4DYDA

Substrate-directed dual catalysis of dicarbonyl compounds by diketoreductase
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
283
structure length
283
Chain Sequence
b'MTGITNVTVLGTGVLGSQIAFQTAFHGFAVTAYDINTDALDAAKKRFEGLAAVYEKEVAGAADGAAQKALGGIRYSDDLAQAVKDADLVIEAVPESLDLKRDIYTKLGELAPAKTIFATNSSTLLPSDLVGYTGRGDKFLALHFANHVWVNNTAEVMGTTKTDPEVYQQVVEFASAIGMVPIELKKEKAGYVLNSLLVPLLDAAAELLVDGIADPETIDKTWRIGTGAPKGPFEIFDIVGLTTAYNISSVSGPKQREFAAYLKENYIDKGKLGLATGEGFYRY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diketoreductase
publication title Dual catalysis mode for the dicarbonyl reduction catalyzed by diketoreductase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 108
structure length 283
sequence length 283
ec nomenclature
pdb deposition date 2012-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 4dydA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4dydA01
4FW8A 4MOWA 4F6LA 4MP3A 1XCBA 4OGWA 1U8FO 1YS4A 3JQ9A 5CDGA 1I2ZA 1Z75A 1G0OA 3WWZA 2Z1MA 4R1NA 4G5HA 4E31A 2YYYA 3H7AA 4AJKA 2PWZA 2AEJA 1LA2A 4PLCA 4Y6SA 3ZGYA 1ZSNA 2V6MA 1WPQA 2X7HA 2CY0A 3PHHA 2X1HA 1EBUA 1SNYA 1Z82A 4A27A 5JCJD 2IZ0A 1KVTA 3C3XA 5T57A 4XB2A 1A7KA 1ULSA 2BLLA 4RVHA 4J91A 1C14A 3L4BA 3WJ7A 4D42A 4QFCA 3I4CA 3FBTA 1JDJA 3K5PA 4PZDA 3JD1A 3MJEA 5AVOA 3WQQA 4TKLA 4B7CA 2GZ3A 1DC3A 2C0CA 2IRWA 3IMFA 2BGLA 2BGKA 4I1IA 2PLAA 2Q46A 2BH9A 5B12A 1B8PA 1R6DA 2ZK7A 4OH1A 4TZKA 4GX0A 1NQOA 3DMYA 2WD8A 4RL6A 5BSHA 2OORA 2V6FA 4TRRA 1MXHA 3EYWA 4YRDA 1DIAA 5B37A 3IP3A 4YJFB 3GC6A 1PGPA 1Y6JA 3EGOA 3BHMA 1AN9A 1A27A 1F8FA 3GGGA 1NVTA 3HDJA 1R4MB 1PR3A 3WG9A 4CMJA 1T2EA 4BO4A 1GR0A 1FK8A 1HDYA 1ONNA 1LEHA 3MJ4A 4WOJA 3MTGA 4RLSA 5I8ZA 3B20A 4E12A 1IB6A 1LDEA 3SC6A 1HTBA 1U7HA 4UVHA 5ES3A 1G0NA 3D3EA 1PJCA 2DFVA 3O38A 1BXGB 1OOEA 4NH4A 3LDHA 4E4YA 3QSGA 4GSKA 4BL5A 3FWZA 4BO8A 3GEDA 5CDUA 3BMQB 2DBQA 1OI7A 1PQUA 2HRZA 1U2DA 1YQGA 4E5YA 4IY1A 1GQYA 5L4SA 4PCVA 4KUGA 2B4QA 3JQFC 1TI7A 3LLVA 4DGSA 3WLFA 2CMDA 2V65A 3I6IA 3PQFA 2HRBA 3FPLA 2HSDA 4IINA 3QW2A 3CMMA 4CQMB 1A71A 2VYVA 5HBRA 5KJ1A 1E1MA 3SLGA 4BO9A 1ZSVA 2PTGA 3TFOA 4Z9YA 4IDDA 4NHEA 2VZ0A 3E9QA 4INAA 4YAGA 4DPMA 4DRYA 1NHWA 5KTKA 1DC6A 2JAHA 3AUSA 4MVJD 4CUZA 5IAAA 4CR7A 2XF8A 3HN7A 3GEGA 1A4UA 4WOKA 1UP4A 3K30A 4CMAA 4EUHA 4D46A 4R16A 2J8ZA 3GVXA 3KOUA 3PGJA 3HN2A 1YBVA 4WNIA 4BO2A 3ZHXA 1M67A 4BQPA 5JYDA 4IBOA 5EINA 1LLCA 3DHNA 4FPXA 1LDYA 3F46A 1GL3A 1ZEMA 2EWMA 2HAEA 3ETGA 3G49A 2CDBA 3Q2KA 1CQIA 1E0DA 1BG6A 1LQTA 3NAQA 4ZVVA 3WQRA 1YBAA 2NTNA 4ZQGA 4CUKA 2I3GA 2X5KO 3D5TA 1H94A 1UR5A 1ZEJA 3IUSA 3WYEA 1BXZA 4YRAA 1IL0A 2IEDA 1BW9A 3CSDA 4BNWA 1LSJA 4MVJI 3QQPA 4KP7A 4K6FA 1FF9A 4E2WA 2DBRA 1WMBA 3DOOA 4L76A 3ZU2A 1ZK0A 3E1KA 2VT2A 1GAEO 4WLOA 4NMHA 4CMBA 2B37A 2VUUA 3RKRA 3AM5A 3U62A 4QXMA 5F5LA 1H93A 3LYLA 5T64A 5G4KA 3H5NA 4BGVA 4NBVA 3SJUA 4L74A 4GVXA 3V1TC 1Y9EA 1QYDA 3IUPA 2IZ1A 3WGYA 3UGKA 2RH8A 2FR0A 2GR9A 3FNGA 3PRJA 3Q6IA 4GPD1 3AJRA 3NX4A 1T2CA 1OC2A 3GAZA 2VRBA 1YGYA 1C0LA 2DTEA 3EVTA 2UAGA 3D5QA 1LU9A 3NT4A 4Q3BA 2P2SA 3PHGA 3HNPA 1ZW1A 4XYBA 1GZ3A 2VYNA 3AM3A 4I5FA 3VPSA 5J23A 1Y5MA 4WLEA 1RKXA 1QYCA 2PK3A 4BO3A 1T26A 3KXDA 1D7OA 2D2IA 3BAZA 5TT1A 3AFNA 1VKNA 2AW5A 1A9YA 4XQGA 4XYGA 1WAMA 4B4WA 2PV7A 4DREA 3U09A 3E5RA 1O6ZA 1IPFA 3AK4A 1R4NB 2AQIA 1ZVMA 5IFLA 3WWYA 4BGUA 3JQGA 3GVCA 1Q0QA 5HS4A 1E3WA 3B1KA 2O3RA 1ZSYA 2FMUA 4E2YA 3VH1A 5C7OO 1XR3A 1J49A 5THQA 4MVJM 1LBEA 3LK7A 5G0VA 4LVUA 3JQBC 3Q3CA 4FJ2A 2JFHA 3GFBA 1QV7A 5JAZA 1X0XA 4R1SA 5CHEA 5EPOA 2YJZA 2WE8A 3INRA 4XGIA 3H65A 2X0NA 1H2BA 3AI2A 2JKVA 1TB4A 1PGNA 1HE4A 5KWEA 2Y1GA 2O7QA 4XX0A 3GN2A 3GZNA 2EHDA 2FR1A 3I5MA 3KV3O 1PZHA 4XRRA 2ZTVA 4RQUA 1D1TA 3ZV4A 4A2CA 5I9LA 3JQ8A 1DHTA 5JY1A 5IF3A 1TA4A 4HADA 3FHLA 4RVUA 3P19A 3R0IA 1HXHA 4ALLA 4ALNA 2VUTA 2IXAA 1C1DA 5JBIA 1HETA 2D5CA 1HZJA 1SB8A 3QY9A 3ST7A 1EUDA 1RM4A 2UDPA 2X5JO 6LDHA 5JNLA 4WK6A 3LC7O 3EC7A 4NG5A 2FR8A 3RC1A 5L7TA 1ZH8A 4AJOA 2JD2A 3OJOA 3DZFA 1YOVA 2PZMA 3NDRA 3STHA 3ANLA 2VT3A 3PIIA 4JBHA 3AM4A 1PS9A 1NASA 3VH3A 4LVCA 3H3FA 3I9NA 3NJ8A 2PGLA 5MGBA 4OXNA 1CRWG 4W9NA 4ZJUA 2QW8A 3INTA 2IE0A 3IC5A 2W8ZA 5CP8A 4BKOA 2AE2A 1IULA 4UVEA 1G1AA 1IZ9A 3GGOA 3GRPA 1GCOA 3VOSA 1K6IA 1ENOA 1F06A 4KWHA 1RYEA 1Q0LA 2W90A 1UXJA 3RWBA 2EW8A 1Q2XA 1FDVA 3DDNA 4DLLA 1R12A 3CIFA 2HK8A 3JQ9C 5L4LA 3CINA 2CF6A 2AQKA 3JQ7A 1YKFA 4WE3A 4J2HA 1Y81A 4QO8A 4R3WA 3U9LA 1U2GA 4DBVO 4KUHA 2HUNA 3HFGA 3PVZA 4OHUA 2HK7A 5FI3A 1ZMOA 1LRKA 4M89A 2GF2A 2B5WA 1SB9A 4DQUA 3HADA 1V3VA 5ILGA 1KY5A 2P9CA 3U4IA 1VPDA 4HFNA 4TVBA 3RFTA 3U49A 4YT5A 4XKJA 1JKJA 3HJAA 2XAAA 1NFRA 4D43A 4YJHA 3SLKA 1LLQA 3NTRA 2X9GA 1DIBA 1MLDA 4CM1A 4QECA 1T4DA 2AQHA 3L4BC 1OC4A 3FNEA 3VZPA 1JQBA 4CM5A 1ID1A 1LLUA 2GN4A 2X6TA 4FFPA 5HS6A 1J6UA 4AJ2A 4IZHA 1SCUA 3K6JA 1N2SA 1NYTA 4NNJA 5KNLA 3DAFA 4I5DA 3R6DA 4NIMA 1U7TA 1T2FA 1NXQA 3ZU4A 5H81A 5CEJA 3S1LA 2YHIA 4YT4A 2R00C 1M66A 3SXPA 3W8FA 3JYOA 3WMWA 1WDLA 3CH6A 4BKUA 2GN9A 2J6IA 4KQXA 1F8GA 4N54A 4WECA 1FDSA 4JJFA 1GZ4A 4EW6A 4IM7A 4IJUA 4BNJA 3S2EA 5JS6A 4PLHA 5L45A 1BW9B 2GN6A 3BXXA 3UF0A 4BNLA 4JIGA 4EZBA 2QIOA 2NWQA 2G5CA 4KDEA 4ZQBA 4ZRMA 1JAXA 1YJQA 2WYUA 2Y05A 3HSKA 3GVPA 1ZKMA 1C1XB 3DZKA 2BHLA 1E7MA 5U1PA 3ZZNA 5LDGA 3Q11A 4QQRA 4BNYA 1LC0A 1HDXA 3WFJA 5KOIA 5KVVA 2VOEA 3ZI0A 2P68A 3GHYA 3CUKA 3NDJA 1UP7A 4RF5A 2CDAA 3DTTA 2XXJA 4DYVA 3SX2A 2Q1WA 2X5OA 5G0WA 4BO0A 5DCUA 3DBHB 3MJVA 1DPGA 3HHPA 4YPOA 1OZAA 3V1YA 5K6AA 1E3LA 2CSUA 4NBWA 3BHIA 2JFGA 4MIOA 4GX1A 3E03A 3V5NA 5IDXA 3JYQA 1YQDA 1EFLA 2X9VA 3BTUA 3W4KA 3H8VA 3M6IA 3ZWCA 4D44A 4RF2A 1W8DA 3QJ5A 4H16A 5EMHA 5U9CA 4MDHA 1KEUA 2PKQO 3GGPA 2VUSA 3ZH2A 1PJSA 2OZPA 3DZBA 4F45A 1E6EA 4YJGA 4CMEA 2OFPA 5GY7A 3K31A 3WYCA 4CPDA 3Q9NA 3ICPA 4PG5A 4NQZA 4Q3AA 2B5VA 3D3WA 2YFQA 3BMNB 2WJPA 2RBEA 3JQGB 1X7GA 3IP1A 1E6WA 1E3WB 4BHTA 3WBBA 2PH3A 4YAJA 4L9RA 5BSFA 3OM9A 5AXCA 4B4VA 5IDWA 5IDYA 2EF1A 4AJHA 1AUPA 4IJKA 2YV1A 3DZIA 1NBOA 1KVUA 2HO5A 4Q3CA 1GYPA 4YAEA 2HMVA 4B79A 3L6DA 5CG2A 2I76A 3AY7A 4MJLA 3L6OO 2C5EA 1DAPA 1GV0A 3FBGA 4CMKA 1XQ1A 4MVJG 1P3DA 3GVIA 5JAIA 2Z95A 4ONEA 4DXHA 2PKRA 2IDZA 2FHSA 3N58A 3UXYA 1E5LA 1GEEA 3PIDA 4L4RA 3WSVA 1IZ0A 4H7PA 1O9BA 1DBVO 3MWDB 1U3VA 4D41A 4RPKA 4BNVA 3OQBA 2EJVA 2GGSA 3JQ8B 4NDNE 4Y98A 1Y8QA 2DBVO 4EEZA 3RUEA 1HDGO 1EE9A 4M86A 4M87A 1MP0A 1B8UA 3CTVA 1DJQA 2JJYA 2UUPA 4I5GA 2DU8A 1GDHA 2W98A 1C1DB 1SEVA 2B36A 1LDGA 3RU9A 4BNHA 5JMPA 4XDYA 4AL4A 2HDHA 4E5NA 4EJ6A 4R5MA 3KYCA 4YBZA 1MA0A 1GU7A 1WNTA 2NLOA 3OIFA 1B16A 4YR9A 2CF5A 2O3JA 4BNIA 5DCWA 1PS8A 1YOVB 3TZKA 2CDCA 1XHLA 1K6JA 1UH5A 2P4QA 2VHZA 1B8VA 1DFHA 5TS3A 1PTJA 1DEHA 3GNQA 1PWXA 3DAPA 3MJTA 3PDUA 2ZIZA 5A04A 3F1LA 2HCTA 4JP2A 3T4EA 1CF2O 3WGQA 4UUMA 5LCXA 1F0YA 2VTDA 4B8WA 2YHUA 3OICA 4MVJF 4YVFA 1VE9A 4DIOA 4PLYA 5A9SB 3MCVA 4BKQA 2Q2QA 2QHXA 4IDFA 1VSVA 1ENZA 3IOYA 1IOLA 1U8XX 4ZD6A 2NVUA 2X86A 4DWVA 4CR8A 2OHXA 1PJBA 4FC7A 1TVEA 1DXYA 4Q9NA 3T7CA 1EDZA 1PU2A 1NM5A 4E30A 3JQ7B 3QWFA 1MG5A 5JPIA 1ZK2A 3HB5X 3LQFA 3WIDA 3RQSA 3IJPA 3NEPX 2VZ8A 4ZGWA 4J1QA 4WLUA 1GV1A 3D1LA 1DFGA 1H0KA 3ZV3A 4DA9A 5ADHA 3EAGA 4A26A 2IYPA 1IUKA 2Q99A 4RORA 4Y6PA 3HDQA 1DSSG 3OA0A 4PIVA 3ANMA 1S6YA 4EGFA 3VPGA 3OSUA 5DOZA 1BVRA 1ADFA 5T67A 2BD0A 3OEWA 3C1TA 2AEFA 3HFSA 1XYGA 3VHRA 5EESA 1BSVA 1NWHA 4GBJA 3SC4A 2ZQZA 1CQJA 3I9LA 2JHFA 3WDSA 3X2FA 1NWCA 2W2KA 3GPIA 1H9AA 4BNXA 4GMGA 5DF1A 3M1LA 4QSMA 1I3LA 5ENDA 3ASVA 2X23A 3DFZA 2AG8A 2UVDA 3UH1A 4WKGA 5L7YA 3TDKA 4OOFA 4GAEA 5CEFA 4TKMA 2NV6A 1GFSA 2Y1FA 5F1KA 1HE5A 2EKPA 4ALIA 3EZYA 3BZUA 2AA3A 1I3NA 4WEQA 5F1PA 4BVAA 4E5KA 4XD2A 5KIAA 2Q50A 1PZGA 3PLNA 1N92A 4BO7A 2P91A 3GDOA 1ENPA 4BNUA 4W7IA 1V35A 4IXTA 2QQ5A 3GDFA 1ENYA 4NI5A 1Y5RA 2TMGA 4PRLA 3TWOA 4UUOA 2YFHA 3DZHA 4J1SA 3DTYA 2I66A 2EV9A 1FXSA 4N5NA 2E48A 3RIHA 1YB5A 4OIMA 5AXDA 2AQ8A 5F5NA 4HXYA 2X8LA 4BS9A 1YH3A 1ZXBA 3Q9UA 1VKOA 3UN1A 1KBZA 4CR6A 5JC8A 3ENKA 4X54A 4A73A 4DPKA 4D3FA 4E33A 1DDOA 1DJNA 4IJWA 3G0OA 4D3SA 2ZB7A 4CL8A 4D0RA 3JYPA 2IYOA 1Z74A 4YTEA 4BUCA 5C5IA 5JDCA 1YE3A 4U0KA 4BGIA 3M2TA 4IQ0A 1M75A 3PLRA 1KEWA 1XU7A 3DB2A 2EKQA 2ZTLA 3B1JA 1OBFO 4IDEA 4AFNA 5JDIC 3QVOA 2DT5A 3PHLA 5EIOA 2X0JA 8ADHA 1MFZA 3AUTA 2EG9A 2RHRA 5KJCA 1E1KA 4J1NA 1WMAA 1NHGA 2AG5A 5A4DA 3FRJA 2PNFA 3TOZA 2A94A 4GMFA 3GPDG 4TRJA 4GVLA 5A5EA 3DBLA 4PLGA 3OA2A 4HV4A 1QV6A 1BVUA 2VWGA 1XGKA 4ZHSA 1O5IA 1I36A 5DT9A 2BI7A 2HLPA 4BMNA 2E49A 1EK5A 2ZTMA 4E6PA 5DDIP 1TT7A 1WP4A 3RU7A 4BGEA 3NJ4A 3BIOA 3GNTA 4MVJE 3JQAD 1QKIA 3AW9A 2LDXA 4FC6A 4QT0A 3VDRA 3KVOA 4PG7A 3WYBA 4FOSA 5JSFA 1N1GA 1FMCA 1J5PA 1WVGA 5KKCA 1HRDA 2Y99A 3AI1A 1EQUA 2OO5A 4MIYA 2GUGA 3B70A 4MVJP 1P1JA 1O94A 1UJMA 4GQAA 2J3HA 2JL1A 5TX7A 4DMLA 5K6AC 2IODA 3UCFA 2WEKA 3RROA 3WXBA 4CMCA 1NAIA 2LDBA 4KTVE 3LC2O 1Y8QB 4Z3DA 3MOGA 2ZQYA 3FR7A 4KOAA 5KKAA 5IZ4A 3SVTA 1E6UA 1P0CA 3FPCA 5ICSA 4ILKA 4XDZA 1VJ0A 1P33A 4CM4A 3JQEA 3DC2A 5T8KA 4NPCA 1VJTA 4CLOA 2Y0CA 2G0TA 4TRNA 4P4LA 5COBA 3T7EA 4MKXA 3F3SA 1HYGA 4BB6A 1GYQA 3HUDA 3NRCA 2POQX 3GY0A 4OJNA 3WGHA 2GYYA 4AJPA 3GUYA 4I08A 3S55A 4R1UA 2O2SA 2CUKA 3GQVA 3KYBA 2A9FA 2QRJA 4DIFA 4II3A 1LDBA 4FN4A 1H6AA 1ZJZA 1DRVA 4NJMA 3TZQA 4Z9FA 5BR7A 3PEFA 1HZZA 1U3TA 4CV2A 5BSEA 2DBZA 3LU1A 3L0DA 4HFMA 1F17A 1CWUA 5KJFA 3RASA 2NVUB 3K73O 4J90A 3EW7A 3NUGA 2VNAA 3ZHYA 5F1OA 3AUUA 4BNKA 1WXDA 1ISHA 3F4BA 3TFQA 4PZEA 1FJHA 2R6JA 3BTSA 3OJFA 2PR2A 1R66A 1D8AA 2EGHA 4JN6B 5GZ6A 2Q2WA 4Z3KA 3E18A 4UEKA 3ONEA 1UAYA 1KC1A 2VZ9A 3QVWA 3DHEA 1QMGA 1W4ZA 4RV9A 4PG8A 3ZWYA 5DBIA 8LDHA 2HMUA 2WD7A 4KWIA 1C0PA 1M6WA 1ZBQA 1YDEA 3ETEA 3ZWOA 4FSHA 3U3XA 4JROA 4YAKA 3RC7A 4GKBA 1TT5A 4CL3A 1EZ4A 1KIFA 3GFGA 5AXBA 3L6EA 1YB1A 3QWBA 2FN7A 3TJRA 1UXIA 3BA1A 4A5OA 4BO1A 1HYHA 3PJFA 3C1OA 1PQWA 1PZFA 1L7DA 3NGLA 3NTOA 1HT0A 1JN0A 2WE7A 1FDTA 4IXWA 1ADGA 2UYYA 3KETA 3MJCA 3TQHA 4K9DA 4UUNA 5FFFA 4JLWA 2EKLA 4G81A 4P4NA 4G65A 3PJGA 3I52A 3ZU3A 3PYLA 5KJ6A 5IZCA 3H9QA 4GX5A 2HK9A 3ROKA 3ZNPA 4TRMA 5TJHA 1HYEA 3DXFA 5B4TA 3CZRA 3IJRA 3OFSA 3H9GA 2VHVA 4XYEA 2OP1A 1GYRA 3RFXA 3IDSA 5EN4A 3HDHA 4Q3EA 3TRIA 3V2GA 2GN8A 4UREA 4ZQEA 4B3JA 4GGOA 5JCJA 4WCFA 1LDNA 1GQQA 1MUUA 3ZHBA 1DHRA 2EGGA 5FWNA 2HMTA 4U8GA 5A05A 3SBOA 1HF3A 3OP4A 1ZK3A 1LUAA 1Q7CA 1SAYA 1DLIA 1R0KA 2GASA 3MOIA 4QTZA 2NADA 5G0UA 4OKNA 2FP4A 2Q1SA 4AICA 4DQXA 1YL7A 1DRUA 3CTMA 1K0UA 3EUWA 3ROPA 3DMTA 2D1YA 5IG2A 3P2OA 5CPFA 1LSSA 4CM9D 5I9MA 4XJTA 4ZRNA 1T4BA 2FSVA 3I9KA 2OBYA 1AHHA 4WNCA 1H6BA 2IEBA 2QYSA 5IDQA 1XDWA 3Q2IA 1A5ZA 4FCCA 3LT0A 1GUZA 1I32A 2RCYA 3ZWPA 1LRLA 4HWKA 3G1UA 3JQAA 4R3NA 1U3UA 5ICMA 1A72A 4ROSA 3ROMA 2E4AA 3QP9A 4GH5A 3GT0A 3OEYA 2YW9A 4K1LA 5KJEA 3PQDA 4URFA 1L7EA 5A9RA 1F14A 3NGXA 3PPIA 4BKPA 5DNAA 3ZDFA 1ML3A 4TMFA 1MC4A 3ZNQA 1DB3A 2WWRA 4ND2A 3C7DB 1MX3A 1I30A 4P22A 1F12A 5CDTA 4R1TA 5JAMA 5K9ZA 1P9LA 1I5RA 4GI2A 3A06A 4MVJH 5JXWA 3B6ZA 4XIJA 1WWKA 1KEPA 3S2IA 2BFMA 4CQMD 1NP3A 4A7PA 1S7CA 4YACA 3ZWAA 1ZMTA 1V0JA 1NX6A 1U3WA 2WDZA 2H63A 5A3VA 3UOGA 1JWAB 4KUEA 1SBYA 1IHXA 4IDBA 4MVJA 5A06A 1HEUA 3E9NA 5TGDA 1ONPA 3KEOA 1MFPA 4XCVA 3WOHA 5T6BA 4GKVA 2PZKA 3RKUA 4YAIA 3INGA 2WM3A 5IN5A 3ZWNA 1YONA 4BNMA 4D7AA 4LISA 4LMRA 1SZJG 3DO5A 1QORA 1NR7A 2VWQA 5CEEA 1TLTA 3UAGA 2RAFA 3O8QA 3DONA 3F6YA 3U0BA 4JP3A 5EL0A 1CERA 4RPLA 4TZTA 2OXIA 4CM4B 4J9UE 2C5AA 1LQUA 4CLOB 2YQ4A 1M2WA 4II2A 2O3TA 4XRGA 2CVQA 2I6TA 1SMKA 1T25A 2Q4BA 3LT4A 1HKUA 4FDAA 1ISJA 3KO8A 3HZZA 4CLXA 3AI3A 5L53A 4FBGA 3O4RA 9LDBA 4AJ4A 3GMSA 2YQ5A 3EK2A 4XQCA 2JCXA 3H9JA 2PGJA 4J7UA 1ONOA 3V1UA 4AJ1A 1QYXA 1XWFA 2BF7A 4NJMB 5ER6A 4IMPA 1WZEA 4BMVA 3E82A 5TSDA 3WLEA 3WICA 3GG9A 4BNZA 1P1KA 1BTOA 4UUPA 2JCVA 5CPBA 4OQYA 4ALMA 4U7WA 1UZLA 1R16A 4BNGA 1N7GA 4Z6KA 2X9NA 4FS3A 3AUAA 3KYDA 3E48A 4DMMA 4MKZA 3KBOA 4OKIA 1Z7BA 3VKUA 1E7WA 1XLTA 1GEGA 1EQ2A 3JQDA 1PGQA 4CM7A 4CMIA 4D79A 5HM8A 2NQTA 5G4KB 4UVIA 2J3IA 1P1IA 4RF3A 2DPGA 2QRKA 3SEFA 1AXGA 3IKVA 3ZWXA 1X13A 3N7UA 4LCEA 1LTHR 2YDXA 3GAFA 4NK4A 5A9TA 1N8KA 1FDWA 1YDWA 3P7MA 4K6CA 3AU9A 4PLFA 1TT5B 1PEDA 2Q1TA 1ZUD1 2B69A 1SOVA 2HJRA 2P9GA 5I7EA 4FD3A 3VZSA 3IKTA 1FDUA 1MXFA 4PVDA 1HWYA 2OMEA 4YQZA 3LT1A 1Y7TA 1MV8A 4EEXA 3GEMA 1P1FA 4AJLA 4KDFA 2OOSA 4JK3A 4RGBA 1MG0A 1NPTO 2ZCVA 4H3VA 2Q3EA 3I83A 4MINA 3K2EA 1N9GA 4TROA 3P5SA 2Y93A 4ND5A 4YA6A 1X0VA 2VHXA 2NTVA 3MZ0A 1E1LA 1VI2A 5A02A 1QP8A 1VC2A 5JFOA 3AU8A 4PZCA 1ZK4A 4OYRA 4OM8A 2WTBA 3WQSB 2VWHA 3I6QA 2BFPA 4J7CA 2VHWA 2AXQA 3G3EA 3SJ7A 2GLXA 2JCYA 4DL9A 1ZCJA 3W1VA 4NZ9A 2OGUA 4XEHA 3WIEA 4CM9A 1LC3A 4KZPA 3QWAA 4FJ0A 4L4SA 3CKYA 3QRWA 3ROQA 4G2NA 3RUIA 3KUXA 2IXBA 1YWGO 5H82A 2DTXA 2BMAA 4UULA 2VWPA 1I33A 2ZJ1A 4WCFB 2A35A 1E7YA 1Q7BA 1PGJA 5JO9A 3QIVA 4N5LA 3PJDA 5MDHA 3GN1A 1I0ZA 4YEDA 1PJQA 1R4MA 5JW6A 3WBFA 3GK3A 3UFXA 4CV3A 4D0SA 2BRUA 2O2YA 4PLZA 4UVDA 1U4OA 3GZNB 3DEYX 1N1EA 3OQ6A 4ID9A 5COAA 3WTBA 4XWYA 4EUEA 4Z9XA 2PZJA 1UP6A 5DP2A 1V8BA 3FF4A 3HWRA 5AOVA 3QVTA 1PR9A 2P5YA 1NVMB 4ITUA 1BGVA 4GX2A 1MGOA 3A14A 2EW2A 1E92A 3BMQA 4OL9A 1GPDG 1G6KA 1M76A 1A4IA 3A28A 3BTVA 4RLHA 3ULKA 3ADPA 5AQ1A 2W2LD 1JAYA 3VC7A 3WJAA 5CG1A 1I24A 4RPJA 3FTPA 3CEAA 1WDMA 1RJWA 2ZB8A 4RVDA 1SC6A 3LF1A 4NBTA 3JQAB 1WZIA 1I3MA 1V6AA 4R01A 5T5QA 3WSWA 1PWZA 1E3JA 4R5HA 3PZBA 2HMSA 4BNTA 4TSKA 4B7UA 3MEQA 4QO7A 1E7QA 4PFJA 3C85A 4DTIA 1K89A 4R68A 4WLFA 3Q0EA 4KTTE 3TOXA 4ESOA 1D3AA 1GCUA 4WCFC 4EUFA 1QSGA 3OJ0A 3PHIA 1Z7EA 5TC4A 5BSGA 2PD4A 4NK5A 3V8BA 4WGGA 3NV9A 1GD1O 4WJZA 1EDOA 5DOVA 4PRKA 1IYZA 2HKIA 3D7LA 3F4LA 3OBBA 1EBFA 3COSA 2YY7A 3OMLA 3I9MA 1I3KA 4FIZA 4RZHA 4XA8A 3BMOA 5TLSA 4IGFA 1N5DA 4J7XA 2O3QA 4CJXA 3DMTC 4GWKA 2QX7A 5THKA 2Y1CA 2AHRA 3AWDA 3E8XA 4JBIA 3ZN2A 4FOOA 1U5CA 3D4PA 4ALJA 4XB1A 2X22A 3HDYA 1W73A 3QE3A 4F6CA 3VH2A 2EP5A 4YJHB 1JVSA 1WDKA 1XKQA 2X58A 4Y67A 4BMSA 4C7KA 3Q1LA 1K5HA 3DL2A 1ADCA 4D3DA 2I99A 1DC4A 5HRUA 2VCYA 3JQBA 3R1IA 5DBGA 5I7FA 3C1AA 1OMOA 2YZ7A 3H9EO 3ZWBA 1CYDA 3O8QB 3AY6A 4E3ZA 3AOEA 3I23A 2CD9A 4BO6A 4R41A 4LSMA 5JE8A 3K2BA 5C37A 5BNTA 4HKTA 4W9NC 3U4DA 4E2ZA 5IJZA 3K96A 5BNIA 4MPDA 1H6CA 4JX8A 5GMOA 1Y1PA 4ZN6A 1ISGA 1X15A 4PLWA 4BQRA 3ZWVA 4I9NA 1X1TA 1ARZA 3DAGA 3RBZA 2YHIB 3RJ5A 4N18A 3I3OA 2QYTA 3DBRA 1IHYA 1PZEA 3E5MA 2JD1A 4O63O 4RVFA 3ZV6A 3C7AA 1LJ8A 1XQ6A 2NSDA 3LSYA 5JMWA 2O3SA 5CDYA 4J0FA 1P0FA 3PJEA 2P5UA 1WLYA 2I67A 4W4TA 4M8SA 5L4NA 4CLEA 4FFLA 4M49A 4L75A 3TZCA 1DIHA 4R51A 3OETA 4WLNA 4Q39A 3UW3A 1GADO 2UV8A 3PFWO 4AJJA 3RJ9A 3PTZA 1ZFNA 4JJIA 3V2UA 1QR6A 5JLAA 2Y66A 2Y0EA 3D4OA 3K9QO 1JKIA 2VNSA 3LLSA 4CM3A 3IAHA 3QA9A 3KYDB 1X7HA 2GNAA 3IQDB 2R2GA 1HSZA 1NTOA 1I2CA 1B3RA 2V7PA 1KEVA 2J5KA 3O26A 4J9VA 4CMIB 1W0CA 3JTMA 1JKFA 2VYND 4NBUA 4U6QA 3ZU5A 4R4JA 3QVXA 4WLVA 1VRWA 3VDQA 5LDHA 4HP8A 3EZLA 4YQYA 1AHIA 3E9MA 4EDFA 4CQLA 2Y1OA 1I8TA 3TZ6A 3GZ4A 2I65A 1O0SA 2CNBA 1BRMA 4Y6RA 4IDAA 4WASA 3AFMA 1YQXA 3W6UA 2H5LA 1GPJA 4KQWA 4LSWA 3RI3A 5COQA 1C3VA 4FGWA 2J5QA 4Y9DA 1QYVA 2C2YA 5EJ2A 3TSCA 3DOJA 1EE2A 1LRJA 3TN7A 3FNHA 2DUUA 4O59O 4RVSA 2FPGA 2Y67A 4P38A 3PP8A 1ADBA 3WGIA 3FD8A 2FRDA 2Y68A 1C0IA 2PH5A 3JD0A 4UEOA 4YJGB 5BT9A 1N9GB 4NR0A 2EJWA 4HUJA 3RCBA 4F3YA 1L1FA 4OMUA 3L07A 4NU5A 3W4IA 5L9AA 4JCOA 4B3HA 4AG3A 3D3WB 5GZ3A 4E5PA 2CVZA 1P45A 4IZIA 4MKRA 2WSBA 1ZNQO 4BOYA 5L95A 3NYWA 3F47A 2VTEA 3UHAA 4B3IA 2VQ3A 2X4GA 4ZQFA 4Z0TA 5ITWA 3U5TA 1P31A 4I9UA 2AEMA 4Q3DA 3GUCA 3O9ZA 4I5EA 3VPFA 3GH3A 3WTCA 1PIWA 3KLMX 1GUFA 1PJ2A 4CODB 4FJ1A 2ZYGA 2W2LA 3CPSA 4YRBA 2R00A 4B8ZA 3RSHA 2Q49A 2H9IA 4EJ0A 3C8MA 1V9LA 3PWSA 1AXEA 1VM6A 4XR4A 2PA3A 5B1YA 2B83A 5A5FA 5L40A 2Z5LA 2A92A 1RYDA 4EJMA 1AGNA 3W8EA 4FQ8A 2NU8A 2J3KA 7MDHA 2RH4A 4FGSA 1A7AA 1GTMA 2CZCA 5EQFA 3TPCA 2VHYA 1H5QA 1E77A 4QX6A 2JHGA 3PFFA 5A3JA 4HFJA 3GDGA 1EMDA 3K92A 5JYEA 4XYLA 1ZZEA 1P1RA 3QWIA 4IS3A 1RM0A 5BNFA 3H9UA 2TMDA 1H9BA 1MC5A 2YV2A 1VL6A 2JD0A 4J1TA 1BHSA 4OQZA 4IJVA 4OOEA 4CMEC 4IQGA 3KYCB 2G1UA 1I2BA 3DBVO 3OJLA 4PLPA 3ICCA 3IL2A 3UCXA 1GZ6A 3WMXA 3ON5A 2PKQP 1DAOA 1IPEA 4RCVA 1BWSA 5ITVA 1TEHA 3S8MA 4YCAA 1AE1A 2D0IA 1DIRA 2GD1O 2OUIA 1HLDA 2B0JA 2BGMA 3ASUA 3PWZA 4ZA2A 4B4OA 4CM8A 1EFKA 1O8CA 2J3JA 1LX6A 1IY8A 1PL7A 4BKRA 4AJIA 5CFZA 1YJ8A 3O03A 3H2ZA 2OBNA 4FFMA 3IS3A 3QLJA 1HL3A 3D0OA 3S2GA 2I5PO 5FF9A 4BNNA 3W8DA 1DOHA 2C82A 1J0XO 1PQPA 3CZMA 3N74A 3NT5A 4YB8A 1GQ2A 5ENVA 1KY4A 2H6EA 3H3JA 4C7JA 4GGPA 1B0AA 3ITKA 4RPGA 3I4FA 3HQ4O 3QVSA 3BMOB 4CV1A 4K26A 2NNLD 4D45A 4CUJA 1NFFA 4PLVA 5I9NA 4HNGA 3OH8A 3GRKA 3EMKA 4R54A 4HY3A 4I8XA 4QEDA 2F00A 2XOXA 4HFRA 2QRLA 4CLRA 1ZO8A 2YV3A 1V3TA 1KERA 3S2FA 2PFGA 1NQTA 2ZATA 3GG2A 3PWKA 4JJGA 3LF2A 4O6VA 2AE1A 1U4SA 3CMCO 4NFYA 1ISMA 2FOIA 4LN1A 1C1XA 1UXHA 4EI2A 3D64A 1CETA 3L9WA 1DIGA 2DTDA 3P2YA 4I9HA 3VPHA 5JC1A 4BO5A 2Z1NA 4GLOA 4IUYA 3KZVA 5HWSA 2DM6A 2X0RA 6ADHA 3DFUA 1LSUA 4LGVA 4CM6A 1UUFA 1B15A 1KETA 2DKNA 3OIDA 3PGXA 4Z0PA 3L4SO 4ND4A 3LVFO 1SO8A 3GA0A 3H4VA 1YVEI 2W2KB 1HE2A 3FCOA 3DBHA 1DO8A 2G76A 1XELA 4JNKA 3ADOA 4GWGA 4UVGA 2DVMA 3PZRA 3DBRB 2NU7A 3GF4A 2Q1UA 3RUAA 3ZWWA 2HMWA 4J4TA 3G17A 1HDRA 1UDBA 4IS2A 2P9EA 4U5QA 3HB4X 2BFAA 1MB4A 1PJTA 4QUKA 2SCUA 4UEJA 5C3MA 5KVCA 1BDBA 5KVSA 2ZYAA 1Y9AA 5JCXA 4WCDA 1X1EA 1EUZA 2D59A 3L9XA 5HTOA 2GZ1A 3G79A 5G4LA 3BMNA 1EEHA 1SPXA 3VTZA 3D4NA 1JLLA 1RWBA 4QFDA 2RIRA 1UZNA 3ONDA 1YRLA 2O4CA 3RUHA 3TZHA 4A0SA 5IN4A 2WYWA 4MP6A 1JVBA 5FI5A 3C7CB 3WB9A 3PK0A 3GMDA 4A03A 3LZ6A 1CJCA 4DYDA 1Q1NA 3AOEC 5L51A 4XR9A 1EVIA 3JQ6A 1XSEA 4CQLB 1KVQA 2A4KA 3ZV5A 4BV9A 4TQGA 2GO1A 1Z45A 1YBMA 1P74A 3T4XA 1LSOA 2ZB3A 5FEUA 3UICA 1E3SA 3RAJA 2XPCA 1E1NA 4JBGA 1PS0A 1JA9A 1Q0HA 4W99A 2D3TA 3RFVA 3NTQA 2O7SA 5DN9A 1NPDA 3OF2A 3VTFA 1H2HA 1SOWA 3X2EA 1TXGA 2FPPA 3ZW9A 3KEQA 2I3AA 1E3EA 3DOCA 5JAQA 2C7VA 1ZIDA 5U4QA 4XJSA 2B4TO 3PYMA 1EVJA 3JV7A 4XGKA 2ZYDA 3WGGA 3ITDA 4E21A 3H6KA 4MO2A 4EITA 4GL4A 1PL6A 3DBLB 5G0SA 3KSZO 1X14A 4FFNA 3ZHZA 1HDOA 1ORRA 2HQ1A 1NNUA 3JCZA 5TRTA 4LK3A 1JU9A 2NU6A 3RUDA 1B26A 4IMRA 3WFIA 4PG6A 2FY8A 4IIUA 2AMFA 3OECA 4DBZA 3JYLA 3DQPA 5CDSA 4GSLA 1HE3A 4FB5A 5I7VA 5IXSA 1CEQA 4J0EA 3TF5A 2EXXA 3WX0A 2PGDA 4J49A 3VVCA 4IDGA 4BV8A 3OJEA 2DLDA 2D4AA 1YL5A 4AVYA 2PD3A 3DWFA 5A9SA 2OL4A 2GRAA 2Y0DA 4OSOA 3DR3A 2J5RA 3EVNA 2NVWA 3MTJA 1KOLA 4AJEA 4W7HA 1UDCA 3BMCA 3VPXA 1CDOA 3H5RA 3FWNA 2Y1DA 4U0JA 5JDCC 4RJTA 1D1SA 1LDMA 4M1QA 5A03A 1B3BA 1UXGA 5H83A 3FN4A 2H1SA 4O0LA 1PSDA 5GZ1A 5KCZA 1VJ1A 1X7DA 4DC0A 1XA0A 4IQ8A 2ET6A 3LT2A 1JTVA 4L73A 4YYZA 1Y8RA 4Q3NA 1H6DA 4ALKA 4CV0A 3HE3A 3QHAA 4LW8A 1NFQA 4LMPA 4J4BA 2O4UX 2UUOA 2O3UA 3RC9A 1KS9A 1OAAA 1UAGA 1ZK1A 2BKAA 1EK6A 1PX0A 1QYWA 2E82A 4ND3A 3JD2A 1SEPA 4LCJA 5BQFA 3L77A 5DP1A 3UCEA 5G2OA 1DLJA 3RC2A 1JWBB 4P4GA 4CM8B 1J4AA 2BELA 2ZKLA 4M54A 4B4UA 3G1TA 4C4OA 1E5QA 5JO0A 4PLTA 4FR5A 4CLHA 1CIVA 3AY3A 3TL2A 4CLDA 3KHUA 2GERA 1B7GO 5C7LO 3M1AA 3F1KA 4RZIA 3ETDA 2DQ4A 5F21A 2CFCA 4E13A 1P44A 3VZRA 5JDIA 3F5QA 4J4HA 4Y8VA 2FZEA 2CVOA 3V2HA 3PYXA 1R37A 3NT2A 3RUCA 1YO6A 2ZTUA 4OSPA 1T1SA 3FR8A 4YT2A 4CMGA 1DRWA 2GSDA 1PGOA 2P4HX 1C0KA 2VRCD 2WD7B 2DFDA 1DC5A 1KVSA 3QV1A 1NQ5A 1K2WA 4CLRB 5JY6A 4OXKA 3RBXA 3W6ZA 1LLDA 5T8KC 2DC1A 2QZ9A 3H5AA 4O5OA 2C29D 3B1FA 4LRSB 1PL8A 3ABIA 4NFHA 5AXAA 4J16A 2JFFA 3FSRA 5L3ZA 5EERA 4JQCA 2HU2A 4RDHA 3VAZA 4A10A 5L7WA 4B7XA 5TF4A 3KSDO 5TNXA 1U1IA 1I01A 4BIIA 1JW9B 1O95A 1UXKA 1DFIA 1EUCA 4W6ZA 1XG5A 4DQVA 2FSSA 2NM0A 2YUTA 3DZJA 1HDCA 3DZGA 2ILTA 3JQFA 2WYVA 4NU6A 4WPGA 3ONFA 4XIYA 1E7SA 2FPIA 4RDIA 4RPHA 2D5AA 4FFOA 5LC1A 3FNFA 7ADHA 4Z0HO 5IXYA 4MIEA 1YB4A 3ENNA 3MWEB 3F9IA 3JYNA 4LRTB 3W4JA 2B35A 4RF4A 1ZXLA 3E6AA 4WEOA 3WNQA 4JGBA 1EVYA 3PQEA 4L8VA 3QWHA 1UZMA 2PD6A 2NQ8A 2V6BA 1GY8A 1EVZA 5EQDA 2HJSA 3NDIA 4BB5A 1YL6A 2Y1EA 4R69A 4DPLA 2B4RO 4PVCA 3GOHA 1T24A 4YJFA 3IIEA 2PZLA 1K6XA 1GUYA 1OFGA 5KVQA 1UDAA 4TVOA 1U9JA 3GHHA 3A9WA 4WUVA 9LDTA 2C2XA 3OIGA 5ILOA 1I10A 2NU9A 2NACA 2WMDA 2VOJA 4KMSA 3GR6A 1NAHA 1K3TA 2PY6A 1HDZA 4L4XA 1W6UA 1BXGA 3MJSA 5DBFA 1LI4A 1P1HA 3VKVA 3FTNA 1V3UA 1VL8A 4E0BA 4HNHA 4ZQHA 2O23A 3RBVA 4E2XA 4EYEA 5B4VA 1NQAO 3AOGA 2QZZA 2V6GA 3JD3A 5CAEA 1NR1A 1T2DA 1XEAA 5IZCC 1BXKA 2RHCA 3GLQA 2QG4A 3ORFA 3GNSA 4ZU3A 4BNFA 2X0IA 4CQMA 4R9SA 1KC3A 3ANNA 1VSUA 4P8RA 4N7RA 3VVBA 4S1VA 2F1KA 2D8AA 4RVGA 5AYVA 5G0TA 1U28A 2E6UX 3HG7A 4FFRA 5ER9A 5I8WA 3WS7A 3M2PA 3ZCXA 5K0ZA 4JXKA 5B4UA 3BHJA 3JSAA 1QLHA 2IZZA 2EERA 3FI9A 5DZSA 3ZNOA 4IIVA 3U4HA 4XQEA 4NJOA 2GPTA 1ULUA 1P77A 4OXYA 3A1NA 2DUWA 3F5SA 4J3FA 1KYQA 1QXSA 3H2SA 5TQVA 4RQTA 1VLLA 4J2OA 1B14A 2EIHA 1R0LA 4H15A 2VYVD 3I1JA 3UVEA 2C7GA 3UKOA 1U5AA 2I9PA 3RD5A 3U4CA 2EP7A 2JAPA 1YXMA 1PJLA 3GVHA 3EHEA 4HBGA 3PXXA 2NTJA 1NPYA 1B2LA 1WW8A 1Q7GA 2W4QA 4GLLA 3WGZA 4M55A 4PN3A 2BI8A 5TIIA 3BYZA 2FWMX 4MP8A 2C07A 4O1MA 1PJ3A 3JQCA 4YDRA 3UUWA 1LNQA 3KB6A 3BMCB 3ZWMA 1KVRA 3CE6A 2EEZA 4U6SA 5HA5A 1ZJYA 4NFSA 2FZWA 4PG4A 2G17A 3KRTA 3PDJA 2O50A 4OO3A 1PJ4A 1HSOA 4YWJA 4UAGA 3OHSX 1RPNA 4DC1A 4DIBA 4J43A 2ZJ0A 3A4VA 2DAPA 3R3SA 3C24A 1RM3A 1Y8RB 3WGTA 3BTOA 1QRRA 1ISIA 1NVGA 3NKLA 2OP0A 4IDCA 4R9RA 3R3JA 3RVDA 5A1TA 1QLJA 2Q2VA 1T2AA 4TWRA 4E5MA 3KM0A 2ZCUA 4AJNA 2XXBA 5F3RA 1XIVA 1O89A 2ZB4A 4IGEA 5FYDA 1Z6ZA 3LC1O 3TNLA 3VZQA 3WNVA 4F46A 1D4FA 5I7SA 2G82A 2Q4EA 4PGFA 5TJ9A 1R0SA 4J6FA 4N5MA 4L0QA 2O48X 3ZW8A 3DHYA 4ND1A 2VRCA 3PHJA 3RUFA 4XQ9A 3ZNNA 4YXFA 4NBRA 3CXRA 4RO0A 1BDMA 3I9JA 2NUAA 1LXCA 1R15A 3WGOA 1QG6A 1Z73A 2C54A 4HX5A 3I9OA 4OAQA 3KSUA 4W82A 4E32A 1XU9A 2DPHA 4YT8A 2C59A 4XYMA 5DCYA 5C7IO 1R4NA 1E3IA 2YDYA 2E37A 1RM5A 1IE3A 2BFOA 1A9ZA 3KLPX 1HLPA 4CMHA 3TL3A 4DLAA 1VL0A 1T1RA 1M6HA 4XZ3A 2GZ2A 5DULA 4DVJA 4IPTA 2VN8A 4EBFA 3VH4A 2NVBA 3JD4A 3KTDA 3OQ1A 2GDZA 4DUPA 3K8ZA 1ISFA 4XGNA 3EDMA 3WR5A 1N7HA 3PI7A 1E7RA 3EY4A 4S3MA 4DLBA 4K28A 2Q45A 2C20A 1BMDA 5TT0A 4ZICA 4YJDA 2GCGA
chains in the Genus database with same CATH superfamily
5L6MB 4FW8A 4DCSA 4MP3A 5AW3A 1ZCAA 5CDGA 2JAWA 1CQPA 1Z75A 2Z08A 3DNFA 1XROA 4EG3A 2IJGX 4RMJA 3I92A 2YY5A 2YYYA 4G5QA 5FOUA 4HEA6 3H7AA 2OYRA 1FU8A 3JWGA 3TD9A 4LJAA 5KVAA 1LA2A 1E0KA 4OUKX 1GILA 1RPZA 1L7VC 3OZDA 4ZYXA 5EHXA 1VKRA 4G4GA 5MFZA 2V6MA 2X7HA 2CY0A 2QJOA 2PDAA 2Y1XA 1KAMA 2G07A 2ZTHA 3H16A 5JCJD 5FBZA 4AMYA 1E0JA 3EF1A 2JFYA 2W71A 1KVTA 3TOCA 2B7CA 1GT6A 1YVRA 4J91A 3KOYA 2KYRA 5L3QA 4IIBA 3ZXIA 1FBNA 3E22A 3FBTA 3MQ2A 3Q9LA 3K5PA 1F4PA 1KYVA 4PZDA 2Q0HA 2CCKA 3T3GA 4G0QA 4EVSA 4TKLA 4B7CA 4BZZA 3W3AD 2QRHA 1WUJS 1YRQA 3IMFA 2BGLA 4ZYVA 1DBIA 1UADA 3QTTA 3SFZA 4TZKA 1XLTC 1GKIA 1IN4A 5K4GA 1Q3KA 4RL6A 5AVXA 2VJMB 3VPAA 1GFIA 2MMGA 1MXHA 3AJEA 3TINA 3KE9A 2IYFA 3VDXA 4M7OA 4ZMRA 2CEKA 1PGPA 2HCRA 3BHMA 2BPOA 3CNHA 1A27A 3E9EA 3OZBA 3URKA 2XQVA 3GGGA 4ND7A 4PAWA 3HDJA 5BVGB 2IH2A 1U8ZA 5TGZA 2BONA 1R4MB 1U0OC 1EP2B 3LHDA 1T2EA 1PT8A 1FJGB 4BO4A 5AJVB 1HDYA 1U3FA 1LEHA 3QGMA 4QQ8A 3DOEA 3M1YA 3EY9A 2BV3A 4ANFA 3T1TA 2NU9B 1IMOA 3NOXA 4W1PA 1AKYA 1EGVB 4UVHA 2DB3A 4KXYA 3FTCA 1GNSA 2DFVA 2NO7A 1E2PA 4CGYA 1XYYA 1KKMA 3U7IA 1UKEA 3NBUA 2I55A 5IC5A 1DINA 5KHOC 2ZGVA 1PQUA 3WTCA 3KQHA 1U2DA 3P9SA 4E5YA 1EJ6A 1NXXA 5E3HA 5L4SA 2H7CA 3ANSA 1DWQA 4JD5A 2K5UA 1TI7A 1SBCA 4ECAA 5IPFA 2JFOA 3UMSA 3EQ7A 3VPCA 2FUCA 3PQFA 4G09A 2QRGA 3C8ZA 4IG4A 1X8XA 4R2XA 4UTOA 5KYXB 1TZKA 3HJCA 3THWB 1P8AA 3CMMA 3F90A 2NAPA 1QVRA 3DQQA 3ZDDA 4S1NA 4PXSA 2HLNA 3BXOA 5CTAA 5HBRA 3MUEA 3HACA 4ARSA 5FUYA 3KVVA 3KR9A 3ODPA 3GFVA 4S2UA 3TFOA 1EUYA 2VZ0A 3E9QA 5BWOA 2PSJA 5EJ9A 2OWDA 5EJEA 2HTFA 2RK3A 2IWRA 3MMSA 1HFWA 1NQVA 4CR7A 1BOFA 1INLA 1WKBA 2XVMA 3KALA 1E3MA 1QBGA 1JSZA 4WOKA 1BDHA 3E7XA 3N70A 4XLLA 4RD6A 3GRCA 4R16A 3AG6A 4B40A 4RGVA 2P65A 3KQQA 4RLQA 5D51S 3ZHXA 1JFTA 5J4VA 2ERXA 5K8LA 1OXBB 1M67A 2OMKA 2QF7A 1U2ZA 3P9QA 4L0MA 5JYDA 5HPYB 2SNIE 3ND6A 3OLCX 4FPXA 5A3SA 3KOWA 2FCRA 2HAEA 3EIOA 4WESA 6GPBA 1QTRA 3HJBA 3MSXA 5GV8A 3D7SA 5A6SB 1T29A 1XJCA 4MQ4A 1MO5A 1AKNA 2GYWA 4ZOLF 3VYWA 2JW5A 1KO5A 1LQTA 4O4LB 2NTNA 2QD2A 1SCIA 5FTLA 1K08A 3I6MA 1WDTA 1Y4UA 2LUOA 2C57A 1H94A 4DSTA 3E05A 1BXZA 1IL0A 2KLBA 2DFNA 4LXQA 4KLRA 4JP5A 3TSOA 3C97A 3L18A 1OIXA 2AMJA 5AI0A 1MDBA 1P3JA 4MVJI 4JLPA 2D5BA 4OH7A 4E2WA 1FF9A 3TL6A 3A36A 3IB3A 4OA5A 1A8IA 2DBRA 2FRXA 2I1LA 3P9PA 4UNSA 5HW0A 2JLUA 2VT2A 1RRKA 1V9CA 4NMHA 4WLOA 2R6DA 3E0XA 5DCLA 5B7NA 1QP0A 1KQOA 4PHGA 4INZA 4ND8A 1FX0B 3SXUB 4QXMA 3UA3A 1AKRA 2QP9X 4L2IB 3EQ8A 3LYLA 5T64A 3H5NA 4BGVA 1GQRA 3AFIA 4HGYA 5DRTA 4GVXA 4OXRA 3V1TC 1XJ5A 2GHRA 1QYDA 2G40A 1IIBA 1OW3B 2C9MA 3IUPA 4Q4DA 2ONCA 3A6DA 3BOSA 3SZRA 3V6LA 2IVZA 2FR0A 2GR9A 3JVDA 3OUTA 2A9KA 1AKTA 3Q6IA 1ZVQA 3ZE0B 3AJRA 4AF8A 2COUA 4OQLA 1OLXA 4Q3OA 4RZ2A 4OX9Y 1YGYA 5JNRA 1SC3A 4NZMA 1SA0A 1Z8HA 2Q7OE 3BICA 4MRSA 1ZN9A 4TS3A 2XUIA 2BTQB 3OKPA 1IB0A 2AH5A 3CSSA 4DLZA 4KPYA 1EP3B 3A6FA 3NNNA 4D57A 4MQEA 4Q3BA 2P2SA 1OB5A 5FOVA 1TTTA 3FFWA 3AEKA 1GZ3A 3H5LA 1FYDA 4I5FA 3VPSA 1Y5MA 3BE5A 4FYJA 1G55A 5GGXA 1V1RA 2PK3A 4EHIA 3DM5A 1NU6A 3EXIA 1FFCA 3B8HA 1P0QA 4YX9A 2QAGC 1D7OA 2JJ2D 1CBUA 2XWBF 3H9BA 2JRLA 1ZOSA 3ETJA 2PX6A 1VKNA 3AFNA 3N59A 1Y6RA 5KU7A 4XYGA 5TARA 4A16A 3C5EA 2PV7A 3GJ3A 2L42A 4JHXA 3RIXA 3DQZA 3AR5A 3PVCA 1N5OX 2EARA 5AW9A 2WVAA 4P5DA 1ZVMA 4BGUA 2I6XA 2EL7A 2QVXX 3JQGA 2GYUA 5FH9A 2OD9A 4NAVA 1MT0A 2O3RA 3ZK7A 1Z63A 4V03A 4A6PA 2FMUA 5CDUA 4E2YA 1NVEA 1BFDA 1PWHA 4KXUA 1GR1A 1U4NA 1XXHE 1WM1A 4M0EA 1XVTA 2DECA 5T4BA 3AESA 1NZDA 1UCFA 2RD2A 5G0VA 1EFTA 4PZUA 1JDVA 1LF5A 4AMUA 4S12A 4WKNA 3F7NA 2VLIA 2IZ5A 5EUBA 1QV7A 1Q7TA 1N9ZA 1JHYA 5JAZA 4R1SA 2XF2A 3FCYA 1IRIA 2L69A 1BX1A 5CHEA 4RZXA 1A9SA 3V4PB 3D8SA 4IJ6A 3N8KA 3DTVA 3NVDA 1PG5A 4F3RA 3INRA 4R8RA 1H2ZA 3TLXA 3UV7A 2X0NA 2HN9A 1DKNA 1H2BA 1ZI6A 2RHDA 3ZQ6A 1X77A 3BJRA 1RMTA 2FEWB 1HE4A 3RS8A 3MINB 3QXXA 1WMFA 4AP6A 2UZ4A 2OCXA 5HIIA 2EHDA 3A4LA 3W3AA 1R64A 4XRRA 2BLNA 2ZULA 2X1MA 2EFJA 2ODWA 2W6ID 4HJRA 1BX0A 4X1IB 1DHTA 1FTGA 3QUAA 5IF3A 4HADA 4EW1A 4S0XA 5BV8A 1C1YA 5AI4A 3P19A 2BE9A 3DHWC 2XKKA 2RDMA 4HH0A 3R0IA 2XBMA 1T0UA 2IXAA 4ZI2A 1C1DA 5IBQA 2OGZA 2PQ6A 2C9CA 2JS7A 1ILEA 3PR2B 5SY4A 2UDPA 4B33A 1OXXK 4JKYA 3V4OA 3WSTA 4KGZA 5JNLA 2ETVA 4FQ5A 3EC7A 2YRFA 2QL9A 3A2LA 4NG5A 1ZH8A 5AESA 2JD2A 3ZOKA 3DZFA 2PZMA 3DOIA 2LWIA 3STHA 1KAOA 1Z26A 2VT3A 3PIIA 5CM9C 1LCIA 5K51A 4EH1A 4EUSA 3DHVA 2I2BA 3H3FA 5DK6A 1OU4A 1FMTA 2RGXA 4GLJA 4OXNA 4X1KB 1W30A 4HDMA 4F8YA 1FLAA 3JQQA 5CP8A 2P2ZA 2D1TA 3IC5A 3W1EA 2AE2A 3WIUA 4BKOA 1EFAA 1VB3A 3VR0A 2RH5A 3GRPA 3ZVRA 1GCOA 4RK7A 3RK0A 2G7MC 2D3WA 3RSSA 3NORA 2IS4A 3FGPA 3WGVA 1MMFB 5CB8A 1TYAE 2R8EA 2UZAA 1Q2XA 3DDNA 3WGMA 4M1TA 4EO4A 1H4SA 3RSFA 2Y0BA 2NNWB 4QXOA 5GINE 3H05A 3HBAA 1L7RA 2FZCA 1U04A 2WD9A 3SZGA 3N0VA 4DBVO 4WE3A 2GKGA 2X8WA 4QO8A 4R3WA 3RQIA 2CT8A 4KUHA 1U8YA 4KE7A 4L57A 1H85A 1MTOA 1V1MA 1T9HA 3PVZA 4QTYA 2HK7A 4R2LA 2WKWA 3AFHA 3CRRA 3G0GA 4HLNA 5FI3A 2VK8A 3RYTC 4M89A 4Z4EA 2B5WA 4NSNA 3SP1A 3CLUC 1KBQA 4DQUA 1IEWA 3G5TA 2Q3CA 5KBYA 5M04A 1VPDA 1D8TA 1YC2A 4HFNA 3SSNA 3U49A 1VLJA 2W6QA 2Q5HA 2CLIB 3HJAA 4UFOA 4XKJA 2GAIA 1AF4A 1GGNA 1QE3A 1LLQA 1TRKA 4NARA 3SLKA 2ZR0A 1HY3A 4EJSB 2VDMB 2C9ZA 4TSFD 2EWVA 4CM1A 4QECA 1ZINA 4DTCA 4E08A 2QXTA 1OC4A 3NASA 3V7WA 2PJRA 2BFCA 2WYHA 5CCXA 3ESQA 5G02A 4GRIA 3UBMA 1S7GA 2FV8A 4CM5A 4YY3B 4QM7A 3UXEA 3PUYA 1WUHS 2PU7A 4XEUA 5HS6A 5FO0A 4K9PA 1QQ5A 4ZC1A 1SCUA 1D2MA 3KXIA 2OM6A 1P72A 2ZJ6A 4RYDA 3UT5A 4BU1A 4O5AA 3GFFA 1OH6A 3AQIA 4NIMA 1DAEA 2R3SA 3ZU4A 4DRXB 4TXHA 3FCXA 2CFIA 4BYMA 1AV6A 4PIPA 3WIOA 4KJZA 2R5FA 1E2IA 5EP2A 4LDPA 4N4AA 5JSYA 2IPXA 1T1JA 5ESWA 1G6HA 4BKUA 3V48A 2V5UA 4BEJA 5C1IA 3SVZA 1ZGJA 2FX3A 4N54A 5CU7A 5CJ2A 5EWMA 3DUFB 3TGWA 1WZCA 3HCFA 3OT5A 3PXEA 4JITA 1OXKB 2R8PA 4XWWA 4IM7A 4S1PA 3BH6A 3QKSB 3GJQA 4ZGGA 4LY0A 4AO6A 1G2IA 3EZ2A 4BNJA 5JS6A 3DC7A 1VLQA 2QBYB 2R25B 2ZE5A 4RW0A 1BW9B 3L8HA 2GN6A 4BNLA 4O8ZA 4YQEA 4MGHA 3C7KA 5HXAA 4CF4A 2VDUE 3DE3X 1OWMA 5AJXA 3MMXA 2HJ9A 2NWQA 2QIOA 1L4UA 3JWEA 5TVKA 3U13A 4DDWA 5REQA 4ZRMA 3C14C 3E4DA 4QPZA 4CDNA 3WJ2A 5H7XA 3RK1A 3SIWA 4DLVA 1BROA 3GVPA 2PRJA 2YWEA 3KKPA 4KR3A 2BHLA 2FKAA 3PGVA 5LDGA 1N2CB 5KOHB 1RKQA 3N2GA 2B94A 1LC0A 3IE2A 4C0WA 2K7FA 1T13A 1W85B 4KACA 2GWRA 3CZAA 2JJ2A 3GHYA 2RMKA 3IT3A 2EKZA 4RFSA 1AUVA 5BN3A 5KNBA 4F72A 1JEQB 1LPAB 2CDAA 1NDHA 3B7PA 3DTTA 1DARA 4FP9A 3KSBC 2Q1WA 4BO0A 2C4UA 4FHGA 5FWDA 3IHTA 1BMQA 1XK6A 2AZ4A 3D6HA 1L1RA 1RI2A 4FNGA 5K6AA 1K75A 3LBNA 4QVIA 3BX1A 5M2QA 1ADJA 4N9QA 2CSUA 5DH9A 4YAOA 2JFGA 4LF8B 3COJA 1JFLA 4GX1A 4OTZA 2CXPA 3A9RA 5IDXA 2ZU6A 1JRLA 1N6HA 2QL6A 3ZWCA 3W4KA 5THXA 3MXTA 1C2YA 4K6MA 5I3ZA 3QJ5A 4FDTA 4H16A 1EXNA 1MJ5A 1SOMA 3WMGA 4AX8A 4CYMA 4MDHA 5U9CA 4IV5A 1KEUA 2EU8A 4ILEA 2GEFA 5KYYB 4KV7A 2R751 3P0FA 4U9UA 5EERA 4LTDA 4F45A 4YMUA 3DZBA 1PQYA 3CWZA 1E6EA 1Z6XA 3T15A 1AZSC 1JEDA 1UBTS 3JWHA 1Y4ZA 1TQHA 2WC1A 3WLQA 4F85A 4Y2YA 2BSXA 4B3BA 8GPBA 2IA5A 3Q9NA 4CPDA 1XMJA 4H08A 4F2PA 3H87A 1SHJA 3CX6A 4Q3AA 4MHTA 1YVDA 2B5VA 4TKVB 1ORWA 4JV5B 5DW0A 3BMNB 3CNLA 5FBKA 2WFLB 2RBEA 1A7UA 4KITB 2PH3A 4A8JC 5F51A 1MA3A 2Q27A 4B4VA 2EQ5A 1XEFA 3IQEA 1OFVA 5K3FA 1APBA 4JLBA 1UOQA 4LDJA 4IJKA 2JLXA 1NBOA 1U0HC 4PBRA 2C5LA 3OQVA 5KS2A 1EZZA 3KAJA 5CG2A 2I76A 3L6OO 2JKYA 2XMDA 4X6UA 2WIAA 5EPUA 1XQ1A 4MVJG 4RA9A 4B3DA 4ONEA 2VF4X 3IDAA 2IDZA 4ERXA 1KJWA 1EK1A 4OBWA 4PFSA 3GDWA 4FYIA 3UXYA 5ELXA 3BD8A 4ZC8A 1WTAA 1T1GA 4XVUA 4K7JA 3KBBA 1JDNA 2YWCA 1EWYA 2ROQA 1CY1A 3MWDB 1U3VA 4FLFA 1IY0A 4UHFA 2JPDA 5KQRA 1KKUA 3M34A 5ICFA 1XB2A 3PE6A 1Y8QA 2HFKA 5AKLA 4AN0A 4YMHA 1GU0A 1EE9A 4M86A 4BLTA 1MP0A 3DFMA 2HBYA 2CXNA 3AONB 3E0QA 4BZPA 1HI9A 2B36A 2QLFA 1SD1A 4B47A 3COYA 2PKEA 3RU9A 1U7PA 4AYTA 1Z4KA 1XNGA 5K3SA 3H9CA 1EUDB 4H2DA 4ZU1X 3UJNA 4AL4A 2HDHA 4ZANA 3EWSA 3RABA 3AB7A 1GU7A 1WNTA 2ZSAA 4KGXA 4K2HA 3N87A 2O3JA 1F60A 4BNIA 5LZ5A 2CDCA 1ECJA 1K6JA 1CUEA 2VHZA 4JBYA 3LCUA 1NN3A 1B8VA 1DFHA 3HGQA 4TKZA 5TS3A 1PG2A 1R00A 3N6RA 1C9NA 2ISSD 1PTJA 1QO0D 2OPBA 1DEHA 1GP2A 3OFVA 3KKQA 2IWHA 4W5QA 2HH9A 3DAPA 3LL4A 3ZDQA 2WWWA 1FLVA 1U1CA 2NN3C 3KKOA 3ND8A 2EKDA 5HQJA 2C03A 3RWOA 5KYNA 4Z9BA 2VTDA 1TCAA 3OICA 3SEAA 4YVFA 1LNSA 4KAAA 5CYOA 4OLBA 3CWQA 3HMQA 2RKOA 2C2KA 2AMLA 2QW0X 3C6QA 3FKSD 3O9VA 5FLKA 3RV4A 5KTTA 4BKQA 4I50A 4TSFA 4QUGA 4GI7A 2X8JB 1R8XA 4DWVA 3U3OA 1NURA 1Z07A 1PJBA 4FC7A 5J1TB 1TVEA 4QAQA 5E4TA 2P27A 4ZI3A 4XASA 3WKEA 3TRKA 5C4IA 3RADC 4C7OA 1X7ZA 3JQ7B 1NF2A 3UGTA 4QPNA 3L05A 1NRIA 3RQSA 4Z4CA 1PNTA 4OP1A 9ABPA 2FFRA 3CRQA 1H8HD 1JT9A 4OK6A 4WAUA 1GV1A 3D1LA 3ORHA 4GUAA 4HLQB 5H9VA 4BCDA 4EPYA 4OGLA 4DA9A 1ZGCA 1MDFA 2WVGA 3EXG2 3FLEA 2J48A 5IS2A 4KYVA 1IUKA 2Q99A 4KVZA 4Y6PA 2IC5A 2CV0A 3BSSA 1CY7A 3HDQA 1RZRD 1JKJB 4K9LA 4L6CA 1JL3A 2CBZA 3N2IA 3Q8KA 1PJRA 4PIVA 3ANMA 4RV4A 1S6YA 4ENRA 1RC1A 5KU1A 3W06A 3P0JA 4QICA 4Y7DA 4G85A 5DTRA 3PQCA 4B31A 3HXPA 1RWMA 3VPGA 3N28A 4JB8A 5T67A 4GLBA 2BD0A 3UC5A 4CKCA 1EIZA 1YBFA 2HSJA 3K9NA 1NI5A 1TCVA 3THXB 4JUDX 3L8CA 4CGZA 4DSNA 3PSHA 5HEKA 1LBIA 1ZBDA 3PI6A 3OCZA 3D7NA 3L7KA 4TTQA 1CJBA 1CQJA 1KIMA 3SC4A 1IXRC 4Z1MD 5JJCA 1DQSA 2UXBB 5CD9A 5I9IA 3X2FA 1F48A 2W2KA 2Y1WA 1X38A 2H2IA 3I64A 2N1BA 4RKFA 1C8BA 2A5DA 3UYKA 1FP4B 2HMAA 4M0PA 1B0PA 2V3VA 3M1LA 3GA5A 1QHNA 3G2IA 1N9KA 1GNRA 2OAGA 3M81A 4OXIA 3ZVLA 7MHTA 2FLWA 2W2MA 3UMFA 3ER9A 2AG8A 2GD2A 2UVDA 4XWAA 5L7YA 4G5FA 1Q22A 1FVFA 3BWCA 3T7DA 2IS2A 5K0JA 3R8CA 3RYIB 1RXCA 3SQOA 2NV6A 4IHJB 5AOCA 1I1QB 4C4PA 1H0SA 1RQLA 2A57A 1YFZA 1EE1A 2H2FA 1QS0B 3V7FA 1K7SN 2WPDD 2Z5FA 3FYUC 5CX1B 4BVAA 3R9XB 5JJIA 1ZL0A 5KIAA 4B80A 2Q50A 3QA3E 1PZGA 2HIMA 3PLNA 2NVOA 2P91A 2O7RA 1ENPA 5CVUA 1Q0SA 4W7IA 2DEUA 3QFFA 3GDFA 2CLFB 4HPJB 4NI5A 1B73A 1XZAA 1Y5RA 2VP0A 4HQKA 4DLXA 4N3NA 1R6TA 5KTSA 4PRLA 4WQMA 4WBNF 3KV1A 4TTPA 2H85A 4J1SA 3VU3A 4AQDA 2C1EA 4A4DA 1MJGA 1V71A 2R8BA 4N5NA 3G1WA 4P3OA 5LFAA 2E48A 1Z12A 1SVSA 4X66B 4I4TB 4Y2JA 1S0UA 1YB5A 2B61A 5CLGA 2AQ8A 2GFIA 4FGKA 2I33A 3HCRA 5F5NA 2XQIA 3U3MA 5F9FA 3HUTA 1Z5GA 3PGMA 1M1YA 2QR3A 5HQ3A 2YOHA 4CL2A 3BF8A 1E8NA 3WL4A 4D1YA 2TMYA 3IQXA 4A73A 3FAKA 3BVPA 1L8AA 1QQ6A 4O2AA 2QL7A 1DDOA 4F5EA 1W2GA 1DJNA 2COEA 3G5UA 3PE4A 2BCEA 4MV1A 4UD6A 5HGXA 2FMKA 1MTZA 1D2HA 4WFKA 4EA8A 4QLBA 2CDNA 4KPGA 1IDOA 5JSUA 3ZY6A 3SF8A 3PCTA 4B46A 4CIYA 1YE3A 3U1BA 4PWYA 3TS1A 1RYHA 3IUJA 4IQ0A 1MAAA 3N07A 3PUVA 1W5AA 4Y9TA 3VKGA 5HFJA 1I1OA 4ZJPA 1QTQA 5I47A 4IWNA 4LYEA 1QONA 1XX6A 2F90A 4BMYA 4DJAA 2DT5A 3V4VB 3EQZA 8ADHA 2EG9A 4UQPA 2E6KA 1FDIA 4Q9DA 3AHHA 5AKZA 5A4DA 1SC1A 5EFOA 3TOZA 1T0HB 1W35A 2AVNA 4EFKA 3AP2A 1RYYA 4YHHB 4QOFA 3JW8A 4V0RA 1NBIA 3OA2A 1SCBA 1O8BA 3CLHA 4GM1A 4PLGA 1EYZA 1AZTA 3RS2A 1T2VA 4DA0A 1DKQA 2FQWA 3INYA 4Z2AA 5I8PA 3OQJA 2ZRPA 5DT9A 2BI7A 2HLPA 1KJ8A 4BL5A 1XCOA 4LNHA 3CUUA 3T7JA 3V80A 1PFVA 5HF8A 2PEYA 2A7QA 4E6PA 3P8ZA 1A9RA 2CNLA 5DDIP 2O7VA 5A4JA 1WP4A 1QDLB 1ZQ9A 3EXFB 2QUZA 1RXIA 3LBHA 4BGEA 4ZK2A 3NJ4A 2V9PA 2PUWA 4G5SA 4HWOA 3ZE2B 5C51B 1XF1A 1XXHB 1FX1A 2IDMA 4MS1A 1AMNA 1MO6A 1YSCA 4FMDF 1DT5A 3KVOA 1AKEA 4HYTA 4P3NA 3S40A 1I3OA 3OOWA 5JSFA 4HZGA 4C7MA 1J5PA 1WVGA 1I0LA 2Y99A 3OBIA 4RIGA 4RSHA 3RKSA 3TLYA 2VDWA 2OO5A 4P4SA 4MIYA 1HBJA 5IM4F 3ODGA 1F2VA 2JGIA 3B70A 4MVJP 4L9AA 3OZGA 1GKKA 4MA4A 3Q3EA 4Q1VA 2XDYA 5TX7A 5K6AC 1ZH6A 2IODA 2F3TA 3B9PA 3RROA 1J2UA 1KAHA 2ADMA 1AXRA 1YJBA 4WW0A 4WOCA 4P54A 4UDYX 4FUTA 4CMCA 1W5BA 3EBOA 3IVAA 4HD8A 3IKLA 4M1WA 2BEKA 3RHSA 4Z3DA 3MOGA 2ZQYA 2GK3A 1PCXA 3TK1A 3L1UA 5FBVB 2QNBA 1CZRA 3SVTA 1P0CA 2GN1A 3FPCA 5ICSA 3DMRA 1JSXA 1G21A 4G0XA 5CLHA 1T8PA 3NYIA 4RD0A 1GO2A 3BE4A 3FKSA 1H5UA 1LW7A 2Y0CA 3QLVC 1JLSA 4FU0A 1X3SA 3KHKA 4P4LA 3TQTA 4PBTA 5JV5A 3P0RA 5BWMA 4WOPA 1HYGA 2DPMA 5KSYA 1BC5A 4MLPA 4BVLA 4BPBA 2GPAA 2WIFA 5F64A 1I6WA 4ZYTA 3DEHA 3NRCA 2ORED 4AZVA 1QGDA 3WKCA 3R3VA 4D9HA 3GUYA 1JA0A 2QR5A 3Q7QA 2ZR7A 3ITEA 4C01A 2B20A 2EDAA 3EUEA 3KYBA 3EZNA 3NHRA 2J4CA 1ZJZA 2XT9A 3E3LA 3WAKA 1KP9A 2AV6A 3D81A 5B7GA 4UM5A 1U3TA 2LIPA 5CH5A 2HLDD 4Q15A 4GYYA 3QE9Y 1UMCB 1K7FB 1OCEA 4PQGA 5KUTA 1ESMA 4HFMA 2W4MA 4HPWA 1F17A 2M6SA 1CWUA 4NMWA 2XDQB 5KJFA 3RVQA 1D6JA 1WS6A 3AEUB 3DDHA 2NVUB 3EW7A 3CX4A 4I5IA 2D2XA 1M1ZA 3Q3JB 3ZHYA 4GM0A 4E5UA 5KOJB 4MW2A 4C0XA 4BNKA 1N2IA 3F4BA 1ISHA 1NBEA 2OUKA 1T5OA 1VJ5A 1FYVA 1FFXB 1R3DA 2E85A 1R66A 3OKCA 1D8AA 1I80A 5GZ6A 5JWRA 2Q2WA 1NKTA 4ZOLB 3OZFA 1FVXA 1Y3IA 3RTCA 1IOZA 1WVMA 4C3UA 1EJ0A 5EP4A 5DBHX 4Z1MA 4TVKA 3DHEA 4P86A 3ZQ4A 5LQDA 1W1WA 5DBIA 5JOQA 4L8FA 1UPCA 4KWIA 2J3EA 4YI3A 1ZBQA 1YDEA 5J2TF 4G9GA 2ZLBA 3SS9X 3TSZA 4F6RB 2VDNB 2FPWA 2UUBB 1UZAA 1J0CA 1U28C 2QNRA 2VP2A 3W5VA 3AEXA 4RQAA 2ZRHA 4CL3A 1KIFA 1J2RA 3GFGA 4UCQA 3VYRB 3SOPA 4ZCIA 5LSAA 1XYVA 3IIJA 2EQBA 2Y2VA 3QWBA 3JWJA 3G2HA 4MUIA 3BA1A 5CITA 4PYLA 4BO1A 1SKUA 1N5RA 4BX0A 2DETA 3FTFA 1PQWA 4N01A 3NGLA 1L7DA 1T5IA 3D1JA 4R8MA 2R5NA 1VMAA 2B9EA 2WSYB 1KDRA 3N2YA 2C3MA 1PTJC 1JN0A 1RXYA 2YBEA 4HEQA 4HRVA 1B0ZA 4AKHA 4KR0A 4MI6A 2ZBQA 3L02A 3RAEC 1X80B 3KETA 3C3MA 2XB6A 1S89A 1ODTC 3GFQA 4HWSA 4QRDA 5EMKA 3SS7X 3A6PC 2VPXA 4UUNA 4OREX 5FFFA 3WBJA 4V0QA 3CZ5A 3DF7A 1LK0A 3F4KA 2WWIA 4P4NA 4XFDA 3UTCA 1SWWA 3W5UA 3WL3A 3ZU3A 2L0XA 3EGEA 4YCBA 5IZCA 4GX5A 4OJQA 3ZNPA 1QIFA 1XMPA 3DNMA 2P6RA 1J8YF 3GRVA 2AZTA 2CEAA 2JBAB 2M1ZA 5TJHA 2XA1A 4AXBA 1ZD8A 3E1GA 3QE0A 4KYUA 4MRNA 4ZZ3A 4NVRA 3SR4A 4GR4A 1N3LA 3CLSC 2G5GX 4URHA 2VHVA 2REQB 1N57A 2X0DA 3RFXA 2BZSA 3EF3A 1QRUA 1YTUA 5EN4A 1LW6E 3EXAA 4BXOA 2ZW9A 1FW8A 1D9ZA 3Q3HA 3UJ3X 2GN8A 2ATXA 1G42A 2HADA 2GOYA 3HJUA 4GGOA 4ZQEA 2PMEA 2R87A 2ZITA 3HB7A 1G9SA 2C2OA 5KQGA 1J0AA 1T9CA 3F78A 1TYEB 2FHPA 2JGNA 3KELA 2GBFA 3K32A 5JYBA 2NO5A 2J33A 5EIWA 4DYHA 2PXAA 2PT9A 1X1RA 2PHZA 2GASA 4QTZA 1CR1A 2J9FB 2YZKA 1WCXA 3TRJA 3CTMA 1K0UA 3EUWA 1Q1EA 2BEWB 4RHTA 2D1YA 4LF6B 3KU4A 3OIWA 5CPFA 3LNCA 1V7PC 3V34A 1ZRSA 1KYTA 1HTTA 3I42A 1YR2A 2GXQA 1FXUA 1G7RA 4G01B 3I9KA 2CHGA 4HQ6A 6NULA 3ZIUA 1D0SA 1Z8DA 5LXTF 1DCKA 1J07A 3RRJA 4GZ5A 3KSRA 5FAKA 5ALTA 5TQ2A 4Y2TA 1VQ1A 4JBLA 4WNCA 2R1VA 2IEBA 4EY8A 5I4BA 1V4NA 1PJZA 5IX8A 4X62B 2ZIAA 3CN7A 3I12A 3QNMA 1GG8A 4HO1X 3LT0A 3RRNA 1M0SA 1M72A 1XKLA 2C8JA 3VZDA 4Q4LA 2YC2C 4OBEA 3G6KA 4D4MA 3CJRA 1LRLA 2FW8A 3QLUA 3AVTA 2ALJA 2CL5A 2G0AA 3L0CA 4PCAA 5DM60 4DUGD 2IZ6A 2MR6A 2RH9B 4ZO9A 3NMUF 1POXA 1QNLA 3FDZA 3H8SA 1CKEA 1OAKA 1TM3E 4YGYA 4L72A 4HBZA 2JGFA 4Y6LA 4ASUD 5KTRA 4GH5A 1C41A 3GT0A 2YW9A 3PKIA 1S8OA 2O2HA 2ZSJA 3LP6A 3PGA1 4MS3B 1Y4DE 5A9RA 3ZZUA 1CFZA 1ULAA 2JLQA 3ETCA 4JI6B 3C3BA 4BKPA 5JVDA 5DNAA 2YN4A 3UH0A 2DY1A 3R3HA 4QTUB 4TMFA 1C2TA 4MVCA 4P22A 3T3PB 3C7DB 1N5KA 5JAMA 4R1TA 4A36A 1W1IA 5KWSA 1IJFA 3IODA 3KWLA 4A2QA 5D85A 1WJGA 1JEAA 4IRXA 5ESXA 3S2IA 5HHTA 1U81A 3TQFA 5ADUS 3LO5A 1BJTA 5LDDC 2VK1A 2GF9A 3BJMA 4L1KA 2WVHA 3VR4D 3JX9A 5IAEA 1RWVA 2HM7A 3R3UA 5CB0A 2ZTSA 2WICA 1IHXA 1JZTA 2VPWA 4IDBA 4NICA 1HEUA 2QDXA 2DR0A 4EI7A 5A06A 3E9NA 4WVFA 5AD1A 2VATA 3KEOA 1MFPA 1OFTA 1Y1LA 2FUEA 2OHVA 4XCVA 3WOHA 2RCNA 2NG1A 3ICWA 4ZYYA 3AO0B 2PZKA 3DO6A 2XGOA 3HYCA 5AM0A 5E6RA 4TXLA 2GAOA 2W7TA 3CPJB 3LI2A 4L95C 4CG0A 4G4SP 4YMVA 2WJ3A 5IN5A 3CZPA 4LZPA 2NZYA 3RT1A 3NV7A 4BNMA 2A4MA 5ED0A 1TD1A 1O96B 4KMRA 4ZWNA 1QORA 4M9SA 4WVLA 5CEEA 1M2EA 1TLTA 5PGMA 2HIHA 2RAFA 1G20E 3O8QA 3DONA 3NW9A 3F6YA 3U0BA 5EL0A 2HLDA 3MQ4A 4IRUB 2VQEB 4HVCA 2BY4A 2NMVA 1HTWA 3QELA 1Z0FA 5ALIA 4AT1A 4F5YA 4GMDA 1LQUA 4L5JA 1PR5A 1UDWA 2YQ4A 2ZJ3A 4QA9A 5FUQA 2O3TA 3IQHX 1LTKA 1T6YA 1T25A 1DEKA 5E9WA 5LZ7A 1GNLA 4XTCS 1BDIA 3VQTA 2G72A 1IEXA 3V32A 2G8LA 2IU0A 3K70B 2GEDA 3GT3A 3LL7A 3AI3A 4Y6GB 3UKJA 3EFBA 3CNOA 3HTXA 4R1QA 2R8RA 3QMPA 4PS1A 3SYKA 4WMLA 5BSTA 1ONOA 1PKEA 2D13A 3MPUA 2YMLA 4RKWA 2BF7A 3LC0A 5CB4A 5JI3E 1ACMA 4D8TA 4GP9A 3THSA 1KAEA 1URPA 3M49A 4BZWA 4UTPA 3NHJA 4BNZA 3AJDA 3ND5A 1BTOA 2GYVA 3ZBPA 3LQKA 1RCUA 1RD4A 4OQYA 3QXHA 4ALMA 3QYAA 1FTYA 3FRHA 4U7WA 3WWPA 2OO5C 3LHIA 2A1TS 1EK2A 1UZLA 4HAYA 4PYNA 1YT5A 1N7GA 5DB4A 1SK9A 1XI2A 4WKBA 4BEVA 2X9NA 3KDPA 4JJKA 1FS5A 4P3PA 2VJOA 3BFJA 1KGDA 3DA8A 5K3BA 5LMZA 4OKIA 1Q1ZA 4ZV9A 1O0BA 3WXMA 3TMAA 1BAPA 1E7WA 2C98A 3OI7A 4N0DA 1AIPA 3R0QA 4ZYLA 4I4IA 3TIVA 1P19A 4CMIA 5HM8A 1CUVA 2NQTA 2NUPB 4R8SA 2QRKA 2XKBA 3K6RA 1LWNA 4QOJA 3SEFA 1AXGA 1ZN7A 3AKDA 3GUHA 3IBCA 4LCEA 2ZPAA 2QTRA 4V24A 1Y3BE 4NK4A 1ESZA 1GPWB 2B3DA 1KU6A 2FEOA 1FDWA 2JAOA 4EHHA 1ZM2A 2RHWA 3AU9A 4Q6WA 5CK4A 3NDBB 1TT5B 2HPHA 16PKA 2P9GA 5AW4A 5CA0F 4TTVA 1MXFA 1A76A 3DCJA 2AUMA 1YR6A 4YQZA 3R5JA 3V8QA 1X8LA 3GEMA 2GTHA 2CHEA 4JK3A 5JFTA 3GBSA 2J3DA 4JIMA 4RSRA 5JQGA 1P75A 2ZUBA 3F67A 1KP2A 1SUBA 1S4MA 2W6NA 4LZLA 4UBKA 3W5IA 2ZE7A 5IJ0A 2Q3EA 1WX1A 4MINA 3U61B 4HLDA 5JPCA 1FMFA 4H59A 1N9GA 2GN0A 3P5SA 3THYB 1RACA 4LMAA 2ZT6A 3IEMA 4CKEA 2ZSKA 5A02A 4I2NA 2ZU0C 3AU8A 3C48A 4DSOA 3LBFA 2JGDB 4OM8A 5FOXA 1MABA 2QJRA 2GAFA 5I7WA 2VLBA 2WSSD 2JG3A 3MT9A 3HUUA 4J7CA 2ECPA 2WTMA 2P4UA 2X2PA 4KNWA 4OL0A 5J5VA 1OIVA 1QH0A 1YUNA 3OTIA 4XEHA 3S2SA 1JILA 8ATCA 2PYZA 4FS8A 1O6BA 3GCXA 3THOA 5CYFA 3HSYA 2Q7DA 2Y6VA 3ROQA 4G2NA 3PUXA 2IXBA 1KAGA 1ZYUA 4L8GA 3CEHA 4OV6B 2DTXA 1V2GA 4UULA 4WCFB 1KORA 1OT5A 2B7LA 4HEA1 3K1JA 4EKNB 1Q7BA 2V3WA 1U11A 3BGOS 2XAUA 3G2MA 2HYDA 3PJDA 3GJ6A 6REQB 2C2WA 3GN1A 4YEDA 3HJFA 1PJQA 1VTKA 1XZLA 1O87A 2IYVA 3UFXA 1FJXA 3ECSA 5DU2A 1RJEA 1U4OA 4L4ZA 4UNPA 2CCJA 3DEYX 3H86A 4UATA 3RTEA 1UXOA 1BEZA 2PZJA 1IK4A 1CS0A 1UP6A 4JQYA 3FYHA 3H7IA 5DP2A 2HWXA 2GUWA 3X0DA 5A4KA 5AOVA 3V4LA 3FPJA 2DLNA 1QIEA 4ASUA 2D7DA 1HQKA 5GVSA 2ZYRA 2ISQA 1TMYA 2OQIA 1U0JA 1MGOA 2EW2A 3AQ4A 1E92A 3BF7A 2C5GA 3BMQA 4LYAA 4MLDA 4ZEOA 4B2IA 4IWXA 2UVPA 4G4IA 3T95A 1T10A 4IDPA 3W6OA 3H2GA 3MUFA 4V0MA 4QGHA 1IC6A 3QNWA 2FFQA 1JEYA 1KS2A 3MILA 1CYEA 2YIVX 1I24A 2OAP1 3FTPA 1RXEA 2J1LA 3AHEA 4I46A 1YFLA 1P2FA 2ZB8A 3KOZA 4MVWA 1VOTA 3WRYA 5AM3A 5IF9A 4RVDA 2WABA 5LNK6 2YXEA 1AKWA 2W0SA 4NBTA 3O8LA 1D4ZA 1W49A 5T5QA 1L5GB 3VR4A 1ZICA 4DZRA 1E3JA 1Z29A 4KPUA 2HMSA 4IQFA 5E9QA 4DCNA 3PLAE 6CHYA 4TSKA 5HILA 3MEQA 1UM9B 3BWXA 3JARA 3PD7A 4M9RA 4QXAA 3UA4A 4R8LA 4PFJA 4W9RA 5ESDA 3DLCA 1ORHA 4M1OA 4UC0A 4CBVA 4F7WA 1Q0UA 1YZLA 3RH0A 3TOXA 1VSBA 1GCUA 1F2TB 4ZOEA 4EUFA 4J3JA 3MMNA 1CP3A 4IUBS 4FHCA 2OV3A 2PD4A 3GLKA 2ON6A 1DQNA 1GTJ1 1E94E 2IYYA 4Y6QA 4F4UA 1GD1O 3HKBA 1DBSA 2FW6A 2QN2A 3T99A 3VX4A 1DJMA 1CRPA 1P5JA 4N5HX 4E5DA 1NT4A 2BGGA 1EA5A 1O7JA 2YY7A 3A1VA 3I9MA 3LDAA 4FIZA 4EEKA 1HPLA 3ZVNA 1F2UA 4J7XA 1RPTA 1PDOA 2EFCB 4DV0B 3LHSA 5LP1A 4FBLA 4NEHB 3KDAA 3TG8A 4JBIA 1JQLB 3KKEA 3J81A 4HZUB 4UM9B 4DDMA 4L02A 3EFOB 4FOOA 1U5CA 4I66A 3ZN2A 3W5JA 4ZVTA 2NO4A 3LBYA 1ESDA 4WZAB 5DLEA 3RC3A 4YMWA 4LAFA 3HBMA 2OXFA 3QE3A 3VH2A 1ISRA 2EP5A 4D4IA 2HBQA 2CXSA 4EAQA 1GGKA 1ZDMA 4YJHB 2X58A 3BILA 2FWPA 3REGA 13PKA 1TUBB 2I99A 2Z9BA 4P36A 2DXIA 1DC4A 4YRMA 2Q5QA 5CT9A 4YJ3B 5LIPA 5EWLA 5TQ0B 4OQMA 4RY0A 2ZWPA 4BMPB 1QGYA 5HM6A 2VRWA 3DLAA 3UJHA 1DWPA 2FMHA 3I23A 1C30A 1JDPA 1UJNA 4LSMA 4JLDA 3DB1A 3L1IA 2JH3A 3KFVA 1DUVG 3U4DA 2H92A 3F3KA 3MGGA 4TLMB 1GITA 5JSHA 3K96A 3GRRA 1T5HX 4GZ6A 1RZRA 2DUNA 1U0BB 3TDMA 4BFVA 4L50A 3A4MA 4ZN6A 1ZJJA 1TQ8A 1VIMA 2QN7A 4Z86A 1X1TA 3DAGA 3RBZA 5BMOA 2C7RA 1JFFB 4M6WB 2FEAA 3I3OA 4FI3F 1UM8A 2QYTA 3OX1A 3O0TA 1PT5A 5PNTA 1Q44A 3ZD8A 1PZEA 5AVVA 1X1SA 2QV0A 4GBGA 4O63O 1M3SA 2PX3A 3WNBA 1LJ8A 1WETA 2YJ6A