4DYDA

Substrate-directed dual catalysis of dicarbonyl compounds by diketoreductase
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
283
structure length
283
Chain Sequence
MTGITNVTVLGTGVLGSQIAFQTAFHGFAVTAYDINTDALDAAKKRFEGLAAVYEKEVAGAADGAAQKALGGIRYSDDLAQAVKDADLVIEAVPESLDLKRDIYTKLGELAPAKTIFATNSSTLLPSDLVGYTGRGDKFLALHFANHVWVNNTAEVMGTTKTDPEVYQQVVEFASAIGMVPIELKKEKAGYVLNSLLVPLLDAAAELLVDGIADPETIDKTWRIGTGAPKGPFEIFDIVGLTTAYNISSVSGPKQREFAAYLKENYIDKGKLGLATGEGFYRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diketoreductase
publication title Dual catalysis mode for the dicarbonyl reduction catalyzed by diketoreductase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 108
structure length 283
sequence length 283
ec nomenclature
pdb deposition date 2012-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 4dydA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4dydA01
5F3RA 1V8BA 4WCFA 2DQ4A 2A92A 1OC4A 3ASUA 4ITUA 1HDOA 1Q2XA 1ADFA 1UXGA 2PZJA 5JO0A 3LU1A 2P5UA 3VC7A 4TRRA 1XG5A 4CMHA 4L4XA 1WLYA 3GA0A 4IIUA 1NPYA 2C54A 3VTZA 2Q2QA 3BTUA 4XRRA 1NYTA 1ULUA 3ANLA 5IDQA 3NJ4A 4ZQGA 5IN5A 3I9MA 1HLDA 1LEHA 2R00A 3RKUA 5ER9A 3BTSA 4OYRA 4P22A 1E3WA 3DZJA 4CPDA 5AXAA 2BGMA 2A9FA 4WPGA 5U4QA 1X1EA 1N7HA 5LCXA 4EZBA 1R0LA 3JYPA 2Y1FA 3ICCA 2J8ZA 4DC1A 1ONOA 2OMEA 3AW9A 3P2YA 5JMPA 4M8SA 4R1UA 1DHRA 1PJTA 2ZYDA 1ZJYA 3H8VA 4TROA 3TPCA 2GUGA 4OH1A 3AK4A 2E82A 3ETDA 4D7AA 5A04A 5L45A 4BO3A 4KOAA 3HN7A 3AWDA 2B5VA 2EW2A 3PHIA 1PTJA 1E7YA 3HWRA 4RVDA 4HFNA 3JQGA 4Z0HO 1ML3A 5HA5A 1ADBA 3IOYA 4IXWA 4NFHA 2BI8A 4AJPA 3D3WB 4TZKA 3FR7A 3CMMA 7ADHA 2YFQA 3GRKA 4GL4A 1PZHA 4Q3NA 1SOVA 4LMPA 1A27A 1SZJG 2GCGA 4DRYA 1VL0A 3K6JA 4BV9A 1DIHA 3WOHA 4R68A 3EK2A 3JD3A 4ALNA 4CR6A 2J3HA 2NV6A 2ZB4A 4UVIA 1M67A 3HJAA 4CMGA 4BGVA 5EIOA 2B69A 2E4AA 1KC3A 1SBYA 2Z95A 5G0UA 4UAGA 4J4BA 5IDYA 3ZH2A 2P4QA 1O89A 2X5JO 3JSAA 4WLNA 4NJOA 5HRUA 4E21A 4CM8B 2FZWA 3IUSA 3RI3A 4YACA 4ND4A 2V65A 3QSGA 2ZJ1A 1AHIA 4QECA 3PK0A 4Z0PA 1VL8A 1DLJA 1E1KA 1SMKA 3CZMA 1WXDA 3S2EA 4NBUA 3S2FA 4MPDA 4Z9YA 3JQAB 1EUZA 2D2IA 1PJ2A 2P4HX 4W7IA 3GHHA 3JV7A 2EW8A 4RPJA 1ENPA 2XPCA 4JJFA 4ZGWA 2VYND 4NPCA 3EUWA 4EYEA 2Q2WA 3F1KA 3JQDA 2NWQA 4GX5A 1GAEO 1YWGO 2EKQA 1A4IA 2CUKA 3DAGA 3D1LA 3IS3A 5TRTA 3RROA 4E5NA 4YB8A 1PR3A 1NP3A 1XCBA 2FWMX 4FFRA 4NBTA 4IPTA 2VUSA 3O8QB 3PQFA 4TKLA 5IG2A 2GN9A 4IDCA 2GLXA 1B8UA 2NU8A 1T2CA 3MOGA 3UHAA 1YONA 3ZWBA 3WTCA 3PP8A 4BKOA 4OXKA 5JCXA 1GV1A 4BKUA 2DTDA 4J9VA 3V2HA 5AOVA 2PH5A 3AUTA 3GAFA 1AUPA 4JNKA 1NM5A 3MTGA 4RL6A 3ITKA 2O3QA 4BL5A 5KJ1A 3MEQA 5G4LA 3JYQA 1NQOA 1BTOA 3GGPA 3D3EA 3OEYA 2JFGA 2V6MA 3FR8A 4J6FA 4XYMA 3NT5A 1I3MA 1P3DA 3H6KA 4IQ0A 4CLRA 5BNFA 4E4YA 2CDCA 5KJ6A 1XR3A 4B4WA 1Y8QB 2DAPA 4N54A 4Q9NA 1P1KA 9LDBA 4WKGA 1B2LA 3OICA 2VWQA 4LGVA 4FFNA 4L73A 4FBGA 2W2LD 3GFGA 3FNHA 4WCDA 1QYWA 1H6DA 2Y0DA 2ZJ0A 4M55A 2ILTA 1DC4A 3JQ9A 3OA0A 4AJEA 1F12A 1E3JA 4LCEA 1DIRA 1HT0A 1UJMA 4DIOA 4L74A 1PQPA 3GHYA 1R4NB 3AM4A 1BVRA 2YZ7A 5DBFA 3D4PA 3QP9A 3E9NA 3CINA 1ID1A 4CM4B 5EPOA 1EVJA 1GQQA 5F1OA 1HXHA 2C0CA 3PIIA 2J5RA 1E1NA 1KVRA 1WMAA 3AFMA 5FI3A 5I7EA 1ZJZA 3FCOA 3PLNA 5JCJA 4PCVA 2ZTLA 4PG5A 2IZZA 3GN1A 4LMRA 4FSHA 4NNJA 2GASA 4RDHA 3HG7A 3GNSA 1M75A 1LX6A 1R4MA 4HX5A 3GEDA 4M54A 5TSDA 4ZJUA 1LC0A 1M76A 4KTVE 1D3AA 3ENKA 3U62A 1GYQA 3MTJA 3FSRA 2X9NA 3JQCA 4YJGA 3KSZO 1LLQA 2HQ1A 4XJSA 3W1VA 2J5QA 4R41A 4CMKA 4YDRA 3LVFO 4BO8A 2HLPA 4XGIA 2G82A 3B70A 3IUPA 4CLHA 5B4TA 1QYVA 3L9WA 4BOYA 5TNXA 2WSBA 4MIYA 4AICA 2HUNA 4JX8A 2SCUA 3N7UA 2Y1GA 1U28A 3SX2A 1F0YA 3JQ8A 4CL8A 4Q3EA 1EUCA 2G5CA 2VRCA 4R3NA 2PWZA 4ZVVA 3AFNA 4U8GA 4RVHA 3ADPA 4I9HA 2DKNA 5J23A 5JPIA 4WEQA 2OOSA 1ZK0A 3BA1A 2GRAA 3D4NA 1M2WA 3FRJA 1T1SA 5F21A 4INAA 4M86A 2Q99A 2EKPA 3BMQA 3D5QA 1JWAB 3WIDA 5MDHA 4Z3KA 2FPIA 3ONFA 4KZPA 4OIMA 2IE0A 4BMVA 1KBZA 1O5IA 1XLTA 3DDNA 4ZRMA 4FDAA 4NIMA 1NX6A 1OC2A 3HE3A 5DCWA 4DQUA 2DPHA 1XSEA 1PGQA 2BGLA 1B3RA 1U5AA 2VTDA 5JDIC 5TIIA 1HDZA 3T4XA 4A7PA 1DLIA 4RPGA 4L75A 5CP8A 3LT4A 2E49A 2X58A 2CVQA 4RPLA 3VOSA 1KOLA 5FWNA 2A4KA 2CFCA 3RKRA 1PL6A 4LW8A 4ALLA 4XB2A 1YDWA 3ZW9A 4TRMA 2DUWA 1K3TA 3H9JA 2I9PA 4OQYA 2OBYA 2X23A 3ZWYA 3K30A 4TKMA 5CEFA 1HLPA 3K73O 1LSOA 4NH4A 4R01A 3C1TA 2GF2A 3I9KA 3NRCA 4PLGA 3QQPA 3RUDA 2Q4BA 2ZB7A 3GGGA 3BMOA 2B4TO 2UDPA 3FWNA 4I9NA 4WEOA 3U09A 2JCVA 1P45A 2O7QA 1YB4A 3WGOA 3MJVA 3DZHA 1ZMOA 4AJJA 1RM3A 2YV2A 3JTMA 3KSDO 4MJLA 1MP0A 2HO5A 3AM5A 3VZQA 3FPLA 3Q6IA 4MOWA 1GL3A 3MOIA 5DF1A 5AYVA 1QP8A 3ABIA 1DO8A 1V0JA 5FYDA 4E6PA 3MCVA 4N5MA 2O3TA 5A06A 2IXBA 3IIEA 4IM7A 1GUFA 4FN4A 1UXHA 4R4JA 2CVZA 4OOEA 5ES3A 1PU2A 2DUUA 5I7VA 1V9LA 2UUPA 4BO6A 3WFJA 3QIVA 3OQ6A 4OHUA 4WCFB 1KVUA 2PTGA 3RIHA 2P68A 1U7TA 4NI5A 1C1XB 3L4SO 4QXMA 5DCUA 3PHGA 1VE9A 5KTKA 2YY7A 4RF5A 4ZQBA 5G0WA 5T64A 2VWGA 3IP3A 4GMFA 4J9UE 4Z3DA 4BQPA 1QSGA 1I24A 1EVYA 1LDMA 4IDEA 2HK9A 3PGJA 2P9EA 2IZ0A 1LRKA 4R69A 4TQGA 4UUOA 1I5RA 4BO5A 5CEEA 4W6ZA 3WJ7A 4DXHA 3G79A 2VOEA 3TZKA 1I01A 1CF2O 2RHCA 4I5DA 1QV7A 2DM6A 1KY5A 3RUAA 4PLTA 2NADA 1E3WB 3BZUA 1E3IA 4YYZA 3JQEA 3KYCB 2B37A 2O2YA 3FF4A 1X7HA 1ZIDA 5LDHA 4R1NA 3DAFA 4F3YA 2NQTA 4YT2A 3GG2A 3JQFA 1I10A 1PX0A 3SC6A 3Q9NA 1Y9AA 3BMNA 1PJQA 5DP2A 2EF1A 3D4OA 3W4IA 1JKJA 1KEWA 1LRLA 3MWEB 1DC3A 1PZGA 3TZHA 3G1UA 2VHVA 3QVWA 2AQ8A 4D42A 4OAQA 4LN1A 3B1FA 2C7VA 5U9CA 2PFGA 1NAHA 3RU7A 4C7JA 2PR2A 5GMOA 1Y9EA 1HDYA 3JD1A 2Q46A 3ZV6A 4J1SA 5L4LA 1NNUA 3QVOA 4G5HA 3JQGB 1IOLA 3AM3A 3LK7A 3X2EA 3BTOA 4Q3BA 3S8MA 1GPDG 4B79A 5L51A 1ADCA 3QWHA 4OSPA 1LLUA 4ZQFA 4M89A 1KY4A 3K92A 4U6QA 1JVBA 1X7DA 1T2AA 4D3FA 4EEXA 5JYDA 3KRTA 4I1IA 1EQ2A 2PD4A 2HMVA 3TOXA 3CH6A 3DBHA 3ST7A 4EW6A 2I66A 5HS6A 3KO8A 4TZTA 3WYEA 3U49A 4QFCA 3D64A 2QRKA 4YAGA 4AJ1A 4CV0A 1NBOA 4HNGA 4KDFA 2GD1O 1LA2A 1IYZA 2G0TA 1KVTA 3OJLA 1QYDA 3UF0A 1L7DA 3FPCA 1SCUA 4PN3A 1BXGA 2AQIA 2CSUA 3TQHA 1V3TA 1MB4A 1ZH8A 1ZSVA 3W8DA 5A9SA 2P2SA 1Z7BA 4FIZA 4OKNA 3AY7A 3PWSA 4GI2A 3ONDA 2Q4EA 3DMTC 5BT9A 2ZQYA 1U2DA 4GLOA 3HDQA 1DAOA 2CNBA 1XYGA 1ZXLA 5JAMA 1Y1PA 1YOVA 1EZ4A 5KVSA 3K96A 4FGWA 3E82A 4XR4A 4CLXA 3INRA 3ZI0A 2Z1MA 4QX6A 1H6CA 2ZB3A 2AEFA 2O23A 1YVEI 2DT5A 1GADO 3UW3A 1CERA 1ZFNA 4YJHA 3TZ6A 2Q50A 4MP6A 1NPDA 2C29D 3HHPA 1J5PA 2BKAA 4YWJA 1T26A 1U9JA 1PJSA 2BGKA 4IDDA 3PRJA 9LDTA 2Y66A 1W73A 3QV1A 2LDBA 4ILKA 4HFJA 4IMPA 3T4EA 2EHDA 5IDXA 4OQZA 3F46A 4EI2A 3PFFA 5C37A 4IQGA 4A2CA 4J3FA 1EVZA 3BHIA 5A3JA 1GQYA 2DTEA 1VJ1A 4PG4A 1VKNA 4GGOA 4GKBA 2HRZA 3KB6A 4IZHA 3GVIA 2GZ2A 3RBXA 1LDGA 1F8GA 5DZSA 1ORRA 1Z82A 1YGYA 1OMOA 2P5YA 3WSVA 3V8BA 2BFOA 5I9MA 4OMUA 2PKQP 4MKZA 4WLVA 1LU9A 3F4BA 1HYGA 1EVIA 4CLRB 3AOEA 5L7WA 1A9ZA 1ZKMA 3HDHA 4UEOA 4RZHA 2OL4A 4BGIA 4J2OA 2Y99A 1ULSA 2VHZA 4M49A 1ZO8A 4LSMA 4D41A 1T4BA 2XF8A 3RBVA 4BNJA 5CDGA 1IPEA 1WW8A 1E5LA 2Q1SA 1R15A 1HETA 2Q2VA 3PLRA 1GY8A 3GUYA 5F1PA 5BSGA 3QVTA 1DB3A 3KSUA 4XB1A 4DQVA 3VDQA 1VL6A 5T6BA 5EMHA 4J1QA 3SC4A 1W0CA 1Y8RA 2FSVA 1XWFA 3R0IA 2D3TA 3RFVA 3WBFA 3GAZA 1HDCA 3WWZA 5K6AA 4F45A 3IL2A 3H2SA 4MVJE 5DOZA 4R9RA 4ZD6A 3AUAA 3WS7A 4CMCA 4OKIA 1E7SA 1H2BA 5JO9A 1U3UA 5DOVA 5AXCA 3L0DA 4ONEA 2D1YA 1R4MB 4II3A 3ZWPA 5HBRA 1HRDA 3CZRA 1AGNA 2JFFA 3QVXA 1WWKA 2VTEA 4YAIA 2I99A 1RM0A 3FNFA 5AXDA 4YJGB 1W8DA 4XR9A 1UZMA 3DTTA 4IDAA 4A10A 1ZEJA 4E31A 4D3DA 3GZ4A 1I2CA 4HKTA 2O3RA 3I6QA 1NWCA 4J1TA 1QYCA 5JDCA 2AHRA 1C0LA 5JY1A 1PZEA 3E1KA 2C5EA 2WE8A 3K2EA 3OH8A 5A5FA 1O94A 1V3UA 4MKRA 4HV4A 1RM4A 1A5ZA 3JQ8B 4YJDA 3DHNA 4PLYA 1HKUA 1PS9A 1QLJA 2O48X 3H5AA 1B15A 4RV9A 2BHLA 3GPIA 3IQDB 4ND2A 3VZRA 3RUEA 3EDMA 5A9RA 1DHTA 3C7DB 4CR7A 4FFPA 2WTBA 4FFOA 5KIAA 3DOJA 4EUHA 2Q1UA 4CQMB 3BMQB 1LDBA 3ROKA 5EL0A 1H5QA 1PQWA 1P0FA 1WZEA 2RIRA 3GUCA 2UYYA 5EINA 3TF5A 1XHLA 1I3NA 3GR6A 3QWBA 1B16A 4UVDA 4E13A 3HFGA 2JHGA 5TT1A 3Q3CA 3LQFA 1TB4A 1JVSA 3DO5A 2W4QA 5EJ2A 4DREA 4Q3DA 4WCFC 2VYNA 5C3MA 1TT7A 1CDOA 1GUZA 1WMBA 1MFPA 3EY4A 1N7GA 2EV9A 4XQ9A 1N2SA 1HDRA 4AJ4A 1W6UA 1GU7A 1O9BA 3JQ7A 4YAJA 3ZNQA 4GPD1 2DLDA 1DAPA 2G1UA 4BNZA 1EEHA 2H63A 3HADA 1T2DA 4RQUA 1I3LA 2EP7A 1DRUA 5JY6A 3WG9A 4E2YA 2I3AA 5CDUA 3G17A 3CSDA 4AVYA 4JXKA 1YQXA 4U5QA 2R00C 2ZTMA 3PHLA 1NAIA 3WMWA 1YBMA 3SLKA 3ON5A 2QQ5A 1CEQA 3BMOB 4CR8A 3F47A 1MV8A 3MJCA 4I5FA 4ALMA 4CUKA 5IXSA 1AE1A 5JW6A 2PA3A 3JQBA 3ZWAA 3TSCA 4FB5A 2ZKLA 1N9GA 2AA3A 4P4NA 1K0UA 1ISJA 3JYNA 4YAKA 5KVVA 1ADGA 4B7CA 2HKIA 2J5KA 2DVMA 4K6FA 1WDKA 1Y6JA 4D46A 1E3EA 2O3UA 4JGBA 4WECA 5JLAA 4KWHA 3QY9A 2VOJA 2P9CA 3H4VA 3N58A 2X22A 4QFDA 4P38A 4UUPA 3AY3A 1N1EA 3U9LA 1TT5A 4BNVA 3H65A 4HXYA 3ASVA 4ND1A 4IQ8A 4DLBA 1LQTA 2W2LA 4IIVA 2VT2A 4W82A 3ZV5A 4WOJA 3SLGA 3I6IA 1EMDA 2EWMA 3D0OA 4EEZA 4JBIA 4BO4A 2H5LA 3OECA 1CIVA 1QLHA 2EERA 4AG3A 4J7UA 3IP1A 2NM0A 2EGGA 2G76A 2CF6A 1O8CA 3DOOA 4PRLA 5ILGA 3E6AA 5I7FA 4BKQA 3NKLA 1Q0QA 1UP7A 1PWZA 4WOKA 1YRLA 3H9GA 3NUGA 2IYOA 2C82A 1E6WA 3OHSX 4BUCA 1PZFA 2AE2A 4ZQHA 4YRBA 3KXDA 5FFFA 4NK5A 4GLLA 5DBIA 3WNVA 3ROPA 3L4BA 5LDGA 2CY0A 4IS3A 5A4DA 4TWRA 3BMNB 4FOOA 3ZHYA 1VSUA 3R3SA 1MC4A 2GN4A 1VKOA 5U1PA 1F17A 1EUDA 2YJZA 4ND5A 2W90A 3PHHA 3I23A 1E7RA 2AMFA 4YAEA 5IFLA 1TVEA 2DBVO 2IODA 4O0LA 1GZ6A 2FPPA 2YV1A 1DXYA 1E1MA 1YQGA 2ZQZA 3DONA 4NHEA 3RC7A 1MX3A 2IYPA 5JAQA 4J1NA 1LXCA 5TGDA 4NBWA 1SB9A 4KMSA 4XWYA 4U0JA 4DPKA 3KYDB 3Q9UA 4YCAA 2QHXA 5TJHA 2X5OA 3F5SA 3AUUA 4LISA 3DBHB 2RHRA 4LVCA 4JN6B 4BGEA 2BFMA 2FY8A 3JQ6A 3AUSA 4XQCA 4CM9A 2ZTVA 4HFMA 5ITVA 1PR9A 1YH3A 2X86A 4N18A 3ZWXA 1PJ4A 1N1GA 3UCEA 3UCFA 4JIGA 1XQ6A 1ZBQA 2P9GA 1ARZA 1KEVA 2X6TA 1BXGB 4GKVA 4ZU3A 5A9SB 4MVJG 1DFHA 2VHXA 4NBRA 2JCYA 2XAAA 4KQXA 4Y6SA 3GLQA 2OUIA 4IZIA 1JDJA 4XDYA 4E12A 1J6UA 5B37A 3WXBA 4DA9A 4O1MA 3B1JA 3CXRA 1B8PA 1X1TA 4W9NA 1FDSA 1YOVB 2EIHA 2JAPA 4XGNA 2NU6A 4GX0A 1JQBA 5L3ZA 3H3FA 2OBNA 1XA0A 4ID9A 3MJ4A 3U4DA 3L6DA 3WB9A 3VVBA 5IDWA 3QHAA 3WGZA 3JQ9C 5DULA 5JNLA 3DHYA 1HE3A 3OFSA 1ISMA 4YJHB 4CMIB 4BQRA 2VZ0A 3GMSA 1N5DA 2QZZA 1UZLA 1DBVO 2D0IA 4TMFA 3C7AA 2JKVA 2AQHA 2NTJA 2FZEA 2IEDA 4CV1A 1HZZA 1VPDA 2FN7A 1TLTA 2AQKA 5IN4A 4XDZA 4EBFA 2QX7A 3UKOA 5A3VA 4TVOA 3Q1LA 3GT0A 4XX0A 1ZCJA 3H5RA 4JJGA 1SEPA 1PS0A 2DC1A 4AL4A 4CMBA 2GPTA 8ADHA 4DPMA 1EE2A 4FCCA 2NSDA 3VPSA 3CUKA 4PZEA 5DT9A 1HDXA 3DBLA 2AE1A 3INTA 1GQ2A 3H7AA 3IJPA 2V6GA 3EZLA 1BSVA 1LQUA 1NQ5A 4J4TA 1FDUA 2AW5A 3WGGA 3K9QO 4IDFA 4Z6KA 3Q2IA 1OBFO 2X0JA 4R51A 3V5NA 5AQ1A 2CD9A 3I5MA 1GCOA 4GVXA 4HBGA 4ALJA 3DC2A 2VWHA 3ZNPA 4J2HA 5GY7A 1OAAA 2PZKA 3UGKA 1SO8A 1V35A 1D4FA 2I65A 3Q0EA 1Y8RB 5JMWA 1ZW1A 4Z9XA 2PKQO 4GSLA 1ONPA 2NUAA 1NTOA 2QIOA 4XJTA 4GWKA 4BNHA 2Y1EA 1LSUA 3B6ZA 1MFZA 1UUFA 1X15A 2BFPA 4NJMA 1Z7EA 5JFOA 3DZBA 3ZWVA 1D1SA 3C3XA 1LDYA 1K5HA 3R3JA 4CM1A 3EGOA 1NQAO 1U2GA 1BXKA 4BNTA 3T7CA 4FC7A 1J4AA 3AU8A 1MLDA 3GQVA 2YHUA 4RLHA 5A02A 2IEBA 1E7MA 2FPGA 2HMUA 5G4KB 3I83A 2I3GA 1UP4A 4MVJI 4CODB 3NV9A 4IUYA 4BO2A 3WFIA 3P7MA 4D0RA 1FMCA 5JS6A 3VPFA 1XDWA 1JKIA 3UUWA 1Q0HA 2HJSA 2Y1CA 1ZSYA 4R5HA 4R3WA 2F1KA 1A4UA 5ENDA 1Y81A 3KBOA 3PZBA 4OJNA 1QG6A 4I9UA 3GMDA 2F00A 4FR5A 5F5LA 5TQVA 3OJEA 4YPOA 1Q7BA 1OOEA 1CYDA 5DNAA 1P33A 1IZ0A 1U4OA 4FW8A 1Y5MA 4AJLA 4R1SA 3INGA 4MKXA 1AN9A 4J7CA 3ZWWA 4CUZA 3GFBA 4ND3A 5DCYA 4AJ2A 1PL7A 3VAZA 5CDTA 2R6JA 3JYOA 4E0BA 4J91A 2JD0A 1RJWA 4YQYA 2AG5A 2OGUA 3FD8A 1SAYA 1P77A 3DZKA 1Q0LA 3H9EO 1PGOA 1MG5A 2EJVA 5CHEA 4WASA 3LYLA 1U8XX 4U0KA 4B4OA 3HFSA 2C5AA 1JU9A 4Y9DA 3GZNA 4J4HA 3RUCA 3VH2A 2H6EA 1E7QA 1UDAA 2VYVD 2WMDA 4E32A 1S7CA 2C7GA 5KVQA 3KTDA 5I9LA 4U7WA 1D7OA 2NTVA 4FD3A 4IJKA 5KKCA 4D45A 1B8VA 4PRKA 2PGLA 4MVJD 3LT1A 4P8RA 2LDXA 5B1YA 3UH1A 1GEEA 3QE3A 1AHHA 1E5QA 3NJ8A 3UN1A 5JSFA 3L6OO 3I52A 3ZW8A 2VZ8A 3W8FA 2NTNA 3G3EA 2Z1NA 2WYVA 4JQCA 2AEMA 3PPIA 1ZK4A 1QR6A 1SC6A 3QW2A 4D3SA 3RD5A 5L7TA 2ET6A 4YEDA 2JAHA 5JCJD 4OL9A 2HMSA 3C1AA 3GVPA 4NQZA 3N74A 2QZ9A 4F46A 5L53A 1DC6A 2PNFA 3JQFC 3X2FA 2WYWA 2VQ3A 4B8ZA 1DPGA 1R12A 1GZ3A 3GNQA 2BD0A 5EESA 3BMCA 3A1NA 1XGKA 3TDKA 4KQWA 3S2IA 2PKRA 3BAZA 3MWDB 4CV2A 5CG2A 4CJXA 4OO3A 4II2A 1PJCA 4OOFA 3ANNA 3U5TA 3LC7O 3TFOA 2EKLA 2ZCVA 4FJ0A 3BIOA 1ISFA 1BMDA 1HWYA 3DZGA 4JBGA 5H82A 4L4RA 4U6SA 1TT5B 2FR1A 3PZRA 2X0IA 3ZNNA 4D79A 3VH1A 4J0FA 2O2SA 3GPDG 2TMGA 1A71A 5EERA 1IZ9A 4W99A 3ZZNA 2ZATA 5IF3A 3EHEA 1GDHA 2J3JA 4MDHA 1NVGA 1D8AA 1HTBA 3A14A 4AJOA 3VZPA 3I4FA 3WQRA 5BSEA 3JYLA 3TRIA 3C7CB 3PQEA 3GVCA 4J7XA 1J49A 3DFUA 4UVGA 1KVQA 4CQMD 1L1FA 2YDXA 3Q11A 5JAZA 2VT3A 3ITDA 5IAAA 2AEJA 3OF2A 3DQPA 5IZCA 8LDHA 1E3SA 1BDBA 1UZNA 4YT5A 3E5RA 5JAIA 4GAEA 2JD1A 1H6AA 4RO0A 1IB6A 1BVUA 1GPJA 1KVSA 1LDNA 3SVTA 4WLUA 1P9LA 4BNYA 1VM6A 1PS8A 1ZXBA 4K1LA 3GEMA 1PJ3A 3ZHBA 4RDIA 5COQA 3GVHA 4KUEA 2WD7A 1UDBA 5T5QA 3ZU5A 4NFYA 4IBOA 1DIGA 4EJ0A 4R5MA 1B3BA 4IJVA 4PLHA 1YJQA 4XD2A 3LSYA 6LDHA 4A0SA 1ZK1A 1WZIA 2NVUA 2R2GA 3RU9A 3RJ9A 4WLEA 3RUIA 1A7AA 4DBVO 4GH5A 4PIVA 4AJNA 4K9DA 1WPQA 1B7GO 1NHWA 2ZCUA 3PHJA 3HNPA 1P31A 2FRDA 3LC1O 1ISGA 2IZ1A 3HN2A 3GNTA 4R16A 2J6IA 1K6XA 4BIIA 3WIEA 1P0CA 4HFRA 1Y8QA 3NX4A 3RVDA 3WGIA 2E6UX 1S6YA 5C5IA 4JBHA 4OXYA 1YBAA 2QRJA 1I0ZA 4FJ1A 4XEHA 3ZWNA 4XIYA 2DBZA 4JROA 4TSKA 2HCTA 4CQLA 5EQDA 2GR9A 3AOEC 2PY6A 4DQXA 4BKRA 3O38A 2TMDA 4E33A 5BNIA 1SNYA 3ZHZA 4IS2A 4YA6A 4YBZA 5JC1A 1CETA 1PIWA 4Z0TA 4JJIA 2VNSA 2P91A 4WK6A 2EGHA 4CM4A 4MVJM 1L7EA 1LSJA 1Q7CA 2Y68A 1RM5A 3B20A 1F06A 3BXXA 5JE8A 1DFGA 1Z73A 1PL8A 3DR3A 3PTZA 4QSMA 4XYEA 4BKPA 2V6FA 3WICA 2B36A 1GEGA 3K8ZA 1NFFA 4QUKA 3QWAA 1EK5A 3PI7A 1MGOA 3E48A 3KOUA 1P1JA 1U3TA 4OSOA 2RCYA 4YT4A 2EG9A 4ESOA 1CQIA 3BTVA 3W4KA 4I5GA 4Y6PA 3WBBA 3HB4X 1YJ8A 1BG6A 5A9TA 4PG6A 1FJHA 4XRGA 5K6AC 2BF7A 5I9NA 1TEHA 1N92A 5KJFA 1WDLA 3EVTA 3VH3A 4ALIA 1I32A 3ETEA 4N5LA 4P4LA 4BNFA 4DL9A 5BQFA 4L8VA 4J16A 4E2XA 2WE7A 2H9IA 3VTFA 2QRLA 4CMEA 4HUJA 1LSSA 1KETA 2HSDA 4B7UA 3ZWOA 1RPNA 4PFJA 2WD8A 3DB2A 3GEGA 4NU6A 2Q49A 3E8XA 4LSWA 5H81A 1GYPA 4H7PA 4XCVA 3WYCA 2X0RA 1LLCA 4N5NA 5T8KA 1I8TA 3JQAD 5F5NA 3W6UA 5KJCA 3PFWO 4YVFA 3DBLB 2JL1A 3PJGA 1X0XA 2NU7A 1PJLA 4ALKA 5JDCC 4E5MA 2NVBA 2PZLA 3F1LA 1FDTA 3WLFA 4B3JA 1O0SA 4OGWA 4I5EA 4XKJA 3K5PA 5CDYA 1AXGA 4PG8A 4N7RA 3RFXA 2QG4A 4NU5A 4BNXA 4YT8A 2Q45A 2YUTA 3NDJA 1B26A 2GGSA 3VVCA 3DBVO 5ICMA 3FBTA 4UREA 3FI9A 3ZWCA 1NFRA 1K89A 1GYRA 3OJOA 4RJTA 3MZ0A 4D0SA 1FDWA 3OBBA 1HSZA 1T4DA 2HK8A 3MJSA 3QRWA 4WLFA 4YJFA 2FR0A 4H16A 2EXXA 2POQX 4EUFA 4BNKA 2HK7A 1LNQA 1NVTA 2JFHA 4FC6A 3DBRA 3M1LA 2NACA 4UUNA 3U4CA 1ZEMA 2BLLA 1ONNA 4NJMB 2B0JA 4FOSA 3ZHXA 1UR5A 5LC1A 4ZN6A 2PZMA 1YQDA 3WX0A 1O6ZA 1YB1A 2J3IA 1XELA 3TWOA 4IDGA 3KEQA 2O4UX 2X4GA 3PWKA 2VHYA 3HZZA 2VRBA 4YQZA 4YTEA 4RORA 3PIDA 3OM9A 1W4ZA 5ER6A 3RCBA 1C1DA 2PD6A 4QO8A 3QVSA 4G81A 3RC2A 2UVDA 3ZCXA 1IE3A 4C4OA 4CUJA 1GUYA 3ULKA 3TJRA 4MVJP 4BO7A 5THKA 4DMMA 1H2HA 2DFDA 3G0OA 2GSDA 5HS4A 1UXKA 3FN4A 3NDRA 3ZU4A 1E1LA 2A35A 2W8ZA 4M87A 1NPTO 3CKYA 2BRUA 2DTXA 4KP7A 3JQBC 1E7WA 1DIAA 3GOHA 3D7LA 3IMFA 2UAGA 1G6KA 3I1JA 3E9MA 5C7IO 2OHXA 1C14A 3WGQA 4TRNA 1C1XA 1QRRA 4HP8A 4JP2A 5AVOA 2HAEA 3L77A 3DZIA 2GZ3A 3DFZA 3FNGA 2NVWA 3O9ZA 1V6AA 4QT0A 1R66A 2I5PO 1BW9A 4OXNA 4A26A 5I7SA 3RUHA 3RASA 3PYXA 3GZNB 3KZVA 4G65A 1TXGA 3RQSA 1MA0A 4PVDA 1MC5A 3NDIA 4IGFA 4DWVA 3UVEA 2CMDA 3P19A 3PDJA 3RBZA 4GX1A 4A73A 1HDGO 3KYCA 3ZV4A 1P1HA 4EGFA 1KEPA 3UOGA 1H93A 5L4NA 1X0VA 4DYDA 4R54A 4BB6A 4BNNA 5I8WA 3V2GA 1VLLA 1JTVA 1IULA 4K6CA 4YRDA 1U8FO 3KUXA 4E5YA 2PLAA 1HZJA 2I76A 2YDYA 4FGSA 2XXBA 3Q2KA 2OFPA 4O59O 1UH5A 3AJRA 2Y05A 3TL3A 1G1AA 1PGPA 5ENVA 3F9IA 2BMAA 4BVAA 4H15A 4P4GA 5JC8A 5DN9A 2GN8A 1YL6A 3AOGA 1Y5RA 2PV7A 3L4BC 3SBOA 3HQ4O 4PLWA 3RC9A 4KWIA 2Q1WA 1FK8A 1X7GA 3BMCB 3VPHA 3PEFA 1GV0A 3FWZA 3GDOA 1J0XO 1YE3A 1R37A 1EFKA 4FFMA 1HE5A 3PGXA 1ZVMA 4C7KA 3CPSA 1EDZA 2D4AA 4E2WA 5JXWA 3F6YA 1YO6A 3A28A 1Z75A 3RWBA 2W2KA 3WJAA 4KTTE 3B1KA 5KNLA 1KC1A 5GZ6A 1JAXA 3M2PA 4DC0A 1LLDA 5KWEA 2QW8A 3FHLA 4IY1A 2NNLD 3ENNA 3RC1A 3DAPA 2C20A 3CIFA 1U3VA 3K2BA 5G0VA 3U4IA 1EE9A 3OP4A 3GF4A 4XYGA 5CFZA 2C59A 3NEPX 2YV3A 3CTVA 1VI2A 1SEVA 2VWPA 2GN6A 4IGEA 1G0NA 2EP5A 1E6EA 1XEAA 1RYDA 1VSVA 5DDIP 5DP1A 5TT0A 3WGYA 5CG1A 3RFTA 3GK3A 3TL2A 3ZU2A 1VJ0A 3VKVA 3U4HA 4ZA2A 1YDEA 2IDZA 2UUOA 4BNUA 2WWRA 3LT0A 3QWFA 1U3WA 2O4CA 3CTMA 4Y67A 4YR9A 3E9QA 2C07A 3DL2A 4CLEA 1Q1NA 3OSUA 3FNEA 4CLOA 1A72A 2WD7B 4XIJA 4W9NC 2JJYA 4BNWA 3M1AA 5F1KA 1HL3A 2Y1OA 3R6DA 3LLSA 1NHGA 1DFIA 4RGBA 1H94A 1U1IA 1ZUD1 4DUPA 1YKFA 3HUDA 4ZICA 4WNCA 5HTOA 2YQ4A 5A05A 3PYLA 2YHIA 2NVUB 4CM3A 4FS3A 4NMHA 3NYWA 3T7EA 4URFA 2GZ1A 3LLVA 3O03A 3PJEA 1M6HA 4L9RA 4DBZA 1LBEA 4Z9FA 5TF4A 4AJKA 2G17A 2V7PA 4WJZA 3ONEA 4HADA 3LC2O 1H6BA 5L95A 4UEKA 4MIOA 3DMYA 5ICSA 1T1RA 2Q3EA 4PGFA 4TVBA 3RJ5A 3WQSB 3HDJA 1V3VA 5B4VA 1GTMA 4DMLA 1EFLA 4XQEA 3NT4A 3OIFA 2X8LA 4K28A 3G49A 1X13A 1YL5A 2VYVA 3TFQA 1SOWA 5B4UA 3M2TA 3IDSA 4CQLB 4UEJA 1SB8A 1T2FA 3L6EA 4MVJA 1FF9A 4MVJH 3RUFA 1T2EA 3OJ0A 3HSKA 1XU7A 1Z74A 7MDHA 3KEOA 3KYBA 3SXPA 2WEKA 3NGLA 2CF5A 1UXJA 2AG8A 5IZ4A 2GNAA 4DVJA 1Z6ZA 3LF1A 4PZCA 3VPXA 5TS3A 1UDCA 3DWFA 3OIGA 3WQQA 1LJ8A 1ENYA 1GZ4A 1HSOA 3H9QA 2VZ9A 4ZRNA 1PJBA 3IJRA 2OZPA 4DPLA 4LK3A 2PK3A 4LRSB 4FPXA 5COBA 1YL7A 2HU2A 1K6IA 2ZYAA 4BO0A 3I9JA 3GC6A 3PWZA 1PEDA 4BNIA 1F14A 5CAEA 4YRAA 1JKFA 3SEFA 4WUVA 3MJEA 1YXMA 2B5WA 4JCOA 1ZZEA 5KCZA 4MO2A 1BDMA 2X9VA 3WLEA 2HMTA 4RVGA 3EVNA 1DSSG 4TRJA 1LC3A 4ZQEA 1BRMA 2IXAA 1LTHR 3H2ZA 1UAGA 4ROSA 5G0TA 1X14A 4BGUA 3W4JA 4PLCA 1P1RA 4W4TA 1JLLA 4DLLA 4B8WA 3PJDA 3WMXA 1RYEA 4B4VA 1M66A 4DIFA 3PDUA 1R16A 2DBRA 1C0IA 3W8EA 1IY8A 1K6JA 3OQBA 3ETGA 4NK4A 2W98A 2FP4A 3GY0A 3NTOA 1B14A 4QO7A 3I9NA 3JD2A 1OFGA 3AI3A 4CQMA 5JBIA 3UAGA 1IPFA 3PQDA 4EJ6A 1H9BA 2CZCA 2PGJA 4IDBA 4E3ZA 1NASA 3M6IA 2C2YA 1MUUA 3VKUA 3O26A 4CM9D 1B0AA 4CV3A 4J0EA 1QORA 3SJUA 1DJQA 2JCXA 3VDRA 1ISIA 1JAYA 1AXEA 4RLSA 2ZYGA 5BNTA 2BELA 4XA8A 3PVZA 3RAJA 1CWUA 2RH8A 2Y67A 4R9SA 2D59A 4YJFB 3DOCA 3VH4A 1ZMTA 1ZNQO 3WGHA 1KS9A 1GCUA 1E0DA 4RVFA 3DBRB 2E48A 3D5TA 4CMAA 5HWSA 5KVCA 3FTNA 4S1VA 5JDIA 1Q7GA 2YYYA 2D8AA 2EEZA 4IJUA 4J49A 2QYTA 2EJWA 3UCXA 1RKXA 2B35A 1ZSNA 1ENOA 5L9AA 4Y98A 1EQUA 3U3XA 1PGNA 3H3JA 2O50A 3ANMA 3WWYA 1WDMA 3TZQA 3PJFA 1Y7TA 5AXBA 2VNAA 2WJPA 3OETA 3P5SA 4LCJA 4NZ9A 4O63O 4RQTA 1IHYA 4YXFA 2RH4A 3NT2A 4GX2A 5CEJA 1PSDA 3BYZA 2DBQA 4CM5A 2B4QA 1XQ1A 3H5NA 1C1DB 3CEAA 1DC5A 4MINA 1A9YA 2VCYA 2HDHA 3AI1A 3JQ7B 5MGBA 1JWBB 1HE2A 4GWGA 3COSA 5HM8A 3ZNOA 2UV8A 4CMJA 5CDSA 2Y0CA 4XYLA 1YB5A 3C24A 1D1TA 2Q1TA 4Q3AA 3PXXA 3S2GA 4UUMA 1HEUA 5BSHA 3ROQA 4L0QA 2DU8A 1E6UA 2I67A 1U5CA 3P2OA 2WYUA 3DXFA 3GG9A 3CE6A 1K2WA 4O5OA 5G2OA 1TI7A 1H0KA 3PYMA 2ZTUA 1N9GB 4NDNE 4I8XA 2X1HA 2YFHA 1NR7A 2V6BA 4H3VA 3IAHA 3ZV3A 4RPHA 3LF2A 3WR5A 1R6DA 3D3WA 3ZGYA 3GGOA 4GMGA 4B7XA 3UXYA 5C7OO 1EK6A 4PZDA 3FBGA 1H9AA 5THQA 3ROMA 1BW9B 2VHWA 3EW7A 1WP4A 4IMRA 1IL0A 1MXHA 2HRBA 4XQGA 1YBVA 1HF3A 1T24A 3C1OA 2DFVA 4PG7A 4G2NA 4LRTB 5L40A 1E92A 2Z5LA 3A4VA 3EZYA 5JYEA 3GN2A 4K26A 2CDAA 4WNIA 1ISHA 1JW9B 1C0PA 2VRCD 1SPXA 1CJCA 3OIDA 2Y1DA 1EBUA 5IJZA 1QKIA 3BHJA 3JCZA 5KJEA 4CM8A 5TLSA 4CM7A 1N8KA 2PGDA 2HMWA 3QJ5A 4M1QA 3AY6A 2OP1A 4GGPA 4GQAA 4A27A 3WSWA 4FQ8A 5IZCC 4Y8VA 1PQUA 1NQTA 1NVMB 4RPKA 4PLFA 1XIVA 4L4SA 2X0NA 1I36A 5ILOA 3HDYA 3W6ZA 4KUHA 3DTYA 3EYWA 2CVOA 5G0SA 2OORA 3JQAA 1PGJA 5GZ3A 3TOZA 3GRPA 1T25A 2O3SA 1ZK2A 3E03A 1FXSA 1JA9A 4UULA 2FR8A 3I4CA 3F5QA 1E77A 3IKVA 4FJ2A 3ZU3A 3K31A 4BMNA 3KYDA 2FOIA 3EC7A 5IXYA 4IJWA 3OQ1A 1BXZA 4UVEA 1HYEA 2OP0A 2GYYA 2W2KB 3KVOA 3NGXA 3O8QA 1G0OA 4W7HA 2WM3A 4DIBA 1DRVA 3E5MA 3U0BA 1UXIA 3KLMX 5BSFA 4JP3A 1GD1O 1I30A 4PLZA 4X54A 2NU9A 3H9UA 1QMGA 3VPGA 1ENZA 6ADHA 2ZK7A 3JD0A 3ZN2A 1WNTA 2GO1A 4MP3A 1Z45A 2GDZA 1M6WA 3WGTA 3VZSA 3KV3O 4QEDA 5L7YA 3QA9A 4QTZA 3R1IA 4UVHA 1O95A 1C3VA 4PLVA 1XU9A 3V1YA 4E5PA 1QYXA 5K9ZA 1C0KA 4NBVA 3C85A 5C7LO 3KM0A 3O4RA 2D5CA 3L9XA 2FMUA 5FEUA 1R0SA 3DMTA 3WNQA 1DOHA 1I2ZA 4RZIA 1F8FA 1IHXA 1LUAA 2OXIA 3KETA 2XXJA 4CLDA 3ZDFA 5TX7A 3WYBA 2NQ8A 4WE3A 1QXSA 1LDEA 5L4SA 1DRWA 2HJRA 5FF9A 2VUTA 5T57A 1DJNA 4CMIA 1P1FA 4LVUA 3QLJA 1OI7A 3UFXA 3V1TC 3F3SA 4A03A 4CLOB 1P1IA 1R4NA 3ORFA 2X9GA 5A1TA 3OJFA 4FFLA 2WDZA 3UICA 5DBGA 4WLOA 4KDEA 4Q3CA 3LZ6A 1CRWG 1TA4A 2X7HA 1EBFA 2ZIZA 4AJHA 1DIBA 2X5KO 4EDFA 5GZ1A 5CPFA 2AXQA 4IXTA 4CM6A 1CQJA 4BMSA 4DGSA 5K0ZA 2YHIB 3FTPA 3I9OA 4DTIA 3IKTA 1MXFA 1JN0A 4F6CA 3NTQA 1R0KA 4D44A 4JK3A 4BNGA 2PH3A 1GFSA 3ICPA 4GVLA 5CPBA 4AJIA 4IINA 1QV6A 1FDVA 3NTRA 5T67A 4A5OA 1E3LA 1LRJA 3OEWA 4I08A 2O7SA 3WTBA 2YQ5A 2FHSA 4NR0A 2YW9A 5KKAA 2C2XA 2BFAA 2A94A 3IC5A 2VN8A 4CMEC 4OM8A 2CDBA 2QYSA 1A7KA 1U4SA 1UP6A 3DZFA 3E18A 3MJTA 1WVGA 3TZCA 1UAYA 1DDOA 1NXQA 4BO9A 3L07A 2B4RO 1XKQA 2RAFA 4QQRA 5T8KC 4AFNA 1HYHA 2O3JA 4R1TA 1BGVA 3GDFA 1P74A 4DLAA 1KIFA 1LI4A 4D43A 4EUEA 1BHSA 3VHRA 1HE4A 1PWXA 3A9WA 4E2ZA 4PVCA 5BR7A 3LDHA 1VJTA 2D5AA 3GVXA 2XOXA 3EMKA 5COAA 1KEUA 4GBJA 2ZB8A 4NG5A 3A06A 3AI2A 2OO5A 4F6LA 1P44A 4J43A 4B4UA 2Y0EA 4O6VA 2NLOA 1NFQA 4BS9A 3I9LA 1KYQA 1ZK3A 3V1UA 4WGGA 5TC4A 1EDOA 5I8ZA 4BNLA 3JD4A 4PLPA 1I33A 2VUUA 3DEYX 5EQFA 1NWHA 5FI5A 4DYVA 3V2UA 5H83A 5A03A 3C8MA 5G4KA 4L76A 4KUGA 4BB5A 2BI7A 4EJMA 3KLPX 3STHA 4MVJF 1VC2A 3CMCO 5TJ9A 4HY3A 1WAMA 3EAGA 4Y6RA 3S55A 1I2BA 1U7HA 1VRWA 4B3HA 1KERA 1YS4A 4XGKA 3BHMA 4XZ3A 5ITWA 2GERA 3OA2A 3WDSA 2BH9A 1OZAA 1RWBA 4BO1A 4MIEA 3ADOA 3DHEA 3GDGA 4RVUA 4RF3A 5EN4A 1BWSA 5KOIA 4EITA 5ADHA 1IUKA 3RSHA 2JD2A 1DEHA 1NR1A 4CL3A 4RF2A 4ZHSA 5A5EA 2E37A 3OMLA 3KHUA 4RF4A 4BV8A 2Y93A 3AU9A 3TNLA 3G1TA 3ZWMA 2J3KA 1GR0A 4HNHA 3S1LA 2IRWA 2FSSA 3SJ7A 2DPGA 4RVSA 4XYBA 3NAQA 4HWKA 3TN7A 4RCVA 4BHTA 4S3MA 2I6TA 2H1SA 2PD3A 2RBEA 4E30A 3LT2A 3QWIA 4JLWA 4BNMA 4Q39A 4B3IA 5B12A 4E5KA 3GH3A 1MG0A 3HB5X 4NFSA 3F4LA 2JHFA 4MP8A 2B83A 4J90A 4GSKA 1I3KA 3I3OA
chains in the Genus database with same CATH superfamily
3QEBZ 1CJMA 5EHNA 5F3RA 1OR8A 2XRYA 3AETB 5CA1B 1VPEA 2DQ4A 2QRNA 3HPQA 4K7JA 2VP4A 3FDIA 3G9ZA 3HLTA 3Q0IA 1UXGA 4B48A 1DXHA 1NRIA 2PZJA 2H18A 2R8EA 3ZBUA 5JO0A 2X2EA 3KWFA 1WZUA 4TRRA 1Y1QA 2QVLA 2C4MA 4CMHA 4Q9KA 1WLYA 3D2CA 4AURA 4HWGA 2Q2QA 3OCVA 4OHYA 3T9EA 3BL8A 4AMZA 2XRZA 3NJ4A 4C14A 4J03A 4GGMX 4WSOA 3ZS9A 4YRJA 4D9NA 1FLVA 4L5YA 3BTSA 2GSWA 4E14A 4P22A 1WCYA 3KQVA 4I3GA 4CPDA 5LKRA 1KORA 2BGMA 3AESB 4WK2B 5U4QA 4HHEA 1X1EA 1N7HA 3FHTA 2GEDA 3KTOA 4DC1A 3IAFA 2G3YA 1DI0A 3EAQA 1TM3E 3IUMA 5C8XA 1ZVKA 2OMEA 2IZ5A 1L7XA 2QPTA 5JMPA 1D09A 2VP9A 2V7XA 4RELA 4M8SA 4C08A 4R1UA 1PJTA 5FNVA 1TJ3A 1K68A 1ZJYA 2QN9A 3GGSA 4LF9B 5B6PA 2KMLA 4LY3A 2G88A 3IDQA 3TPCA 4JKYA 4OH1A 3AK4A 4HNSA 4KXWA 4OAPA 4AD8A 4D7AA 2L69A 1S5PA 1GQRA 4JFRA 2HOQA 3OTQA 4KKVA 1KJ8A 3QKSA 2JJ2A 4YRLA 1YRYE 2JBAB 1Q16A 2B5VA 3VSDA 2EW2A 1M2JA 4L2IA 1E7YA 3VR5A 4TS3A 4KVZA 1RI5A 1L4GA 4HFNA 4AJ9A 3WADA 1ADBA 5ESWA 4ED9A 4ENRA 1GGHA 1JXMA 3D3WB 4F56A 4K2AA 3U5ZB 7ADHA 2WWFA 2GD6A 1XLWA 4C2BA 1PZHA 4Q3NA 1CQPA 3AR3A 4Q1BA 1RZVA 4UMDA 2GCGA 1REQB 4G5GA 4BMDA 4G8BA 1EFRA 3ND8A 2R1TA 4LNUA 1FYFA 4IIYA 5IX8A 4JVOA 1L9XA 3OG9A 4BV9A 2CNKA 4RD6A 4TKUB 4BQEA 4CR6A 1AKNA 3JD3A 5CGQB 3WV4A 2X6RA 1AUXA 3ENWA 4ALNA 1R0CA 2FSPA 2ZB4A 4YHBA 4B7ZA 1EWQA 1TAUA 3EXEB 3HJAA 4FYHA 4PSCA 1W36C 1SHKA 1GG9A 3CRZA 5EIOA 1RQ2A 3OMXA 4WOCA 2XIQA 4R98A 1X7ZA 5G0UA 2PMWB 1F3OA 2O5RA 3TTYA 4ZYXA 2P4QA 3BS4A 1O89A 3E3LA 2M9MA 4N3NA 4PTZA 4XPIA 5EXXA 3WLSA 1TLLA 1L7NA 4UOQA 1NQWA 3C43A 2FA9A 1A98A 5ALPA 2B82A 3EIEA 5F64A 3RI3A 3CF2A 4EHIA 4F3KA 3H5WA 4ND4A 1KJ9A 3T3EA 4P53A 4YMUA 3QSGA 4DV6B 2W2XA 1J2JA 2JFPA 4QECA 3PK0A 2CVPA 2ONJA 3W6PA 3A2KA 1IATA 5HEKA 1E1KA 4OGFA 3M0EA 2QD4A 3CZMA 1AZSC 3L82B 4LI0A 4MPPA 3PA6A 2Q2OA 5C8YA 3HBNA 3KZNA 5CK4A 3RR2A 4MPDA 4Z9YA 1WUJS 2PBZA 2DHCA 1EGHA 2BT4A 2P9HA 4LBYA 4W7IA 5AKIA 1T3LA 4RPJA 1ENPA 1CJTC 4JJFA 3K0KA 5FHQA 1J1ZA 4NPCA 3VXKA 4ZGWA 5HIKA 1NJ1A 1QWSA 1S3SA 1PD1A 1P80A 1Q11A 3EUWA 3E0XA 3FI0A 2QV7A 3JQDA 3HWWA 2VDRB 4RZUA 2H1WA 3RLIA 4DMCA 1AVTA 1FXWF 4RSGA 4DDUA 5BN3B 3IS3A 3W5SA 1NJSA 3H2BA 3SN6A 1ZHFA 1BHO1 4FFRA 5DVZA 1IBRA 1Y4AE 2VUSA 2ZIFA 3O8QB 2D06A 3ADKA 4FYIA 1ECGA 1R9MA 1KHTA 2PUJA 3GRCA 4IDCA 2G9QA 3ESDA 1JGTA 2XB8A 4NWIA 1T2CA 5CJJA 4C4YA 2R84A 1KYIA 3EVGA 3WTCA 3DE6X 2NUTB 3PP8A 2ZYTX 4AY4A 3H2HA 1GV1A 1SG9A 2IHNA 2DTDA 4TYQA 2ERCA 2GFIA 1QHXA 4M1OA 3VR6D 4LIPD 3QUQA 3JALB 2XQVA 5CT5A 2W22A 3ITKA 1XVIA 2O3QA 4MCHA 4RXUA 5ALHA 1N0UA 2HI0A 1TUEA 3RRYA 1YGPA 1QX3A 4RWZA 4XDHA 3ETHA 1JA0A 1ORVA 4QG3A 2GEJA 1QRUA 2ZSIA 4PQFA 3FDZA 4BVGA 1P3DA 4NDZA 1OXXK 2QL5A 3H6KA 4RXMA 2DLNA 3C6ZA 4CLRA 4Z4FA 2CDCA 2HWUA 1U7ZA 1AUVA 4LHZA 4MUYA 4DDTA 4P81A 1QO0A 1YR9A 3OF5A 4B4WA 2GZRA 3C7TA 4Q9NA 1FRNA 3K72B 4EX6A 1N1DA 5FL7D 4B6GA 5E0OA 1KMNA 2C9DA 1CY0A 1B42A 3CN9A 4Y1RA 1JEYB 1C3EA 2X4LA 3QGMA 4ZI3A 1NJFA 3IOBA 1URPA 3AHCA 4WCDA 2RHGB 5AH0A 3FOZA 4WKOA 4G8CA 1DQSA 4L28A 1Y89A 2QX4A 4LCEA 1BHQ1 1L7QA 2CLHB 2XE4A 2YY5A 3F74A 4IWNA 1PQPA 5EZQA 5KU1A 1E2PA 2Z9DA 1BVRA 3JWIA 2YZ7A 3QP9A 2V97A 1XTZA 4EX7A 1TTTA 3CINA 4AUEA 4BN5A 4CM4B 4F3NA 1NDUA 1QHGA 5HE9A 4MUMA 1HXHA 4UZSA 2IUUA 5J43A 4UU7A 1UZAA 3AFMA 2AYXA 2H59A 1KDOA 1ZJZA 1NBIA 3PLNA 4ROTA 1KDVA 5CBPB 3D0RA 3SXUB 3ABOB 3M1YA 2WWXA 2PUHA 2IZZA 4UHFA 5JCOC 4N3CA 3IO5A 2ERXA 4QXOA 2H92A 1NBME 1KI6A 2G28A 2VAVA 4JYBA 5I9IA 2PE5A 4HX5A 1CZNA 4WTOA 4ZVSA 3EEIA 3QFHA 1YZHA 5CM9C 1KZ7B 1RWWA 4FT2A 5DXAA 3ENKA 5H7XA 2BKVA 3BG5A 4I0WB 1GRQA 3DOIA 2G25A 3FSRA 3JQCA 1OLXB 2TRSB 3DPSA 3T6KA 3KSZO 2HXSA 3PICA 3FPEA 1Z5PA 4R41A 2FFAA 4BO8A 1Q5PA 2CV1A 2HLPA 3P71T 3M7IA 3VRHA 2E89A 4WOBA 2WNHA 2RGUA 2BTQA 1OAKA 2F43A 1WQ3A 3IUPA 4CT0A 4ESHA 5B4TA 1QYVA 1A4RA 3N0RA 5LLDA 4MIYA 2GTPA 4DNFA 3DCJA 2HUNA 4G97A 4JX8A 4XTRA 2NP7A 2XYGA 2ID7A 1M72A 2Y1GA 5CCXA 1EWYA 2WVAA 1FW6A 3H1FA 3RVQA 3T52A 4BWFB 3CQ9A 4N4AA 1K5PA 3UB4A 3JQ8A 1GAWA 3VUFA 1X1SA 3Q85A 1QGDA 1EUCA 2NPFA 4R3NA 3OAAD 4HH1A 5FUQA 1VMEA 4U8GA 2AJCA 3CC8A 4HYYA 4P3XA 1XDDA 3HCFA 5H8WA 1NNEA 4TWZA 4KGZA 3EW9A 3UK1A 4BP1A 3BBLA 5LIPA 4LQCA 2OMKA 3KQQA 4WEQA 2OOSA 1ZK0A 1SBQA 4B1FA 1BN6A 1GILA 2B1JA 1OXUA 2Z09A 3ZHOA 2XWBF 3NOOA 3U3ZA 3U4GA 5F21A 4AZ3A 4IKPA 1DEAA 1JWAB 1V8FA 1E2NA 1E9VA 5M34A 3ONFA 1H8HA 3L6RA 4ZK2A 3GJQA 3EPRA 4FXPA 4HO1X 1D1PA 5EWJB 5BN4B 1WW3A 1O5IA 1XLTA 2PKYX 1DMRA 2RG1A 3FDJA 2VKTA 5EP3A 3HE3A 2H4FA 3ZCTA 2I1WA 3I0NA 2RJ3A 4I4LA 4R1MA 1QDUA 3AIIA 2HXYA 3DW1X 5CVJA 4NEQA 1XSEA 1B3RA 4PXSA 1Z18A 2XV1A 4Q3KA 4FFVA 3QPAA 3T4XA 4GM1A 4LNAA 5CP8A 3C5WP 1N2HA 3IR5A 2D1QA 1MKYA 2HIGA 3IEKA 4GWLA 3P9QA 3VOSA 1CCWA 3N8HA 2DULA 4HQ0A 2WUWE 2CFCA 1QFJA 3JAMA 1PL6A 5KX5A 2Q5LA 1FCJA 4XB2A 1E9RA 4FE4A 3ZW9A 1YDWA 3L04A 4TM7A 1KOFA 5DM60 4B75A 4HDMB 1DO0A 2AYZA 4M1ZA 1JLSA 4G0WA 1RPJA 1I2MA 2IY7A 2QTFA 4U7DA 3GFQA 2IYFA 5CEFA 1HQDA 2JLVA 1IJBA 1CUAA 3NRCA 3C3DA 2FW8A 3M1IA 5JECA 4C7MA 4KQFA 2AK2A 2ZB7A 3GGGA 2PX0A 4OYHA 4RHYA 3U3DA 4EGCB 2VF8A 4TTIA 3MFYA 2NZYA 4WEOA 1O6FA 5LFAA 3U09A 1SD2A 1ICIA 1P45A 3NXKA 3GCDA 3MJVA 5E7MA 3FUUA 1ZMOA 5KSYA 4DNQA 3CRVA 3KWMA 3VZQA 4J0CA 5LSAA 3E35A 1FFXB 1QP8A 2CK3A 3ABIA 1PK8A 1AK1A 1Y3HA 3N6VA 4G0VA 1W52X 4CEHB 2J9FB 3LP8A 4OB8A 5FYDA 3MCVA 3QEOA 4N5MA 5D00A 3RVPA 3I64A 1RAHA 4KO4S 4RAOA 5K4HA 1GUFA 1U7DA 4FN4A 5JXJA 5ES3A 1TEZA 3BB1A 5I7VA 1Z07A 4M0PA 3OPXA 5K20A 2UUPA 5F7JA 1IEXA 1V96A 3GV0A 3LAWA 1OH5A 1SWVA 3QIVA 3OQ6A 4UKDA 4WIAA 1KK3A 1P61B 3V8RA 1QG4A 3IKMB 2PTGA 1W30A 4MRPA 5AKKA 3RIHA 3KT0A 2P68A 3DNPA 3G82C 1C1XB 1FP1D 1L3IA 3KUDA 3PHGA 1VE9A 3NR2A 3WMEA 5KTKA 1OJ7A 2RD2A 3N5KA 1PR4A 5K6AA 4TKVB 2AN9A 1GTSA 2ISQA 2EBHX 3PUHA 3IP3A 4GOND 1QSGA 2XJ9A 1I24A 4IDEA 4R69A 4Q9HA 1IY0A 1LY1A 4BO5A 1LK0A 2FLWA 3ZXIA 4MV3A 3WJ7A 3QU9A 3G79A 5KYWA 1E9DA 1I01A 2ZYIA 2ZVDA 4A8TA 4DARA 5HKKA 4PINA 2O5CA 1QV7A 4PLTA 4L22A 2FXIA 1E3WB 3PX3A 3QNUA 4AC9A 1EEXB 3KWJA 3JQEA 5BW4A 4OLJA 3S4YA 4AYTA 2B37A 2O2YA 4PTYA 3ZHCA 2BHNA 1X7HA 2Y9YA 1NUQA 2NQTA 1VE7A 3C97A 1KI1A 1KO8A 2C2MA 3V3KA 1I10A 2RH5A 4R71A 1PX0A 3SC6A 5LOVF 1BYUA 1T0IA 1Y9AA 1V5FA 5KEIA 3EYAA 1U90A 2A9OA 1LRLA 2R3SA 1PZGA 1BJRE 2B61A 2V58A 1NL3A 3MWEB 4Q66C 3TZHA 1YFKA 3G1UA 3ZE2B 4C5BA 4C20A 1Q1AA 2R6AA 3FLEA 2O0MA 3P9ZA 2VA8A 1I1NA 1Z0IA 1F0PA 2AQ8A 3EUAA 2AR7A 4KQGA 1VRVA 5J5CA 5U9CA 2C5GA 4FE7A 1QIMA 1MJGA 2IP1A 2GEVA 4DQDA 4AX4A 4R6XA 5DYTA 2C94A 1S2MA 1RQNA 3A70A 1IXRC 3NHLA 3H2YA 4QGGA 3PFCA 4J1SA 4X20B 2PNJA 5L4LA 4O4IB 1F4LA 1RVDA 1ISSA 1N3BA 2YV5A 4Q3BA 2VXBA 3TSZA 1KAMA 1U2QA 1LLUA 2VHCA 3IILA 2HBYA 1N2IA 4M89A 1KY4A 3AERB 3K92A 4U6QA 2XRFA 4D3FA 1DWQA 1ODTC 4F2PA 3KRTA 1FPMA 1EQ2A 1P73A 2CNNA 2G0AA 2Z0MA 3CH6A 3PV0A 4ATNA 4OX9B 2C77A 2VBGA 2R60A 2YZKA 3KO8A 1GUBA 4TZTA 3DVSX 3U49A 1UKEA 2CBGA 3L0ZA 5EWLA 4ZHQF 2HA2A 2IW3A 3PGMA 4DT1A 1NBOA 5EJ4A 2OZLB 4PSAA 4JUCA 2JEYA 2HD4A 3LX4A 3QLUC 2GEKA 2G0TA 3OJLA 3O9MA 3ICEA 2X8JA 3FFXA 2WMYA 2KB0A 1T5LA 1W5EA 2AQIA 4PN3A 5K3AA 3CLRD 2RGRA 3GJ8A 1MB4A 2C4VA 1J0CA 3W8DA 2VDVE 3E9CA 4DDKA 5TV2A 3ZVRA 3R0VA 1EXMA 2HU8A 3PT9A 1G5FA 3OLYA 4GKAA 4OKNA 4OQQA 4EG3A 2DQYA 3ONDA 1PNOA 3DMTC 1TF7A 2XOKA 3ZD8A 1OIXA 2ZQYA 3OQIA 1ZJ4A 1HKHA 1FDIA 3IELA 5ALZA 4ZAVA 2XVAA 1QU2A 2VPTA 4F9FA 2BM1A 4G9GA 1ZXLA 1E0AA 1XXLA 2ONYA 1YOVA 3OKAA 2OZKA 2GCOB 4L07A 3U37A 4HB4A 3INRA 2DECA 3KKOA 4CLXA 1MDFA 1L8QA 1H6CA 3GZJA 3OZCA 1PHPA 2ZB3A 4HS4A 2HA3A 3QU2A 4QX6A 4YS6A 4A8JC 4F2WA 1UKBA 2ZVQX 5CNKA 3UJNA 3OD1A 2WDPA 4NMXB 1ZFNA 4YJHA 4L5AA 4MP6A 1IBMB 1FS6A 2Z6UA 3I3OA 2JPDA 1JE0A 4B2IA 4H7EA 3QW4B 1HDIA 2VPQA 4HDNB 4PNHA 4AN4A 3MHTA 4QYSA 1NBAA 1U9JA 1E5DA 2HTFA 3BFXA 1H2RS 1C8LA 1U0EA 1XZDA 3BE4A 3ISTA 3VBEA 3EPKA 4HVTA 2NU8B 3T4EA 2ADFA 1QV9A 2CN1A 5LJIA 2VA9A 5B7NA 3A7DA 2OG1A 3ZJYA 1KYXA 4A2CA 3F3KA 3OU6A 4NPAA 3U7FB 1VJ1A 1MPXA 5IM4A 2BJHA 4LUCA 3VHXB 4HRYA 2O2JA 2D7DA 2JJ8A 1E9CA 2HCJB 4UD6A 5HNKA 1A2BA 1LDGA 3V7WA 3UXMA 1F8GA 1PT8A 5DZSA 3SD7A 4AS3A 2P5YA 3V8BA 2G4LA 2IOHA 4IIEA 3M82A 1L5HB 2PKQP 2ZSFA 1OE0A 3RBAA 3AVXA 1LU9A 1C8BA 3ZD9A 1R6VA 1WSBA 1ZOPA 2IUEA 3AOEA 3ORYA 5I5GA 1ZKMA 1ABBA 4PU0A 5AVUA 5JV5A 4BGIA 3RT9A 4J2OA 5J59A 3UK6A 1M2OA 1E79A 1KWGA 3ZD7A 2GJ4A 2VHZA 6REQB 1AF7A 1DQNA 4LSMA 4D41A 2HR1A 5CDGA 1NJ6A 1VFPA 2Q1SA 1R15A 4BBZA 1JI0A 1HETA 1NU8A 2Q2VA 3PLRA 2HA4A 3CH4B 3R3UA 1NW8A 1BN7A 2EKBA 2X4DA 4WESA 5F1PA 5BSGA 5IABA 1QP0A 2J08A 1TK2A 2J46A 3VDQA 3U40A 4I50B 4YRPA 2IHBA 5EMHA 3SC4A 2ONCA 1W0CA 4MLCA 1P2VA 3SICE 3UFBA 2BPOA 5FAKA 2PGNA 2FSVA 4LWPA 3QMPA 3B9PA 5ALIA 1PR1A 3RFVA 1CUUA 4JOSA 4M9CA 3LRTA 2ZIUB 4S24A 2C98A 4FMDF 2AFIA 4MW7A 4U3JB 4F45A 4LXQA 4HDAA 3H2SA 4GQIA 4K6HA 1DEKA 4KR3A 3TTXA 1ZOSA 3VM6A 5KINB 3SM9A 4CEIB 4KU4A 1FA9A 4HSEA 3OKPA 1WVMA 2ZR7A 5AXCA 1Q1QA 1SUFA 3A10A 2A5DA 2DFNA 4QDKA 5B1SA 3AFOA 3ZWPA 2IVZA 2OO7A 1YUNA 3C3JA 4I6GA 1CIPA 5E6UB 5AW9A 5LJLA 2JFFA 3DAYA 3I6YA 4YAIA 1T3HA 3DDOA 5F5XA 4LHEA 4EA6A 3U4QA 3NORA 4M0DA 5AXDA 2J45A 4YJGB 1SULA 2BMVA 3GZ4A 4HKTA 2O3RA 1IONA 1OYOA 1AGPA 1QYCA 3O1JC 1G8FA 2A33A 1LNZA 2D1SA 3COWA 5K8UA 4KXQA 1PZEA 4YLYA 1XZCA 4TN1A 4IO0A 3K2EA 3WBJA 5A5FA 3I2GA 2ZR8A 1WETA 3LZDA 1DZIA 2YW2A 4B31A 2QAGA 3PD7A 4KSCA 1RM4A 1A5ZA 5K0FA 4D9JA 1U8ZA 4AX8A 4OBXA 2OHFA 3DHNA 3W2EA 4NULA 2GILA 4AULA 4X9XA 1PS9A 1QLJA 3TPZA 4F5ZA 4RTRA 3AVTA 3AIMA 4EP1A 4ZGGA 4OAOA 2BHLA 1GCGA 2BFCB 3GPIA 3BWYA 3GIDA 5A9RA 3CZCA 4BWYA 3HZRA 4FFPA 2VJKA 2D2VA 1P5HA 3KKLA 3BBPA 3O3NB 4DZRA 2Q1UA 2L82A 2EDAA 5JSQA 3BMQB 3D8RA 1LDBA 4BU1A 1E1CB 5D5QA 3SKVA 1H5QA 1OBHA 2IL1A 2RIRA 2YZ2A 3GUCA 2UYYA 2Q6OA 3L40A 4PFSA 4Q4HB 4TTTS 1P2SA 1I3NA 4MR7A 4DR7B 2HB6A 1XXHB 1DWPA 2C1XA 2JHGA 4RU1A 1YS9A 2XXAA 1MT0A 1V6CA 2AIRA 3D9QX 2GZSA 5IAEA 5EJ2A 5FBHA 3VMMA 1CDOA 1NY5A 3C6MA 5CFOA 1TQ6A 3L8CA 4ZO9A 4X85A 4DYHA 5CR9A 4FCWA 5HKBA 1BEEA 1GU7A 1O9BA 3EDQA 5K3CA 4HUTA 4MQMA 4F96A 2FLKA 3OZSA 4CN9A 4BNZA 4XVHA 2UYGA 5FKJA 3R5FA 2Z2KA 1I3LA 1TJNA 1SG0A 3RS2A 5JVDA 5JY6A 5F9HA 4YGXB 2IYRA 2FJPA 2ZT8A 2HJGA 1T91A 2I3AA 4O3MA 1JEDA 2GJ9A 3GD7A 1N8TA 5AR1A 1GTZA 3CSDA 2VDWA 4Y9UA 4ZVNA 3SVZA 3T1NA 1YQXA 2RCNA 3HCRA 1ODIA 4U5QA 2E4ZA 4L3OA 5J4YA 2FZCA 3EGVA 3QEJA 4M7WA 4RZQA 3QKRA 1CEQA 1I1HA 2B4YA 3BMOB 1KARA 3F47A 4R2JA 4C0BA 4CUKA 5IXSA 2PA3A 1T43A 3HCCA 3TSCA 4WNAA 4DA0A 1J06A 3SZMA 1RC0A 4P4NA 1K0UA 4EG4A 3LNTA 4EJFA 4C04A 1NYQA 4B7CA 3PTLA 2WJZB 4ZO6A 4JB3A 1Y6JA 4F38A 2VYFA 5KSOA 2C9ZA 4K2HA 3Q10A 3TK1A 3UA3A 4WECA 2WJAA 5JLAA 1AQIA 3S1SA 3BWCA 2IEYA 2QUAA 4WY8A 4ZTUB 2VOJA 2P9CA 1T8UA 1ACMA 5FHRA 3ZE7A 4L50A 4DNPA 4LAFA 4FMBB 3AY3A 1N1EA 1DX4A 4BLSA 2JIZA 2N1MA 3U9LA 1R0XA 1TZKA 1QQ6A 2GBGA 1ETHA 2J7KA 2Y1XA 4HXYA 4IQ8A 1LQTA 3HRIA 2AZ4A 2XUZA 4KPUA 4R1QA 3BMXA 4R8SA 2WUGA 1YULA 3ZS8A 1UK6A 4AMVA 3TUIC 2Y27A 4EEZA 2CCKA 2QNRA 3VR5H 3R6GA 1AQ6A 1T15A 2VHEA 4GE0A 1ZNYA 3AF3A 3FYUB 1G8GA 4LDRA 10MHA 3D6MA 2O8NA 3IP1A 3IGFA 3TAHA 3ZJ5A 3EFHA 3BSYA 5FL3A 2JKYA 3DOOA 3N2ZB 5ILGA 4BKQA 1JHDA 2MSCB 1TM2A 3L4KA 1Q0QA 3QPCA 5EHGA 2ZSJA 3IPRA 2C1EA 1EQAA 1FTNA 3A1DA 3I2HA 3N59A 3OQHA 4WOKA 5FUWA 3NUGA 3GJ3A 4ZJZA 1ABFA 2EX1A 1ZJ5A 1AG9A 2WICA 2Z8YA 3CWZA 3OHSX 1PZFA 3PDCA 4FWBA 1FU4A 2P11A 1TMGE 3KXDA 2B30A 4YRBA 4RK1A 5FLKA 3D7SA 4GLLA 2PSDA 3UMMA 4QPDA 3IKLA 3ROPA 1XRNA 2YRFA 1OYVA 4EO4A 1K4KA 1J22A 1J2RA 1MB0A 3CLTC 4TWRA 1FP4A 4QOJA 3BMNB 2XSZD 4ER7A 4WH0A 1QFMA 5JBNA 2AI1A 2SNIE 4FOOA 1VSUA 3R3SA 4BV2A 2HCFA 2ORED 1MC4A 3Q3HA 1VKOA 3T7TA 1Z4LA 2ZBPA 1S2DA 2PVSA 2YVLA 4B80A 1LLFA 4PO3X 1ZD5A 3PHHA 1EFUA 1FYXA 4RHCA 3I23A 4LWQA 5C5EA 3H1BA 1ZG3A 1E7RA 1KJJA 1PKXA 1Q1BA 2QPLA 2W6CX 3CWQA 3E53A 2J59A 4UOEA 1COWD 3DGEC 3QNWA 2DBVO 3C4QA 5LLSA 5F2NA 3MCWA 2PUCA 4EABA 2F8MA 2FPPA 1Z9BA 2YV1A 3CKLA 1U8AA 3ISJA 1E1MA 3K5HA 5SZKB 4A15A 4HQNA 1MX3A 3VV2A 5EKDA 6Q21A 5J1SB 3MMNA 3P2IA 4MJ7A 5BRAA 1OQAA 2PGOA 4LBVA 4K9QA 2QLMA 4KMSA 4XWYA 2MTBA 3SHQA 4DY4A 4KMRA 3KYDB 3WGJA 2A5YB 1LTKA 4F97A 4I55A 2COUA 4YCAA 1JKMA 3X0DA 2X5OA 5B53A 3AUUA 1QF9A 4LISA 4LVCA 1USWA 2PT9A 5BV0A 5KYKA 4X6LA 2G71A 3FE2A 1CQXA 4L08A 4Q9AA 3SYLA 5EE0A 2BFMA 1Z5NA 2FY8A 5LN1A 2HJVA 2POCA 2BKLA 3F6RA 1JFFB 1AN0A 2ZWVA 3DD5A 4O2AF 1KQOA 1PR9A 1YH3A 2X86A 3AJ9A 4N18A 4WUTA 4RJKA 3WAKA 3ZWXA 2W2MA 4J0HA 1N1GA 3UCEA 1G20E 1N1MA 2EBFX 4BP3A 2VEOA 4RPCA 3WIOA 3T3DA 1SCUB 1RLUA 4ZU3A 5A9SB 1Q7EA 4K8RB 3OZAA 1IIRA 2JW5A 1S9DA 3S5JA 1TRKA 4JOCA 2BJVA 1A77A 2XAAA 5C9ZA 4Q7JB 1QG0A 3IQGX 3GLQA 5DSTA 3RG8A 1GNTA 4E12A 1J6UA 3CHYA 5B37A 2DY1A 1EXWA 5GV7A 1E5XA 5DHAA 4MGYR 1X1TA 4DCOA 2QUKA 3HI6A 4JUAA 3X1MA 2JAPA 2OBMA 2X0KA 4G37A 3QHQA 4F5WA 4O4HB 4ID9A 3QG5A 4NDAA 2ZRNA 1AT1A 3WB9A 5IDWA 2EL9A 2OA0A 1S8AA 2C9BA 1RZRD 1KU0A 3BCSA 4BVKA 1GDDA 2GJAA 2SKCA 2Z1DA 5DHQA 4EPWA 5A6VA 3CR7A 4HMQA 1I6KA 3E5NA 4MW6A 3FCSB 4A8JB 4ZYLA 2F59A 5CB8A 2PPVA 3O4FA 1DINA 4TMFA 3EWAA 1XTKA 5B3AA 4OQNA 2Q5EA 4U7FA 2FZEA 3D7KA 1QIJA 4MWOA 1QANA 5AKZA 1TEXA 3N76A 1F60A 2RHTA 4KVGA 4FSXA 4LHSA 4PGGA 3CS3A 5IN4A 3IYLW 4QWMA 5CU7A 5ALGA 3C7KA 1GKLA 1T9DA 4IVNA 4Y2RA 2PUWA 5A3VA 3Q8MA 4TGLA 3Q1LA 1Y8ZA 2C9YA 3Q6MA 2JLXA 4D0NA 1ODJA 4PSDA 3ZJ4A 2ZZNA 4ZU1X 2XNJA 4GBMA 2JJ2D 2DC1A 1II9A 4TL6A 5C3UA 3WI7A 4KNYA 3CPEA 4DPMA 3DJYA 3PC8A 4GP6A 4XLLA 5GJBA 2BCEA 1RP1A 3CUKA 4U2CA 2I6GA 1NG9A 3W2GA 1Z38A 1K7SN 3DBLA 1JX6A 4D9EA 4PZ9A 4G0YA 2FLVA 1GQ2A 3INTA 4EY4A 2O2HA 4K81B 4FK8A 4IHJB 1I94B 2P6MA 2PU5A 4UBNA 3R75A 3AZOA 5K8TA 3HCAA 3EZLA 4CTJA 1NQ5A 4J4TA 5JJIA 1FDUA 2O57A 4F2GA 2ZW9A 1D2AA 4M22A 1FNDA 2BZ1A 4F4DA 4KMMA 5L6LB 1RPTA 2ZSAA 3OJWA 5FA6A 4BQQA 2CD9A 3I5MA 1GCOA 4DWJA 2C8JA 4HBGA 4Q34A 1LFAA 2BSAA 4ALJA 1G18A 3TIGA 2EU8A 1RCFA 2IQIA 3ZNPA 2C95A 3KQOA 4L6AA 3AF4A 3UAYA 3L4EA 2CKMA 4NOJA 2PZKA 5REQB 5HF6A 3K9FC 2GWHA 2I65A 1IQPA 3Q0EA 3V8VA 2LWIA 5BNWA 4MGKR 4B6QA 4IKEA 4U6NA 3R7AA 3DTVB 1CY1A 1ONPA 2C9MA 2QIOA 2RHWA 4GR9A 1SVIA 4NZPA 4GWKA 1LSUA 3B6ZA 3RIXA 1RD4A 1QGYA 1XLVA 1XMQB 5J2UF 4UHBA 4P5DA 4N49A 4KR9A 5JFOA 1X15A 2BFPA 4NJMA 4LQDA 4MHOA 1ZONA 4DDHA 5HRCA 3UJDA 3DZBA 4QDJA 2C7BA 4Z7JA 1KDTA 1XLTC 3C3XA 1HG1A 1ES9A 1T1IA 2YV4A 1YAJA 1E1DA 1V48A 1NQAO 1QUEA 1Z8NA 3BE5A 3I2IA 3IT3A 3LOPA 4B6SA 3T7CA 4RZ3A 4CKCB 1EXNA 3AU8A 5AESA 2WHYA 4MS3A 4RLHA 3Q8WA 4C3ZA 3X43A 2IEBA 1E7MA 1UBSB 5G4KB 1X7XA 5EJ8A 2OB2A 2QN6A 2WP0A 4MVJI 3N87A 4ZOLB 5CNJA 3NV9A 3ND5A 4S12A 4BO2A 3WFIA 3P7MA 2PWAA 4AKEA 3VR2D 1DAFA 4FM9A 4ZDWA 5KOJA 5JS6A 2XVMA 2K7FA 2QK4A 1ZWLA 1CF9A 4AO7A 1JKIA 1FX0A 4TV8F 5KKNB 5ADWA 3I12A 2Y1CA 2V74B 4OHXA 4R3WA 4ZO4A 5H9VA 3ZHVA 1A4UA 3KBOA 1TA0A 1KI7A 2CKDA 3PZBA 4OJNA 1L7MA 2ZRIA 1PVVA 4FR5A 5F5LA 5TQVA 5HJEA 4JXXA 1P2GA 4PQGA 4YPOA 1G8KA 1Q7BA 1U94A 2QP9X 1CYDA 4ZQIA 4RVCA 4JP5A 1TCVA 4AQYB 4N41A 1PP4A 4UBMA 4FNGA 2NVOA 1ESMA 2YCLA 1Y5MA 1PLJA 4B3CA 2JH3A 1AN9A 1S89A 2HHJA 3LY8A 5M5BA 4ZOEA 3H2JA 3KQMA 3DE3X 1PG0A 3TLCA 4QDXA 2XKAA 3JAWA 3FMFA 4RKRA 1W4BA 5TARA 3V6LA 4ARZA 4N5DA 5DTQA 5IH7A 3K0EA 5IC6A 4CKZA 3VAZA 3JYOA 3G2IA 1Q91A 4J91A 3GUZA 5DT2A 3S1AA 1RPZA 4C03A 3UMGA 1G5TA 1P77A 1SAYA 3ANYB 3DZKA 2HNKA 1P7VA 5C8ZA 3CRW1 2ZUFA 1QO0D 3LYLA 2A7QA 4YP6A 4U8HA 4U0KA 1SCIA 1ZCFA 3IV7A 1DELA 3EXIB 3HFSA 3KAPA 3KWLA 4BEBA 5IYZB 3UK2A 4D4MA 2JAUA 2GKOA 3J7AC 2HJHA 2PTHA 3QLEA 2IPXA 4XVRA 2AKEA 4E32A 1EX9A 1ZA2A 3H99A 1OFVA 1S7CA 2R8OA 2AN1A 2WJGA 4G8DA 4QNMA 4YI3A 3RW9A 3HA3A 5LQMA 3A4TA 2IS2A 1E3MA 5K8IA 4QQNA 3JWGA 4NBLA 1B8VA 4PV7A 2PGLA 1NXXA 1Q2UA 2PJUA 4BE4A 2YYZA 1A9XA 4HNQA 2GXQA 1S4MA 2ZB2A 4CKBB 1CJSA 1AHHA 1P4JA 5KQMA 4ZCQA 3KC2A 3VR3D 3EG5A 2VZ8A 2NTNA 3G3EA 4FWTA 4AB1A 3NWPA 3A1EA 4JQCA 2P9BA 3FCYA 4X71A 3U7EB 1FRFS 1FJ2A 1MRNA 1DBPA 1NF3A 2B9VA 2YVUA 3PRYA 4Q1EA 3QW2A 3VI3B 1JHXA 4CCWA 2AMVA 2GBIA 2ET6A 2ANBA 1LF5A 2HMSA 3C1AA 3C41J 3GYBA 4OQMA 4JJEA 3H97A 1V8ZA 2WKWA 3QKIA 3Q87B 4CCYB 1MIOB 4Q03A 3VKGA 2XWPA 1V7ZA 4ZCTA 5THXA 5L3RA 1RU3A 1R7RA 1R12A 2QI9C 3BCUA 5ECYA 4KLAA 4DJTA 5B1IA 2ZXUA 1B0PA 3A0RB 5EQJB 2G4CA 1R18A 2CFTA 1JECA 1USVA 1QJ4A 2AFRA 2PKRA 1E4YA 3HJRA 3JSXA 5IKEA 1JIXA 2XZDA 1Q3HA 3CPJB 4UDXX 5CG2A 4RIEA 1TX4B 3SQXA 1ZICA 3PC2A 4PCUA 4YONB 4Y2XA 1XRJA 4ZV7A 5FLEX 3TKAA 4DLTA 2EKLA 3TFOA 1J1UA 1M33A 1ISFA 1ZI9A 1ZGZA 1YRQA 3ZLUA 4EWLA 2GF9A 2G36A 4LMAA 2D2EA 5K8LA 2FR1A 2NSHA 4WBXC 3ZNNA 3MTEA 3FCXA 4LVOA 1RKBA 4D79A 1AB6A 4LJSA 1OWPA 4GOLD 5DTEA 3OZIA 3IIKA 1Q57A 4L2IB 2GBCA 5JANA 4LV5B 4HGYA 2DYKA 4Y18A 1QH8A 1T3GA 5FOXA 5FOQA 3GPLA 4QLAA 3EHEA 4LOIA 4IF6A 3PL1A 4MDHA 1CG6A 1PBTA 2NZ2A 4OFXA 3P9NA 3VZPA 4B2YA 5F12A 3WQRA 1NT2A 2Z4SA 2PLRA 4Q02A 3T7AA 2FJUA 2P0AA 3BE8A 3OIUA 3LL4A 3CU5A 4K6KA 1FMJA 4UC0A 4CQMD 4NYIQ 3EF1A 2YDXA 1HMPA 2YIJA 5AHOA 5JAZA 2UUAB 1G8JA 1LVUA 2VT3A 3DKIA 5IAAA 5ELMA 1M2EA 2AEJA 3OF2A 4IOMA 3AX6A 4E4RA 4EW3A 1A8PA 1XDSA 3DQPA 1G21A 3NASA 2XWQA 3SX4A 2Q3CA 1B0ZA 5IZCA 4MB0A 3HKCB 1YCFA 2CLIB 1E3SA 4MKFA 5FLXA 4YT5A 2M1ZA 4HH4A 3E5RA 4XUGB 2AYYA 3HA7A 4GAEA 1EPUA 2INGX 4XPIB 2J32A 4MRAA 4L0CA 1BVUA 1T9CA 1VBKA 4KLCA 2PV0A 1KVSA 3AT1A 4W5OA 1MQAA 4C87A 4RA9B 5C80A 1CW2B 3MB5A 1P9LA 3ILXA 1PS8A 3ZHBA 2YBEA 5IF9A 1JPNA 5L3QB 2RHDA 1KY2A 4K46A 1KYWA 1UDBA 4IIXA 5EIBD 4YC7A 1ORHA 1EE1A 1MAAA 4JLNA 3R8XA 1D03A 3UMBA 1JSXA 3TO5A 2ZE6A 3IQWA 2J85A 5C8YB 4IFTA 4INPA 3CVUA 1DIGA 3FROA 1D2NA 1SXJE 3TRHA 2AD1A 3CRNA 3OPYB 2A1TR 4Y30A 1XEXA 2B2NA 5JS2A 1VB5A 1W0JA 3H84A 4DM4A 3WISA 2NVUA 3RU9A 3S28A 4WLEA 1C7JA 3W9UA 3RUIA 3SZGA 4MUAA 4JYPA 4Q4AB 5DM2A 3D7RA 2X2FA 3UUFA 3UMFA 3CLSC 4K9DA 1S2LA 3RIEA 3W5HA 4UTRA 3PHJA 2FFQA 3HNPA 1P31A 3QMMA 2IYTA 1DUVG 3FX2A 4MV5A 2BP7A 2Z6AA 3HN2A 4WZAE 3GNTA 4MYCA 5CXXA 1H2ZA 4Q9DA 3RNLA 3WIEA 1P0CA 4REQA 3U3KA 1J2EA 1PUXA 4CZ2A 2DPYA 4RVOA 3NX4A 4E15A 4ZEMA 1WXWA 2ZJ5A 5BN1A 2XCOA 3HR8A 1U3DA 4WNYA 5ELXA 3WZLA 4UMEA 2HLHA 2NXNA 1D07A 2XDQB 5J4KA 1KEEB 3F8WA 3SYNA 4TSKA 2HCTA 2XI4A 2KWIA 2OB1A 4CQLA 3AOEC 4B9AA 4KXLA 4G4JA 4DQXA 1SUBA 4QJBA 4E33A 2AN3A 2JCSA 2V4MA 2P79A 2Q3FA 2QMOA 1LV7A 3AVWA 3ZHQA 1Q0UA 1L4MA 1W88B 3IJ5A 2GYVA 4GNKA 3WL8A 4B09A 2GD0A 2GETA 3OSZA 5K8CA 4D9MA 2ETXA 1IHUA 2WSLA 2WR8A 1EP2B 1L7EA 1NBMA 3IVRA 3LWZA 1Q7CA 4NSNA 1RM5A 1QQAA 2H4XA 1UJCA 5A1JA 4MRRA 3FNBA 2CJFA 1DFGA 3DR3A 1WXGA 4JC0A 2GPSA 2WHPB 4QSMA 1UJNA 1QGED 1ULBA 2R6R1 3B3AA 3EJWA 4V0KA 4YPFA 2F1JA 2C84A 1GEGA 1ZH4A 1NFFA 4E1BA 4LFBB 3PI7A 3X44A 1MGOA 3E48A 2X15A 2OAEA 5DYIA 5IC4A 1FRQA 4LS3A 4YT4A 2EG9A 2FSVC 4LRXA 5KNDD 3KR9A 2RGNA 3WIUA 3W4KA 5MN6A 4I5IA 1Z12A 4Y6PA 1ADYA 3LYUA 1OLSB 1BG6A 1T5SA 2G1PA 2HGZA 2HJ9A 1NA5A 3KTFA 5K6AC 2BF7A 3LUDA 1VXRA 1EFVA 3KSBC 1KOGA 1TEHA 3WNCA 5KJFA 1WDLA 3EVTA 4LRQA 3BWMA 1MAUA 1UKYA 3K6RA 4F6RA 2VT6A 1I32A 3OPNA 4TV9B 3E2IA 5BN5A 3G13A 1YDHA 3FPHA 5SYMA 2GVNA 3VTFA 2BKEA 4CMEA 2GN2A 3N8IA 2HSDA 3TR6A 2J9GA 2CDRA 3MS7A 4UXIA 4PFJA 5I9NA 3DB2A 2X6QA 2Q49A 4LSWA 2VQFB 1M0EA 2VRWA 2B34A 3KJZA 4H7PA 2X0RA 1LLCA 3GLRA 4N5NA 1I4WA 5EEHA 5T8KA 1I8TA 1CZRA 4CCAA 2V0GA 3WMGA 1A96A 3AONB 4YVFA 3QI2A 4EPVA 3OHPA 5K45A 1KAGA 4UM9B 2NU7A 1A1VA 5JARA 1XVVA 2GZMA 1IMJA 1WE2A 4WXPA 1IHDA 4W5RA 4RXTA 4J0JA 5D3QA 3WDMA 5F2OA 3QFRA 4HRAA 4S1OA 1QBKC 1WABA 4ZEOA 4JUDX 4YO7A 3ZDRA 4AKTA 4YREA 3KAQA 4NYMQ 4OGWA 4XKJA 3GDHA 2BEWA 1D6SA 3RFFA 3QPWA 2BMEA 4N7RA 3RFXA 4NBSA 4NU5A 2QAGC 2PT6A 3ZIAA 5BQ3A 3NYIA 2P2GA 3MMSA 2Q45A 2SKDA 1R8QA 1XJQA 2QMUA 4CQJA 2QORA 5C31A 5AW6A 1G38A 4H0FA 3OE7D 3ZY6A 2R5NA 1XMVA 3MWLA 1H2AS 3DFFA