4DYCA

Crystal structure of the terminase small subunit gp1 with d19r mutation of the bacterial virus sf6
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
123
structure length
123
Chain Sequence
b'PSDYMPEVADDICSLLSSGESLLKVCKRPGMPDKSTVFRWLAKHEDFRDKYAKATEARADSIFEEIFEIADNAIPDAAEVAKARLRVDTRKWALARMNPRKYGDKVTNELVGKDGGAIQIETS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Terminase small subunit
publication title Structural and Functional Studies of the Phage Sf6 Terminase Small Subunit Reveal a DNA-Spooling Device Facilitated by Structural Plasticity.
pubmed doi rcsb
source organism Salmonella phage hk620
molecule tags Viral protein
total genus 39
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4dycA01
1LE8A 1IDZA 1X2MA 5EEAA 3A02A 2DMQA 3RQIA 4C2MJ 4M3GA 3BR1A 5J1RA 1F36A 2LFBA 2LLKA 4IHXA 4QSHA 2OF7A 3FK6A 3G1MA 1TC3C 3IV5A 3DEWA 2GM4A 3H3VK 5JLWA 4W1UA 3TEDA 4IEJA 3IH3A 4A3IJ 2HI3A 3BQYA 5K7ZA 3GTPJ 2E2JJ 4M3DA 1IG7A 4BY7J 1WCMJ 3BR6A 1OJLA 2NVYJ 1FIPA 3GTKJ 2JJ7A 2K40A 1JKRC 1GT0C 2Y9YA 4BBSJ 3IH4A 1HCRA 2ME6A 5C4XJ 3HOWJ 2XPUA 4D7MA 5K7HA 4A3JJ 4A69C 1P7IA 4BXXJ 3I4MJ 2DMNA 3TP3A 2AHQA 2P81A 3BQZA 1HOMA 2QCOA 4FE4A 1GDTA 4A3GJ 4XICA 3O8GA 2NOGA 2XPVA 1BJZA 3A03A 1MNMC 2LVSA 2NS8A 4JP0A 3LSGA 1B72A 1OCTC 4GFBA 1K61A 5EYRA 1TWGJ 4XIDA 1JT0A 1U9NA 1HDDC 2R7ZJ 2O7OA 1IGNA 2YU9J 3QPSA 2DA1A 1E3OC 2X48A 1T56A 2CRGA 4B3AA 5M3FJ 3Q0WA 1JJ8C 1WGXA 2M8GX 1XC5A 1K83J 1HLVA 1MBGA 1Y1VJ 2E2HJ 5F04A 1HF0A 1JKQC 1IJWC 1FIAA 1UHSA 3CQZJ 3K7AJ 4Y52J 1ZK8A 1IV6A 3BR2A 3PO3J 3BG9A 3ZOBA 4MFEA 1AKHA 5IP6A 2X6OA 3HB9A 5F0FA 2MSYA 3CCYA 2DMTA 2KT0A 3LSRA 4AC0A 1MH4A 3A01A 1FJLA 4FISA 2R0QC 2JA6J 4A3DJ 3JRGA 2DA7A 2WAQN 4RBOA 1O4XA 5E3LA 9ANTA 3MN2A 5E3OA 3CDLA 4EEFG 1IC8A 1UMQA 2Y31A 3LSPA 3FISA 2JN6A 2TRTA 3DCFA 1Z77A 1B8IA 3S17J 3E7LA 5EG0A 3M3YJ 3S1QJ 1RETA 3TP0A 2XGEA 3M4OJ 3GTJJ 1PUFB 3S1MJ 2DN0A 1NK3P 4MFDA 5EGOA 4JX5A 1TWAJ 3BTLA 5C4JJ 1U78A 1GV5A 1H89C 3OOUA 2JMWA 5F0HA 4FTHA 1BW6A 1XS9A 3WHCA 1YRNA 4QTRA 2FJ1A 2L9RA 4LOCA 5GPAA 2Y2ZA 4MLOA 2XGDA 5M3MJ 3B6CA 4M6VA 1JUSA 4S0HB 2JWTA 4DYQA 5GPCA 4A3EJ 4A3FJ 2EBIA 3HDDA 3BTCA 2GBYA 2JA8J 1SFOJ 2VKVA 1ORKA 1R9TJ 3JRAA 5IYCJ 3NAUA 5IPAA 2DA6A 3GBGA 2O8KA 2Y0SN 1ZQ3P 3I4NJ 2DA2A 1FTZA 3K2AA 3LSJA 2ME0A 3BTJA 5DTDA 3BR3A 2EQRA 3JRFA 1VNDA 3S1NJ 2VI6A 4UUSB 4I76A 1W0UA 2Y9ZA 3HOUJ 2DJNA 4CYCA 2X9DA 3S14J 4A3LJ 2IAIA 2FD5A 5BNGA 3OSFA 5J1UA 3BG3A 4A3MJ 4Y7NJ 5F1JA 3S15J 2HXIA 2LKXA 1Q1VA 2KDZA 3G1OA 2JA7J 3VPRA 3S16J 1RR7A 1I3QJ 2K9SA 5EZGA 4AUXA 4B4CA 5E3NA 3SDGA 1A6IA 1MBEA 5FKOA 1ETYA 1T33A 2MGQA 2XB5A 3TW7A 5FKKA 1F43A 3UKGA 1LFBA 5J3LA 1H88C 2H8RA 3G1LA 4AYBN 1LE8B 2AO9A 4D7NA 3O8HA 2R5YA 2R5ZA 1NTCA 2M2EA 2I10A 3WHBA 2COBA 3ZQIA 5IYBJ 1MBHA 1ETOA 4XRMA 2LP0A 1OFCX 4D5FA 2LD5A 3BT9A 4IHVA 3JRCA 1JTYA 1JUPA 5K7FA 5M5XJ 5F0CA 4A3BJ 1ZTRA 2DMPA 3MVPA 1AHDP 2XSDC 1GUUA 1X2NA 2EZIA 3TW6A 2HOAA 5DS9A 3HEFA 1FTTA 3IH2A 2CQQA 1ZGWA 1HDPA 3GTOJ 1H8AC 2E1OA 1G2HA 1BL0A 3ZQFA 4C3HJ 2CUEA 4X1EA 4BBRJ 1MSEC 1IUFA 4M3EA 5J1YA 2NVQJ 2E2IJ 2NS7A 3SFIA 2M0CA 1ETKA 4C3JJ 3CMYA 1VF9A 2Y30A 3B6AA 2FX0A 2VKEA 2XGCA 1JJ6C 4W97A 2XPWA 3GTMJ 3LNQA 1B72B 1P7JA 3JRBA 1FEXA 5FLMJ 4V2GA 2CQXA 1ENHA 2EZLA 2EZKA 2LR8A 1I50J 2EZHA 1MH3A 2L0KA 4A3CJ 4HNVA 1X58A 1QRYA 2G0EA 4B1RA 3S1RJ 4UUTA 2QF7A 5FKNA 4A93J 1LFUP 1JGGA 2NVXJ 2M9HA 2L7ZA 1D5YA 3FK7A 3JR9A 3ZQCA 1JTXA 4FE7A 2MG4A 2L7MP 1DU0A 4BKXA 1MBJA 1AKHB 3OIOA 3JRHA 3GTLJ 3JRIA 2CJJA 1NK2P 4MO7A 2PMZN 2B63J 3GTQJ 4DZJA 3A01B 2JK3A 1U9OA 1ZR2A 2L7FP 1I6HJ 3PM1A 1BW5A 1AU7A 3HKZN 4M3BA 1JT6A 3H0GJ 1EF4A 4QIWN 2HDDA 4X6AJ 4MIMA 1QVTA 3RZDJ 2H1KA 2JA5J 2DA5A 5EZHA 3Q0UA 3PO2J 2OPTA 1APLC 3HOZJ 3MKLA 2ECBA 2HQ5A 1B8IB 1QVUA 3F0CA 4L5EA 5EG0B 3OSGA 2DTZA 3NARA 4D5CA 2R92J 3HGGA 2N8GA 1ETVA 4JX4A 2HYJA 5M5YJ 3ZQLA 1MBFA 3JREA 2CUFA 2O9LA 1SANA 1GV2A 5EGOB 1VFCA 2GLOA 2IEKA 4C3IJ 1TWFJ 4I6ZA 2XRLA 3SJMA 1TWCJ 1RPWA 1ZR4A 3FIWA 3BR0A 2ELKA 3HGYA 5IP9J 4XRSA 3HOXJ 1YRNB 5F27A 3ZQGA 4M3FA 5FLVA 1Z0XA 5FKLA 1PUFA 1VI0A 4DYRA 1MSFC 1IRZA 2K9QA 3L1PA 4ABZA 5EDNA 4A3KJ 4IHYA 1RKWA 2M34A 2VUMJ 2MW8A 3BTIA 3QPLA 4IHWA 1DU6A 1RESA 2LK2A 1XG1A 3HBLA 2VPRA 1ETQA 5C44J 1QPIA 1ETWA 4RDUA 5IP7J 3S2DJ 2LY9A 2YUSA 2K9NA 1WPKA 5GP9A 5E3MA 1WI3A 2E19A 2RAEA 3BG5A 2HOSA 4XK4A 3RZOJ 2NVTJ 5FKMA 4CYCB 3HOVJ 4BY1J 2YS9A 5JLXA 1CQTA 1JKOC 3D1NI 5C3EJ 5EF6A 5M5WJ 4JX6A 1POGA 3S2HJ 1MBKA 1IDYA 4V2FA 5FJ8J 2W48A 3Q0VA 1UG2A 1JKPC 1RKTA 2ID3A 3HOYJ 2FQ4A 2DA4A 3RKQA 2HOTA 1W0TA 3LOCA 4DYCA 1Y1WJ 3JRDA 4UUSA 2IBDA 5HODA 2EH3A 1WH7A 2WB1N 2XB0X 3Q3SA 2R93J 1JUMA 3W6VA 1ETXA 2LTPA 3C2BA 2D5VA 5IYDJ 2ID6A 1ZKGA 1TWHJ 2DMUA 2ECCA 2R5YB 2R5ZB 1WH5A 1GVDA 1ITYA 4DZPA 1OCPA 2DA3A 5IOZA 2CU7A 4NDLA 3QQAA 4J19A 3GTGJ 4XRSG 3ZQHA 4DW6A 2HXOA 3HM5A 4FCYA 2ZB9A 3FKIJ 2TCTA 5IOYA 1U8BA 1A5JA 1S7EA 3BR5A 4JYKA 2WV1A 4G12A 5F08A 1BA5A
chains in the Genus database with same CATH superfamily
1S72I 5EEAA 2DPDA 1FOKA 1DP7P 2A5YB 4L18B 2R7XA 2OU2A 3RQIA 5D5VB 3ZXSA 3OL3A 2DK8A 3H3ZA 3RYRA 3TOBA 2OF7A 3G1MA 1G3SA 5H20A 3IV5A 1ZH5A 2GM4A 3H3VK 4U7BA 3FZVA 5CQEA 4PJMA 1RRJA 3TEDA 1G6NA 2HFHA 3VB2A 3IH3A 3I64A 3JSPA 4A3IJ 2XAGA 2P6SA 3LSMA 3DV8A 4M3DA 1B4AA 4BY7J 1WCMJ 2FUG2 2VLAA 3L09A 2VJ4A 3LSKA 2PFBA 2JJ7A 2K40A 1FC3A 1LKXA 2HR3A 2JUGA 1Z7LA 1VQOI 2L02A 4WK8F 3OMYA 5F1RA 1U8RA 4LK1F 1JGSA 1XD7A 5C4XJ 2V6CA 3SQNA 3U1DA 3HTSB 1OCZH 2KZVA 1P7IA 3JSOA 3M07A 3I4MJ 2AHQA 4FE4A 2DDAA 4RGRA 4A3GJ 3N05A 2NOGA 2FBHA 1MNMC 1R4NB 1OR7C 4JP0A 1B72A 2K27A 5F6FA 4UB6C 2OJED 1K61A 4RAYA 2R7ZJ 3A0HC 1T98A 3HTUA 4AIHA 2YU9J 4J00A 4S04A 3FWEA 1R5ID 3KP5A 1WGXA 3ZN0A 4KUMA 1K83J 5KK1A 1Y1VJ 1QNTA 4UB8C 1AWCA 2HS5A 4N4OB 1T0FA 3PIPF 4L5JA 3L00A 4JK1X 1JKQC 3DLAA 3BCAA 5HS7A 1IJWC 3OYJA 4OIRF 3N97A 1QU3A 4XQFA 3OR1C 1ZK8A 3KYLA 1EA3A 2VT3A 3AAFA 2WAEA 3BPVA 3DPTA 3RPUA 1MDMA 4PCQA 3D0SA 2H6BA 4FETA 2MC4A 3NWTA 2YPRA 3CCYA 5E79C 2DMTA 3JTHA 2KT0A 5FFZA 4BAYA 3WTXC 3OYBA 3LSRA 2Z16A 4AIDA 2KLOA 3A01A 2V4JC 3OWTA 1XPXA 4AD9A 3JRGA 2DA7A 5CYVA 1O4XA 2NNYA 1HW1A 3GFJA 9ANTA 2L7KA 2CYYA 2IP2A 3CO7C 2XF5A 3LSPA 4C9YA 3F8FA 2JN6A 4HZFA 2TRTA 4PGGA 4WXHA 4EM1A 1GLNA 3LA7A 5EG0A 2MLKA 3TP0A 4B44A 4EV0A 1D0XA 2XGEA 5LRSA 3M4OJ 4L0ZB 5HNFA 5ICGA 1S6LA 4E7JA 4L9TA 1B6AA 4F7ZA 5E8IA 2UUZA 2X85A 3CF2A 5J4YA 2QLZA 3RI4A 2W4SA 3IKVA 1EV7A 2IA2A 4RLFA 2PQ8A 5CVJA 4LB5A 3BTLA 5K5QA 3OOUA 2WBMA 4IX7A 1JI8A 3F23A 2TDXA 2VJ5A 2VT2A 4M9ZA 3WHCA 4KISA 2FJ1A 1HSJA 3FXLA 1Q1HA 1A36A 2B9SA 1IV8A 1R1VA 2XGDA 3BG7A 1T6SA 3I9V2 5CPRB 1T95A 2KISA 1YJNI 4S0HB 1HSTA 5GPCA 2J5PA 4A3EJ 4OIPF 4IVNA 1IN4A 1TW2A 2F4MB 4XLAA 2VOPA 2DLLA 1PP7U 2M1BA 2HVSA 1ORKA 1FZPB 5L3GA 3RKYA 3A0BC 2V1DA 5IPAA 2BV6A 3L7WA 4E7SA 1YOVB 1FBSA 3M7GA 3TDZC 2A5WA 2VI6A 2M4GA 1I6XA 4LFUA 3EETA 4CGZA 4P9UA 4HDVA 2ZMEB 1FBUA 2P0WA 1DPRA 3D5RC 2IAIA 4CZZA 1NG7A 4MGRA 3BG3A 4HX4A 3VSKA 1HQCA 4A3MJ 2RNGA 2MH9A 2M7BA 3RYPA 3S15J 1G3YA 2OCCH 1YX5A 4G7ZF 3PNVA 3VYTB 3G1OA 4CCKA 1TBXA 4LLLA 3AG2H 2AQFA 3O2PE 3MKWB 2WAQA 3KLNA 2YU3A 3VOEA 4BJ5C 1MBEA 3DTIA 3IAM2 2CQ7A 2VASA 5HLIA 3R6SA 1KYZA 2PG4A 3CJTB 3UNGC 1O3RA 1LFBA 1HBXG 5ERIA 1FLIA 5HDKA 4CSWA 1LE8B 2R5YA 3DEEA 5GADJ 2BEOA 2DOEA 3WHBA 1VQNI 5CVVA 2E35A 3SZTA 3I56I 4RGSA 1L0OC 2DFHA 1S8NA 4C30A 1LUJB 1NH3A 5DCMB 2HYFA 4XRMA 1GVJA 1OFCX 4D5FA 5JVGF 1I1SA 4IHVA 3JRCA 3F8CA 3VEPA 3HZJA 1WJDA 1Z6TA 5F0CA 4A3BJ 5B66C 2JA2A 3MVPA 2D45A 2M4KA 4NQWB 3TW6A 1B1BA 2HOAA 3JTGA 3KYCB 3IH2A 2CQQA 1FOXA 1A35A 4Q4ZF 1PP8F 2BW3B 1H8AC 2IGKA 3BLYA 1U2WA 1XN7A 1U6GA 3DBRB 1KA8A 3GX4X 1OCCH 1P4AA 2E1OA 3QRFF 1HC8A 1G2HA 1IF1A 4C3HJ 5D5UB 2CUEA 3LWFA 4X1EA 3HSRA 4MQ9F 1IUFA 5J1YA 3L2RA 4XBFA 3SFIA 4EJOA 4BHCA 2ZXHA 3HRSA 5EEGA 2M0CA 3WG9A 4B09A 2Y30A 2LYCA 2KHMA 3BJOA 2FX0A 2VKEA 2EIMH 3EUAA 3WGIA 1R23A 2R7QA 1Z21A 5BMZA 4CCOA 2L54A 1XCVA 3CO6C 2ZNZA 3K9TA 3GZ6A 4O5VA 1SVLA 1I50J 4D0PA 4XLNF 2FF4A 3ZPLA 4LK0F 3AG4H 2R7OA 5TGTA 1QRYA 3AL0C 3S1RJ 1FP1D 4UUVA 2EFNA 2MD0A 3SYTA 3SHFA 3CCJI 2NVXJ 4JBAA 3CCEI 1D5YA 3RPUD 4ON0A 5ICEA 2DT5A 3VODA 3PUFA 2Z33A 3CF5F 4BXUA 2L7MP 2AXTC 3FX3A 4B3XA 4B48A 3OIOA 2O61A 5IT9Z 2R7VA 3GTLJ 1NHAA 4GYIA 3TO9A 4MO7A 2B63J 4ZYGA 4DZJA 4AYBA 1ZR2A 1I6HJ 3QOEA 2XAUA 4N4NB 1AU7A 1BW5A 4IRIA 3H0GJ 3FXUA 2HDDA 3K4KA 5FO5A 3H5RA 2HTSA 5HS8A 4X6AJ 2L3DA 3FXKA 5LEJA 3Q0UA 5AIPA 5E8GA 1W4MA 2ZNYA 4Q48A 1RUOA 3HOZJ 1APLC 2ECBA 2NNNA 1U5TA 5LBQA 1BR1A 1FSHA 3IRQA 2DTZA 3ABTA 4A0XA 4ZYAA 2RV8A 3B02A 3OYNA 3P5JA 4HV6A 4XLEA 1SEUA 5DD4A 3ABUA 2FBKA 3WU2C 1YG2A 3JREA 1SMYF 1MJBA 1SFEA 3K4LA 4BDYA 1XGOA 4E7LA 3ZMVA 2GLOA 4C3IJ 1TWFJ 3DQVC 4I6ZA 1LDDA 3L2WA 2M3AA 4XKVA 2FNPA 2ELKA 5IP9J 1TL8A 3B73A 2BYVE 3ZQGA 5DM7F 1O7FA 4M3FA 1P4XA 4Y17A 5A2QZ 2FOWA 1T0FC 2PJRA 4DYRA 3MFKA 1MSFC 2K9QA 2IRFG 5EDNA 5IT3A 2A05A 2A61A 3HG9A 3BTIA 2F4OB 5FROA 1NG6A 3BJAA 3HSFA 3CCSI 4AVPA 2R7FA 3VFZA 5CKTA 1ETQA 1ETWA 2UV1A 2MFZA 1QA6A 3P9KA 2BE5F 4BH9A 3OYKA 1O57A 5B1BH 3I58A 2E1MB 1WPKA 4EJWA 4XOTA 2OV7A 5JHUA 2K3FA 1TT5B 4IHTA 3BG5A 2NYXA 4IZZA 2HOSA 1LFPA 2ZC2A 5ILVA 4LD5A 3HOVJ 1IN7A 2GA1A 1CQTA 2R4GA 2VL8A 1X1AA 2FQ3A 5C3EJ 4JX6A 3K4JA 3H1CA 4I98B 1YW7A 1WSUA 3HOYJ 4XORA 3U1KA 1L3LA 2DA4A 2L9VA 5B5EC 1LVKA 3LOCA 2VBWA 1VQ9I 2IBDA 1Z7UA 5JHFA 3DTEA 2K7LA 2KJCA 2WB1N 2OCEA 3E1SA 4BQAA 2W85A 2FU4A 2MYSA 2VQHA 4EATA 3F22A 2EPFA 2ID6A 1ZKGA 4XN3A 3V4GA 2O0YA 3QP5A 1X1DA 1R22A 2ZXIA 1WI9A 3I59B 5E18F 1WH5A 3ECOA 4DZPA 1SD7A 3R61A 5DCFA 2LNBA 2STTA 3GTGJ 3OYDA 3LFKA 2IS1A 1OMIA 2DT7B 1JE8A 2YX7A 2ZKZA 1DP3A 3IWFA 4OIQF 1BI1A 4PDKA 2OQRA 3EPZA 3REOA 5IOYA 3EQLF 1U8BA 1S7EA 1HKSA 1LDJA 5BS6A 2FMYA 4P5OA 1LFUP 5F08A 2I8DA 4HLYA 1JHHA 4II3A 4RM2A 3MQ0A 1FP2A 2DMQA 4C2MJ 1XDSA 4E70A 5J1RA 1F36A 3QP6A 2LLKA 1G4DA 1PDNC 2JVGA 4CH7A 2Z9OA 4I02A 5JLWA 3DBHB 2EILH 3DF8A 3U9GA 2HI3A 5K7ZA 2GXAA 2OUMA 1X4OA 3EDPA 1GXPA 5D8LB 2XVCA 3V7CA 1OJLA 2QBYA 2NVYJ 5LD2C 4A0YA 4F91B 1Y39A 1JKRC 1O3QA 3DXJF 2P4WA 5H6RA 4KJZA 2Y9YA 4HG2A 3KIOA 3IH4A 2ME6A 2M30A 2PBIA 3HOWJ 5K7HA 3S32A 3RDIA 4A69C 3BDDA 3PSFA 2DMNA 2GOMA 2LBFB 4ETSA 4DBRA 3LSIA 4LMYA 3KPHA 1XGMA 3CDIA 2H27A 1B9MA 2ZXJA 4BHBA 1EJ9A 1QHGA 2XPVA 1G59A 2JRMA 1E2XA 2Y48A 2QYOA 1I27A 3LQQA 4XLFA 3CTAA 4BU2A 4AWXB 1AOYA 3G6EI 1LPQA 4A12A 1SVMA 1HDDC 3L9FA 1IGNA 1TTYA 3CLOA 3QPSA 3BP8A 3ZQQA 1DPUA 2MA3A 3F3XA 3Q0WA 4YELA 1UJ8A 1IN6A 1S3JA 4IRGA 3W2VA 3CCMI 3G71I 5LRRA 1E0EA 3BOQA 1R5HA 3FMRA 5D8KB 2F4IA 2K3PA 3WTWC 1QZYA 2E2HJ 5CLSA 3RKWA 1HF0A 1HXDA 1FSEA 2Z1DA 1FIAA 2HOEA 3BWGA 2ZJPF 1MMSA 2BXZA 3CQZJ 3A2KA 3HOSA 1WWXA 3DTKA 3E6MA 3BR2A 1N25A 3PO3J 3BG9A 2DYSH 3NEUA 4MFEA 2X6OA 3HB9A 4N0BA 4F92B 2ZO4A 3WG7H 1J5YA 1FJLA 1MMAA 1ZGJA 5BPIA 4XKCA 2R0QC 1Z3YA 2JA6J 2DCEA 1TQMA 4A3DJ 3P9IA 4RBOA 3KP7A 4HA8A 2ADUA 2E36A 5LGUA 4HEA2 2IGOA 3CDLA 5DDGA 3R60A 2ZJQF 3CCUI 4M71A 3WTUC 4HF0A 3BG6A 2UXNA 4BQNA 1Z77A 2MLGA 1B8IA 3E7LA 2GQQA 3M3YJ 3S1QJ 2BOLA 3S3NA 1RETA 2Z5UA 4UVCA 4PFOA 3Q9VA 1WQ2A 3KZZA 2QQ8A 4IO9F 1PUFB 1IAWA 4K2EA 2VC1A 1TW3A 2KJBA 3S1MJ 3ESWB 2YX4A 3VSLA 3PQJA 2CG4A 3F8NA 1ZG3A 2E7WA 2M45A 4JX5A 1TWAJ 4ENNA 4XRFA 1B59A 2L9SA 3DU5A 5C4JJ 1I3AA 3E3VA 2JMWA 1BW6A 1USSA 1ZGAA 4AIJA 2UXXA 4XM3A 2CH0A 1YRNA 2M8EA 3OOPA 3PJRA 2L9RA 4LLNA 5GPAA 2Y2ZA 3B6CA 4M6VA 3WU0A 3O3KA 2OD5A 3RSNA 4DYQA 2LKSA 1W5CC 1P2FA 3N4MA 3H3UA 1DGRM 4ITVA 3ZCOA 1VQ6I 1LEBA 5B1AH 2GBYA 5D4RA 3S2WA 1SFOJ 1FT9A 3S93A 5FD5A 3FF5A 4UV9A 3JRAA 5IYCJ 1EH8A 1U5TC 2HU9A 3NAUA 3M1EA 1ONVA 4KFCA 1FTZA 3I4NJ 2DA2A 3KEYA 3K2AA 1VQKI 3LSJA 4B43A 1WJBA 3BR3A 4WWCA 3S1NJ 4G6TB 4UUSB 4PSWA 3LAPA 2XIGA 3HOUJ 4CYCA 3SXYA 4O3MA 4A3LJ 1ZRFA 1Y6IA 2V79A 3MKZA 1MD0A 3DWLE 2FD5A 3OSFA 3NRVA 4QLCU 5JI6A 3VYSB 3LL7A 2DTRA 4Y7NJ 1R71A 2HXIA 1TNSA 2LKXA 2K02A 2IA0A 1Q1VA 2XAJA 3LSTA 3GF2A 1YW9A 1TNTA 2K4JA 3GFMA 1G8XA 1I3QJ 2K9SA 5EZGA 4AUXA 4B4CA 1Z67A 4P9FA 4LJZF 4N9IA 2Y0MA 1ETYA 2XB5A 4PSXA 5HLHA 3OYCA 1IN8A 2P5LC 3TW7A 5FKKA 2VKDA 1F43A 3KP3A 3UKGA 1W5SA 4I2OA 2B7EA 3KP4A 5J3LA 4BEHA 1K78B 2XROA 3G1LA 2H8RA 4D7NA 3O8HA 2R5ZA 1NTCA 4IKFA 2M2EA 1R1UA 2I10A 5HLGA 5D5WB 2COBA 1V3FA 1X1BA 4I0AA 3T8TA 1DQUA 5IYBJ 1HKQA 1MBHA 1MIJA 1ZYRF 3TBIA 4CICA 1QGPA 2ZJRF 3H5AA 1JUPA 2A3SA 1UAAA 1ZTRA 2DFIA 2ESHA 2P7CB 1YHQI 1GUUA 1X2NA 2EZIA 1H0MA 1ZRDA 3CUQB 5J47A 4LLGF 1R4MB 1ZGWA 2OC6A 3QAHA 1HDPA 1F1ZA 4YFXF 3GTOJ 4M74A 4YIRX 4WF2A 3OV8A 1ULYA 2NS0A 3SFZA 4BGDA 1KQ8A 3SEQA 5E17F 2E2IJ 3J7AO 4UHTA 1OKRA 1KZHA 3K4CA 3KYDB 2RN7A 2O3FA 2BXYA 1ON1A 2FEZA 1P7JA 2VPLA 3JRBA 2IS2A 5FLMJ 4V2GA 4ZZDA 2EZLA 3H9GA 4RGXA 4LG0A 4HNVA 2RVCA 2W24A 1T08B 4AM3A 2X0LA 3HPHA 2G0EA 2LDUA 3FXQA 3V8KA 3G73A 2F5CA 1XTAA 3WTSC 1YX3A 2DQLA 2X1CA 4IXAA 1KYWA 5FKNA 3JW4A 1YLFA 3MKYB 1JGGA 2ESNA 2DQRA 4WXDA 3CC2I 3RKXA 2K5CA 4ANJA 3WODF 1JTXA 4ENMA 1FX7A 4NC7A 5H6QA 3FXOA 5AIQA 4WX9A 2XASA 1DU0A 2CFOA 4HRIA 1AKHB 3JRHA 4PJNA 5CVIA 3X2QH 3JRIA 2CJJA 4NBQA 5FGMA 5H2FC 1T38A 1NK2P 2JK3A 1U9OA 3TOAA 4ZZLA 2L7FP 3GYHX 3U2RA 4R1HA 2A6HF 2X6WA 1UFMA 3HKZN 2IT0A 4G94A 1JT6A 4BNCA 2CV1A 1UB9A 3ZMDA 1W7PB 4CYDA 3QYBA 2VONA 2JA5J 4AVZA 3PO2J 2AQEA 1X3WB 4E7ZA 2LSOA 2ELHA 4CUGA 1WJCA 1QVUA 2LH9A 3OSGA 4HF2A 4V19K 1EH6A 3HGGA 1A31A 2IXSA 3CZ6A 4RB3C 2XHKA 4QPOA 1O3TA 4U7DA 3CLQA 2HPIA 3HSEA 4E4HA 2HYJA 3OYEA 4G9YA 1MBFA 2G7UA 2GA2A 1ON2A 4BACA 4L0YB 3TO6A 5EGOB 3WGGA 3W2WA 2QA4I 3ASNH 1IRGA 5TJJA 3OYGA 4R8HA 3DBLB 1OLTA 3IC7A 4F55A 3K70C 1RPWA 4HQMA 2LKPA 3HGYA 4XRSA 1RUNA 1J59A 1P9QC 1BJAA 1Y56A 4A6DA 3DP7A 5ICCA 2HQNA 2KDOA 1VI0A 3R4KA 3M8JA 3L1PA 4ABZA 2X1EA 2XRNA 3K10A 1DU6A 3OS2A 2LK2A 3J81Z 2EFPA 1QPIA 5C44J 3C1DA 1T39A 1LEAA 2DBBA 2H6CA 2LY9A 4CCJA 5LHHA 2ISYA 1X19A 3ULQB 4XR6A 1D3YA 3OYFA 3OYIA 4IL6C 3T5XA 3ASOH 3PUBA 3H0DA 4HLXA 4UVBA 4I0BA 2E7XA 3CDHA 1K6OA 4PFPA 5FKMA 2NVTJ 4A0ZA 3S3OA 1KONA 2YS9A 4RM3A 3VYRB 4MTDA 4BE0A 4XKWA 5D5XB 2G7HA 4DBQA 2IS4A 3MAJA 5DD8A 4EM0B 1VQ4I 3H36A 5CQGA 5EF6A 5M5WJ 2R7DA 1POGA 4XN0A 1MBKA 4ZH4F 2X6XA 4OMZA 1UG2A 3CMAI 2V1NA 3CCRI 4ZJZA 3JCUC 3ZN1A 2FQ4A 1UELB 2V9KA 1W0TA 4I09A 5FRNA 2LRDA 1Y1WJ 1VQ5I 1BIAA 3JRDA 1BI2A 1Z6RA 1G3WA 3KP2A 1F4KA 4GO1A 1GXQA 5HODA 3TMOA 1WJFA 2XAFA 2IS6A 3NQOA 2ZMEA 1X1CA 3IRRA 2VQLA 1FOYA 3BJ6A 2CMPA 2K86A 1TQPA 2LTPA 2QWWA 4HPQA 2A6TA 2RKHA 5LGNA 2FSWA 2BY0A 2E1NA 2GIVA 3QPTA 2FBIA 4NC6A 4MTEA 1YW8A 1YS7A 4EGZA 3J80Z 5E1ZB 4J19A 2EINH 2L5QA 4HW0A 4I01A 2HXOA 4UNOA 5KAIC 2CQKA 3SZPA 2NRAC 5D4SA 4FCYA 1ZRCA 1BOBA 2ZB9A 2STWA 2XF6A 4YG2F 2HDCA 3GLXA 4L9JA 3D5LA 4HYEA 2FE3A 3AFHA 3CD6I 2V9VA 3OL4A 3I0TA 3ZP5A 4ZTJA 1W5TA 5HVQC 1BA5A 1LE8A 1IDZA 2KRHA 3QODA 4KDPA 4UV8A 2PN6A 4A5MA 4RB1A 3A02A 3T1BA 2IA1A 2X51A 4M3GA 4IHXA 1KU7A 4LITA 3FK6A 4YRVA 3VYUB 2DI3A 5DCMA 3GW2A 5L3DA 1W36C 1S7OA 1RNLA 4W1UA 4CDGA 2P6TA 4R79A 2YR2A 2LY1A 3J7ZI 1MMDA 2NVUB 3CMEI 1TLHB 5HDGA 2DK5A 4NQWA 3GTPJ 3S8PA 3WTYC 2Q8KA 1IG7A 3BR6A 4L9NA 2K9MA 3GO5A 3MEXA 3FM3A 4HQEA 1FIPA 3GTKJ 2AXLA 4XSXF 3AKZA 2BW3A 4BHPA 4BXFA 1FMWA 3BZKA 1GT0C 4NHJA 1SAXA 4KT6A 2Q0OA 4BBSJ 4YFKF 1HCRA 3I5UA 2WTEA 2XPUA 1QO0D 4HAMA 1Y0NA 4LIUA 2KFDA 4BXXJ 3TP3A 4P55A 3BQZA 2QM3A 2KQRA 2QCOA 4EMSA 2JTVA 2KIFA 2VODA 1KGSA 1BN5A 3DKXA 1K4TA 4IRHA 1BJZA 4ZYDA 2LVSA 2VJIA 2NS8A 5TISC 4DOZA 5DEQA 3KETA 1ODDA 2L01A 1J75A 3GZNB 1JT0A 1U9NA 2Z3YA 3FHNA 2O7OA 2HNHA 2WB1A 3OY9A 2XSJC 2WV0A 4ENKA 1E3OC 1UCRA 2A69F 2BY1A 5M3FJ 1DGWY 4B3AA 3IKTA 1IUYA 2ZCWA 4O6JA 4AU7A 4B47A 4GRIA 1JJ8C 2M8GX 1HLVA 3TO7A 3F9KA 4G7HF 4ZC3A 1DUXC 2W1OA 5GTHC 5LFAA 1YI2I 1BC8C 3MZ8A 5F04A 3D5SC 3LSHA 5HDNA 1D0YA 1ZARA 4F3QA 3CCVI 2V6EA 3KZYA 1OCOH 1SFUA 2HZTA 4KT5C 1UHSA 1ZG5A 1TP4A 4EM2A 4Y52J 3WE3A 4NUBA 4MEYF 3ZOBA 4U88A 1SD4A 4YIFA 5F0FA 2MSYA 5E1XA 1WRJA 5KCMA 2L9NA 4AC0A 4FISA 1IO2A 3IUOA 3DLLF 1IW7F 1XSXA 2KPMA 1RIOH 3WU1B 1CF7B 2BVMA 2XGXA 2NOJB 5E3LA 3OYAA 5IT9K 4PZJA 4IQ4A 3MN2A 5JFRA 2JT1A 2HEOA 4H4KC 1Z9CA 3HRTA 1WZ2A 1D5VA 1I1GA 4A6EA 1UG0A 3S17J 3A1YA 2WA0A 4HSTA 3W6JB 3KEOA 3S3MA 4Z2YA 3DKYA 1RZ4A 2HYGD 4EGYA 1R5GA 3R0JA 3C18A 2QENA 2DN0A 3TDUC 1BC7C 1NK3P 2W00A 3MMYB 1XB4A 4MFDA 1QZZA 1TQIA 1BR2A 2BGCA 3FKJA 2EFQA 5KHDA 4CO8A 1U78A 1H89C 1XDUA 3H92A 3K6GA 4GXOA 3BPXA 3K4NA 5F0HA 4FTHA 1XS9A 5BOXA 4OMYA 1X3ZB 3FMSA 4G6DA 4JOMA 1MW7A 3K69A 4QTRA 3OYHA 4LOCA 5FRMA 2A68F 4BL0B 1K4SA 3V7SA 2XAHA 4KYWA 3V7RA 1YQAA 1U3EM 3LAJA 1JUSA 1PJRA 2DFFA 3BROA 3W6KB 4A3FJ 1JHFA 2EBIA 3PFIA 2MD5A 4ZDLA 3HDDA 2ISZA 3BTCA 2W84A 3CCQI 4FX4A 1H9TA 1VQLI 4ZYHA 3HUGB 2VKVA 1YE9A 1R9TJ 5A2QK 4M9XA 2Y0SN 3BC8A 1ZQ3P 2DODA 1HKTA 4IQJA 3BTJA 2F5VA 5DTDA 1T8IA 1HA8A 3GXOA 2LOOA 1N77A 4U0VA 4RLQA 1VZ0A 2BZTA 2VQGA 4I76A 3RCOA 1VQMI 1XSDA 1W0UA 2Y9ZA 2JSPA 1FPQA 2Q2EB 3DPLC 3GEZA 4FHTA 4KN4X 1D0ZA 2WC2A 2LY2A 4RA2A 4ESJA 3KLOA 3Q5FA 5FLXK 4BJTA 2X4HA 3KFWX 4DIQA 2EIKH 5J1UA 3F6VA 2GXGA 3O6BB 5F1JA 2FA5A 5KNLA 5BPDA 1Y0UA 2RQPA 2BY2A 3CESA 2JA7J 1V5GA 3VPRA 4E7KA 1RR7A 2K85A 2PMHA 5GAHJ 1KQ9A 5CVUA 3H9QA 1XGNA 3ZMTA 2R3SA 1S9HA 2BY3A 3K1MA 1ZLKA 1A6IA 4OAZA 5FKOA 1T33A 2CO5A 2MGQA 4XONA 1S29A 3E6DA 2COMA 4Q47A 1OYIA 2P8TA 3OIQA 3C3WA 2KKOA 4BUPA 2DT6A 3AL0B 1H88C 1IXSB 1TT0A 4GCVA 5DUIA 2QZ8A 2AO9A 4KIBA 3I59A 5FD6A 3F8BA 4EJTA 4PGHA 4EQQA 1SC7A 5AONA 3RQ4A 4C2TA 2LD5A 3P9CA 1BBYA 3EUHA 4L9VA 1AHDP 3RTRA 1FBQA 2XSDC 2KIUA 4UVAA 4U0YA 2QQAA 2LF7A 4UY8I 4Q5SF 3F6OA 3ONQA 2R7UA 4EJUA 4UXNA 1W1WE 3I55I 4KMFA 3PNTA 3WTZA 2V26A 2CW7A 2BHYA 5BQTA 2OZ6A 2VOOA 2ZMEC 3BY6A 4NNJA 3CMMA 5J40A 4XNFA 3IP4B 4I99C 4OAYA 1VQ7I 2VBZA 5DM6F 5TRDA 3MZHA 4M9SA 3K4MA 3E6CC 3GCMA 1BOAA 1F5TA 1R58A 2X1DA 1ETKA 1SD5A 4C3JJ 3CMYA 1VF9A 3L2VA 1WHUA 2V7FA 4HDUA 4W97A 3LNQA 1OYWA 1B72B 1FEXA 1LJ9A 2CQXA 3R0AA 3J7AY 4Y33A 1MH3A 2L0KA 5K5OA 4A3CJ 1BIBA 2QKLB 5FFXA 2FRHA 1X58A 1MNDA 1P4WA 3FM5A 2LBFA 3QWLA 2QF7A 2Z99A 4KMUX 2Z2SB 4A93J 1HW2A 1ZELA 4B8XA 1E3PA 2L7ZA 3H5NA 2XKPA 3JR9A 2QQ9A 3I4PA 2MG4A 3OYLA 3L2UA 1QPMA 4BKXA 2QKMB 5DYMA 1MDMB 3H35A 2EV5A 3WTVC 1Z05A 4CXFA 2FXAA 1OQYA 3FHZA 3A01B 3KP6A 2PI0A 1XMAA 1LNWA 3PM1A 4PJLA 3JAMK 4DGWB 3TGNA 4QIWN 4LIVA 3LMMA 4GGGA 4RMNA 4MIMA 5LLQA 2CSOA 3RZDJ 3SDBA 2O03A 1FYLA 2QGUA 2HQ5A 1K6YA 5EG0B 4IJAA 2R92J 4D5CA 4HX7A 2N8GA 5LHIA 2V9PA 2VKHA 4JX4A 3TKYA 2R7SA 5M5YJ 4BQOA 2CUFA 2O9LA 4BS9A 1UHMA 3A4CA 2EV0A 4LG0B 5D6FA 1VFCA 1QZEA 4KA4A 2IEKA 2ZJ2A 1VTNC 1V5FA 2DAOA 1TZLA 3SJMA 1TWCJ 3W3CA 2EJRA 2WY7Q 3CP2A 3BR0A 3E6BA 2VBYA 5HS9A 2Y75A 4OINF 1WJAA 1RR8C 1YIOA 3E97A 1E3HA 3FMQA 5FLVA 1Z0XA 2GOXB 3F8MA 1YYVA 1PUFA 2D1HA 2PLYA 1IRZA 4A3KJ 1YFHA 1RKWA 2M34A 2CGPA 2MW8A 5J4VA 3QPLA 2HVRA 1H9GA 1XG1A 4HX8A 4Y15A 2YUSA 3OS0A 3QOPA 2JZYA 1P6RA 4ZDPA 3K0LA 5GP9A 5E3MA 1WI3A 2E60A 2VN2A 2CV0A 2F5DA 2RAEA 2O6GE 3KX2A 5ILUA 3KEQA 3RZOJ 2OA4A 2VC0A 3I54A 2QSGX 3UR3C 1FWZA 1ZN2A 1R00A 5JLXA 1JKOC 1USTA 3QU3A 2GAUA 3QU6A 3S2HJ 1FY7A 2IPQX 1IDYA 1MJ9A 3GFLA 4F93B 3EYIA 2NXNB 5EJCA 3Q0VA 1JKPC 1R7JA 1RKTA 1P92A 2A6EF 4E7IA 4LGWA 2RDPA 2HOTA 3DPUA 1FMVA 1SD6A 3K4BA 2GZWA 3HKZA 1OISA 4OOIA 4PJ0C 4UUSA 3K70D 2EH3A 1WH7A 3ABLH 4XSZF 1XX5A 3ERMA 2H94A 3HC7A 3Q3SA 4XL9A 2HVQA 5ICFA 4KNYA 2R93J 3K1PA 2ZSIB 4RS8A 1ETXA 2D5VA 3C2BA 3I53A 3OS1A 2DMUA 2ECCA 2R5YB 1GVDA 4N9HA 4M72A 4CCMA 5IOZA 2RGVA 3MZYA 2GWRA 3HJEA 1MJAA 4XRSG 3ZMZA 4ESBA 1QHHD 4XLPF 2WWYA 4HV5A 3SEZA 1X1PA 2DU9A 3HM5A 1T2KA 3NWSA 1MKMA 2EV6A 3FKIJ 3MWMA 1M1EB 1A5JA 3BR5A 1O7LA 1REPC 2WV1A 1EH7A 2V1XA 4IOCF 1K78A 2E1MC 4IF4A 2VE9A 3WGHA 1X2MA 2F6CA 1SFXA 1LVAA 2OQGA 2L4MA 2E71A 2DW4A 2HQRA 2V1UA 3AG3H 3BR1A 2LFBA 2YSRA 4QSHA 1TC3C 1WFXA 1J09A 3CP8A 4KIGA 3DEWA 5LHGA 3ABMH 2L2OA 1YITI 4IEJA 1XSVA 5JR3A 3COAC 2LREA 1JXSA 3BQYA 2E2JJ 5K5RA 3CUQA 1WJEA 2K9LA 2RNJA 2JPCA 3HPGA 5J8FA 1WVRA 3LFUA 4FT8A 2VB6A 3GUDA 1STZA 2XDVA 4NC8A 5L3FA 1QBJA 3ISPA 3MD2A 1K7AA 4D7MA 3CC4I 4A3JJ 1Z1DA 4M6YA 4DNCA 4I7HA 2PJPA 1FOWA 2P81A 2IW5A 3W2AA 1HOMA 1GDTA 1J2XA 3HHHA 3P7NA 4XICA 4P1WA 3O8GA 2E5NA 4AIKA 1IN5A 4G7OF 3A03A 5KVRA 1MZBA 1J9IA 3DFGA 3LSGA 4YIIA 3PQKA 3OYMA 5J6XA 1OCTC 3CC7I 4GFBA 4Y4RA 1Z3XA 5EYRA 1TWGJ 2WAFA 4XIDA 1S5LC 3M9AA 3FXMA 3EYYA 2PEXA 1MMNA 3EUHC 2DA1A 1KU3A 3KCCA 2X48A 1T56A 2CRGA 2H09A 2JUCA 1XC5A 5EEHA 2OTLI 1IRXA 1MBGA 1XMKA 2O8XA 4X0GA 4IPAA 2EFWA 1W36D 2CW8A 4M73A 4J01A 3ECHA 1LQ1A 4MEXF 2AS5F 4HSRA 5JVTA 3CUOA 2MC3A 3HIFA 4CCNA 4RB2C 4LB6B 4QWQA 3K7AJ 2W57A 2MH2A 1IV6A 2VE8A 1R36A 4Y13A 2QUFA 1AKHA 1U5TB 4D1QA 4XKBA 5IP6A 1ZREA 1FNNA 1S7AA 2HGCA 1LB2A 1MH4A 4HF1A 4DQ2A 1OYYA 4CHUA 2WAQN 4KIFA 2LG4A 2CWEA 1R49A 1Y8RB 1W7PA 5GAEJ 5E3OA 2JRTA 4EEFG 4ZTFA 3ABKH 1IC8A 2M7AA 3ZRGA 1UMQA 3L2CA 2Y31A 5DV5A 3E5QA 3FISA 1WJ5A 2BHZA 4JQFA 3DCFA 2DOFA 4A5NA 4H0EA 1SFKA 4WXCA 3GTJJ 2M0MA 1EKEA 1E17A 4OU0A 2PJRB 1V4RA 3E5XA 3FBNB 1D1CA 4RB0A 2VXDA 2D2WA 3BZ6A 3IWZA 2DJIA 5EGOA 1B9NA 4IOAF 1N78A 4BE2A 3V8LA 5E1WA 3FXRA 4KN7X 3FBIB 1IXRC 2LMDA 1GV5A 1WKMA 2BVLA 4OWRB 2QEXI 2EFOA 2IJLA 2J5OA 2W7NA 4NB5A 1XMXA 2QVOA 1ERDA 4MLOA 5M3MJ 3DKWA 2CUZA 2L4AA 4RAZA 3G2BA 2JWTA 5F64A 1MGTA 1MNEA 3ERED 1RC9A 2Q1ZB 5CJ9A 1X3UA 2VBXA 2XKOA 2DXIA 2JA8J 1UZCA 2EA2A 2W82A 2ELJA 2P5VA 1ZLJA 2DA6A 3GBGA 2O8KA 4F52A 3OR2C 2ME0A 2UZKA 2EQRA 1Y8QB 3JRFA 1VNDA 3BCBA 5ED4A 4BJ6C 3J81K 4FX0A 4BYYA 2DJNA 3PFYA 4PK4A 2X9DA 3S14J 3PNYA 3CCLI 4WCGA 3C7JA 3QPHA 2KRCA 2KIQA 2DDBA 5BNGA 5L3CA 4CZCA 3Q9SA 4Y3OA 2FOKA 4S05A 2R7WA 2E34A 2KDZA 2DFEA 2HTJA 3DEUA 3VDXA 1CGPA 2P7VB 3S16J 1HW5A 1BI0A 3ELKA 3L2QA 5E3NA 3SDGA 2Y69H 3V8JA 2MBFA 4FQGA 1D8JA 3GVAA 2P5KA 3RPQA 2XC7A 6PAXA 2ZFUA 3GLLA 1F9NA 1XCBA 3H9JA 1BR4A 5J8CA 1I5ZA 3K1NA 4AYBN 4GDFA 3PIOF 3QYFA 3ZR8X 5CVRA 5HLTA 4EJVA 2VIXA 4FASD 2D1VA 2F2EA 1OR7A 3ZQIA 1R6RA 2KZGA 3G3ZA 2XF7A 2H1LA 4RAFA 1ETOA 1J7KA 2LP0A 3E5UA 3BT9A 5FB2A 1FYMA 1JTYA 4YEJA 4BQQA 5K7FA 5M5XJ 1LDKB 1OCRH 2O5RA 2DMPA 5FLXZ 2ZSHB 3J80K 2EWNA 2GIZA 5DS9A 3HEFA 2QBYB 1FTTA 3HHGA 2E5ZA 5IY5H 2KIMA 3KZIC 3GFIA 3WE2A 1BL0A 2I5UA 2M87A 2VXZA 3M1CA 3ZQFA 2B0LA 1V5EA 4BBRJ 1K79A 1PYVA 1MSEC 1X4PA 1IRFA 2ETHA 4M3EA 2NVQJ 2DOAA 2C6YA 2NS7A 4LG3A 3I71A 4HNTA 1ZHFA 3PL8A 2PMUA 3F21A 3HXLA 2EIJH 3AG1H 3OIPA 3B6AA 2Y0SA 3ROUA 2XGCA 2PMZA 1JJ6C 2XPWA 2CUJA 3T8RA 3GTMJ 3F72A 2XAQA 4E6KG 1ENHA 2EZKA 5KAFC 2LR8A 2ZBKA 2EZHA 4BDZA 1J0RA 4D9JA 4YFNF 5D6EA 1YS6A 2CV2A 1U0JA 2XV4S 4B1RA 2G9WA 1D8KA 4UUTA 1MMGA 2JPBA 2VQCA 2PX9A 5B3SH 2QSHX 2ZFWA 5GAGJ 2ZXWH 1ZG1A 2F5EA 4C2UA 2HZDA 2M9HA 3BZCA 2K4BA 4CCLA 1GHCA 4GYGA 3HYIA 3FK7A 3ZGKA 1OPCA 3ZQCA 1SVOA 2F5FA 4PJJA 4FE7A 2HQAA 4ESFA 1KQ0A 3TL4X 3ZQ7A 2LC2A 1MBJA 4L5IA 4XLCA 2WADA 1FYKA 3CJNA 3C2HA 4RAGA 1SMTA 1SAUA 1ACIA 2H8WA 3RIRA 1D1AA 3PSIA 2PMZN 1O3SA 3GTQJ 3GWZA 3J7YJ 1W7PD 3CUQC 1D1BA 3ML6A 1IZ1A 3FDYA 3LA2A 1YJWI 1BM9A 4G8XA 1UHWA 2RQQA 4RGUA 4M3BA 2JQ7A 3CJQB 1EF4A 4XMYA 4M6XA 2CFXA 4MQVA 1V54H 2FMLA 5LEKA 3HOTA 3I3LA 2NAZA 3DU6A 3LA3A 1PUEE 1QVTA 2H1KA 1Z91A 2DA5A 5EZHA 4PUSA 1IXCA 1I39A 1C0WA 3WTTC 2OPTA 3MKLA 1B8IB 3F0CA 4L5EA 3NARA 4MHGA 5E20A 4ZDOA 1R1TA 1KU2A 1YTYA 1ETVA 4Z6YA 4KICA 2VJJA 2BBYA 2KP6A 3ZMUA 2X6YA 5ILSA 5HOOA 3ZQLA 1ZAOA 1RI7A 2F48A 2HKXA 3GMEA 5DUKA 1DDNA 1CF7A 1SANA 1GV2A 4MNUA 3GZ5A 2OZUA 3KE2A 4EVIA 4ASNA 4CA0A 2DYRH 3FXJA 2KL4A 2XRLA 4IHSA 2EK5A 2EB7A 3ZMSA 1ZR4A 3FIWA 1YRNB 2IGNA 3SZGA 3HOXJ 5F27A 1YO5C 2A07F 2DPUA 2IGMA 4ENJA 3EUKL 5FKLA 2HKOA 5LGTA 4OIOF 3HRMA 1G3TA 4IHYA 1VQPI 1A04A 2ICWG 2VUMJ 3JAMZ 4IHWA 1RESA 5GTIC 2HPMA 3HBLA 2VPRA 2W25A 1BI3A 2OAZA 4ZYEA 5IP7J 4RDUA 3S2DJ 1KU9A 2K9NA 4U87A 3E0JB 2IVMA 4HNUA 2CQNA 2E19A 2QSFX 1QQIA 3K2ZA 2KMUA 3C2GA 4XK4A 2JSCA 2XUBA 4CYCB 2CS3A 4G6QA 3IHUA 1XGSA 4BY1J 2OTJI 5L3EA 4A2UA 3D1NI 2RREA 2RC4A 3CJRB 3HRUA 4P96A 3HUGA 4V2FA 5FJ8J 2W48A 2ID3A 2JVHA 2R7TA 1VQ8I 3U21A 3RKQA 3IAS2 3VWBA 2UWMA 1V55H 2M5WA 2WY8Q 4DYCA 3M8EA 2EA4A 4BE1A 2Q2EA 2XB0X 2ACJA 3TQNA 2GXBA 1JUMA 4TV7A 3T0YA 1AA7A 1A6QA 2HWVA 3MCZA 4II2A 5L3BA 3W6VA 4BEHB 5IYDJ 4DJAA 1TWHJ 3HL2A 3LQRA 4U0WA 2E1CA 3QYEA 2HDWA 4KITB 2R5ZB 2KRFA 1N75A 4XLHA 1ITYA 1PVEA 1OCPA 2LF8A 2DA3A 4E7HA 2QQBA 3IL2A 2CU7A 4NDLA 3QQAA 4QPQA 3RJPA 2OBPA 3ZQHA 4DW6A 2MABA 1YJ9I 2R7RA 2DO7A 4HOBA 2FNAA 4HBLA 5HNHA 1YIJI 2TCTA 3G4SI 3V42A 4XOPA 2CW0F 3M8FA 4JYKA 5K1YA 4G12A
chains in the Genus database with same CATH topology
1LE8A 1IDZA 1X2MA 5EEAA 3A02A 2DMQA 3RQIA 4C2MJ 4M3GA 3BR1A 5J1RA 1F36A 2LFBA 2LLKA 4IHXA 4QSHA 2OF7A 3FK6A 3G1MA 1TC3C 3IV5A 3DEWA 2GM4A 3H3VK 5JLWA 4W1UA 3TEDA 4IEJA 3IH3A 4A3IJ 2HI3A 3BQYA 5K7ZA 3GTPJ 2E2JJ 4M3DA 1IG7A 4BY7J 1WCMJ 3BR6A 1OJLA 2NVYJ 1FIPA 3GTKJ 2JJ7A 2K40A 1JKRC 1GT0C 2Y9YA 4BBSJ 3IH4A 1HCRA 2ME6A 5C4XJ 3HOWJ 2XPUA 4D7MA 5K7HA 4A3JJ 4A69C 1P7IA 4BXXJ 3I4MJ 2DMNA 3TP3A 2AHQA 2P81A 3BQZA 1HOMA 2QCOA 4FE4A 1GDTA 4A3GJ 4XICA 3O8GA 2NOGA 2XPVA 1BJZA 3A03A 1MNMC 2LVSA 2NS8A 4JP0A 3LSGA 1B72A 1OCTC 4GFBA 1K61A 5EYRA 1TWGJ 4XIDA 1JT0A 1U9NA 1HDDC 2R7ZJ 2O7OA 1IGNA 2YU9J 3QPSA 2DA1A 1E3OC 2X48A 1T56A 2CRGA 4B3AA 5M3FJ 3Q0WA 1JJ8C 1WGXA 2M8GX 1XC5A 1K83J 1HLVA 1MBGA 1Y1VJ 2E2HJ 5F04A 1HF0A 1JKQC 1IJWC 1FIAA 1UHSA 3CQZJ 3K7AJ 4Y52J 1ZK8A 1IV6A 3BR2A 3PO3J 3BG9A 3ZOBA 4MFEA 1AKHA 5IP6A 2X6OA 3HB9A 5F0FA 2MSYA 3CCYA 2DMTA 2KT0A 3LSRA 4AC0A 1MH4A 3A01A 1FJLA 4FISA 2R0QC 2JA6J 4A3DJ 3JRGA 2DA7A 2WAQN 4RBOA 1O4XA 5E3LA 9ANTA 3MN2A 5E3OA 3CDLA 4EEFG 1IC8A 1UMQA 2Y31A 3LSPA 3FISA 2JN6A 2TRTA 3DCFA 1Z77A 1B8IA 3S17J 3E7LA 5EG0A 3M3YJ 3S1QJ 1RETA 3TP0A 2XGEA 3M4OJ 3GTJJ 1PUFB 3S1MJ 2DN0A 1NK3P 4MFDA 5EGOA 4JX5A 1TWAJ 3BTLA 5C4JJ 1U78A 1GV5A 1H89C 3OOUA 2JMWA 5F0HA 4FTHA 1BW6A 1XS9A 3WHCA 1YRNA 4QTRA 2FJ1A 2L9RA 4LOCA 5GPAA 2Y2ZA 4MLOA 2XGDA 5M3MJ 3B6CA 4M6VA 1JUSA 4S0HB 2JWTA 4DYQA 5GPCA 4A3EJ 4A3FJ 2EBIA 3HDDA 3BTCA 2GBYA 2JA8J 1SFOJ 2VKVA 1ORKA 1R9TJ 3JRAA 5IYCJ 3NAUA 5IPAA 2DA6A 3GBGA 2O8KA 2Y0SN 1ZQ3P 3I4NJ 2DA2A 1FTZA 3K2AA 3LSJA 2ME0A 3BTJA 5DTDA 3BR3A 2EQRA 3JRFA 1VNDA 3S1NJ 2VI6A 4UUSB 4I76A 1W0UA 2Y9ZA 3HOUJ 2DJNA 4CYCA 2X9DA 3S14J 4A3LJ 2IAIA 2FD5A 5BNGA 3OSFA 5J1UA 3BG3A 4A3MJ 4Y7NJ 5F1JA 3S15J 2HXIA 2LKXA 1Q1VA 2KDZA 3G1OA 2JA7J 3VPRA 3S16J 1RR7A 1I3QJ 2K9SA 5EZGA 4AUXA 4B4CA 5E3NA 3SDGA 1A6IA 1MBEA 5FKOA 1ETYA 1T33A 2MGQA 2XB5A 3TW7A 5FKKA 1F43A 3UKGA 1LFBA 5J3LA 1H88C 2H8RA 3G1LA 4AYBN 1LE8B 2AO9A 4D7NA 3O8HA 2R5YA 2R5ZA 1NTCA 2M2EA 2I10A 3WHBA 2COBA 3ZQIA 5IYBJ 1MBHA 1ETOA 4XRMA 2LP0A 1OFCX 4D5FA 2LD5A 3BT9A 4IHVA 3JRCA 1JTYA 1JUPA 5K7FA 5M5XJ 5F0CA 4A3BJ 1ZTRA 2DMPA 3MVPA 1AHDP 2XSDC 1GUUA 1X2NA 2EZIA 3TW6A 2HOAA 5DS9A 3HEFA 1FTTA 3IH2A 2CQQA 1ZGWA 1HDPA 3GTOJ 1H8AC 2E1OA 1G2HA 1BL0A 3ZQFA 4C3HJ 2CUEA 4X1EA 4BBRJ 1MSEC 1IUFA 4M3EA 5J1YA 2NVQJ 2E2IJ 2NS7A 3SFIA 2M0CA 1ETKA 4C3JJ 3CMYA 1VF9A 2Y30A 3B6AA 2FX0A 2VKEA 2XGCA 1JJ6C 4W97A 2XPWA 3GTMJ 3LNQA 1B72B 1P7JA 3JRBA 1FEXA 5FLMJ 4V2GA 2CQXA 1ENHA 2EZLA 2EZKA 2LR8A 1I50J 2EZHA 1MH3A 2L0KA 4A3CJ 4HNVA 1X58A 1QRYA 2G0EA 4B1RA 3S1RJ 4UUTA 2QF7A 5FKNA 4A93J 1LFUP 1JGGA 2NVXJ 2M9HA 2L7ZA 1D5YA 3FK7A 3JR9A 3ZQCA 1JTXA 4FE7A 2MG4A 2L7MP 1DU0A 4BKXA 1MBJA 1AKHB 3OIOA 3JRHA 3GTLJ 3JRIA 2CJJA 1NK2P 4MO7A 2PMZN 2B63J 3GTQJ 4DZJA 3A01B 2JK3A 1U9OA 1ZR2A 2L7FP 1I6HJ 3PM1A 1BW5A 1AU7A 3HKZN 4M3BA 1JT6A 3H0GJ 1EF4A 4QIWN 2HDDA 4X6AJ 4MIMA 1QVTA 3RZDJ 2H1KA 2JA5J 2DA5A 5EZHA 3Q0UA 3PO2J 2OPTA 1APLC 3HOZJ 3MKLA 2ECBA 2HQ5A 1B8IB 1QVUA 3F0CA 4L5EA 5EG0B 3OSGA 2DTZA 3NARA 4D5CA 2R92J 3HGGA 2N8GA 1ETVA 4JX4A 2HYJA 5M5YJ 3ZQLA 1MBFA 3JREA 2CUFA 2O9LA 1SANA 1GV2A 5EGOB 1VFCA 2GLOA 2IEKA 4C3IJ 1TWFJ 4I6ZA 2XRLA 3SJMA 1TWCJ 1RPWA 1ZR4A 3FIWA 3BR0A 2ELKA 3HGYA 5IP9J 4XRSA 3HOXJ 1YRNB 5F27A 3ZQGA 4M3FA 5FLVA 1Z0XA 5FKLA 1PUFA 1VI0A 4DYRA 1MSFC 1IRZA 2K9QA 3L1PA 4ABZA 5EDNA 4A3KJ 4IHYA 1RKWA 2M34A 2VUMJ 2MW8A 3BTIA 3QPLA 4IHWA 1DU6A 1RESA 2LK2A 1XG1A 3HBLA 2VPRA 1ETQA 5C44J 1QPIA 1ETWA 4RDUA 5IP7J 3S2DJ 2LY9A 2YUSA 2K9NA 1WPKA 5GP9A 5E3MA 1WI3A 2E19A 2RAEA 3BG5A 2HOSA 4XK4A 3RZOJ 2NVTJ 5FKMA 4CYCB 3HOVJ 4BY1J 2YS9A 5JLXA 1CQTA 1JKOC 3D1NI 5C3EJ 5EF6A 5M5WJ 4JX6A 1POGA 3S2HJ 1MBKA 1IDYA 4V2FA 5FJ8J 2W48A 3Q0VA 1UG2A 1JKPC 1RKTA 2ID3A 3HOYJ 2FQ4A 2DA4A 3RKQA 2HOTA 1W0TA 3LOCA 4DYCA 1Y1WJ 3JRDA 4UUSA 2IBDA 5HODA 2EH3A 1WH7A 2WB1N 2XB0X 3Q3SA 2R93J 1JUMA 3W6VA 1ETXA 2LTPA 3C2BA 2D5VA 5IYDJ 2ID6A 1ZKGA 1TWHJ 2DMUA 2ECCA 2R5YB 2R5ZB 1WH5A 1GVDA 1ITYA 4DZPA 1OCPA 2DA3A 5IOZA 2CU7A 4NDLA 3QQAA 4J19A 3GTGJ 4XRSG 3ZQHA 4DW6A 2HXOA 3HM5A 4FCYA 2ZB9A 3FKIJ 2TCTA 5IOYA 1U8BA 1A5JA 1S7EA 3BR5A 4JYKA 2WV1A 4G12A 5F08A 1BA5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LE8 A;  1IDZ A;  1X2M A;  5EEA A;  3A02 A;  2DMQ A;  3RQI A;  4C2M J;  4M3G A;  3BR1 A;  5J1R A;  1F36 A;  2LFB A;  2LLK A;  4IHX A;  4QSH A;  2OF7 A;  3FK6 A;  3G1M A;  1TC3 C;  3IV5 A;  3DEW A;  2GM4 A;  3H3V K;  5JLW A;  4W1U A;  3TED A;  4IEJ A;  3IH3 A;  4A3I J;  2HI3 A;  3BQY A;  5K7Z A;  3GTP J;  2E2J J;  4M3D A;  1IG7 A;  4BY7 J;  1WCM J;  3BR6 A;  1OJL A;  2NVY J;  1FIP A;  3GTK J;  2JJ7 A;  2K40 A;  1JKR C;  1GT0 C;  2Y9Y A;  4BBS J;  3IH4 A;  1HCR A;  2ME6 A;  5C4X J;  3HOW J;  2XPU A;  4D7M A;  5K7H A;  4A3J J;  4A69 C;  1P7I A;  4BXX J;  3I4M J;  2DMN A;  3TP3 A;  2AHQ A;  2P81 A;  3BQZ A;  1HOM A;  2QCO A;  4FE4 A;  1GDT A;  4A3G J;  4XIC A;  3O8G A;  2NOG A;  2XPV A;  1BJZ A;  3A03 A;  1MNM C;  2LVS A;  2NS8 A;  4JP0 A;  3LSG A;  1B72 A;  1OCT C;  4GFB A;  1K61 A;  5EYR A;  1TWG J;  4XID A;  1JT0 A;  1U9N A;  1HDD C;  2R7Z J;  2O7O A;  1IGN A;  2YU9 J;  3QPS A;  2DA1 A;  1E3O C;  2X48 A;  1T56 A;  2CRG A;  4B3A A;  5M3F J;  3Q0W A;  1JJ8 C;  1WGX A;  2M8G X;  1XC5 A;  1K83 J;  1HLV A;  1MBG A;  1Y1V J;  2E2H J;  5F04 A;  1HF0 A;  1JKQ C;  1IJW C;  1FIA A;  1UHS A;  3CQZ J;  3K7A J;  4Y52 J;  1ZK8 A;  1IV6 A;  3BR2 A;  3PO3 J;  3BG9 A;  3ZOB A;  4MFE A;  1AKH A;  5IP6 A;  2X6O A;  3HB9 A;  5F0F A;  2MSY A;  3CCY A;  2DMT A;  2KT0 A;  3LSR A;  4AC0 A;  1MH4 A;  3A01 A;  1FJL A;  4FIS A;  2R0Q C;  2JA6 J;  4A3D J;  3JRG A;  2DA7 A;  2WAQ N;  4RBO A;  1O4X A;  5E3L A;  9ANT A;  3MN2 A;  5E3O A;  3CDL A;  4EEF G;  1IC8 A;  1UMQ A;  2Y31 A;  3LSP A;  3FIS A;  2JN6 A;  2TRT A;  3DCF A;  1Z77 A;  1B8I A;  3S17 J;  3E7L A;  5EG0 A;  3M3Y J;  3S1Q J;  1RET A;  3TP0 A;  2XGE A;  3M4O J;  3GTJ J;  1PUF B;  3S1M J;  2DN0 A;  1NK3 P;  4MFD A;  5EGO A;  4JX5 A;  1TWA J;  3BTL A;  5C4J J;  1U78 A;  1GV5 A;  1H89 C;  3OOU A;  2JMW A;  5F0H A;  4FTH A;  1BW6 A;  1XS9 A;  3WHC A;  1YRN A;  4QTR A;  2FJ1 A;  2L9R A;  4LOC A;  5GPA A;  2Y2Z A;  4MLO A;  2XGD A;  5M3M J;  3B6C A;  4M6V A;  1JUS A;  4S0H B;  2JWT A;  4DYQ A;  5GPC A;  4A3E J;  4A3F J;  2EBI A;  3HDD A;  3BTC A;  2GBY A;  2JA8 J;  1SFO J;  2VKV A;  1ORK A;  1R9T J;  3JRA A;  5IYC J;  3NAU A;  5IPA A;  2DA6 A;  3GBG A;  2O8K A;  2Y0S N;  1ZQ3 P;  3I4N J;  2DA2 A;  1FTZ A;  3K2A A;  3LSJ A;  2ME0 A;  3BTJ A;  5DTD A;  3BR3 A;  2EQR A;  3JRF A;  1VND A;  3S1N J;  2VI6 A;  4UUS B;  4I76 A;  1W0U A;  2Y9Z A;  3HOU J;  2DJN A;  4CYC A;  2X9D A;  3S14 J;  4A3L J;  2IAI A;  2FD5 A;  5BNG A;  3OSF A;  5J1U A;  3BG3 A;  4A3M J;  4Y7N J;  5F1J A;  3S15 J;  2HXI A;  2LKX A;  1Q1V A;  2KDZ A;  3G1O A;  2JA7 J;  3VPR A;  3S16 J;  1RR7 A;  1I3Q J;  2K9S A;  5EZG A;  4AUX A;  4B4C A;  5E3N A;  3SDG A;  1A6I A;  1MBE A;  5FKO A;  1ETY A;  1T33 A;  2MGQ A;  2XB5 A;  3TW7 A;  5FKK A;  1F43 A;  3UKG A;  1LFB A;  5J3L A;  1H88 C;  2H8R A;  3G1L A;  4AYB N;  1LE8 B;  2AO9 A;  4D7N A;  3O8H A;  2R5Y A;  2R5Z A;  1NTC A;  2M2E A;  2I10 A;  3WHB A;  2COB A;  3ZQI A;  5IYB J;  1MBH A;  1ETO A;  4XRM A;  2LP0 A;  1OFC X;  4D5F A;  2LD5 A;  3BT9 A;  4IHV A;  3JRC A;  1JTY A;  1JUP A;  5K7F A;  5M5X J;  5F0C A;  4A3B J;  1ZTR A;  2DMP A;  3MVP A;  1AHD P;  2XSD C;  1GUU A;  1X2N A;  2EZI A;  3TW6 A;  2HOA A;  5DS9 A;  3HEF A;  1FTT A;  3IH2 A;  2CQQ A;  1ZGW A;  1HDP A;  3GTO J;  1H8A C;  2E1O A;  1G2H A;  1BL0 A;  3ZQF A;  4C3H J;  2CUE A;  4X1E A;  4BBR J;  1MSE C;  1IUF A;  4M3E A;  5J1Y A;  2NVQ J;  2E2I J;  2NS7 A;  3SFI A;  2M0C A;  1ETK A;  4C3J J;  3CMY A;  1VF9 A;  2Y30 A;  3B6A A;  2FX0 A;  2VKE A;  2XGC A;  1JJ6 C;  4W97 A;  2XPW A;  3GTM J;  3LNQ A;  1B72 B;  1P7J A;  3JRB A;  1FEX A;  5FLM J;  4V2G A;  2CQX A;  1ENH A;  2EZL A;  2EZK A;  2LR8 A;  1I50 J;  2EZH A;  1MH3 A;  2L0K A;  4A3C J;  4HNV A;  1X58 A;  1QRY A;  2G0E A;  4B1R A;  3S1R J;  4UUT A;  2QF7 A;  5FKN A;  4A93 J;  1LFU P;  1JGG A;  2NVX J;  2M9H A;  2L7Z A;  1D5Y A;  3FK7 A;  3JR9 A;  3ZQC A;  1JTX A;  4FE7 A;  2MG4 A;  2L7M P;  1DU0 A;  4BKX A;  1MBJ A;  1AKH B;  3OIO A;  3JRH A;  3GTL J;  3JRI A;  2CJJ A;  1NK2 P;  4MO7 A;  2PMZ N;  2B63 J;  3GTQ J;  4DZJ A;  3A01 B;  2JK3 A;  1U9O A;  1ZR2 A;  2L7F P;  1I6H J;  3PM1 A;  1BW5 A;  1AU7 A;  3HKZ N;  4M3B A;  1JT6 A;  3H0G J;  1EF4 A;  4QIW N;  2HDD A;  4X6A J;  4MIM A;  1QVT A;  3RZD J;  2H1K A;  2JA5 J;  2DA5 A;  5EZH A;  3Q0U A;  3PO2 J;  2OPT A;  1APL C;  3HOZ J;  3MKL A;  2ECB A;  2HQ5 A;  1B8I B;  1QVU A;  3F0C A;  4L5E A;  5EG0 B;  3OSG A;  2DTZ A;  3NAR A;  4D5C A;  2R92 J;  3HGG A;  2N8G A;  1ETV A;  4JX4 A;  2HYJ A;  5M5Y J;  3ZQL A;  1MBF A;  3JRE A;  2CUF A;  2O9L A;  1SAN A;  1GV2 A;  5EGO B;  1VFC A;  2GLO A;  2IEK A;  4C3I J;  1TWF J;  4I6Z A;  2XRL A;  3SJM A;  1TWC J;  1RPW A;  1ZR4 A;  3FIW A;  3BR0 A;  2ELK A;  3HGY A;  5IP9 J;  4XRS A;  3HOX J;  1YRN B;  5F27 A;  3ZQG A;  4M3F A;  5FLV A;  1Z0X A;  5FKL A;  1PUF A;  1VI0 A;  4DYR A;  1MSF C;  1IRZ A;  2K9Q A;  3L1P A;  4ABZ A;  5EDN A;  4A3K J;  4IHY A;  1RKW A;  2M34 A;  2VUM J;  2MW8 A;  3BTI A;  3QPL A;  4IHW A;  1DU6 A;  1RES A;  2LK2 A;  1XG1 A;  3HBL A;  2VPR A;  1ETQ A;  5C44 J;  1QPI A;  1ETW A;  4RDU A;  5IP7 J;  3S2D J;  2LY9 A;  2YUS A;  2K9N A;  1WPK A;  5GP9 A;  5E3M A;  1WI3 A;  2E19 A;  2RAE A;  3BG5 A;  2HOS A;  4XK4 A;  3RZO J;  2NVT J;  5FKM A;  4CYC B;  3HOV J;  4BY1 J;  2YS9 A;  5JLX A;  1CQT A;  1JKO C;  3D1N I;  5C3E J;  5EF6 A;  5M5W J;  4JX6 A;  1POG A;  3S2H J;  1MBK A;  1IDY A;  4V2F A;  5FJ8 J;  2W48 A;  3Q0V A;  1UG2 A;  1JKP C;  1RKT A;  2ID3 A;  3HOY J;  2FQ4 A;  2DA4 A;  3RKQ A;  2HOT A;  1W0T A;  3LOC A;  4DYC A;  1Y1W J;  3JRD A;  4UUS A;  2IBD A;  5HOD A;  2EH3 A;  1WH7 A;  2WB1 N;  2XB0 X;  3Q3S A;  2R93 J;  1JUM A;  3W6V A;  1ETX A;  2LTP A;  3C2B A;  2D5V A;  5IYD J;  2ID6 A;  1ZKG A;  1TWH J;  2DMU A;  2ECC A;  2R5Y B;  2R5Z B;  1WH5 A;  1GVD A;  1ITY A;  4DZP A;  1OCP A;  2DA3 A;  5IOZ A;  2CU7 A;  4NDL A;  3QQA A;  4J19 A;  3GTG J;  4XRS G;  3ZQH A;  4DW6 A;  2HXO A;  3HM5 A;  4FCY A;  2ZB9 A;  3FKI J;  2TCT A;  5IOY A;  1U8B A;  1A5J A;  1S7E A;  3BR5 A;  4JYK A;  2WV1 A;  4G12 A;  5F08 A;  1BA5 A; 
#chains in the Genus database with same CATH topology
 1S72 I;  5EEA A;  2DPD A;  1FOK A;  1DP7 P;  2A5Y B;  4L18 B;  2R7X A;  2OU2 A;  3RQI A;  5D5V B;  3ZXS A;  3OL3 A;  2DK8 A;  3H3Z A;  3RYR A;  3TOB A;  2OF7 A;  3G1M A;  1G3S A;  5H20 A;  3IV5 A;  1ZH5 A;  2GM4 A;  3H3V K;  4U7B A;  3FZV A;  5CQE A;  4PJM A;  1RRJ A;  3TED A;  1G6N A;  2HFH A;  3VB2 A;  3IH3 A;  3I64 A;  3JSP A;  4A3I J;  2XAG A;  2P6S A;  3LSM A;  3DV8 A;  4M3D A;  1B4A A;  4BY7 J;  1WCM J;  2FUG 2;  2VLA A;  3L09 A;  2VJ4 A;  3LSK A;  2PFB A;  2JJ7 A;  2K40 A;  1FC3 A;  1LKX A;  2HR3 A;  2JUG A;  1Z7L A;  1VQO I;  2L02 A;  4WK8 F;  3OMY A;  5F1R A;  1U8R A;  4LK1 F;  1JGS A;  1XD7 A;  5C4X J;  2V6C A;  3SQN A;  3U1D A;  3HTS B;  1OCZ H;  2KZV A;  1P7I A;  3JSO A;  3M07 A;  3I4M J;  2AHQ A;  4FE4 A;  2DDA A;  4RGR A;  4A3G J;  3N05 A;  2NOG A;  2FBH A;  1MNM C;  1R4N B;  1OR7 C;  4JP0 A;  1B72 A;  2K27 A;  5F6F A;  4UB6 C;  2OJE D;  1K61 A;  4RAY A;  2R7Z J;  3A0H C;  1T98 A;  3HTU A;  4AIH A;  2YU9 J;  4J00 A;  4S04 A;  3FWE A;  1R5I D;  3KP5 A;  1WGX A;  3ZN0 A;  4KUM A;  1K83 J;  5KK1 A;  1Y1V J;  1QNT A;  4UB8 C;  1AWC A;  2HS5 A;  4N4O B;  1T0F A;  3PIP F;  4L5J A;  3L00 A;  4JK1 X;  1JKQ C;  3DLA A;  3BCA A;  5HS7 A;  1IJW C;  3OYJ A;  4OIR F;  3N97 A;  1QU3 A;  4XQF A;  3OR1 C;  1ZK8 A;  3KYL A;  1EA3 A;  2VT3 A;  3AAF A;  2WAE A;  3BPV A;  3DPT A;  3RPU A;  1MDM A;  4PCQ A;  3D0S A;  2H6B A;  4FET A;  2MC4 A;  3NWT A;  2YPR A;  3CCY A;  5E79 C;  2DMT A;  3JTH A;  2KT0 A;  5FFZ A;  4BAY A;  3WTX C;  3OYB A;  3LSR A;  2Z16 A;  4AID A;  2KLO A;  3A01 A;  2V4J C;  3OWT A;  1XPX A;  4AD9 A;  3JRG A;  2DA7 A;  5CYV A;  1O4X A;  2NNY A;  1HW1 A;  3GFJ A;  9ANT A;  2L7K A;  2CYY A;  2IP2 A;  3CO7 C;  2XF5 A;  3LSP A;  4C9Y A;  3F8F A;  2JN6 A;  4HZF A;  2TRT A;  4PGG A;  4WXH A;  4EM1 A;  1GLN A;  3LA7 A;  5EG0 A;  2MLK A;  3TP0 A;  4B44 A;  4EV0 A;  1D0X A;  2XGE A;  5LRS A;  3M4O J;  4L0Z B;  5HNF A;  5ICG A;  1S6L A;  4E7J A;  4L9T A;  1B6A A;  4F7Z A;  5E8I A;  2UUZ A;  2X85 A;  3CF2 A;  5J4Y A;  2QLZ A;  3RI4 A;  2W4S A;  3IKV A;  1EV7 A;  2IA2 A;  4RLF A;  2PQ8 A;  5CVJ A;  4LB5 A;  3BTL A;  5K5Q A;  3OOU A;  2WBM A;  4IX7 A;  1JI8 A;  3F23 A;  2TDX A;  2VJ5 A;  2VT2 A;  4M9Z A;  3WHC A;  4KIS A;  2FJ1 A;  1HSJ A;  3FXL A;  1Q1H A;  1A36 A;  2B9S A;  1IV8 A;  1R1V A;  2XGD A;  3BG7 A;  1T6S A;  3I9V 2;  5CPR B;  1T95 A;  2KIS A;  1YJN I;  4S0H B;  1HST A;  5GPC A;  2J5P A;  4A3E J;  4OIP F;  4IVN A;  1IN4 A;  1TW2 A;  2F4M B;  4XLA A;  2VOP A;  2DLL A;  1PP7 U;  2M1B A;  2HVS A;  1ORK A;  1FZP B;  5L3G A;  3RKY A;  3A0B C;  2V1D A;  5IPA A;  2BV6 A;  3L7W A;  4E7S A;  1YOV B;  1FBS A;  3M7G A;  3TDZ C;  2A5W A;  2VI6 A;  2M4G A;  1I6X A;  4LFU A;  3EET A;  4CGZ A;  4P9U A;  4HDV A;  2ZME B;  1FBU A;  2P0W A;  1DPR A;  3D5R C;  2IAI A;  4CZZ A;  1NG7 A;  4MGR A;  3BG3 A;  4HX4 A;  3VSK A;  1HQC A;  4A3M J;  2RNG A;  2MH9 A;  2M7B A;  3RYP A;  3S15 J;  1G3Y A;  2OCC H;  1YX5 A;  4G7Z F;  3PNV A;  3VYT B;  3G1O A;  4CCK A;  1TBX A;  4LLL A;  3AG2 H;  2AQF A;  3O2P E;  3MKW B;  2WAQ A;  3KLN A;  2YU3 A;  3VOE A;  4BJ5 C;  1MBE A;  3DTI A;  3IAM 2;  2CQ7 A;  2VAS A;  5HLI A;  3R6S A;  1KYZ A;  2PG4 A;  3CJT B;  3UNG C;  1O3R A;  1LFB A;  1HBX G;  5ERI A;  1FLI A;  5HDK A;  4CSW A;  1LE8 B;  2R5Y A;  3DEE A;  5GAD J;  2BEO A;  2DOE A;  3WHB A;  1VQN I;  5CVV A;  2E35 A;  3SZT A;  3I56 I;  4RGS A;  1L0O C;  2DFH A;  1S8N A;  4C30 A;  1LUJ B;  1NH3 A;  5DCM B;  2HYF A;  4XRM A;  1GVJ A;  1OFC X;  4D5F A;  5JVG F;  1I1S A;  4IHV A;  3JRC A;  3F8C A;  3VEP A;  3HZJ A;  1WJD A;  1Z6T A;  5F0C A;  4A3B J;  5B66 C;  2JA2 A;  3MVP A;  2D45 A;  2M4K A;  4NQW B;  3TW6 A;  1B1B A;  2HOA A;  3JTG A;  3KYC B;  3IH2 A;  2CQQ A;  1FOX A;  1A35 A;  4Q4Z F;  1PP8 F;  2BW3 B;  1H8A C;  2IGK A;  3BLY A;  1U2W A;  1XN7 A;  1U6G A;  3DBR B;  1KA8 A;  3GX4 X;  1OCC H;  1P4A A;  2E1O A;  3QRF F;  1HC8 A;  1G2H A;  1IF1 A;  4C3H J;  5D5U B;  2CUE A;  3LWF A;  4X1E A;  3HSR A;  4MQ9 F;  1IUF A;  5J1Y A;  3L2R A;  4XBF A;  3SFI A;  4EJO A;  4BHC A;  2ZXH A;  3HRS A;  5EEG A;  2M0C A;  3WG9 A;  4B09 A;  2Y30 A;  2LYC A;  2KHM A;  3BJO A;  2FX0 A;  2VKE A;  2EIM H;  3EUA A;  3WGI A;  1R23 A;  2R7Q A;  1Z21 A;  5BMZ A;  4CCO A;  2L54 A;  1XCV A;  3CO6 C;  2ZNZ A;  3K9T A;  3GZ6 A;  4O5V A;  1SVL A;  1I50 J;  4D0P A;  4XLN F;  2FF4 A;  3ZPL A;  4LK0 F;  3AG4 H;  2R7O A;  5TGT A;  1QRY A;  3AL0 C;  3S1R J;  1FP1 D;  4UUV A;  2EFN A;  2MD0 A;  3SYT A;  3SHF A;  3CCJ I;  2NVX J;  4JBA A;  3CCE I;  1D5Y A;  3RPU D;  4ON0 A;  5ICE A;  2DT5 A;  3VOD A;  3PUF A;  2Z33 A;  3CF5 F;  4BXU A;  2L7M P;  2AXT C;  3FX3 A;  4B3X A;  4B48 A;  3OIO A;  2O61 A;  5IT9 Z;  2R7V A;  3GTL J;  1NHA A;  4GYI A;  3TO9 A;  4MO7 A;  2B63 J;  4ZYG A;  4DZJ A;  4AYB A;  1ZR2 A;  1I6H J;  3QOE A;  2XAU A;  4N4N B;  1AU7 A;  1BW5 A;  4IRI A;  3H0G J;  3FXU A;  2HDD A;  3K4K A;  5FO5 A;  3H5R A;  2HTS A;  5HS8 A;  4X6A J;  2L3D A;  3FXK A;  5LEJ A;  3Q0U A;  5AIP A;  5E8G A;  1W4M A;  2ZNY A;  4Q48 A;  1RUO A;  3HOZ J;  1APL C;  2ECB A;  2NNN A;  1U5T A;  5LBQ A;  1BR1 A;  1FSH A;  3IRQ A;  2DTZ A;  3ABT A;  4A0X A;  4ZYA A;  2RV8 A;  3B02 A;  3OYN A;  3P5J A;  4HV6 A;  4XLE A;  1SEU A;  5DD4 A;  3ABU A;  2FBK A;  3WU2 C;  1YG2 A;  3JRE A;  1SMY F;  1MJB A;  1SFE A;  3K4L A;  4BDY A;  1XGO A;  4E7L A;  3ZMV A;  2GLO A;  4C3I J;  1TWF J;  3DQV C;  4I6Z A;  1LDD A;  3L2W A;  2M3A A;  4XKV A;  2FNP A;  2ELK A;  5IP9 J;  1TL8 A;  3B73 A;  2BYV E;  3ZQG A;  5DM7 F;  1O7F A;  4M3F A;  1P4X A;  4Y17 A;  5A2Q Z;  2FOW A;  1T0F C;  2PJR A;  4DYR A;  3MFK A;  1MSF C;  2K9Q A;  2IRF G;  5EDN A;  5IT3 A;  2A05 A;  2A61 A;  3HG9 A;  3BTI A;  2F4O B;  5FRO A;  1NG6 A;  3BJA A;  3HSF A;  3CCS I;  4AVP A;  2R7F A;  3VFZ A;  5CKT A;  1ETQ A;  1ETW A;  2UV1 A;  2MFZ A;  1QA6 A;  3P9K A;  2BE5 F;  4BH9 A;  3OYK A;  1O57 A;  5B1B H;  3I58 A;  2E1M B;  1WPK A;  4EJW A;  4XOT A;  2OV7 A;  5JHU A;  2K3F A;  1TT5 B;  4IHT A;  3BG5 A;  2NYX A;  4IZZ A;  2HOS A;  1LFP A;  2ZC2 A;  5ILV A;  4LD5 A;  3HOV J;  1IN7 A;  2GA1 A;  1CQT A;  2R4G A;  2VL8 A;  1X1A A;  2FQ3 A;  5C3E J;  4JX6 A;  3K4J A;  3H1C A;  4I98 B;  1YW7 A;  1WSU A;  3HOY J;  4XOR A;  3U1K A;  1L3L A;  2DA4 A;  2L9V A;  5B5E C;  1LVK A;  3LOC A;  2VBW A;  1VQ9 I;  2IBD A;  1Z7U A;  5JHF A;  3DTE A;  2K7L A;  2KJC A;  2WB1 N;  2OCE A;  3E1S A;  4BQA A;  2W85 A;  2FU4 A;  2MYS A;  2VQH A;  4EAT A;  3F22 A;  2EPF A;  2ID6 A;  1ZKG A;  4XN3 A;  3V4G A;  2O0Y A;  3QP5 A;  1X1D A;  1R22 A;  2ZXI A;  1WI9 A;  3I59 B;  5E18 F;  1WH5 A;  3ECO A;  4DZP A;  1SD7 A;  3R61 A;  5DCF A;  2LNB A;  2STT A;  3GTG J;  3OYD A;  3LFK A;  2IS1 A;  1OMI A;  2DT7 B;  1JE8 A;  2YX7 A;  2ZKZ A;  1DP3 A;  3IWF A;  4OIQ F;  1BI1 A;  4PDK A;  2OQR A;  3EPZ A;  3REO A;  5IOY A;  3EQL F;  1U8B A;  1S7E A;  1HKS A;  1LDJ A;  5BS6 A;  2FMY A;  4P5O A;  1LFU P;  5F08 A;  2I8D A;  4HLY A;  1JHH A;  4II3 A;  4RM2 A;  3MQ0 A;  1FP2 A;  2DMQ A;  4C2M J;  1XDS A;  4E70 A;  5J1R A;  1F36 A;  3QP6 A;  2LLK A;  1G4D A;  1PDN C;  2JVG A;  4CH7 A;  2Z9O A;  4I02 A;  5JLW A;  3DBH B;  2EIL H;  3DF8 A;  3U9G A;  2HI3 A;  5K7Z A;  2GXA A;  2OUM A;  1X4O A;  3EDP A;  1GXP A;  5D8L B;  2XVC A;  3V7C A;  1OJL A;  2QBY A;  2NVY J;  5LD2 C;  4A0Y A;  4F91 B;  1Y39 A;  1JKR C;  1O3Q A;  3DXJ F;  2P4W A;  5H6R A;  4KJZ A;  2Y9Y A;  4HG2 A;  3KIO A;  3IH4 A;  2ME6 A;  2M30 A;  2PBI A;  3HOW J;  5K7H A;  3S32 A;  3RDI A;  4A69 C;  3BDD A;  3PSF A;  2DMN A;  2GOM A;  2LBF B;  4ETS A;  4DBR A;  3LSI A;  4LMY A;  3KPH A;  1XGM A;  3CDI A;  2H27 A;  1B9M A;  2ZXJ A;  4BHB A;  1EJ9 A;  1QHG A;  2XPV A;  1G59 A;  2JRM A;  1E2X A;  2Y48 A;  2QYO A;  1I27 A;  3LQQ A;  4XLF A;  3CTA A;  4BU2 A;  4AWX B;  1AOY A;  3G6E I;  1LPQ A;  4A12 A;  1SVM A;  1HDD C;  3L9F A;  1IGN A;  1TTY A;  3CLO A;  3QPS A;  3BP8 A;  3ZQQ A;  1DPU A;  2MA3 A;  3F3X A;  3Q0W A;  4YEL A;  1UJ8 A;  1IN6 A;  1S3J A;  4IRG A;  3W2V A;  3CCM I;  3G71 I;  5LRR A;  1E0E A;  3BOQ A;  1R5H A;  3FMR A;  5D8K B;  2F4I A;  2K3P A;  3WTW C;  1QZY A;  2E2H J;  5CLS A;  3RKW A;  1HF0 A;  1HXD A;  1FSE A;  2Z1D A;  1FIA A;  2HOE A;  3BWG A;  2ZJP F;  1MMS A;  2BXZ A;  3CQZ J;  3A2K A;  3HOS A;  1WWX A;  3DTK A;  3E6M A;  3BR2 A;  1N25 A;  3PO3 J;  3BG9 A;  2DYS H;  3NEU A;  4MFE A;  2X6O A;  3HB9 A;  4N0B A;  4F92 B;  2ZO4 A;  3WG7 H;  1J5Y A;  1FJL A;  1MMA A;  1ZGJ A;  5BPI A;  4XKC A;  2R0Q C;  1Z3Y A;  2JA6 J;  2DCE A;  1TQM A;  4A3D J;  3P9I A;  4RBO A;  3KP7 A;  4HA8 A;  2ADU A;  2E36 A;  5LGU A;  4HEA 2;  2IGO A;  3CDL A;  5DDG A;  3R60 A;  2ZJQ F;  3CCU I;  4M71 A;  3WTU C;  4HF0 A;  3BG6 A;  2UXN A;  4BQN A;  1Z77 A;  2MLG A;  1B8I A;  3E7L A;  2GQQ A;  3M3Y J;  3S1Q J;  2BOL A;  3S3N A;  1RET A;  2Z5U A;  4UVC A;  4PFO A;  3Q9V A;  1WQ2 A;  3KZZ A;  2QQ8 A;  4IO9 F;  1PUF B;  1IAW A;  4K2E A;  2VC1 A;  1TW3 A;  2KJB A;  3S1M J;  3ESW B;  2YX4 A;  3VSL A;  3PQJ A;  2CG4 A;  3F8N A;  1ZG3 A;  2E7W A;  2M45 A;  4JX5 A;  1TWA J;  4ENN A;  4XRF A;  1B59 A;  2L9S A;  3DU5 A;  5C4J J;  1I3A A;  3E3V A;  2JMW A;  1BW6 A;  1USS A;  1ZGA A;  4AIJ A;  2UXX A;  4XM3 A;  2CH0 A;  1YRN A;  2M8E A;  3OOP A;  3PJR A;  2L9R A;  4LLN A;  5GPA A;  2Y2Z A;  3B6C A;  4M6V A;  3WU0 A;  3O3K A;  2OD5 A;  3RSN A;  4DYQ A;  2LKS A;  1W5C C;  1P2F A;  3N4M A;  3H3U A;  1DGR M;  4ITV A;  3ZCO A;  1VQ6 I;  1LEB A;  5B1A H;  2GBY A;  5D4R A;  3S2W A;  1SFO J;  1FT9 A;  3S93 A;  5FD5 A;  3FF5 A;  4UV9 A;  3JRA A;  5IYC J;  1EH8 A;  1U5T C;  2HU9 A;  3NAU A;  3M1E A;  1ONV A;  4KFC A;  1FTZ A;  3I4N J;  2DA2 A;  3KEY A;  3K2A A;  1VQK I;  3LSJ A;  4B43 A;  1WJB A;  3BR3 A;  4WWC A;  3S1N J;  4G6T B;  4UUS B;  4PSW A;  3LAP A;  2XIG A;  3HOU J;  4CYC A;  3SXY A;  4O3M A;  4A3L J;  1ZRF A;  1Y6I A;  2V79 A;  3MKZ A;  1MD0 A;  3DWL E;  2FD5 A;  3OSF A;  3NRV A;  4QLC U;  5JI6 A;  3VYS B;  3LL7 A;  2DTR A;  4Y7N J;  1R71 A;  2HXI A;  1TNS A;  2LKX A;  2K02 A;  2IA0 A;  1Q1V A;  2XAJ A;  3LST A;  3GF2 A;  1YW9 A;  1TNT A;  2K4J A;  3GFM A;  1G8X A;  1I3Q J;  2K9S A;  5EZG A;  4AUX A;  4B4C A;  1Z67 A;  4P9F A;  4LJZ F;  4N9I A;  2Y0M A;  1ETY A;  2XB5 A;  4PSX A;  5HLH A;  3OYC A;  1IN8 A;  2P5L C;  3TW7 A;  5FKK A;  2VKD A;  1F43 A;  3KP3 A;  3UKG A;  1W5S A;  4I2O A;  2B7E A;  3KP4 A;  5J3L A;  4BEH A;  1K78 B;  2XRO A;  3G1L A;  2H8R A;  4D7N A;  3O8H A;  2R5Z A;  1NTC A;  4IKF A;  2M2E A;  1R1U A;  2I10 A;  5HLG A;  5D5W B;  2COB A;  1V3F A;  1X1B A;  4I0A A;  3T8T A;  1DQU A;  5IYB J;  1HKQ A;  1MBH A;  1MIJ A;  1ZYR F;  3TBI A;  4CIC A;  1QGP A;  2ZJR F;  3H5A A;  1JUP A;  2A3S A;  1UAA A;  1ZTR A;  2DFI A;  2ESH A;  2P7C B;  1YHQ I;  1GUU A;  1X2N A;  2EZI A;  1H0M A;  1ZRD A;  3CUQ B;  5J47 A;  4LLG F;  1R4M B;  1ZGW A;  2OC6 A;  3QAH A;  1HDP A;  1F1Z A;  4YFX F;  3GTO J;  4M74 A;  4YIR X;  4WF2 A;  3OV8 A;  1ULY A;  2NS0 A;  3SFZ A;  4BGD A;  1KQ8 A;  3SEQ A;  5E17 F;  2E2I J;  3J7A O;  4UHT A;  1OKR A;  1KZH A;  3K4C A;  3KYD B;  2RN7 A;  2O3F A;  2BXY A;  1ON1 A;  2FEZ A;  1P7J A;  2VPL A;  3JRB A;  2IS2 A;  5FLM J;  4V2G A;  4ZZD A;  2EZL A;  3H9G A;  4RGX A;  4LG0 A;  4HNV A;  2RVC A;  2W24 A;  1T08 B;  4AM3 A;  2X0L A;  3HPH A;  2G0E A;  2LDU A;  3FXQ A;  3V8K A;  3G73 A;  2F5C A;  1XTA A;  3WTS C;  1YX3 A;  2DQL A;  2X1C A;  4IXA A;  1KYW A;  5FKN A;  3JW4 A;  1YLF A;  3MKY B;  1JGG A;  2ESN A;  2DQR A;  4WXD A;  3CC2 I;  3RKX A;  2K5C A;  4ANJ A;  3WOD F;  1JTX A;  4ENM A;  1FX7 A;  4NC7 A;  5H6Q A;  3FXO A;  5AIQ A;  4WX9 A;  2XAS A;  1DU0 A;  2CFO A;  4HRI A;  1AKH B;  3JRH A;  4PJN A;  5CVI A;  3X2Q H;  3JRI A;  2CJJ A;  4NBQ A;  5FGM A;  5H2F C;  1T38 A;  1NK2 P;  2JK3 A;  1U9O A;  3TOA A;  4ZZL A;  2L7F P;  3GYH X;  3U2R A;  4R1H A;  2A6H F;  2X6W A;  1UFM A;  3HKZ N;  2IT0 A;  4G94 A;  1JT6 A;  4BNC A;  2CV1 A;  1UB9 A;  3ZMD A;  1W7P B;  4CYD A;  3QYB A;  2VON A;  2JA5 J;  4AVZ A;  3PO2 J;  2AQE A;  1X3W B;  4E7Z A;  2LSO A;  2ELH A;  4CUG A;  1WJC A;  1QVU A;  2LH9 A;  3OSG A;  4HF2 A;  4V19 K;  1EH6 A;  3HGG A;  1A31 A;  2IXS A;  3CZ6 A;  4RB3 C;  2XHK A;  4QPO A;  1O3T A;  4U7D A;  3CLQ A;  2HPI A;  3HSE A;  4E4H A;  2HYJ A;  3OYE A;  4G9Y A;  1MBF A;  2G7U A;  2GA2 A;  1ON2 A;  4BAC A;  4L0Y B;  3TO6 A;  5EGO B;  3WGG A;  3W2W A;  2QA4 I;  3ASN H;  1IRG A;  5TJJ A;  3OYG A;  4R8H A;  3DBL B;  1OLT A;  3IC7 A;  4F55 A;  3K70 C;  1RPW A;  4HQM A;  2LKP A;  3HGY A;  4XRS A;  1RUN A;  1J59 A;  1P9Q C;  1BJA A;  1Y56 A;  4A6D A;  3DP7 A;  5ICC A;  2HQN A;  2KDO A;  1VI0 A;  3R4K A;  3M8J A;  3L1P A;  4ABZ A;  2X1E A;  2XRN A;  3K10 A;  1DU6 A;  3OS2 A;  2LK2 A;  3J81 Z;  2EFP A;  1QPI A;  5C44 J;  3C1D A;  1T39 A;  1LEA A;  2DBB A;  2H6C A;  2LY9 A;  4CCJ A;  5LHH A;  2ISY A;  1X19 A;  3ULQ B;  4XR6 A;  1D3Y A;  3OYF A;  3OYI A;  4IL6 C;  3T5X A;  3ASO H;  3PUB A;  3H0D A;  4HLX A;  4UVB A;  4I0B A;  2E7X A;  3CDH A;  1K6O A;  4PFP A;  5FKM A;  2NVT J;  4A0Z A;  3S3O A;  1KON A;  2YS9 A;  4RM3 A;  3VYR B;  4MTD A;  4BE0 A;  4XKW A;  5D5X B;  2G7H A;  4DBQ A;  2IS4 A;  3MAJ A;  5DD8 A;  4EM0 B;  1VQ4 I;  3H36 A;  5CQG A;  5EF6 A;  5M5W J;  2R7D A;  1POG A;  4XN0 A;  1MBK A;  4ZH4 F;  2X6X A;  4OMZ A;  1UG2 A;  3CMA I;  2V1N A;  3CCR I;  4ZJZ A;  3JCU C;  3ZN1 A;  2FQ4 A;  1UEL B;  2V9K A;  1W0T A;  4I09 A;  5FRN A;  2LRD A;  1Y1W J;  1VQ5 I;  1BIA A;  3JRD A;  1BI2 A;  1Z6R A;  1G3W A;  3KP2 A;  1F4K A;  4GO1 A;  1GXQ A;  5HOD A;  3TMO A;  1WJF A;  2XAF A;  2IS6 A;  3NQO A;  2ZME A;  1X1C A;  3IRR A;  2VQL A;  1FOY A;  3BJ6 A;  2CMP A;  2K86 A;  1TQP A;  2LTP A;  2QWW A;  4HPQ A;  2A6T A;  2RKH A;  5LGN A;  2FSW A;  2BY0 A;  2E1N A;  2GIV A;  3QPT A;  2FBI A;  4NC6 A;  4MTE A;  1YW8 A;  1YS7 A;  4EGZ A;  3J80 Z;  5E1Z B;  4J19 A;  2EIN H;  2L5Q A;  4HW0 A;  4I01 A;  2HXO A;  4UNO A;  5KAI C;  2CQK A;  3SZP A;  2NRA C;  5D4S A;  4FCY A;  1ZRC A;  1BOB A;  2ZB9 A;  2STW A;  2XF6 A;  4YG2 F;  2HDC A;  3GLX A;  4L9J A;  3D5L A;  4HYE A;  2FE3 A;  3AFH A;  3CD6 I;  2V9V A;  3OL4 A;  3I0T A;  3ZP5 A;  4ZTJ A;  1W5T A;  5HVQ C;  1BA5 A;  1LE8 A;  1IDZ A;  2KRH A;  3QOD A;  4KDP A;  4UV8 A;  2PN6 A;  4A5M A;  4RB1 A;  3A02 A;  3T1B A;  2IA1 A;  2X51 A;  4M3G A;  4IHX A;  1KU7 A;  4LIT A;  3FK6 A;  4YRV A;  3VYU B;  2DI3 A;  5DCM A;  3GW2 A;  5L3D A;  1W36 C;  1S7O A;  1RNL A;  4W1U A;  4CDG A;  2P6T A;  4R79 A;  2YR2 A;  2LY1 A;  3J7Z I;  1MMD A;  2NVU B;  3CME I;  1TLH B;  5HDG A;  2DK5 A;  4NQW A;  3GTP J;  3S8P A;  3WTY C;  2Q8K A;  1IG7 A;  3BR6 A;  4L9N A;  2K9M A;  3GO5 A;  3MEX A;  3FM3 A;  4HQE A;  1FIP A;  3GTK J;  2AXL A;  4XSX F;  3AKZ A;  2BW3 A;  4BHP A;  4BXF A;  1FMW A;  3BZK A;  1GT0 C;  4NHJ A;  1SAX A;  4KT6 A;  2Q0O A;  4BBS J;  4YFK F;  1HCR A;  3I5U A;  2WTE A;  2XPU A;  1QO0 D;  4HAM A;  1Y0N A;  4LIU A;  2KFD A;  4BXX J;  3TP3 A;  4P55 A;  3BQZ A;  2QM3 A;  2KQR A;  2QCO A;  4EMS A;  2JTV A;  2KIF A;  2VOD A;  1KGS A;  1BN5 A;  3DKX A;  1K4T A;  4IRH A;  1BJZ A;  4ZYD A;  2LVS A;  2VJI A;  2NS8 A;  5TIS C;  4DOZ A;  5DEQ A;  3KET A;  1ODD A;  2L01 A;  1J75 A;  3GZN B;  1JT0 A;  1U9N A;  2Z3Y A;  3FHN A;  2O7O A;  2HNH A;  2WB1 A;  3OY9 A;  2XSJ C;  2WV0 A;  4ENK A;  1E3O C;  1UCR A;  2A69 F;  2BY1 A;  5M3F J;  1DGW Y;  4B3A A;  3IKT A;  1IUY A;  2ZCW A;  4O6J A;  4AU7 A;  4B47 A;  4GRI A;  1JJ8 C;  2M8G X;  1HLV A;  3TO7 A;  3F9K A;  4G7H F;  4ZC3 A;  1DUX C;  2W1O A;  5GTH C;  5LFA A;  1YI2 I;  1BC8 C;  3MZ8 A;  5F04 A;  3D5S C;  3LSH A;  5HDN A;  1D0Y A;  1ZAR A;  4F3Q A;  3CCV I;  2V6E A;  3KZY A;  1OCO H;  1SFU A;  2HZT A;  4KT5 C;  1UHS A;  1ZG5 A;  1TP4 A;  4EM2 A;  4Y52 J;  3WE3 A;  4NUB A;  4MEY F;  3ZOB A;  4U88 A;  1SD4 A;  4YIF A;  5F0F A;  2MSY A;  5E1X A;  1WRJ A;  5KCM A;  2L9N A;  4AC0 A;  4FIS A;  1IO2 A;  3IUO A;  3DLL F;  1IW7 F;  1XSX A;  2KPM A;  1RIO H;  3WU1 B;  1CF7 B;  2BVM A;  2XGX A;  2NOJ B;  5E3L A;  3OYA A;  5IT9 K;  4PZJ A;  4IQ4 A;  3MN2 A;  5JFR A;  2JT1 A;  2HEO A;  4H4K C;  1Z9C A;  3HRT A;  1WZ2 A;  1D5V A;  1I1G A;  4A6E A;  1UG0 A;  3S17 J;  3A1Y A;  2WA0 A;  4HST A;  3W6J B;  3KEO A;  3S3M A;  4Z2Y A;  3DKY A;  1RZ4 A;  2HYG D;  4EGY A;  1R5G A;  3R0J A;  3C18 A;  2QEN A;  2DN0 A;  3TDU C;  1BC7 C;  1NK3 P;  2W00 A;  3MMY B;  1XB4 A;  4MFD A;  1QZZ A;  1TQI A;  1BR2 A;  2BGC A;  3FKJ A;  2EFQ A;  5KHD A;  4CO8 A;  1U78 A;  1H89 C;  1XDU A;  3H92 A;  3K6G A;  4GXO A;  3BPX A;  3K4N A;  5F0H A;  4FTH A;  1XS9 A;  5BOX A;  4OMY A;  1X3Z B;  3FMS A;  4G6D A;  4JOM A;  1MW7 A;  3K69 A;  4QTR A;  3OYH A;  4LOC A;  5FRM A;  2A68 F;  4BL0 B;  1K4S A;  3V7S A;  2XAH A;  4KYW A;  3V7R A;  1YQA A;  1U3E M;  3LAJ A;  1JUS A;  1PJR A;  2DFF A;  3BRO A;  3W6K B;  4A3F J;  1JHF A;  2EBI A;  3PFI A;  2MD5 A;  4ZDL A;  3HDD A;  2ISZ A;  3BTC A;  2W84 A;  3CCQ I;  4FX4 A;  1H9T A;  1VQL I;  4ZYH A;  3HUG B;  2VKV A;  1YE9 A;  1R9T J;  5A2Q K;  4M9X A;  2Y0S N;  3BC8 A;  1ZQ3 P;  2DOD A;  1HKT A;  4IQJ A;  3BTJ A;  2F5V A;  5DTD A;  1T8I A;  1HA8 A;  3GXO A;  2LOO A;  1N77 A;  4U0V A;  4RLQ A;  1VZ0 A;  2BZT A;  2VQG A;  4I76 A;  3RCO A;  1VQM I;  1XSD A;  1W0U A;  2Y9Z A;  2JSP A;  1FPQ A;  2Q2E B;  3DPL C;  3GEZ A;  4FHT A;  4KN4 X;  1D0Z A;  2WC2 A;  2LY2 A;  4RA2 A;  4ESJ A;  3KLO A;  3Q5F A;  5FLX K;  4BJT A;  2X4H A;  3KFW X;  4DIQ A;  2EIK H;  5J1U A;  3F6V A;  2GXG A;  3O6B B;  5F1J A;  2FA5 A;  5KNL A;  5BPD A;  1Y0U A;  2RQP A;  2BY2 A;  3CES A;  2JA7 J;  1V5G A;  3VPR A;  4E7K A;  1RR7 A;  2K85 A;  2PMH A;  5GAH J;  1KQ9 A;  5CVU A;  3H9Q A;  1XGN A;  3ZMT A;  2R3S A;  1S9H A;  2BY3 A;  3K1M A;  1ZLK A;  1A6I A;  4OAZ A;  5FKO A;  1T33 A;  2CO5 A;  2MGQ A;  4XON A;  1S29 A;  3E6D A;  2COM A;  4Q47 A;  1OYI A;  2P8T A;  3OIQ A;  3C3W A;  2KKO A;  4BUP A;  2DT6 A;  3AL0 B;  1H88 C;  1IXS B;  1TT0 A;  4GCV A;  5DUI A;  2QZ8 A;  2AO9 A;  4KIB A;  3I59 A;  5FD6 A;  3F8B A;  4EJT A;  4PGH A;  4EQQ A;  1SC7 A;  5AON A;  3RQ4 A;  4C2T A;  2LD5 A;  3P9C A;  1BBY A;  3EUH A;  4L9V A;  1AHD P;  3RTR A;  1FBQ A;  2XSD C;  2KIU A;  4UVA A;  4U0Y A;  2QQA A;  2LF7 A;  4UY8 I;  4Q5S F;  3F6O A;  3ONQ A;  2R7U A;  4EJU A;  4UXN A;  1W1W E;  3I55 I;  4KMF A;  3PNT A;  3WTZ A;  2V26 A;  2CW7 A;  2BHY A;  5BQT A;  2OZ6 A;  2VOO A;  2ZME C;  3BY6 A;  4NNJ A;  3CMM A;  5J40 A;  4XNF A;  3IP4 B;  4I99 C;  4OAY A;  1VQ7 I;  2VBZ A;  5DM6 F;  5TRD A;  3MZH A;  4M9S A;  3K4M A;  3E6C C;  3GCM A;  1BOA A;  1F5T A;  1R58 A;  2X1D A;  1ETK A;  1SD5 A;  4C3J J;  3CMY A;  1VF9 A;  3L2V A;  1WHU A;  2V7F A;  4HDU A;  4W97 A;  3LNQ A;  1OYW A;  1B72 B;  1FEX A;  1LJ9 A;  2CQX A;  3R0A A;  3J7A Y;  4Y33 A;  1MH3 A;  2L0K A;  5K5O A;  4A3C J;  1BIB A;  2QKL B;  5FFX A;  2FRH A;  1X58 A;  1MND A;  1P4W A;  3FM5 A;  2LBF A;  3QWL A;  2QF7 A;  2Z99 A;  4KMU X;  2Z2S B;  4A93 J;  1HW2 A;  1ZEL A;  4B8X A;  1E3P A;  2L7Z A;  3H5N A;  2XKP A;  3JR9 A;  2QQ9 A;  3I4P A;  2MG4 A;  3OYL A;  3L2U A;  1QPM A;  4BKX A;  2QKM B;  5DYM A;  1MDM B;  3H35 A;  2EV5 A;  3WTV C;  1Z05 A;  4CXF A;  2FXA A;  1OQY A;  3FHZ A;  3A01 B;  3KP6 A;  2PI0 A;  1XMA A;  1LNW A;  3PM1 A;  4PJL A;  3JAM K;  4DGW B;  3TGN A;  4QIW N;  4LIV A;  3LMM A;  4GGG A;  4RMN A;  4MIM A;  5LLQ A;  2CSO A;  3RZD J;  3SDB A;  2O03 A;  1FYL A;  2QGU A;  2HQ5 A;  1K6Y A;  5EG0 B;  4IJA A;  2R92 J;  4D5C A;  4HX7 A;  2N8G A;  5LHI A;  2V9P A;  2VKH A;  4JX4 A;  3TKY A;  2R7S A;  5M5Y J;  4BQO A;  2CUF A;  2O9L A;  4BS9 A;  1UHM A;  3A4C A;  2EV0 A;  4LG0 B;  5D6F A;  1VFC A;  1QZE A;  4KA4 A;  2IEK A;  2ZJ2 A;  1VTN C;  1V5F A;  2DAO A;  1TZL A;  3SJM A;  1TWC J;  3W3C A;  2EJR A;  2WY7 Q;  3CP2 A;  3BR0 A;  3E6B A;  2VBY A;  5HS9 A;  2Y75 A;  4OIN F;  1WJA A;  1RR8 C;  1YIO A;  3E97 A;  1E3H A;  3FMQ A;  5FLV A;  1Z0X A;  2GOX B;  3F8M A;  1YYV A;  1PUF A;  2D1H A;  2PLY A;  1IRZ A;  4A3K J;  1YFH A;  1RKW A;  2M34 A;  2CGP A;  2MW8 A;  5J4V A;  3QPL A;  2HVR A;  1H9G A;  1XG1 A;  4HX8 A;  4Y15 A;  2YUS A;  3OS0 A;  3QOP A;  2JZY A;  1P6R A;  4ZDP A;  3K0L A;  5GP9 A;  5E3M A;  1WI3 A;  2E60 A;  2VN2 A;  2CV0 A;  2F5D A;  2RAE A;  2O6G E;  3KX2 A;  5ILU A;  3KEQ A;  3RZO J;  2OA4 A;  2VC0 A;  3I54 A;  2QSG X;  3UR3 C;  1FWZ A;  1ZN2 A;  1R00 A;  5JLX A;  1JKO C;  1UST A;  3QU3 A;  2GAU A;  3QU6 A;  3S2H J;  1FY7 A;  2IPQ X;  1IDY A;  1MJ9 A;  3GFL A;  4F93 B;  3EYI A;  2NXN B;  5EJC A;  3Q0V A;  1JKP C;  1R7J A;  1RKT A;  1P92 A;  2A6E F;  4E7I A;  4LGW A;  2RDP A;  2HOT A;  3DPU A;  1FMV A;  1SD6 A;  3K4B A;  2GZW A;  3HKZ A;  1OIS A;  4OOI A;  4PJ0 C;  4UUS A;  3K70 D;  2EH3 A;  1WH7 A;  3ABL H;  4XSZ F;  1XX5 A;  3ERM A;  2H94 A;  3HC7 A;  3Q3S A;  4XL9 A;  2HVQ A;  5ICF A;  4KNY A;  2R93 J;  3K1P A;  2ZSI B;  4RS8 A;  1ETX A;  2D5V A;  3C2B A;  3I53 A;  3OS1 A;  2DMU A;  2ECC A;  2R5Y B;  1GVD A;  4N9H A;  4M72 A;  4CCM A;  5IOZ A;  2RGV A;  3MZY A;  2GWR A;  3HJE A;  1MJA A;  4XRS G;  3ZMZ A;  4ESB A;  1QHH D;  4XLP F;  2WWY A;  4HV5 A;  3SEZ A;  1X1P A;  2DU9 A;  3HM5 A;  1T2K A;  3NWS A;  1MKM A;  2EV6 A;  3FKI J;  3MWM A;  1M1E B;  1A5J A;  3BR5 A;  1O7L A;  1REP C;  2WV1 A;  1EH7 A;  2V1X A;  4IOC F;  1K78 A;  2E1M C;  4IF4 A;  2VE9 A;  3WGH A;  1X2M A;  2F6C A;  1SFX A;  1LVA A;  2OQG A;  2L4M A;  2E71 A;  2DW4 A;  2HQR A;  2V1U A;  3AG3 H;  3BR1 A;  2LFB A;  2YSR A;  4QSH A;  1TC3 C;  1WFX A;  1J09 A;  3CP8 A;  4KIG A;  3DEW A;  5LHG A;  3ABM H;  2L2O A;  1YIT I;  4IEJ A;  1XSV A;  5JR3 A;  3COA C;  2LRE A;  1JXS A;  3BQY A;  2E2J J;  5K5R A;  3CUQ A;  1WJE A;  2K9L A;  2RNJ A;  2JPC A;  3HPG A;  5J8F A;  1WVR A;  3LFU A;  4FT8 A;  2VB6 A;  3GUD A;  1STZ A;  2XDV A;  4NC8 A;  5L3F A;  1QBJ A;  3ISP A;  3MD2 A;  1K7A A;  4D7M A;  3CC4 I;  4A3J J;  1Z1D A;  4M6Y A;  4DNC A;  4I7H A;  2PJP A;  1FOW A;  2P81 A;  2IW5 A;  3W2A A;  1HOM A;  1GDT A;  1J2X A;  3HHH A;  3P7N A;  4XIC A;  4P1W A;  3O8G A;  2E5N A;  4AIK A;  1IN5 A;  4G7O F;  3A03 A;  5KVR A;  1MZB A;  1J9I A;  3DFG A;  3LSG A;  4YII A;  3PQK A;  3OYM A;  5J6X A;  1OCT C;  3CC7 I;  4GFB A;  4Y4R A;  1Z3X A;  5EYR A;  1TWG J;  2WAF A;  4XID A;  1S5L C;  3M9A A;  3FXM A;  3EYY A;  2PEX A;  1MMN A;  3EUH C;  2DA1 A;  1KU3 A;  3KCC A;  2X48 A;  1T56 A;  2CRG A;  2H09 A;  2JUC A;  1XC5 A;  5EEH A;  2OTL I;  1IRX A;  1MBG A;  1XMK A;  2O8X A;  4X0G A;  4IPA A;  2EFW A;  1W36 D;  2CW8 A;  4M73 A;  4J01 A;  3ECH A;  1LQ1 A;  4MEX F;  2AS5 F;  4HSR A;  5JVT A;  3CUO A;  2MC3 A;  3HIF A;  4CCN A;  4RB2 C;  4LB6 B;  4QWQ A;  3K7A J;  2W57 A;  2MH2 A;  1IV6 A;  2VE8 A;  1R36 A;  4Y13 A;  2QUF A;  1AKH A;  1U5T B;  4D1Q A;  4XKB A;  5IP6 A;  1ZRE A;  1FNN A;  1S7A A;  2HGC A;  1LB2 A;  1MH4 A;  4HF1 A;  4DQ2 A;  1OYY A;  4CHU A;  2WAQ N;  4KIF A;  2LG4 A;  2CWE A;  1R49 A;  1Y8R B;  1W7P A;  5GAE J;  5E3O A;  2JRT A;  4EEF G;  4ZTF A;  3ABK H;  1IC8 A;  2M7A A;  3ZRG A;  1UMQ A;  3L2C A;  2Y31 A;  5DV5 A;  3E5Q A;  3FIS A;  1WJ5 A;  2BHZ A;  4JQF A;  3DCF A;  2DOF A;  4A5N A;  4H0E A;  1SFK A;  4WXC A;  3GTJ J;  2M0M A;  1EKE A;  1E17 A;  4OU0 A;  2PJR B;  1V4R A;  3E5X A;  3FBN B;  1D1C A;  4RB0 A;  2VXD A;  2D2W A;  3BZ6 A;  3IWZ A;  2DJI A;  5EGO A;  1B9N A;  4IOA F;  1N78 A;  4BE2 A;  3V8L A;  5E1W A;  3FXR A;  4KN7 X;  3FBI B;  1IXR C;  2LMD A;  1GV5 A;  1WKM A;  2BVL A;  4OWR B;  2QEX I;  2EFO A;  2IJL A;  2J5O A;  2W7N A;  4NB5 A;  1XMX A;  2QVO A;  1ERD A;  4MLO A;  5M3M J;  3DKW A;  2CUZ A;  2L4A A;  4RAZ A;  3G2B A;  2JWT A;  5F64 A;  1MGT A;  1MNE A;  3ERE D;  1RC9 A;  2Q1Z B;  5CJ9 A;  1X3U A;  2VBX A;  2XKO A;  2DXI A;  2JA8 J;  1UZC A;  2EA2 A;  2W82 A;  2ELJ A;  2P5V A;  1ZLJ A;  2DA6 A;  3GBG A;  2O8K A;  4F52 A;  3OR2 C;  2ME0 A;  2UZK A;  2EQR A;  1Y8Q B;  3JRF A;  1VND A;  3BCB A;  5ED4 A;  4BJ6 C;  3J81 K;  4FX0 A;  4BYY A;  2DJN A;  3PFY A;  4PK4 A;  2X9D A;  3S14 J;  3PNY A;  3CCL I;  4WCG A;  3C7J A;  3QPH A;  2KRC A;  2KIQ A;  2DDB A;  5BNG A;  5L3C A;  4CZC A;  3Q9S A;  4Y3O A;  2FOK A;  4S05 A;  2R7W A;  2E34 A;  2KDZ A;  2DFE A;  2HTJ A;  3DEU A;  3VDX A;  1CGP A;  2P7V B;  3S16 J;  1HW5 A;  1BI0 A;  3ELK A;  3L2Q A;  5E3N A;  3SDG A;  2Y69 H;  3V8J A;  2MBF A;  4FQG A;  1D8J A;  3GVA A;  2P5K A;  3RPQ A;  2XC7 A;  6PAX A;  2ZFU A;  3GLL A;  1F9N A;  1XCB A;  3H9J A;  1BR4 A;  5J8C A;  1I5Z A;  3K1N A;  4AYB N;  4GDF A;  3PIO F;  3QYF A;  3ZR8 X;  5CVR A;  5HLT A;  4EJV A;  2VIX A;  4FAS D;  2D1V A;  2F2E A;  1OR7 A;  3ZQI A;  1R6R A;  2KZG A;  3G3Z A;  2XF7 A;  2H1L A;  4RAF A;  1ETO A;  1J7K A;  2LP0 A;  3E5U A;  3BT9 A;  5FB2 A;  1FYM A;  1JTY A;  4YEJ A;  4BQQ A;  5K7F A;  5M5X J;  1LDK B;  1OCR H;  2O5R A;  2DMP A;  5FLX Z;  2ZSH B;  3J80 K;  2EWN A;  2GIZ A;  5DS9 A;  3HEF A;  2QBY B;  1FTT A;  3HHG A;  2E5Z A;  5IY5 H;  2KIM A;  3KZI C;  3GFI A;  3WE2 A;  1BL0 A;  2I5U A;  2M87 A;  2VXZ A;  3M1C A;  3ZQF A;  2B0L A;  1V5E A;  4BBR J;  1K79 A;  1PYV A;  1MSE C;  1X4P A;  1IRF A;  2ETH A;  4M3E A;  2NVQ J;  2DOA A;  2C6Y A;  2NS7 A;  4LG3 A;  3I71 A;  4HNT A;  1ZHF A;  3PL8 A;  2PMU A;  3F21 A;  3HXL A;  2EIJ H;  3AG1 H;  3OIP A;  3B6A A;  2Y0S A;  3ROU A;  2XGC A;  2PMZ A;  1JJ6 C;  2XPW A;  2CUJ A;  3T8R A;  3GTM J;  3F72 A;  2XAQ A;  4E6K G;  1ENH A;  2EZK A;  5KAF C;  2LR8 A;  2ZBK A;  2EZH A;  4BDZ A;  1J0R A;  4D9J A;  4YFN F;  5D6E A;  1YS6 A;  2CV2 A;  1U0J A;  2XV4 S;  4B1R A;  2G9W A;  1D8K A;  4UUT A;  1MMG A;  2JPB A;  2VQC A;  2PX9 A;  5B3S H;  2QSH X;  2ZFW A;  5GAG J;  2ZXW H;  1ZG1 A;  2F5E A;  4C2U A;  2HZD A;  2M9H A;  3BZC A;  2K4B A;  4CCL A;  1GHC A;  4GYG A;  3HYI A;  3FK7 A;  3ZGK A;  1OPC A;  3ZQC A;  1SVO A;  2F5F A;  4PJJ A;  4FE7 A;  2HQA A;  4ESF A;  1KQ0 A;  3TL4 X;  3ZQ7 A;  2LC2 A;  1MBJ A;  4L5I A;  4XLC A;  2WAD A;  1FYK A;  3CJN A;  3C2H A;  4RAG A;  1SMT A;  1SAU A;  1ACI A;  2H8W A;  3RIR A;  1D1A A;  3PSI A;  2PMZ N;  1O3S A;  3GTQ J;  3GWZ A;  3J7Y J;  1W7P D;  3CUQ C;  1D1B A;  3ML6 A;  1IZ1 A;  3FDY A;  3LA2 A;  1YJW I;  1BM9 A;  4G8X A;  1UHW A;  2RQQ A;  4RGU A;  4M3B A;  2JQ7 A;  3CJQ B;  1EF4 A;  4XMY A;  4M6X A;  2CFX A;  4MQV A;  1V54 H;  2FML A;  5LEK A;  3HOT A;  3I3L A;  2NAZ A;  3DU6 A;  3LA3 A;  1PUE E;  1QVT A;  2H1K A;  1Z91 A;  2DA5 A;  5EZH A;  4PUS A;  1IXC A;  1I39 A;  1C0W A;  3WTT C;  2OPT A;  3MKL A;  1B8I B;  3F0C A;  4L5E A;  3NAR A;  4MHG A;  5E20 A;  4ZDO A;  1R1T A;  1KU2 A;  1YTY A;  1ETV A;  4Z6Y A;  4KIC A;  2VJJ A;  2BBY A;  2KP6 A;  3ZMU A;  2X6Y A;  5ILS A;  5HOO A;  3ZQL A;  1ZAO A;  1RI7 A;  2F48 A;  2HKX A;  3GME A;  5DUK A;  1DDN A;  1CF7 A;  1SAN A;  1GV2 A;  4MNU A;  3GZ5 A;  2OZU A;  3KE2 A;  4EVI A;  4ASN A;  4CA0 A;  2DYR H;  3FXJ A;  2KL4 A;  2XRL A;  4IHS A;  2EK5 A;  2EB7 A;  3ZMS A;  1ZR4 A;  3FIW A;  1YRN B;  2IGN A;  3SZG A;  3HOX J;  5F27 A;  1YO5 C;  2A07 F;  2DPU A;  2IGM A;  4ENJ A;  3EUK L;  5FKL A;  2HKO A;  5LGT A;  4OIO F;  3HRM A;  1G3T A;  4IHY A;  1VQP I;  1A04 A;  2ICW G;  2VUM J;  3JAM Z;  4IHW A;  1RES A;  5GTI C;  2HPM A;  3HBL A;  2VPR A;  2W25 A;  1BI3 A;  2OAZ A;  4ZYE A;  5IP7 J;  4RDU A;  3S2D J;  1KU9 A;  2K9N A;  4U87 A;  3E0J B;  2IVM A;  4HNU A;  2CQN A;  2E19 A;  2QSF X;  1QQI A;  3K2Z A;  2KMU A;  3C2G A;  4XK4 A;  2JSC A;  2XUB A;  4CYC B;  2CS3 A;  4G6Q A;  3IHU A;  1XGS A;  4BY1 J;  2OTJ I;  5L3E A;  4A2U A;  3D1N I;  2RRE A;  2RC4 A;  3CJR B;  3HRU A;  4P96 A;  3HUG A;  4V2F A;  5FJ8 J;  2W48 A;  2ID3 A;  2JVH A;  2R7T A;  1VQ8 I;  3U21 A;  3RKQ A;  3IAS 2;  3VWB A;  2UWM A;  1V55 H;  2M5W A;  2WY8 Q;  4DYC A;  3M8E A;  2EA4 A;  4BE1 A;  2Q2E A;  2XB0 X;  2ACJ A;  3TQN A;  2GXB A;  1JUM A;  4TV7 A;  3T0Y A;  1AA7 A;  1A6Q A;  2HWV A;  3MCZ A;  4II2 A;  5L3B A;  3W6V A;  4BEH B;  5IYD J;  4DJA A;  1TWH J;  3HL2 A;  3LQR A;  4U0W A;  2E1C A;  3QYE A;  2HDW A;  4KIT B;  2R5Z B;  2KRF A;  1N75 A;  4XLH A;  1ITY A;  1PVE A;  1OCP A;  2LF8 A;  2DA3 A;  4E7H A;  2QQB A;  3IL2 A;  2CU7 A;  4NDL A;  3QQA A;  4QPQ A;  3RJP A;  2OBP A;  3ZQH A;  4DW6 A;  2MAB A;  1YJ9 I;  2R7R A;  2DO7 A;  4HOB A;  2FNA A;  4HBL A;  5HNH A;  1YIJ I;  2TCT A;  3G4S I;  3V42 A;  4XOP A;  2CW0 F;  3M8F A;  4JYK A;  5K1Y A;  4G12 A; 
#chains in the Genus database with same CATH homology
 1LE8 A;  1IDZ A;  1X2M A;  5EEA A;  3A02 A;  2DMQ A;  3RQI A;  4C2M J;  4M3G A;  3BR1 A;  5J1R A;  1F36 A;  2LFB A;  2LLK A;  4IHX A;  4QSH A;  2OF7 A;  3FK6 A;  3G1M A;  1TC3 C;  3IV5 A;  3DEW A;  2GM4 A;  3H3V K;  5JLW A;  4W1U A;  3TED A;  4IEJ A;  3IH3 A;  4A3I J;  2HI3 A;  3BQY A;  5K7Z A;  3GTP J;  2E2J J;  4M3D A;  1IG7 A;  4BY7 J;  1WCM J;  3BR6 A;  1OJL A;  2NVY J;  1FIP A;  3GTK J;  2JJ7 A;  2K40 A;  1JKR C;  1GT0 C;  2Y9Y A;  4BBS J;  3IH4 A;  1HCR A;  2ME6 A;  5C4X J;  3HOW J;  2XPU A;  4D7M A;  5K7H A;  4A3J J;  4A69 C;  1P7I A;  4BXX J;  3I4M J;  2DMN A;  3TP3 A;  2AHQ A;  2P81 A;  3BQZ A;  1HOM A;  2QCO A;  4FE4 A;  1GDT A;  4A3G J;  4XIC A;  3O8G A;  2NOG A;  2XPV A;  1BJZ A;  3A03 A;  1MNM C;  2LVS A;  2NS8 A;  4JP0 A;  3LSG A;  1B72 A;  1OCT C;  4GFB A;  1K61 A;  5EYR A;  1TWG J;  4XID A;  1JT0 A;  1U9N A;  1HDD C;  2R7Z J;  2O7O A;  1IGN A;  2YU9 J;  3QPS A;  2DA1 A;  1E3O C;  2X48 A;  1T56 A;  2CRG A;  4B3A A;  5M3F J;  3Q0W A;  1JJ8 C;  1WGX A;  2M8G X;  1XC5 A;  1K83 J;  1HLV A;  1MBG A;  1Y1V J;  2E2H J;  5F04 A;  1HF0 A;  1JKQ C;  1IJW C;  1FIA A;  1UHS A;  3CQZ J;  3K7A J;  4Y52 J;  1ZK8 A;  1IV6 A;  3BR2 A;  3PO3 J;  3BG9 A;  3ZOB A;  4MFE A;  1AKH A;  5IP6 A;  2X6O A;  3HB9 A;  5F0F A;  2MSY A;  3CCY A;  2DMT A;  2KT0 A;  3LSR A;  4AC0 A;  1MH4 A;  3A01 A;  1FJL A;  4FIS A;  2R0Q C;  2JA6 J;  4A3D J;  3JRG A;  2DA7 A;  2WAQ N;  4RBO A;  1O4X A;  5E3L A;  9ANT A;  3MN2 A;  5E3O A;  3CDL A;  4EEF G;  1IC8 A;  1UMQ A;  2Y31 A;  3LSP A;  3FIS A;  2JN6 A;  2TRT A;  3DCF A;  1Z77 A;  1B8I A;  3S17 J;  3E7L A;  5EG0 A;  3M3Y J;  3S1Q J;  1RET A;  3TP0 A;  2XGE A;  3M4O J;  3GTJ J;  1PUF B;  3S1M J;  2DN0 A;  1NK3 P;  4MFD A;  5EGO A;  4JX5 A;  1TWA J;  3BTL A;  5C4J J;  1U78 A;  1GV5 A;  1H89 C;  3OOU A;  2JMW A;  5F0H A;  4FTH A;  1BW6 A;  1XS9 A;  3WHC A;  1YRN A;  4QTR A;  2FJ1 A;  2L9R A;  4LOC A;  5GPA A;  2Y2Z A;  4MLO A;  2XGD A;  5M3M J;  3B6C A;  4M6V A;  1JUS A;  4S0H B;  2JWT A;  4DYQ A;  5GPC A;  4A3E J;  4A3F J;  2EBI A;  3HDD A;  3BTC A;  2GBY A;  2JA8 J;  1SFO J;  2VKV A;  1ORK A;  1R9T J;  3JRA A;  5IYC J;  3NAU A;  5IPA A;  2DA6 A;  3GBG A;  2O8K A;  2Y0S N;  1ZQ3 P;  3I4N J;  2DA2 A;  1FTZ A;  3K2A A;  3LSJ A;  2ME0 A;  3BTJ A;  5DTD A;  3BR3 A;  2EQR A;  3JRF A;  1VND A;  3S1N J;  2VI6 A;  4UUS B;  4I76 A;  1W0U A;  2Y9Z A;  3HOU J;  2DJN A;  4CYC A;  2X9D A;  3S14 J;  4A3L J;  2IAI A;  2FD5 A;  5BNG A;  3OSF A;  5J1U A;  3BG3 A;  4A3M J;  4Y7N J;  5F1J A;  3S15 J;  2HXI A;  2LKX A;  1Q1V A;  2KDZ A;  3G1O A;  2JA7 J;  3VPR A;  3S16 J;  1RR7 A;  1I3Q J;  2K9S A;  5EZG A;  4AUX A;  4B4C A;  5E3N A;  3SDG A;  1A6I A;  1MBE A;  5FKO A;  1ETY A;  1T33 A;  2MGQ A;  2XB5 A;  3TW7 A;  5FKK A;  1F43 A;  3UKG A;  1LFB A;  5J3L A;  1H88 C;  2H8R A;  3G1L A;  4AYB N;  1LE8 B;  2AO9 A;  4D7N A;  3O8H A;  2R5Y A;  2R5Z A;  1NTC A;  2M2E A;  2I10 A;  3WHB A;  2COB A;  3ZQI A;  5IYB J;  1MBH A;  1ETO A;  4XRM A;  2LP0 A;  1OFC X;  4D5F A;  2LD5 A;  3BT9 A;  4IHV A;  3JRC A;  1JTY A;  1JUP A;  5K7F A;  5M5X J;  5F0C A;  4A3B J;  1ZTR A;  2DMP A;  3MVP A;  1AHD P;  2XSD C;  1GUU A;  1X2N A;  2EZI A;  3TW6 A;  2HOA A;  5DS9 A;  3HEF A;  1FTT A;  3IH2 A;  2CQQ A;  1ZGW A;  1HDP A;  3GTO J;  1H8A C;  2E1O A;  1G2H A;  1BL0 A;  3ZQF A;  4C3H J;  2CUE A;  4X1E A;  4BBR J;  1MSE C;  1IUF A;  4M3E A;  5J1Y A;  2NVQ J;  2E2I J;  2NS7 A;  3SFI A;  2M0C A;  1ETK A;  4C3J J;  3CMY A;  1VF9 A;  2Y30 A;  3B6A A;  2FX0 A;  2VKE A;  2XGC A;  1JJ6 C;  4W97 A;  2XPW A;  3GTM J;  3LNQ A;  1B72 B;  1P7J A;  3JRB A;  1FEX A;  5FLM J;  4V2G A;  2CQX A;  1ENH A;  2EZL A;  2EZK A;  2LR8 A;  1I50 J;  2EZH A;  1MH3 A;  2L0K A;  4A3C J;  4HNV A;  1X58 A;  1QRY A;  2G0E A;  4B1R A;  3S1R J;  4UUT A;  2QF7 A;  5FKN A;  4A93 J;  1LFU P;  1JGG A;  2NVX J;  2M9H A;  2L7Z A;  1D5Y A;  3FK7 A;  3JR9 A;  3ZQC A;  1JTX A;  4FE7 A;  2MG4 A;  2L7M P;  1DU0 A;  4BKX A;  1MBJ A;  1AKH B;  3OIO A;  3JRH A;  3GTL J;  3JRI A;  2CJJ A;  1NK2 P;  4MO7 A;  2PMZ N;  2B63 J;  3GTQ J;  4DZJ A;  3A01 B;  2JK3 A;  1U9O A;  1ZR2 A;  2L7F P;  1I6H J;  3PM1 A;  1BW5 A;  1AU7 A;  3HKZ N;  4M3B A;  1JT6 A;  3H0G J;  1EF4 A;  4QIW N;  2HDD A;  4X6A J;  4MIM A;  1QVT A;  3RZD J;  2H1K A;  2JA5 J;  2DA5 A;  5EZH A;  3Q0U A;  3PO2 J;  2OPT A;  1APL C;  3HOZ J;  3MKL A;  2ECB A;  2HQ5 A;  1B8I B;  1QVU A;  3F0C A;  4L5E A;  5EG0 B;  3OSG A;  2DTZ A;  3NAR A;  4D5C A;  2R92 J;  3HGG A;  2N8G A;  1ETV A;  4JX4 A;  2HYJ A;  5M5Y J;  3ZQL A;  1MBF A;  3JRE A;  2CUF A;  2O9L A;  1SAN A;  1GV2 A;  5EGO B;  1VFC A;  2GLO A;  2IEK A;  4C3I J;  1TWF J;  4I6Z A;  2XRL A;  3SJM A;  1TWC J;  1RPW A;  1ZR4 A;  3FIW A;  3BR0 A;  2ELK A;  3HGY A;  5IP9 J;  4XRS A;  3HOX J;  1YRN B;  5F27 A;  3ZQG A;  4M3F A;  5FLV A;  1Z0X A;  5FKL A;  1PUF A;  1VI0 A;  4DYR A;  1MSF C;  1IRZ A;  2K9Q A;  3L1P A;  4ABZ A;  5EDN A;  4A3K J;  4IHY A;  1RKW A;  2M34 A;  2VUM J;  2MW8 A;  3BTI A;  3QPL A;  4IHW A;  1DU6 A;  1RES A;  2LK2 A;  1XG1 A;  3HBL A;  2VPR A;  1ETQ A;  5C44 J;  1QPI A;  1ETW A;  4RDU A;  5IP7 J;  3S2D J;  2LY9 A;  2YUS A;  2K9N A;  1WPK A;  5GP9 A;  5E3M A;  1WI3 A;  2E19 A;  2RAE A;  3BG5 A;  2HOS A;  4XK4 A;  3RZO J;  2NVT J;  5FKM A;  4CYC B;  3HOV J;  4BY1 J;  2YS9 A;  5JLX A;  1CQT A;  1JKO C;  3D1N I;  5C3E J;  5EF6 A;  5M5W J;  4JX6 A;  1POG A;  3S2H J;  1MBK A;  1IDY A;  4V2F A;  5FJ8 J;  2W48 A;  3Q0V A;  1UG2 A;  1JKP C;  1RKT A;  2ID3 A;  3HOY J;  2FQ4 A;  2DA4 A;  3RKQ A;  2HOT A;  1W0T A;  3LOC A;  4DYC A;  1Y1W J;  3JRD A;  4UUS A;  2IBD A;  5HOD A;  2EH3 A;  1WH7 A;  2WB1 N;  2XB0 X;  3Q3S A;  2R93 J;  1JUM A;  3W6V A;  1ETX A;  2LTP A;  3C2B A;  2D5V A;  5IYD J;  2ID6 A;  1ZKG A;  1TWH J;  2DMU A;  2ECC A;  2R5Y B;  2R5Z B;  1WH5 A;  1GVD A;  1ITY A;  4DZP A;  1OCP A;  2DA3 A;  5IOZ A;  2CU7 A;  4NDL A;  3QQA A;  4J19 A;  3GTG J;  4XRS G;  3ZQH A;  4DW6 A;  2HXO A;  3HM5 A;  4FCY A;  2ZB9 A;  3FKI J;  2TCT A;  5IOY A;  1U8B A;  1A5J A;  1S7E A;  3BR5 A;  4JYK A;  2WV1 A;  4G12 A;  5F08 A;  1BA5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...