A;  1YZC A;  2W6J G;  4GKJ O;  1RKE A;  2M4E A;  3ZTZ A;  2XTA A;  3JD1 A;  1M6T A;  4E0H A;  2ADQ B;  2Q7G A;  3OGC C;  2JDI G;  3WFV A;  2EPK X;  2AWC A;  2EPN A;  5IYC O;  1BQZ A;  4JI7 B;  3BFR A;  3KZI Z;  3K1H A;  4LWS B;  4O6Y A;  2ADP A;  2UUC O;  2OTL V;  4OX9 B;  5E3C A;  1IBL O;  4LF5 O;  2ZNI A;  1K3E A;  3ZTM A;  4X1I B;  4Z9J A;  2LFD A;  2LFR A;  2RJZ A;  2JIZ G;  1N34 O;  2EZP A;  3BA9 A;  1TR2 A;  3ETQ A;  4FFB B;  1YIT V;  1LIH A;  4NYK A;  2P67 A;  4ICG A;  4I50 A;  3EH1 A;  3MLG A;  1FFT B;  1XNR B;  2C2A A;  2KGO A;  3JAR A;  3QO5 A;  2QTO A;  5JJE B;  3ETD A;  3SDL A;  2XL4 A;  2XM4 A;  1QZX A;  4DV1 O;  3TOM A;  4RUF A;  4GX2 A;  2IXO A;  4CS9 A;  2J8W A;  1ZHZ A;  2Q7E A;  2ZE5 A;  5CBF A;  1AB3 A;  3F46 A;  3V5X A;  3JAK B;  2F66 C;  4FLU A;  2Q5Z A;  5KYU A;  4QNH B;  3ABM B;  2BE3 A;  3DM9 B;  5JH7 A;  3N2G A;  3OD4 A;  4JI8 O;  3GVM A;  1G1X B;  4X62 B;  1WA8 A;  4FLX A;  2QUP A;  1TVK A;  2YSU B;  3SJQ C;  2NLJ C;  4YT2 A;  5JQG A;  4GKK O;  4JI5 B;  4AL0 A;  3A0R A;  1YZB A;  3SZR A;  4O2B B;  4PA7 A;  3NMK A;  2LO1 A;  3JRT A;  2CGO A;  3CEX A;  2CTQ A;  1W0K G;  1CGM E;  3K66 A;  2HKO A;  3W7U A;  5LYJ A;  2Y0I A;  1WTY A;  3DXJ F;  2QKA A;  4O6M A;  1XMO B;  3QMK A;  4LF8 B;  1XI1 A;  5HFM A;  3FOP A;  4G28 B;  3EXA A;  4O4I B;  1M1K W;  5A6K A;  4MSW C;  2Y69 B;  2A68 F;  3IQ5 A;  5JLI A;  1LUV A;  2OEX A;  5IDJ A;  4R7C A;  2A3Q A;  3RFR A;  4DR2 O;  4YJW A;  3AG7 A;  1XRE A;  1JOY A;  3JSN A;  4CSA A;  3JAM N;  5H2F Z;  4XEF A;  5T1D B;  4MVU A;  1ZSP A;  5LOV B;  4B3S B;  4WGY A;  2YVK A;  2YIB A;  3GEE A;  4DR2 B;  4JCZ A;  1NI8 A;  4CS7 A;  2HSQ A;  4KUM A;  3HJC A;  4GQH A;  3W7W A;  4PJJ A;  3P30 A;  3N2K B;  5LP6 B;  2WA3 A;  4TV9 B;  2F4V O;  4N23 A;  1AI7 A;  1D5A A;  1VMA A;  2Q9B A;  1HY5 A;  4U5H A;  1SYQ A;  1GN6 A;  1VQN V;  1UJW B;  1ORS C;  4RUE A;  4KL1 A;  3I5P A;  5L3V A;  3RYI A;  1MAB G;  1YVI A;  5KHH A;  3AK1 A;  4FZ0 A;  4EUK B;  1WP7 A;  2RD9 A;  1P7B A;  3S27 A;  1JMK C;  4P30 A;  3VQW A;  3ZRV A;  5K1X A;  1Q86 W;  4JI3 B;  1WWP A;  1Q3E A;  3JAL B;  1KP3 A;  3X2Q B;  2XS1 A;  3E83 A;  4H33 A;  3H1I H;  3K58 A;  3K7D A;  1HNZ O;  3VQY A;  5L3C A;  4TUY B;  2WLJ A;  2Q0A A;  3NXS A;  1TWH A;  1OKK A;  2YLI A;  2XLD A;  5DS4 A;  1VF5 B;  4MTO A;  2YDE A;  4NC3 A;  2WLM A;  2HZ8 A;  1T5O A;  5L0F A;  3KKY A;  1VQM V;  1QR9 A;  1XEQ A;  1XMQ B;  3ZHV A;  1KB9 F;  3CCM V;  3L8I A;  1SRY A;  3SYA A;  2F43 G;  2XHB A;  2GSM B;  3IGA C;  2HMZ A;  4ANJ A;  1BZK A;  1AVO B;  2AW9 A;  4JGS A;  1GKF A;  4LWS A;  4MW8 A;  2HSB A;  1Q5O A;  4UCS A;  1YA9 A;  3E70 C;  3O6X A;  2OCC B;  3E89 A;  1XNQ B;  2PBE A;  3Q6M A;  3JCU Q;  1CPQ A;  3B09 A;  1I08 A;  2XRH A;  4ZOL A;  1PV3 A;  1F4N A;  4FFB A;  4U5E E;  3TJ5 A;  1S77 D;  1COW G;  3L34 A;  1MND A;  2DWE C;  3RVZ A;  1NLX A;  4XWJ A;  3TJT A;  3CCL V;  2YI8 A;  1DOV A;  1H2N A;  4JPR A;  5KAF Z;  5GON B;  3DD7 A;  3AJM A;  1K4C C;  2UXC B;  1VIB A;  1RJ9 B;  2XL6 A;  5JJN B;  3D36 C;  4FLZ A;  5DN6 G;  3ZC4 A;  4WJ0 A;  1YF2 A;  2YRF A;  2V3C C;  2KYH A;  4LNU B;  3VOU A;  4F6E A;  3ZMZ A;  1BSM A;  1OR3 A;  2MYS A;  3I4U A;  4IAR A;  2A6H F;  1EFR G;  1AR1 B;  4YJ2 B;  3T4D A;  3JAK A;  1H38 A;  3N0T A;  1SQG A;  3AG1 C;  4WFE A;  1J5E B;  2EIN C;  2KW3 C;  4LAC B;  4H4K C;  3SXK A;  1AP5 A;  3IJ4 A;  2QTV A;  2QEX V;  2MWQ A;  4LFC B;  2XAF A;  4BJ1 A;  3V7O A;  3CRA A;  3UMK A;  2J7P D;  3W2W A;  4JV5 B;  4ZIB A;  4B3T B;  2CYD A;  3D3I A;  1VOM A;  4FPP A;  3SXM A;  1VTM P;  2HVK C;  3FMS A;  5EBL C;  4O2B A;  4QI2 A;  1T9K A;  4YHH O;  1KD1 W;  5F5H A;  4E7S A;  1I5Y A;  3ASN C;  1YJN V;  3JRM O;  1HNX B;  1TKN A;  2Y4U A;  3DGE A;  3H1J H;  3CCE V;  2UUB O;  1BS3 A;  3SP1 A;  3L1M A;  2GA0 A;  1QLN A;  2EIL B;  2WL8 A;  4DRJ B;  5GTI Z;  5IYZ B;  4PA3 A;  4O4I A;  1QPU A;  4B3M O;  4IAO A;  4DV6 O;  1R6T A;  3P3P A;  1YI2 V;  1I94 O;  1D0Y A;  5F28 E;  3EPV A;  5JRA A;  4H54 A;  2A0L A;  1DGS A;  2UU9 B;  2DB4 A;  4CH6 A;  3LSS A;  3TJ6 A;  3RYF B;  4KBL A;  3VAY A;  3LSQ A;  1D0X A;  2J9B A;  2WSS G;  5LOV A;  1I94 B;  5GW7 A;  3S28 A;  2NUP B;  2IBF A;  3S84 A;  3RF3 A;  3CSK A;  3W4Y A;  1SQB H;  1K73 W;  5CI8 A;  1AIL A;  4CS2 A;  4LCU C;  2IJI A;  3W8H A;  2DGJ A;  2CTP A;  1HNW O;  4JJG A;  4A2N B;  1XZQ A;  5EBW C;  1E86 A;  3DWW A;  3GEH A;  1Y74 B;  4DV7 B;  1K8A W;  1G4Y B;  2V7Q G;  5A9G A;  5BZB A;  3DAG A;  4YN0 B;  5DVW A;  3N2K A;  3ZHS A;  5LP6 A;  4TV9 A;  1Q81 W;  1GM5 A;  1VQO V;  2F23 A;  3KYI A;  4MTG A;  2YL3 A;  3EGD B;  2AU5 A;  3L72 H;  1TGO A;  3KCY A;  1XHZ A;  1T6Q A;  2L6L A;  4UB6 Z;  5E1A C;  1WNS A;  4U9D A;  1R1B A;  1T5E A;  2QA4 V;  3LLK A;  3MX3 A;  1EN4 A;  3E35 A;  1LNQ A;  2H7V C;  1M4U A;  4NTY A;  5B1A B;  2HP8 A;  2WZF A;  3JAL A;  4KNV A;  2Q73 A;  3RYC B;  4TUY A;  3K5L A;  3ZWI A;  2CTR A;  2XLE A;  2IBZ H;  4J9Z B;  3P32 A;  2J9W A;  3JZ0 A;  3EHN A;  3OUF A;  1SET A;  1QKR A;  2Q9C A;  3LS0 A;  1SR2 A;  5LHI A;  5KHJ A;  1OQC A;  1M2V B;  4JYA O;  2TMV P;  2AWY A;  2F1M A;  3FOO A;  1Q7Y W;  4MTX A;  3M1C B;  4LH7 A;  2Q68 A;  1PV0 A;  1N0J A;  3AG2 C;  1W2B U;  1N32 B;  1BR2 A;  1T01 A;  1OXK A;  4JAA A;  4J10 A;  1XL4 A;  3K1I A;  3EFF K;  4QDL A;  2PI5 A;  3KYJ A;  3H01 A;  1VQL V;  4OIN F;  2Z0A A;  2F95 B;  2Q9A A;  3ABU A;  2RCV A;  4WFF A;  1NBM G;  3HNK A;  5B1B B;  2RNB A;  3TK0 A;  1FFX B;  3CS5 A;  3L75 H;  2AHZ A;  2Q7R A;  1N4C A;  2LP4 A;  5GON A;  2BOC C;  1B68 A;  2P22 C;  1RJ9 A;  5BXZ A;  4N6H A;  3AOU A;  5E33 A;  4TT3 G;  5CBG A;  1ST6 A;  3S29 A;  1PL4 A;  3ZCC A;  1FXV A;  4LNU A;  4DUZ O;  3WB0 A;  5CB4 B;  1I5X A;  3JD0 A;  1HP8 A;  1GN2 A;  4I44 A;  3OEO A;  3SR2 C;  3K04 A;  2PZS A;  2KJG A;  1B06 A;  2DJV A;  4DV5 B;  4PA6 A;  3VQV A;  1E84 A;  4MND A;  5E2Q A;  4FZ1 A;  3MHS C;  4DUZ B;  4DVZ A;  2DW4 A;  3OE7 G;  1SZX A;  2YXL A;  1TFK B;  3NYM A;  5CMU A;  4JYB A;  2K9P A;  2DMX A;  5EC1 C;  3PMR A;  3AG3 B;  3LUT B;  5AGF A;  5IJ0 B;  4O2A B;  1F23 A;  2EJ7 A;  5GTH Z;  3WB1 A;  3CXC U;  4AHC A;  1A0B A;  1X59 A;  3FYI B;  4XQ1 A;  5H5N A;  2ZDI A;  3U5S A;  3RQE A;  2K1E A;  5B5E Z;  1CP9 A;  1Z5V A;  2PGG A;  2XLW A;  2CNW D;  5KYN A;  3M4C A;  1VYI A;  4ZHQ B;  3SJA C;  2LGQ A;  5IYZ A;  3WU2 Z;  3E2E A;  1U97 A;  1VAR A;  2E76 B;  2R7O A;  3HTK C;  4QJF B;  4B3R B;  4ASU G;  3K57 A;  2M6Y A;  2UUA B;  2GHY A;  1TAE A;  2ZXW C;  4JW1 A;  4RD9 A;  2JS5 A;  3RYF A;  4PJN A;  3K5N A;  3HR0 A;  4N06 A;  1IUR A;  1E1Q G;  3WOD F;  2P6V A;  3POV A;  5CIV A;  2OT5 A;  1YJG A;  1QLE C;  3W2V A;  2V4D A;  2JPU A;  5J2T B;  3CWB H;  1L1F A;  2FAP B;  2NUP A;  1HW1 A;  1RKC A;  2Q4F A;  1HE9 A;  3ECS A;  3GAN A;  1SER A;  1AEP A;  1IW7 F;  1J8Y F;  2RQ6 A;  1RCP A;  4LF9 B;  1Y74 A;  3UMH A;  1QBZ A;  2OIG A;  4JI0 O;  3RH3 A;  1R4T A;  4CS8 A;  1VEW A;  1VMG A;  1ZVZ A;  3EGD A;  2R7U A;  1IZ3 A;  3PN1 A;  5L0C A;  2E87 A;  1S3J A;  1K7D A;  1S72 V;  3JCU Z;  3A0B Z;  4IYH A;  1NG1 A;  2Y39 A;  4NTB A;  4IIJ B;  4JI0 B;  4Q5S F;  4IHJ B;  4QPK A;  3N24 A;  1G8X A;  2VQE O;  1FMW A;  4O4L B;  1BHB A;  1NFN A;  1OCC B;  4I9W A;  1OR2 A;  2WA4 A;  1V55 C;  3WG7 B;  3DJN B;  2H94 A;  1DLB A;  3RYC A;  2DYR B;  1K92 A;  2IM9 A;  4GLX A;  4PK4 A;  2KG7 B;  2VWJ A;  3OAA G;  1SMY F;  2A0U A;  3OR6 C;  2H7B A;  2RN9 A;  1KMI Z;  3NMI A;  1Q43 A;  4Z9H A;  3SEO A;  4X20 B;  5CBH A;  3RW0 A;  2V26 A;  3J80 N;  3M7M X;  2ZXP A;  1FFH A;  5IY5 B;  1M2V A;  2UXB B;  5L3F A;  1RP3 B;  2Q6A A;  4BJT A;  5CN0 A;  2VB6 A;  1VF7 A;  4H0L B;  4DR3 B;  5CA3 A;  1Q0K A;  4GCZ A;  3EGX B;  2WLN A;  3CRM A;  1S5H C;  4GX0 A;  3CEI A;  3EVK A;  4I4T B;  3V5Y A;  2GFH A;  3RYH B;  3OM3 B;  1H6G A;  4IAQ A;  4KC9 A;  2J7P A;  4UFZ A;  1FFX A;  1HMD A;  1E2X A;  4BJ5 A;  2I8B A;  1H9T A;  1YVW A;  2VAS A;  1IVS A;  3C18 A;  5B66 Z;  1YYJ A;  2ILM A;  4X66 O;  3R2P A;  4E7Z A;  4LF4 O;  1ZU5 A;  4JI4 B;  4BJ6 A;  1WP8 A;  2JEX A;  3SPI A;  4IRU A;  1KBH A;  1WN7 A;  5CB4 A;  1MOF A;  3UM7 A;  1TWG A;  2GWW A;  1D2D A;  4JIO A;  4CC6 A;  5ITZ B;  1TUE B;  5FPR A;  4E17 A;  2QWO B;  2A06 H;  1ZTE A;  4DUY O;  2W4B A;  1PP9 H;  4DV0 O;  2R05 A;  3UO3 A;  2JGD B;  5KX5 B;  3JYY A;  4NQF A;  2FYU H;  3ASO C;  3U8P A;  3JAS B;  4QGP A;  5K0I A;  2XLV A;  4HBN A;  1RFY A;  4PHZ A;  2ETS A;  3U3F A;  1DOW A;  2H8P C;  5IJ0 A;  3G6E V;  1LUW A;  1MSD A;  4O2A A;  3CCQ V;  4DR7 O;  4WFG A;  3EJN A;  4I3M A;  1XUQ A;  1WB8 A;  4IJJ A;  3QTH A;  4J7Y A;  4BG0 A;  4QE9 A;  4PJ0 Z;  3C8Z A;  2YL1 A;  3U11 A;  1FYJ A;  4N4W A;  3THO A;  3M79 A;  2JJ2 G;  1EA8 A;  4J80 A;  1V9P A;  4DR7 B;  1GN3 A;  3UKM A;  1XWJ A;  1APC A;  1JOG A;  2FTK A;  3FAV B;  3O9O A;  2G3V A;  3VQX A;  1VQK V;  3U9M A;  2X6A A;  1R6N A;  4DR6 O;  4M63 A;  1RXQ A;  3IPM O;  2J0W A;  5J2T A;  4NXN B;  5FL7 G;  4D7S A;  3J81 N;  4O7G A;  2ZXO A;  3B2E E;  3SPJ A;  4JI7 O;  3LS1 A;  4X1Y B;  4J7T A;  4JC7 A;  4CS9 C;  1YDX A;  2YEV B;  4U3J B;  2P90 A;  4DR6 B;  4YL3 A;  1A7D A;  2MHR A;  2PX0 A;  1YZA A;  3DKA A;  4OX9 O;  3FAJ A;  1I4Y A;  4UCR A;  3TET A;  3GWO A;  1MMN A;  2FGY A;  3U3B A;  4B7E A;  4BIZ A;  3B29 A;  2LJ2 A;  1SC5 B;  5EIB C;  4Z9I A;  4NB5 A;  3ZN0 A;  3JSZ A;  2WWW A;  3C7J A;  4FAP B;  2EBO A;  3HNI A;  5D5Q A;  5EC2 C;  1XNR O;  4IIJ A;  3SYC A;  3TXQ A;  3JAW B;  5E3A A;  4OIQ F;  1V54 B;  2QWN B;  4PEL A;  4A4A A;  1K33 A;  4O4L A;  1I4Z A;  4ER9 A;  5A6B A;  2EUL A;  3FB6 C;  4IT5 A;  3W7S A;  4WBN A;  4CIH A;  3CYO A;  3G67 A;  4J41 A;  2KG7 A;  1EZJ A;  3UO2 A;  3ABL C;  2BL2 A;  4BIU A;  4XEK A;  1Y6X A;  5T3T A;  3HKE B;  1RM1 C;  2HR3 A;  3JSL A;  4K3A A;  4X62 O;  2LGW A;  3L73 H;  5COG A;  1GH6 A;  4GYC B;  1W0J G;  2WVQ A;  4JI5 O;  2YUA A;  4B6I A;  2Y3B A;  2HV6 A;  3G6B A;  4DW0 A;  1KUQ A;  3QW1 A;  1VF6 C;  3EGX A;  3ZVR A;  1MMA A;  2Q7H A;  4X64 B;  2ZIO A;  4CS3 A;  1MZE A;  5HFL A;  4NR1 A;  3Q7L A;  4I4T A;  1H2G A;  4CH3 A;  3MD0 A;  1TA8 A;  1XMO O;  3OR7 C;  3RYH A;  2PNO A;  2R72 A;  4LF8 O;  3OA1 A;  3T6J A;  1S5L Z;  3IHU A;  4D4N A;  2OJQ A;  4XPW A;  4MW3 A;  3NKE A;  1JAF A;  2IW5 A;  3CAX A;  1FKA O;  3U9J A;  1OHH G;  3CME V;  2J9V A;  3FB7 C;  2QNL A;  3CJH B;  4KXR A;  3RFY A;  5B1O A;  5H6R A;  3D8C A;  4CX9 A;  2P5O A;  1V4A A;  3QNE A;  4DBQ A;  2HKV A;  4CC5 A;  3SJB C;  4ZI7 B;  1KU9 A;  3DI5 A;  3OTO B;  4OIP F;  4X8A A;  3JYH A;  4B3S O;  1CGO A;  3KL4 A;  4DOZ A;  4E18 A;  2CNW A;  1UFI A;  3B77 A;  2X0C A;  3L70 H;  4E4E A;  2QLA A;  3UT5 B;  1YAR O;  3O10 A;  1JPX A;  1M57 B;  1Z2G A;  2XLM A;  4N6C A;  2QE7 G;  3APO A;  5KX5 A;  3QVY A;  4AE4 B;  4FLT A;  3JAS A;  1HMO A;  3U8V A;  1D1C A;  5CA0 B;  1HW7 A;  2WLH A;  1IBK B;  2LQT A;  5B3S C;  3RQF A;  1XOU A;  1G5Z A;  4DR1 B;  4DV3 O;  5EBM C;  4YT4 A;  1JFF A;  4UCU A;  3LEO A;  4K0D A;  3AG1 B;  1Q82 W;  4J9Y B;  4DV4 B;  4U5F E;  4AIL C;  1CGN A;  4K7B A;  3M8A A;  2VQF B;  1OW7 A;  3L74 H;  1SQV H;  2NN4 A;  2OJE D;  1JPN A;  1ZUQ A;  1L8D A;  2F93 B;  3FHD A;  1PKX A;  4DYL A;  5KMG B;  1C02 A;  1IXM A;  1ZAU A;  4DV3 B;  4NCQ A;  4JI3 O;  1VQ9 V;  1Y4M A;  3CCV V;  4XLP F;  1LI5 A;  1F51 A;  3ZHT A;  2JGU A;  5DLJ A;  3FAV A;  1UG7 A;  5L0I A;  1GMG A;  3UR3 C;  4HE8 D;  1ZHW A;  2IJK A;  3TUL A;  2ZQM A;  1NJI W;  4GEH A;  2KKW A;  4IL6 Z;  2BC5 A;  1XMQ O;  1SZI A;  2B0J A;  1FFT C;  1Q0D A;  4U7O A;  3G4Z A;  1ZU4 A;  4C7O A;  4P9T A;  5DEC A;  3SPG A;  5KUM A;  2NNU A;  5JT4 A;  4X1Y A;  2P1A A;  4QPJ A;  2M64 A;  4LDQ A;  2YEV A;  4U3J A;  4OIR F;  2E5L B;  1VYK A;  1S0V A;  1R3K C;  1TFO B;  3NYL A;  3EQL F;  2ARH A;  1HW2 A;  1XNQ O;  3ABM C;  1PD1 A;  2PUS A;  2EZO A;  2B1I A;  3FAP B;  3KPH A;  4EFB A;  4NVP A;  3E8H A;  5D5P A;  4NXM O;  2XAJ A;  3JAW A;  4X1I A;  2FML A;  2UXC O;  3K6B A;  4DBR A;  2BCC H;  5EHH A;  4P9O A;  1QCE A;  3C62 A;  1OCZ B;  1P4R A;  3KMI A;  1GM9 A;  3NMJ A;  2HMQ A;  1LS1 A;  1LR1 A;  4J7K A;  2IXM A;  3ZMV A;  4NXM B;  5DS5 A;  2YC0 A;  4O6N A;  3QF7 A;  2L6G A;  3G80 A;  1J5E O;  4U7N A;  2BSK B;  3TQO A;  1KU2 A;  3HKE A;  4F4B A;  4IWB A;  3CX5 F;  4CS4 A;  2Y0P A;  4LFC O;  5JCO A;  4B08 A;  1PNL A;  4IB4 A;  2J45 A;  2IH1 C;  4JV5 O;  3EZH A;  3GM3 A;  4B3T O;  3GM1 A;  1Z63 A;  3OEH G;  4XDK A;  2HJM A;  2NPU A;  4FLY A;  2XAG A;  1S76 D;  4GUN A;  4K0K O;  3DM5 A;  3BRJ A;  4LLC A;  2VC9 A;  1M56 C;  4XTK A;  3B0U X;  3PCV A;  5BQI A;  4LLE A;  3ETG A;  3GWK C;  2B1G A;  1M5I A;  1HNX O;  3EG9 B;  4N21 A;  1SQQ H;  2XS8 A;  1PNM A;  3O39 A;  4LH6 A;  2XXA B;  5LMU B;  2ZM6 B;  1Y76 B;  2QM8 A;  3JYC A;  4G2K A;  4JI1 B;  5K1P A;  2W4M A;  1Q90 D;  4K0K B;  4DXW A;  2QKS A;  2LCH A;  2C04 A;  3R66 A;  5KYY B;  2WVO A;  4PJL A;  5FCL A;  5LP6 C;  5FNV B;  2LFS A;  1U96 A;  3CJH A;  4AX2 A;  4JZA A;  1E1R G;  1PNK A;  2UU9 O;  5IJ9 B;  2J0X A;  5COF A;  1FJG B;  1YIJ V;  4QE7 A;  5KHI A;  1IZM A;  1FXH A;  4ZI7 A;  2YWA A;  1GN4 A;  3TK1 A;  5T3W A;  2H8A A;  2RSE B;  4ULV A;  4FES A;  4GX1 A;  2A9H A;  3G4S V;  3ZJZ A;  4EWC A;  4LDK A;  3UT5 A;  1WOL A;  5BQG A;  3AG4 B;  3DC6 A;  1FXK B;  3ZMU A;  3HKK A;  3M15 A;  4DV7 O;  1BCC H;  3IAY A;  1VLS A;  4AE4 A;  2PP4 A;  2EIM B;  4J32 B;  2QJ1 A;  5KYX B;  2AGA A;  5CA0 A;  4FMT A;  5J9P C;  2IM8 A;  1NT2 B;  2L6F A;  1B6Q A;  3EH2 A;  1MQV A;  5COM A;  2WB7 A;  4LF6 B;  2FKX A;  5BMV B;  2AZ2 A;  1MA1 A;  2OKU A;  3DZA A;  4X65 B;  4L87 A;  1IXB A;  4OD5 A;  2KB1 A;  5KHG A;  3E86 A;  5KMG A;  1WN0 A;  2NG1 A;  4G0H A;  1J95 A;  1YXB A;  2G3K A;  3MBG A;  4UCO A;  3ZHQ A;  3UQ8 A;  3K1I C;  2OCC C;  1JPJ A;  2YLD A;  4F4L A;  5TJ5 E;  2ZIN A;  4O4H B;  1UPG A;  2CH7 B;  2GTA A;  4JEB A;  1W59 A;  2L9J A;  2ZE7 A;  3QTC A;  5IYB O;  4XPX A;  3BAA A;  3ZRW B;  1VK5 A;  4WFA V;  3IQ6 A;  2YS8 A;  4BPM A;  2HJF C;  1VQ7 V;  3X1O A;  2A69 F;  4TQD A;  4TV8 B;  1EI7 A;  2Q4P A;  4E0I A;  1N32 O;  4YIP A;  1Z23 A;  1THZ A;  3K59 A;  3S3W A;  1L7C A;  3AQC A;  2ZXW B;  3BPZ A;  2Y3D A;  3CPW U;  2B5U A;  3K08 A;  5IYD O;  3NKD A;  4JRZ A;  4EIY A;  3Q6N A;  3ZRX A;  1K97 A;  2NSG A;  3AGT A;  1FTS A;  1ZLZ A;  3WB2 A;  1QVX A;  1VLT A;  5A6B D;  3ZMT A;  1LE2 A;  2L7A A;  5L3Q A;  3HPL C;  1WAT A;  2GDC A;  5LXT B;  1DTO A;  1S7Z A;  2B9Z A;  4D7T A;  2IOQ A;  1R6K A;  4H44 B;  2ZDI C;  2LW1 A;  3S90 A;  4H37 A;  4RBN A;  2R7W A;  2BSK A;  1K04 A;  2H3O A;  3B4S A;  4DV5 O;  3SXZ A;  4Q6G A;  1YEW A;  1U89 A;  3T1H O;  2R9R B;  2EIL C;  3G4X A;  3K33 A;  5LMN O;  4HFK B;  3DE8 A;  1LVK A;  3VM6 A;  4CJG A;  2OIE A;  4Q20 A;  4BR6 A;  4YJ2 A;  4ONS A;  4FWV A;  3A9C A;  2DQ0 A;  3CQZ A;  3W7X A;  1YHQ V;  5JVD B;  3FVY A;  3T1H B;  1OCO B;  1J8M F;  5LMN B;  2CCY A;  4I7Z B;  2VWK A;  5EYP B;  3U10 A;  2XXA A;  3EG9 A;  4CJO A;  3A11 A;  1DF4 A;  2FFH A;  2LFF A;  1PD3 A;  2UXN A;  2JVD A;  1N0N A;  1I5N A;  3STL C;  5KYY A;  1MSW D;  2R7X A;  4J11 A;  4X1K B;  4PFP A;  3HNL A;  1AI5 A;  3T1Y B;  4B3R O;  3ZED A;  4OXS A;  4CS8 C;  2UUA O;  5IJ9 A;  1K5Q A;  3JD3 A;  3F5W C;  3K5M A;  1TWC A;  3U2L A;  1B3Q A;  3ETE A;  3HKB B;  2HJD A;  1Y66 A;  2DYS B;  2W0X A;  4NY3 A;  4BEJ A;  1BQ0 A;  5L0J A;  5IWA B;  1EN6 A;  1H2L A;  1N36 B;  4JKV A;  3MYF A;  3CE2 A;  4I0X B;  1XQ8 A;  3K9A A;  4F6R B;  4KHP B;  1BDJ B;  5B1A C;  1L0N H;  3RVY A;  1FXK A;  4LF9 O;  4YL1 A;  3UNG C;  3K9S A;  2VCA A;  5KYX A;  4X0R A;  3ZHR A;  1N8R W;  1WLE A;  5TIS Z;  1TQG A;  1BBH A;  4GYT A;  1QR8 A;  4J7Z A;  4Z2W A;  2ZNJ A;  2QWP B;  3UGP A;  1HR0 B;  2R9I A;  3MHH C;  2LQG A;  5A6A A;  3LDD A;  5BMV A;  3H2V A;  3RT3 C;  3MAQ A;  4RWU A;  3L0I A;  2V1D A;  1WPB A;  3SYO A;  1GM8 A;  1ROP A;  3ZG1 A;  2C03 A;  1QNM A;  1AR5 A;  1BL8 A;  2GTS A;  2CDQ A;  1O87 A;  2B0H A;  5JUA A;  3ASO B;  4I5S A;  1O9G A;  5JP7 A;  1JVM A;  2YLG A;  4LFA B;  1O3U A;  1BT8 A;  1N33 B;  1NR7 A;  4EKW A;  3LNR A;  4O4H A;  2CH7 A;  4FM2 A;  2Y48 A;  2JJ1 G;  2AVK A;  4JI2 B;  3ZRW A;  3W7T A;  4D6T H;  3ZS8 C;  1BGY H;  4LBE C;  4MQ9 F;  4MVM A;  4TOI A;  1H9G A;  2UXB O;  2EPO A;  4CIP A;  4AL1 A;  4EBB A;  1NS1 A;  1SF8 A;  2WAM A;  4J42 A;  4NTF A;  2FL4 A;  3M4B A;  1VP7 A;  3F7V C;  4TV8 A;  4BJ6 C;  4DR3 O;  2UUI A;  5FPO A;  4UCV A;  4JJF A;  2Z5U A;  4DR5 B;  2QM7 A;  1EBO A;  4MVO A;  2P4V A;  4MVR A;  1SES A;  1AJP A;  3EZI A;  1LPE A;  1OXB A;  4R32 A;  1EKY A;  2EIJ C;  1SQP H;  1FS0 G;  2DE0 X;  2EPM X;  3JD4 A;  3SNH A;  3SYN A;  2HFE C;  3CHX A;  3JAR B;  3SGI A;  3GWL A;  1H8E G;  1MMM A;  5AC5 A;  1E83 A;  5KYW B;  2EPL X;  2JD3 A;  1ZHX A;  1H8H G;  5BQH A;  5LXT A;  3RKO F;  3IQT A;  4JI4 O;  5LL6 Y;  2I15 A;  5JWP A;  3G50 A;  4B7K A;  1D1A A;  2X51 A;  3T6G B;  4QI0 A;  5HSW A;  5JS5 A;  3H65 A;  2Q67 A;  4UV9 A;  2XOK G;  2CGE A;  4DVY P;  3LJB A;  5JQG B;  3T6B A;  4WAB A;  2CTW A;  3AEI A;  3OGI B;  4MVS A;  4UCT A;  4BWA A;  2QWQ B;  5KUK A;  4X9Q A;  1MMD A;  3U2M A;  3OMA B;  5JVD A;  2P6J A;  4IYI A;  1A32 A;  4DRH B;  5EGY A;  3DSQ A;  3LSU A;  3CCU V;  3O55 A;  4CDA A;  5LGU A;  4OPA A;  2OU6 A;  3LNN A;  3K5O A;  3ABL B;  5EYP A;  2BE5 F;  4LF7 B;  3DMD A;  4ZLC A;  3ZN1 A;  1LS4 A;  1NFO A;  1L0L H;  3N2Z B;  4JUR I;  4LP8 A;  3OEE G;  3FB5 C;  4MT8 A;  1IBM O;  4NTA A;  2HHH B;  3B71 A;  3E8G A;  1IDS A;  1HWY A;  1M90 W;  4LR3 A;  2LIG A;  1WAZ A;  1KEC A;  1CPR A;  4X1K A;  3E8F A;  3ABK C;  4CBE A;  1JRA A;  1OZ0 A;  4FK5 C;  2PX3 A;  4P9P A;  2A79 B;  2JEU A;  4DR4 B;  2Z3Y A;  1HDJ A;  1YTF D;  2RMK B;  2EIK C;  1IBM B;  5BR8 B;  1NKD A;  4JTC B;  3HKB A;  3B8M A;  4BIO A;  4ZHQ A;  4JI6 B;  3CSX A;  5FLX N;  4W8P A;  4G7H F;  3RWR D;  3E22 B;  3L71 H;  2BTQ B;  3OTF A;  4C7U A;  5J2U B;  1M2O A;  1Q6H A;  4NXN O;  3S0X A;  5B3I A;  2XUM A;  3CP1 A;  1GTO A;  1O9H A;  4I0X A;  4XBF A;  1F7Y A;  4DV2 B;  1OCC C;  2AP3 A;  2ODM A;  3WG7 C;  2N74 A;  2DYR C;  2YQY A;  3H1L H;  3C3T A;  2YIA A;  5L3E A;  4YY3 O;  2G62 A;  5LHH A;  1E79 G;  1Z3I X;  1TUB B;  5L0G A;  2M7W A;  2R7V A;  1IX9 A;  1V74 B;  3RGB A;  1CPY A;  2E74 B;  3TD7 A;  2PYL A;  3PHF 2;  2L6H A;  2L81 A;  3JAT B;  2AHY A;  4YY3 B;  3L8J A;  1N1C A;  4JAS A;  4PI0 A;  3CC4 V;  2EX3 A;  1OCR C;  2PFD A;  4I1M A;  2QM4 A;  5JVE A;  2Q00 A;  1JJ2 U;  3DXR B;  4I55 B;  4L6R A;  2QTS A;  1XBL A;  1FR0 A;  4IHJ A;  1GK9 A;  1QQ3 A;  1SKV A;  1FNT c;  2OG2 A;  1JQ0 A;  4O4J B;  4XDL A;  2KNH A;  3AGU A;  1Q6I A;  3BY6 A;  4ZBM A;  5LHG A;  4RQE A;  2LW7 A;  1ZHY A;  4GX5 A;  4U5B E;  4MVQ A;  1HE1 A;  4GKJ B;  1JCH A;  4EHP A;  4X20 A;  1FD9 A;  3SPH A;  1UFB A;  1YLM A;  1R3J C;  4X64 O;  1KNY A;  4HFF B;  1QHT A;  4BW5 A;  4KI2 A;  4ZOL B;  3ZBH A;  1U6H A;  1WAS A;  2ATK C;  3ITF A;  1JR9 A;  2HS5 A;  3E8B A;  2Q3T A;  1EN5 A;  2VS0 A;  2UUC B;  2PY5 A;  2X7R B;  3JCZ A;  2E3C A;  2WZG A;  4CSA C;  1IBL B;  4LF5 B;  2YL7 A;  4R50 A;  4NKG B;  2ZE8 A;  2GBO A;  3QW0 A;  5AC4 A;  3JD2 A;  3BHP A;  1VB5 A;  3F7Y C;  1N34 B;  2R9A A;  5KYW A;  5F5F A;  1SA0 B;  4KFM A;  4MVZ A;  1AP6 A;  1NU7 D;  4GZR B;  2G38 A;  2QGN A;  2N05 A;  1ZYR F;  3RYL A;  2JK5 C;  1QSP A;  2OEV A;  2YHS A;  1FAF A;  1QQC A;  1GGQ A;  3OTO O;  2EJR A;  3FYE B;  4DV1 B;  2UUH A;  1WGW A;  3JTL O;  4G27 B;  2JS3 A;  5LA6 B;  3A8T A;  4PFO A;  4U9E A;  3UCS C;  2R70 A;  2DOS A;  2VRZ A;  3AK2 A;  2QSA A;  1ORJ A;  2ZR2 A;  2JX0 A;  4E2L A;  2HUJ A;  2X6B A;  5L3G A;  1YTF B;  1MG1 A;  1IBK O;  1P49 A;  2KSD A;  5ITZ A;  2IU3 A;  4JI8 B;  1Z7Q c;  1OV9 A;  1NH2 D;  4DR1 O;  3M99 B;  1AJN A;  4C3D A;  4EB6 B;  2GDS A;  3WAQ A;  4GKK B;  4UDV A;  3DJU B;  2JGD A;  4KNW A;  2N04 A;  1MZF A;  3OUS A;  3AK3 A;  4DV4 O;  4CDY A;  2VQF O;  2KC3 A;  1NR1 A;  2O9X A;  4G78 A;  3C90 A;  2IJJ A;  3CCS V;  4K1O A;  1T6I A;  5H6Q A;  4YT5 A;  1EQ1 A;  1T6U A;  4PD4 F;  4UVC A;  3ZIB A;  4K35 A;  2EIN B;  3B0P A;  4U3F H;  1VF6 A;  5CA1 B;  1LKX A;  3C8G D;  1M56 B;  1URF A;  4CH5 A;  1F1M A;  5BUO A;  3E22 A;  2GV9 A;  2BTQ A;  5J2U A;  3H9V A;  3T4Z A;  4EEQ A;  5JJJ B;  2OWO A;  2OCH A;  5H9C A;  3APQ A;  4MS2 A;  1V54 C;  2O57 A;  3O65 A;  2DQ3 A;  4FJC C;  2HFI A;  3G71 V;  1F4M A;  4JTD B;  3ASN B;  1M93 A;  4LC1 A;  2E5L O;  1AI4 A;  3JSE O;  1VQ4 V;  2HVJ C;  4L8J A;  5EZY B;  1Q0M A;  1C03 A;  4CZZ A;  4BW9 A; 
#chains in the Genus database with same CATH homology
 4F4L A;  1QBZ A;  3TCU A;  3LNM B;  4PDR A;  1G8M A;  5LGT A;  1QVF U;  5IYB O;  5B3S B;  3ZRW B;  3VBB A;  2W6J G;  3K0D A;  1RPO A;  1S3J A;  5KA6 A;  1K7D A;  4WFA V;  1S72 V;  3JD1 A;  2HJF C;  3OGC C;  1VQ7 V;  2IJH A;  2JDI G;  3WFV A;  4QPK A;  3K06 A;  1KP2 A;  1BHB A;  1OCC B;  4PDV A;  5IYC O;  4I9W A;  1V55 C;  3WG7 B;  1THZ A;  2H94 A;  1DLB A;  2ZXW B;  2BOB C;  2DYR B;  1K92 A;  4UUJ C;  5B1N A;  1VQ6 V;  3ZRS A;  3CPW U;  2B5U A;  3K08 A;  5IYD O;  2OTL V;  1ENV A;  1K3E A;  4PA4 A;  4WFB V;  3OAA G;  2LFR A;  1K97 A;  2ZD9 A;  3ZRX A;  3OR6 C;  2JIZ G;  2EZP A;  5CBH A;  3RW0 A;  2IH3 C;  4XDJ A;  1YIT V;  2P67 A;  5C93 A;  5L3D A;  3ZMT A;  5IY5 B;  2PI4 A;  3HPL C;  1YJW V;  1FFT B;  1YSC A;  5L3F A;  2C2A A;  1JX9 A;  2Q6A A;  3OFN G;  1DTO A;  4UVB A;  3SYQ A;  3QO5 A;  5CN0 A;  2QTO A;  3ETD A;  3QO8 A;  2Y69 C;  5CA3 A;  4GCZ A;  4RUF A;  4GX2 A;  1R6K A;  2WLN A;  2ZDI C;  3ABT A;  1S5H C;  4H37 A;  4JTA B;  3CC2 V;  4P2Z A;  4UXN A;  4GX0 A;  3CMA V;  5CBF A;  1M57 C;  2EIL C;  2R9R B;  4QNH B;  3ABM B;  3OM3 B;  3CC7 V;  4PDM A;  1ZWI C;  1NH2 B;  4Q20 A;  2DQ0 A;  3W7X A;  2YSU B;  3SJQ C;  2NLJ C;  3SPC A;  1YHQ V;  1OCO B;  5LBQ A;  3A0R A;  4JF3 A;  3K03 A;  5DM6 V;  2JEX A;  3SPI A;  4PA7 A;  1MOF A;  1DF5 A;  3UM7 A;  4GT1 A;  3AG2 B;  1W0K G;  2WLL B;  1DF4 A;  2HKO A;  5LGN A;  3W7U A;  1PD3 A;  1TUE B;  2P7T C;  2UXN A;  3STL C;  1NVP D;  1MSW D;  1WPX A;  5HFM A;  1KQS U;  4G28 B;  1AI5 A;  1M1K W;  3ASO C;  3HB3 B;  3K0G A;  4OXS A;  4PA9 A;  1NQT A;  4MSW C;  2Y69 B;  2ZR3 A;  1K5Q A;  3JD3 A;  4R7C A;  3F5W C;  5EK0 A;  3SYP A;  5IDJ A;  3ETE A;  2H8P C;  3X2Q C;  3G6E V;  1Y66 A;  2DYS B;  3CD6 V;  2ITD C;  3D36 A;  2OTJ V;  3CCQ V;  1JOY A;  4WFG A;  4QE9 A;  4WCE V;  4MVU A;  2X0L A;  3K9A A;  1K5S A;  4X89 A;  5B1A C;  3RVY A;  1R73 A;  1FXK A;  2JJ2 G;  1N8R W;  4KUM A;  1WLE A;  1GO3 F;  4YXW G;  3UKM A;  3W7W A;  2D3O W;  1QR8 A;  2FTK A;  3P30 A;  2R9I A;  3MHH C;  2CK3 G;  1VQK V;  1ORQ C;  4N23 A;  3LDD A;  1AI7 A;  2X6A A;  1R6N A;  4X88 A;  1YJ9 V;  1VQN V;  2V1D A;  3SYO A;  1UJW B;  1GM8 A;  1ROP A;  4RUE A;  1ORS C;  5FL7 G;  1MAB G;  1OCZ C;  3B8N A;  1BL8 A;  3I55 V;  1P7B A;  3ASO B;  3SPJ A;  4P30 A;  3ZRV A;  4I5S A;  1Q86 W;  1JVM A;  2YEV B;  2P90 A;  1AI6 A;  1KP3 A;  1NR7 A;  3X2Q B;  3E83 A;  3RBZ A;  4EKW A;  4H33 A;  3TET A;  5L3C A;  3GWO A;  2WLJ A;  3NXS A;  2Y48 A;  2JJ1 G;  3EHB B;  4BIZ A;  4MTO A;  3QO7 A;  3K79 A;  3ZRW A;  3W7T A;  2WLM A;  4LBE C;  3ZN0 A;  1BMF G;  2W0F C;  4MVM A;  2WWW A;  1VQM V;  4RAI A;  1QR9 A;  2EBO A;  1K34 A;  5EC2 C;  1BHA A;  2WAM A;  3SYC A;  1QLE B;  3CCM V;  3OMN B;  4CBC A;  1V54 B;  3F7V C;  4PEL A;  1SRY A;  3SYA A;  2F43 G;  1K33 A;  2GSM B;  3IGA C;  2XAS A;  4MTF A;  2Z5U A;  2QM7 A;  1EBO A;  4JGS A;  3FB6 C;  1GKF A;  4MVO A;  4TSF G;  4MVR A;  1SES A;  1AJP A;  3W7S A;  2DWD C;  2EIJ C;  3CYO A;  4MW8 A;  1FS0 G;  4RO2 A;  4QIW F;  1EZJ A;  2HG5 C;  3ABL C;  3JD4 A;  2OCC B;  3E89 A;  4BIU A;  4RQF A;  2HFE C;  1RM1 C;  1F4N A;  2HR3 A;  1S77 D;  1COW G;  1H8E G;  2DWE C;  3RVZ A;  1W0J G;  3CCL V;  1H8H G;  4JPR A;  4JYC A;  2UXX A;  4PDL A;  1K4C C;  4Z1M G;  5DN6 G;  4TWK A;  3GB7 C;  1R3I C;  2KYH A;  3VOU A;  3ZMZ A;  4JAV A;  4R8C A;  1V55 B;  5HFL A;  3AG4 C;  1H2G A;  1EFR G;  1AR1 B;  2Q67 A;  3MD0 A;  1FXK C;  4UV9 A;  3T4D A;  4UVA A;  2XOK G;  3AG1 C;  4WFE A;  1NVP B;  1H38 A;  2EIN C;  3OR7 C;  2EIM C;  2QEX V;  3AEI A;  4MVS A;  2XAF A;  4MW3 A;  3T2M A;  2IW5 A;  5KUK A;  3OMA B;  1OHH G;  3CME V;  3FB7 C;  5B1O A;  5H6R A;  3ML0 A;  2P6J A;  3D3I A;  4FPP A;  2EIJ B;  2WLI B;  3QNE A;  3CCU V;  2HVK C;  5LGU A;  5EBL C;  3ABL B;  1VQP V;  3ZN1 A;  2WPD G;  1KD1 W;  4X8A A;  1I5Y A;  2WLL A;  3ASN C;  3FB5 C;  3K3W A;  3B77 A;  3OEE G;  4LP8 A;  4MT8 A;  1YJN V;  4WFH A;  3DGE A;  1CEZ A;  3E8G A;  3CCE V;  1HWY A;  1M90 W;  3IFX A;  1KEC A;  1JPX A;  1M57 B;  2EIL B;  1QLN A;  2QE7 G;  3ABK C;  3E8F A;  4PA3 A;  1OZ0 A;  4FK5 C;  2A79 B;  2JEU A;  1R3L C;  4P9P A;  1YI2 V;  2XAH A;  2WLH A;  2Z3Y A;  1YTF D;  1PL0 A;  1QVG U;  2EIK C;  1NKD A;  4JTC B;  2A0L A;  3B8M A;  5B3S C;  3LSS A;  5EBM C;  3T1C A;  3LSQ A;  3AG1 B;  2X6C A;  4J9Y B;  1Q82 W;  2XND G;  2WSS G;  3CP1 A;  1RPR A;  1GTO A;  4XBF A;  5GW7 A;  5L3B A;  1OCC C;  2Q69 A;  1PKX A;  3FKS G;  1K73 W;  1IXM A;  3WG7 C;  4LCU C;  2IJI A;  1VQ9 V;  4HAM A;  2DYR C;  1Y4M A;  5EBW C;  2LP7 A;  3CCV V;  4KP4 A;  1F51 A;  1K8A W;  1G4Y B;  1KKD A;  5L3E A;  2V7Q G;  5BZB A;  1GMG A;  1Q81 W;  5LHH A;  1VQO V;  1E79 G;  2IJK A;  2W6I G;  2ZQM A;  1NJI W;  4MTG A;  3BEH A;  2M7W A;  1CPY A;  1M9N A;  5E1A C;  4ZKI A;  4U7O A;  2AHY A;  2QA4 V;  3ABK B;  4JAS A;  3CC4 V;  3SPG A;  3E35 A;  5B1B C;  5KUM A;  2NNU A;  1LNQ A;  1OCR C;  3R65 A;  4QPJ A;  2HLD G;  2YEV A;  5B1A B;  2EIK B;  1JJ2 U;  1ARO P;  1S0V A;  1R3K C;  1VQ5 V;  3KG2 A;  1GK9 A;  3ABM C;  1JQ0 A;  4J9Z B;  4XDL A;  3P32 A;  2EZO A;  2B1I A;  3BY6 A;  4ZBM A;  3OUF A;  1SET A;  5LHG A;  4RQE A;  2IU0 A;  4GX5 A;  5LHI A;  4HYO A;  4MVQ A;  3OW2 U;  3E8H A;  1JCH A;  2XAJ A;  1OCO C;  5KA5 A;  1KC8 W;  1Q7Y W;  4MTX A;  4P9O A;  1QCE A;  3SPH A;  1OCZ B;  1P4R A;  2Q68 A;  1GM9 A;  2MK3 A;  1R3J C;  4BW5 A;  2WLK A;  3AG2 C;  1W2B U;  3LDE A;  3ZMV A;  2ATK C;  3AG3 C;  3E8B A;  4U7N A;  1XL4 A;  3EFF K;  2X7R B;  3JCZ A;  2PI5 A;  3H01 A;  1VQL V;  4R50 A;  3ZIA G;  3JD2 A;  3ABU A;  1PNL A;  3F7Y C;  1NBM G;  4WFF A;  5B1B B;  1OCR B;  2IH1 C;  3OMI B;  2AHZ A;  4KFM A;  3OEH G;  4XDK A;  1VQ8 V;  4MVZ A;  2BOC C;  2DYS C;  2XAG A;  2JK5 C;  1S76 D;  4TT3 G;  5CBG A;  2XAQ A;  2EJR A;  3CCR V;  3ZCC A;  1FXV A;  1M56 C;  3FYE B;  3ETG A;  3ZMS A;  1I5X A;  2B1G A;  4G27 B;  3STZ C;  1SZT A;  3JD0 A;  4N21 A;  1PNM A;  4DO2 A;  3K04 A;  2QM8 A;  3JYC A;  4G2K A;  4DXW A;  4PA6 A;  2QKS A;  1K9M W;  2ZR2 A;  1K4D C;  3LDC A;  3MHS C;  4E2L A;  1RM1 B;  2X6B A;  3PJS K;  5L3G A;  1YTF B;  1MG1 A;  2IU3 A;  2LFS A;  2DW4 A;  3OE7 G;  1E1R G;  1NH2 D;  1GM7 A;  1PNK A;  3M99 B;  5CMU A;  4JYB A;  5EC1 C;  2WLI A;  1YIJ V;  1AJN A;  3AG3 B;  4QE7 A;  3I56 V;  3LUT B;  1FXH A;  1F23 A;  3OUS A;  3CXC U;  3DTU B;  4UV8 A;  4HZ3 A;  3TK1 A;  3FYI B;  2ZDI A;  1NR1 A;  4GX1 A;  2A9H A;  3G4S V;  3ZJZ A;  2K1E A;  1CP9 A;  3CCJ V;  2IJJ A;  3CCS V;  3AG4 B;  5H6Q A;  1FXK B;  4UVC A;  2ITC C;  3ZMU A;  2EIN B;  2EIM B;  3E2E A;  4WF9 V;  4FMT A;  5J9P C;  4QJF B;  4ASU G;  1B6Q A;  1M56 B;  4BAY A;  1AJQ A;  4FIP C;  2GHY A;  2ZXW C;  3IC7 A;  3T4Z A;  1E1Q G;  2OT5 A;  5H9C A;  1QLE C;  4MS2 A;  1V54 C;  2DQ3 A;  4L87 A;  3FB8 C;  4FJC C;  1L1F A;  3G71 V;  1F4M A;  2KB1 A;  3E86 A;  4JTD B;  3ASN B;  4LC1 A;  1SER A;  5IY5 C;  1AI4 A;  1VQ4 V;  2HVJ C;  1J95 A;  1XL6 A;  4R6Z A;  4JAU A;  4CZZ A;  2OCC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...