4DYDA

Substrate-directed dual catalysis of dicarbonyl compounds by diketoreductase
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
283
structure length
283
Chain Sequence
b'MTGITNVTVLGTGVLGSQIAFQTAFHGFAVTAYDINTDALDAAKKRFEGLAAVYEKEVAGAADGAAQKALGGIRYSDDLAQAVKDADLVIEAVPESLDLKRDIYTKLGELAPAKTIFATNSSTLLPSDLVGYTGRGDKFLALHFANHVWVNNTAEVMGTTKTDPEVYQQVVEFASAIGMVPIELKKEKAGYVLNSLLVPLLDAAAELLVDGIADPETIDKTWRIGTGAPKGPFEIFDIVGLTTAYNISSVSGPKQREFAAYLKENYIDKGKLGLATGEGFYRY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diketoreductase
publication title Dual catalysis mode for the dicarbonyl reduction catalyzed by diketoreductase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 108
structure length 283
sequence length 283
ec nomenclature
pdb deposition date 2012-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 4dydA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4dydA01
2C82A 4AJLA 2W2KB 2NVWA 3I4FA 2NVUB 1P9LA 1Z6ZA 4I9UA 3ETGA 4NBVA 1LEHA 3OHSX 3AM4A 3I9JA 3OJLA 4A73A 2HMSA 3OA2A 4WLUA 3ZWOA 4ALNA 5IN4A 2W8ZA 4MVJP 1ZK2A 4ILKA 5ER6A 3M1LA 1ZSNA 4W9NC 3KYDA 4BNTA 5IXSA 2ZYDA 3PHGA 2HMWA 1SZJG 4O0LA 4OSOA 3I6IA 5A5FA 3U9LA 2IEBA 3OFSA 2BI8A 1ISHA 4HBGA 4BNWA 4GWGA 3T7CA 3WGTA 4EJ0A 4GSKA 1RYEA 3OIDA 4TKMA 4R1NA 5DBIA 2QZZA 2VHYA 4YRDA 4D44A 1A72A 1IE3A 1TVEA 3I9OA 4ZRMA 1D1TA 1Q7CA 5AXCA 2YYYA 1FDWA 5T8KA 1V3VA 3ONEA 1N1GA 3UOGA 3WYBA 4Q3DA 4R1UA 2JD1A 1Z82A 4AJIA 5C7OO 5JY6A 5JDCA 5T67A 5CDGA 4E13A 2GCGA 3WGOA 1UP6A 2VHXA 2CVQA 3IQDB 2FR1A 1XDWA 1I24A 2D59A 3OM9A 4FDAA 1ADBA 1LC3A 1H6DA 3DONA 2IZ0A 5F3RA 1CETA 2CVOA 1XCBA 1VSUA 1JKFA 1UZMA 4IGFA 3NDIA 2R6JA 5C7LO 3DAGA 1P0CA 3ZV6A 3QWFA 2TMDA 3GK3A 1PQUA 5HM8A 1DIGA 4L73A 3HB4X 3AM5A 1EDZA 8ADHA 5C37A 2C7VA 4CQLB 1W4ZA 3PQEA 3COSA 1FDTA 3BMNA 3RROA 4D42A 5GY7A 1YBVA 4XB1A 3QVOA 2HO5A 4I5EA 3FNHA 1O0SA 4GAEA 4XRGA 1WW8A 1PIWA 4LSMA 3KM0A 1YDWA 4BO4A 2BKAA 1LQTA 2D5AA 3DZHA 3M6IA 2DBVO 2UUOA 3FTNA 1I8TA 3QIVA 3SEFA 1F14A 4NQZA 3BZUA 1IOLA 4ND1A 1HSZA 1N8KA 4ZQHA 3BYZA 3P19A 2AHRA 2NTJA 5A04A 4HUJA 4BNHA 1E3EA 3KYBA 4RF2A 1U2GA 1WPQA 2BFPA 4PFJA 4E5MA 4CLEA 1R15A 4Y8VA 4XJTA 1GTMA 1Z45A 4WECA 3CXRA 2QRJA 1YB5A 3DOCA 3DQPA 3OH8A 1PJCA 5JNLA 3L4BA 2ZJ1A 1YL6A 4R9RA 5TGDA 3Q1LA 3C1OA 1ZEMA 3Q2KA 4LK3A 2FZEA 1K2WA 2E49A 2FHSA 4BIIA 4CM4A 3NTOA 1SOWA 4R5MA 4W4TA 1BDBA 4YJHA 1KS9A 4YJGB 5DT9A 3ZGYA 3ENKA 4O6VA 3EMKA 3PP8A 3WB9A 1ZZEA 3OIGA 4FC7A 3C1TA 1JTVA 1R4MB 4HV4A 4ZD6A 2GZ3A 3RU9A 2HJRA 2ZKLA 3AUUA 5CAEA 5C3MA 5GMOA 3K8ZA 4CM7A 4EUEA 1GEEA 3AU9A 2VZ0A 4KUEA 3F46A 3V2UA 1PZEA 3ZHXA 1GYQA 1T4BA 3DDNA 1M6WA 3GFGA 3UF0A 3DTTA 4R4JA 4K6FA 1RPNA 1O9BA 4FQ8A 3C7AA 2HRZA 4WPGA 1UR5A 2DBQA 2QHXA 4A26A 4H16A 3T4EA 2G76A 1QYVA 3WLEA 5ER9A 3BIOA 5J23A 5ICMA 1FF9A 3GRPA 4ITUA 1R6DA 4YCAA 1U3UA 3WQRA 3AUSA 5HS4A 1GR0A 1S7CA 3DBVO 4GI2A 1BGVA 1UP7A 3PQFA 5G0WA 2ZTVA 1W0CA 4U5QA 1QORA 1CRWG 3R3SA 1E6WA 3HNPA 1PQPA 2Q1WA 4R1TA 3DFZA 1J5PA 2OUIA 4CV0A 4BV9A 3HSKA 2ZQZA 3WJ7A 4K6CA 4DPMA 4RQUA 4GX0A 3ULKA 4GVLA 4TMFA 2BHLA 4M86A 1U4OA 4JBHA 3CZRA 3QWIA 1Q0HA 4XEHA 3NAQA 4J91A 4ND5A 4RVFA 1XR3A 4TZTA 4NFYA 3PEFA 4GH5A 4XR9A 4QO8A 2ZQYA 2PD4A 4B7CA 3ONFA 3VPHA 1ID1A 3ZHYA 5JFOA 1OMOA 1EQUA 2EP5A 3ZNNA 1CEQA 3DZFA 3C7DB 3DZIA 4MVJG 1E0DA 5FI5A 3CIFA 3QY9A 2AE2A 2WMDA 2VT2A 4YAJA 3FR8A 2CF6A 3O26A 4MP3A 1LQUA 3L4BC 2Y1EA 5TNXA 4IS3A 4Z0HO 3MEQA 3TJRA 1B8PA 3I3OA 1QSGA 1XKQA 4ND4A 2WDZA 4F3YA 2B0JA 1A7KA 1A71A 2GUGA 3WXBA 1ZW1A 4Y6SA 3BAZA 4U0KA 3NTQA 3V2HA 4OO3A 4A27A 3QV1A 4HX5A 4J4BA 4LMPA 5AOVA 3E9MA 4BO1A 2ZK7A 1UZLA 4M54A 2JHFA 5MGBA 1H2HA 3G1UA 3DO5A 2JFFA 3SJUA 3F9IA 2B4RO 2Y1GA 1QV6A 3CEAA 3MCVA 3O38A 5DOZA 3HN2A 2DT5A 1N7GA 3ITKA 1M2WA 1YQXA 4D41A 3RFTA 1DC5A 3I9MA 4A7PA 5JXWA 4WKGA 1KY5A 3EK2A 1VSVA 4PLVA 1JVBA 3B6ZA 4IY1A 2B5WA 1A4IA 1X7DA 4K26A 4RVDA 4XKJA 5LC1A 4F6CA 3HQ4O 3GFBA 1ZCJA 4MIEA 1LUAA 2DBZA 3AY3A 3D7LA 3WBBA 1I10A 3JQCA 5ES3A 3FCOA 4NHEA 3RJ5A 1UZNA 1NVMB 3LT4A 4DRYA 1ISFA 2BD0A 5HRUA 3I9LA 1IHYA 4R16A 3JV7A 1F12A 2ZYAA 3F47A 2C20A 5L4SA 5TT0A 3U09A 4ZQBA 1DOHA 2IYOA 4IQGA 4NDNE 1Y8QA 4CM1A 3RBZA 3L6DA 4XDYA 3SVTA 1U3TA 4E21A 4R5HA 4RCVA 4AJEA 3I9KA 3K2EA 2FN7A 1WVGA 3UVEA 3GGOA 3KBOA 2O50A 1U8XX 2FPIA 2O4CA 2V6FA 3A28A 3FI9A 3L4SO 1YRLA 1VL0A 1YOVB 5DULA 2WD7A 4WASA 1WMAA 1BVUA 1PR9A 1W73A 4J4TA 1U9JA 1U3WA 2Y1OA 1SEVA 2VYND 4PLWA 4Q3CA 4URFA 4D7AA 1AGNA 3KYDB 2RAFA 5H82A 2YV3A 1S6YA 1OAAA 1MP0A 1F17A 4J0EA 4PZDA 3GMSA 4AVYA 1BWSA 4GX2A 3VZSA 1AHIA 1PZHA 1D4FA 4HKTA 5IDXA 1VI2A 4DIBA 5JCXA 4RZIA 3HDYA 5K0ZA 3D4NA 2I6TA 4YT8A 2QG4A 5TT1A 5HTOA 1UXGA 2Q4BA 2CF5A 3GG9A 1QV7A 3PIDA 1JN0A 1HF3A 4Q3NA 3AWDA 1DLIA 3ICCA 3LYLA 3TDKA 4L9RA 1LX6A 3S1LA 4CMGA 5TX7A 1EVYA 3MWDB 4OM8A 3WG9A 4D3DA 2YUTA 4BNFA 2B35A 3D64A 3OIFA 1PL6A 1E5LA 4NBWA 4RPLA 1P1JA 5B4VA 4NK5A 5ITVA 1T25A 1E6UA 2X5JO 2CFCA 4R1SA 5TRTA 1ZSVA 4IZHA 3I6QA 2O3SA 4I8XA 3TZQA 3KEOA 1NASA 1PGJA 2P2SA 4DQUA 1LLCA 2VRBA 4LGVA 2XXBA 4EEXA 1H9BA 4QTZA 4CQLA 4MKZA 1G6KA 4P8RA 3VH3A 3U4HA 4Z9XA 3PYXA 4MVJH 4FFPA 4GX5A 3ZWPA 5CP8A 4U6SA 1TEHA 2JHGA 3H9JA 2X0IA 3BMNB 3AUAA 1XHLA 4OKIA 3RUDA 1BVRA 4CM8B 5CG1A 4UREA 3C1AA 2FPPA 5KNLA 1YL7A 5TIIA 2H1SA 5L53A 3JCZA 2Z1MA 5IN5A 3ZU3A 3K2BA 4R41A 4TKLA 5BSGA 2NM0A 2VHVA 3H2SA 4CUKA 4XQGA 3WYEA 2GN4A 3MTJA 5BNTA 2X6TA 1JVSA 3BMCA 4IIUA 4XJSA 3IOYA 2O2YA 3NDJA 3WFJA 2VUTA 5JC8A 1GCOA 3E48A 4ALMA 3G1TA 3UGKA 3DZBA 5L51A 1VJTA 4FIZA 1EZ4A 2E82A 4CL3A 1DBVO 2WWRA 1DRVA 3BHMA 5ILGA 4A10A 3IJRA 3GVIA 1LRJA 4OGWA 1PJTA 1V9LA 3G79A 4ZN6A 2WJPA 2YV2A 4J1SA 2BLLA 1I3LA 2CDCA 5EERA 4L76A 4NNJA 4Z9FA 3V8BA 4NJMB 2VYVD 4CM4B 2O4UX 1R4MA 3R6DA 2VQ3A 5CDYA 2I76A 3MJCA 3KSUA 1C0KA 1N9GA 2EEZA 3LC7O 4W99A 4YJHB 1YB1A 4L74A 4MVJA 4XYBA 2ZATA 3K96A 3E5RA 1ENZA 1ZH8A 5JS6A 1J6UA 1PX0A 1R0SA 3DTYA 1EUDA 4RVHA 3LVFO 3WFIA 3D4PA 1YJ8A 5K9ZA 4XD2A 2NSDA 5A1TA 4DIFA 3FSRA 4WE3A 3VAZA 1ISMA 1YE3A 4BNUA 2X0RA 1U8FO 1MG5A 5A02A 2I67A 4CV1A 4X54A 4MVJF 5B4UA 1I2ZA 4R3WA 1GD1O 2PKQO 3GAZA 4JXKA 3FWNA 4CL8A 2FOIA 3B1FA 3MJ4A 1H6AA 1CQJA 2FZWA 3GH3A 4OIMA 5T6BA 3QRWA 4BNVA 3U5TA 1HE2A 5EQDA 4IQ0A 4PLYA 1LXCA 4BKUA 2B4TO 3NDRA 4RF5A 1B7GO 5U1PA 3GUYA 3L9XA 3S2GA 5EL0A 1CWUA 2NU6A 3WIDA 5A05A 1DIBA 1LBEA 4UEJA 4D46A 3OSUA 3PZBA 4BKOA 2C7GA 3RD5A 1ZUD1 2VOEA 5BSFA 3MOGA 5IAAA 1PS9A 1NWCA 4UUPA 3KLPX 5DBGA 2DFDA 2EP7A 4RO0A 3BTVA 3ADPA 4ZRNA 3AOEC 3DR3A 1O95A 3WGGA 2YQ4A 1NFFA 4J1TA 3ENNA 1DHTA 4RF3A 1PJ3A 3INRA 3DMTC 3DAPA 1I5RA 3PQDA 2D5CA 1Y9EA 1ZSYA 4NBRA 1ARZA 3PTZA 5T64A 3RC7A 3C24A 1H0KA 2JAHA 2Y1CA 1DIRA 3DOOA 2EHDA 2X22A 1P33A 3CSDA 3H8VA 1OBFO 4DUPA 4L0QA 2C2XA 2JAPA 3PDUA 5JAZA 1LSSA 2YHIB 3V2GA 1DHRA 4OJNA 5EINA 3KV3O 5EJ2A 5CFZA 3O9ZA 4GMGA 3H4VA 4GMFA 4MIYA 1NR1A 2X5OA 4A0SA 4NFSA 3RUCA 5TJHA 3NUGA 1PQWA 3H7AA 5EIOA 4CV3A 1NNUA 3ZWWA 4JQCA 2PGLA 4EDFA 3TFQA 1NPDA 4YTEA 3VPXA 4NG5A 1HWYA 3WNVA 3F5QA 5I7FA 2GO1A 1CQIA 4YVFA 5IF3A 2UAGA 5IZCC 3PFFA 4XB2A 1AXEA 4Q3AA 1Q7GA 2ILTA 1R0LA 2GPTA 2ZB7A 1R0KA 2RHCA 4ZA2A 2DFVA 2YJZA 4QX6A 4UVHA 1ISIA 1WZIA 3KSDO 5IZ4A 1X0XA 4E3ZA 3EC7A 3PI7A 4I9HA 2ZB8A 5T5QA 3H9QA 2EG9A 2HUNA 3HADA 1I32A 3JQAD 4N54A 4BQPA 4PG6A 4CODB 2EGGA 4W7IA 4DYVA 2X9NA 5ENVA 2DAPA 1R4NB 1J49A 2DVMA 2WSBA 4P4GA 4BMNA 4CR8A 5C7IO 4ESOA 1TT5B 1E3IA 3IDSA 3EVTA 1Q2XA 3JYPA 5LDHA 1RJWA 2G1UA 1VLLA 4IDFA 4IS2A 4PVCA 2VZ8A 1P31A 2DPGA 3K92A 4EJ6A 2PKQP 4RGBA 4ONEA 3VH4A 2I3AA 1ENPA 5COQA 3Q11A 4KMSA 4MPDA 3F3SA 3OF2A 4CLHA 1SMKA 1X14A 2AEFA 2OORA 3OMLA 1MG0A 3M1AA 3NV9A 4BNKA 4DQVA 3AY7A 4XQ9A 4E2YA 3GZNB 3JYNA 2A9FA 1BXZA 1H2BA 1O8CA 1GPDG 2IEDA 2POQX 1P44A 4PRKA 3H3JA 4JROA 3G3EA 3Q2IA 2D4AA 1A5ZA 3CMMA 1PJQA 1Y8QB 1LU9A 4MO2A 4XRRA 3V1TC 1YOVA 3IL2A 1HDGO 4R54A 2PGJA 1NR7A 2PTGA 2WTBA 2X9VA 5THQA 4CLOA 5IG2A 4B79A 3PK0A 4KWIA 1KERA 4O1MA 4S1VA 5CPBA 2VRCD 5JCJA 1A9ZA 5I9LA 1GYPA 2WD7B 8LDHA 2E4AA 4B7XA 1SB9A 1VL6A 1EDOA 3AY6A 1SB8A 2CZCA 2Y66A 3IJPA 9LDTA 5IDWA 2GLXA 3ZWCA 2CMDA 4RPJA 3HDHA 3FR7A 2NLOA 3GEDA 4HNHA 1B26A 1D8AA 3UCEA 1MV8A 2X0JA 1LDBA 1XU9A 2XXJA 4E4YA 3KOUA 1DC4A 2AG8A 4LCEA 1KEVA 3LC2O 3EAGA 4GX1A 4LN1A 3GHYA 4CJXA 1EUCA 5I8WA 1RM0A 1ZEJA 4B8ZA 3NGXA 2DBRA 5HWSA 1VE9A 4FFMA 3GDGA 3RKRA 3W4KA 3D0OA 3RUFA 4B3IA 1N7HA 3NGLA 1KEPA 3UCXA 4ALIA 4DBVO 2VCYA 1KEWA 4NIMA 2EERA 5I9MA 1NFRA 1HE5A 4DC0A 3RAJA 1DLJA 5T57A 4WCFA 3GGPA 1QKIA 4Z0PA 3HB5X 4B4OA 2EKQA 2ZIZA 1KVUA 3WICA 1PGQA 4JJGA 4YB8A 2XOXA 3WDSA 4KQWA 2V6MA 2EKLA 3QQPA 1HETA 1MFPA 4BGEA 3ZN2A 1YO6A 3TWOA 4R51A 4FB5A 2PZKA 3AUTA 4NZ9A 5L7YA 4UEKA 5KVQA 3ROQA 3PWZA 2H5LA 3Q3CA 2HK7A 4IXTA 3NKLA 4YAKA 2V6BA 1PJSA 1E7YA 1B0AA 1LC0A 3PHLA 2P4QA 2CVZA 4CM8A 2CDAA 4HFMA 2W90A 1TB4A 4CM9A 1GUFA 2W4QA 1SPXA 1PS8A 3KHUA 3H9EO 1QG6A 3ASVA 4NJOA 3IIEA 4TROA 4MP6A 1ORRA 5FYDA 4CQMD 4I5DA 1EEHA 3OICA 3QSGA 1DFIA 4E32A 3QVSA 3DHEA 4WNIA 3L07A 5FI3A 2BMAA 2O3UA 4J90A 2PKRA 1WDMA 3H5AA 1GADO 3IKVA 5KKAA 4FOOA 2VNAA 3RC9A 5KJ1A 4Z6KA 1XIVA 4JCOA 4PG7A 4IMRA 1R12A 2DUUA 4KDFA 3ROPA 1O6ZA 3BMCB 1RKXA 5U4QA 1YBAA 3KTDA 1FDVA 4WUVA 1LRKA 4DWVA 3TN7A 2QRLA 4BOYA 3RSHA 2X7HA 3KLMX 4BNGA 1LLDA 4YYZA 4G5HA 4N18A 5DCUA 1O94A 1YS4A 3PGXA 4NJMA 2BFAA 2OXIA 4P4LA 1EFLA 3U49A 3PXXA 2QYTA 3RFXA 3ZDFA 4R69A 1BTOA 1PL8A 4ID9A 1XSEA 1TA4A 2P5YA 5CPFA 1Q0LA 5FWNA 1I2BA 4UUNA 2IXAA 2HMTA 4EYEA 4AJKA 3EY4A 4AICA 2X86A 1I3MA 1N9GB 5B12A 3EGOA 1BHSA 3JQ8B 4FFRA 1F06A 1PJBA 3QJ5A 3FN4A 1SOVA 5JAQA 3WMWA 3PRJA 1DO8A 3INGA 2PK3A 3HDJA 3K5PA 1B8UA 5G2OA 4CMAA 2TMGA 4EITA 4Y98A 4WCFC 2DQ4A 3FHLA 1GY8A 1KC1A 4RV9A 1U5CA 1H6BA 2O48X 1L7EA 1NWHA 5AQ1A 1C3VA 1P77A 2HCTA 1DJQA 1ZVMA 3UKOA 4HFNA 1HYEA 4G2NA 4RPKA 4UVIA 3DOJA 2W2LD 3CINA 4C7KA 1U28A 3WIEA 3ZH2A 4FFNA 2UYYA 2GN8A 1LSJA 1P1KA 4XYLA 1BXKA 1IYZA 5BNIA 2PA3A 4AJNA 1J4AA 2EXXA 4CMHA 3BTOA 4JN6B 3W4JA 1DAPA 1ZK1A 3GQVA 3JQ9C 4M49A 2GRAA 2J8ZA 3ADOA 3FRJA 3HE3A 3ZWYA 5DP2A 4Q3BA 3ROKA 1HDXA 1SCUA 2VUUA 4B8WA 3E9NA 4FGWA 5CDSA 2HU2A 4DREA 1QYCA 1GL3A 1TXGA 3QP9A 2VT3A 1ZJYA 3GEMA 1HYHA 2QYSA 5JY1A 2G17A 5F5NA 4XZ3A 1OI7A 3ZWAA 4IGEA 4KWHA 3ETDA 2ZTUA 2BGLA 2JFHA 1DDOA 1IY8A 5L45A 3D5QA 2IRWA 4I1IA 3AI2A 2PZLA 4KTVE 3DAFA 1VJ0A 5I8ZA 4JGBA 1PJ4A 1Y7TA 2YHIA 1CJCA 2RHRA 4ZHSA 1GPJA 2ZYGA 1HDCA 1HXHA 4B7UA 2ZB3A 2CUKA 4OOEA 4YPOA 3CPSA 5BNFA 4GGPA 4IDAA 3WSVA 3VH2A 4E30A 2EKPA 4YT4A 4CQMA 3W4IA 2C54A 4E2ZA 1CYDA 3JYQA 4B4WA 4TZKA 5G4KA 4FPXA 1LJ8A 1YVEI 1JWAB 3ZU2A 1LI4A 3B70A 2DUWA 4P22A 1GV0A 5EN4A 5A03A 4TRRA 4D0SA 4RF4A 4DMLA 3V1UA 2Y93A 3AFNA 3OEYA 1NQ5A 1UXIA 4N5NA 4PCVA 4PVDA 3WMXA 4GWKA 4XGIA 1LSOA 1OC2A 1T2DA 1P1IA 1X7HA 2A4KA 1R4NA 2VN8A 3NT4A 4O5OA 4Y67A 3S2IA 5JYDA 4XQEA 1U5AA 2YQ5A 5GZ6A 3RVDA 1DB3A 1HE4A 1JAYA 1BG6A 2R2GA 1TT5A 3JD1A 3LT2A 3VZRA 3MZ0A 4DLAA 4B3JA 2VWHA 3Q6IA 1D7OA 3UXYA 4QUKA 4PIVA 2PY6A 2A92A 1MC5A 2O3RA 4OOFA 1PWXA 1RM3A 3QHAA 2RH8A 3GZNA 3HDQA 4XGKA 2RIRA 3IC5A 2E48A 4BB5A 4FCCA 4RLHA 1SO8A 4RVGA 1U4SA 1NQTA 3UCFA 2P4HX 2RCYA 2Y0DA 2YHUA 2NQTA 1HT0A 3MWEB 4OYRA 5KVSA 3ZU4A 2ZCVA 5F1PA 2GNAA 1E77A 3BA1A 4PLCA 4R68A 2PLAA 2OGUA 3MJSA 4TRJA 3EW7A 4HNGA 3O03A 2OBNA 5BSEA 3M2TA 5KJ6A 3E6AA 3NT2A 1PJ2A 4QFDA 4BO2A 4YA6A 2UV8A 4RPGA 4ALLA 3GR6A 3RKUA 3N7UA 4QSMA 4UVEA 3H65A 4HY3A 3RUIA 1ZMOA 5JAMA 1GU7A 1EVIA 2J5QA 4CLOB 3PHIA 1T2AA 4FD3A 2O3QA 3CKYA 1ZBQA 1U2DA 5ADHA 5DCYA 3DHYA 1P1FA 2PZJA 4PLGA 3ORFA 3A06A 3RCBA 2B36A 4OKNA 1OOEA 5B4TA 4GBJA 4MKXA 1KOLA 5KCZA 1DC3A 3T7EA 4AFNA 2ZTLA 5G4LA 2XAAA 1XLTA 4DXHA 5EESA 1EQ2A 4NBUA 2P91A 1ZXBA 1HZZA 3U62A 2D0IA 3LDHA 1EFKA 2J3HA 5BT9A 1BXGA 1E7MA 3X2FA 4D45A 4U6QA 2EIHA 2J3JA 3ZHBA 1NM5A 2AQKA 4Y6PA 1G0OA 3PPIA 1FK8A 3RFVA 4YAGA 4LCJA 2IZ1A 2CSUA 4YT2A 4EUHA 4FBGA 4BO9A 1C0LA 3CTMA 1ZK4A 4B4VA 4WCFB 1WMBA 2EJWA 4Y6RA 4YR9A 1Y6JA 2WYVA 2I5PO 4XA8A 1HZJA 5A9RA 3PGJA 2PGDA 3L77A 3TZHA 2QW8A 3GVCA 3IAHA 3INTA 3EHEA 3BMQA 1DC6A 5JLAA 1SNYA 1GYRA 2OOSA 3H2ZA 2X23A 5ICSA 3KXDA 4YWJA 3NT5A 4I08A 3FPCA 5DDIP 2LDBA 3SJ7A 4U7WA 9LDBA 1ML3A 2OBYA 1WWKA 3TOXA 4D0RA 5KJEA 3PJEA 3N58A 4MDHA 3JQGA 1EBUA 4IM7A 1Q7BA 2NQ8A 1DJNA 1I0ZA 5IXYA 1KY4A 2J5KA 2PV7A 4KDEA 3AOEA 3ZWXA 2Q46A 4A03A 3DB2A 5FEUA 3OEWA 1PR3A 1HKUA 3DMTA 2VNSA 4JP2A 1ZMTA 2AA3A 4KZPA 3I4CA 1TLTA 3GDOA 4Y9DA 3EZLA 4WOKA 4DLLA 3WGZA 2FP4A 4WGGA 3STHA 5A3JA 3JQAB 3ETEA 4D43A 4CMBA 4FN4A 5G0TA 1ISGA 3NJ8A 5AXAA 4GL4A 1Z7EA 5GZ1A 3WX0A 4LISA 1U7HA 5DNAA 3FNFA 3FF4A 1DPGA 3VVBA 4LRTB 2YFQA 3I5MA 1B3RA 4LVCA 4G81A 1BW9A 1C1XB 1NX6A 3O8QA 4IDGA 4BMSA 3TF5A 3JQFA 3JQEA 3DZKA 4OMUA 1QR6A 3WQQA 3X2EA 3JQ7B 1RM4A 3UFXA 4CMJA 2IDZA 3DXFA 1YB4A 1YH3A 1YJQA 3UICA 4CUJA 1GUZA 3JQ8A 1ONPA 3VDRA 5IZCA 3U4DA 4NFHA 1AN9A 2O2SA 3F4LA 1R37A 2HRBA 1V6AA 4J16A 4KQXA 3IMFA 1NHGA 1HL3A 1XWFA 5A06A 1B15A 2OZPA 1MA0A 2OHXA 2ZJ0A 4E33A 4JBIA 2BF7A 1BRMA 2VHZA 3DEYX 4PZEA 2YZ7A 1PWZA 3F1LA 3RIHA 2PH5A 1GV1A 1T4DA 4MVJI 4MVJM 2VYNA 5AXBA 1Y81A 2EGHA 3ANLA 1VKNA 4YBZA 3WR5A 1IB6A 1YWGO 3QE3A 1E92A 2DPHA 1B2LA 2PFGA 3ANMA 4INAA 4CM5A 4C4OA 3A9WA 3PLRA 2NU8A 5JDIC 1LTHR 3ZNQA 3RASA 1MGOA 3LT1A 3PDJA 1U3VA 3B1JA 3CMCO 1YQGA 3GLQA 1WZEA 4UAGA 3JQDA 3GDFA 3TNLA 3W8DA 4CLXA 3L6EA 4Q39A 3LK7A 1IZ0A 4J7XA 3TSCA 4KP7A 1XYGA 3AJRA 3LT0A 4EEZA 4W6ZA 4DIOA 4XYEA 5KOIA 3QWHA 3VPGA 3KUXA 3L9WA 3C8MA 4XCVA 4DL9A 4EZBA 1J0XO 2Y67A 1RYDA 3D4OA 3QVTA 4YT5A 1NPYA 2P68A 5JE8A 1WDKA 2VWQA 1NVTA 4MOWA 3K30A 2NTNA 1E3SA 4AJPA 1IUKA 5L3ZA 4BO6A 1NBOA 1SBYA 1MLDA 2DTEA 2IE0A 1EVZA 3WWZA 4AJ2A 1I33A 3PFWO 3F4BA 1PGPA 2EW8A 1GQYA 2IXBA 4BNIA 1OZAA 2Y0EA 5GZ3A 1UAYA 4IJWA 4PG4A 4QQRA 2HAEA 4M89A 2Z95A 4E5KA 4B4UA 2CY0A 2C07A 3AK4A 2BRUA 2DM6A 3E82A 4MJLA 1UXJA 2HMUA 3D5TA 4OQYA 4LW8A 4XDZA 5HBRA 4J3FA 1VJ1A 2GF2A 1NAIA 1AXGA 1DRUA 3O4RA 3V1YA 4QO7A 5CDTA 3I9NA 3ONDA 3RUAA 2HDHA 2CNBA 4N7RA 2NUAA 3ZCXA 3U4IA 2F1KA 1M66A 4JNKA 4N5LA 2QQ5A 5CEEA 1BDMA 1NXQA 3K31A 2JCVA 4PG5A 1T2CA 1Y8RA 3JQFC 5I7SA 4OXYA 2OMEA 4P38A 3ZW8A 3WTBA 4Q9NA 4IUYA 2AQIA 4ZQGA 3E5MA 4BKQA 5IJZA 4E2WA 3I23A 5I7VA 4DBZA 3BTSA 2YFHA 3W1VA 1E3WB 2A94A 2C2YA 2AXQA 4XYGA 2WYWA 4CQMB 4J6FA 5IDQA 3HFSA 2I99A 1T26A 4EGFA 2AE1A 4WK6A 3VC7A 3MJVA 2NNLD 4IJVA 1Z73A 4NMHA 1EK5A 1UAGA 5G4KB 4GKVA 3HHPA 3GA0A 3GG2A 1EE2A 3BHJA 3WGIA 2QRKA 4E31A 2AMFA 4CM6A 3NX4A 1PSDA 1QXSA 3Q0EA 5TS3A 4AJHA 4BHTA 4J1NA 2AEJA 3MJEA 3WNQA 2JJYA 1E7SA 4IXWA 3OA0A 3BHIA 5H81A 1PS0A 4BV8A 1FJHA 4XGNA 1ZK3A 1K3TA 1KVQA 1AE1A 4MKRA 3S55A 1UXKA 4ZQFA 4CUZA 5BR7A 5L40A 2GR9A 3WGHA 1C0PA 2VYVA 3KEQA 2Y1DA 2NV6A 4WLNA 3DWFA 2Z1NA 3GNTA 2CDBA 3D3WA 4ZU3A 4DGSA 2ZB4A 5HS6A 3AI1A 4BMVA 1B8VA 4IQ8A 3VZQA 4GKBA 2VOJA 1HRDA 1LDMA 3EUWA 1G1AA 1I30A 3QVWA 3VH1A 3ZWMA 4BNMA 5KIAA 1E1NA 1F8FA 2BH9A 3R1IA 3IUSA 4E2XA 3GN1A 3WGYA 5K6AA 3PYLA 1DIHA 3ZWBA 1NYTA 4S3MA 2WE7A 3PVZA 1UP4A 1IPEA 1UXHA 3FD8A 5F1OA 3TL3A 3GY0A 3JD0A 3UAGA 1PGOA 2J3KA 2Y0CA 4YAIA 5JBIA 4UUOA 2JCXA 3BXXA 2Y1FA 5DN9A 2AW5A 3A14A 1MFZA 2BFOA 2X0NA 3DMYA 1YL5A 3PYMA 4WLEA 4A2CA 4ZICA 4M1QA 1QYDA 3JD3A 2YV1A 5G0VA 1E1MA 3QA9A 4J2OA 2HLPA 4CMIA 4J7CA 4OAQA 3NJ4A 1A4UA 4WJZA 2EW2A 5BQFA 3EZYA 3GHHA 1ZNQO 5TQVA 3MJTA 3H6KA 1KBZA 3JYLA 4FSHA 4CR6A 3GUCA 1NVGA 2B37A 4YQYA 7ADHA 3TPCA 3GVXA 4CR7A 2WE8A 1DIAA 5L95A 3AU8A 3VDQA 3P2OA 4DYDA 3CUKA 4KTTE 4CLRB 5L4NA 5AVOA 4NK4A 4AJOA 1V3UA 2FWMX 4F6LA 2VHWA 3E1KA 1FXSA 4FJ0A 6LDHA 4BKPA 4I9NA 5A9SA 1BXGB 3LLVA 2FPGA 1Z7BA 1ZJZA 3ZZNA 1F0YA 2X58A 4AL4A 3JTMA 3LSYA 4DTIA 1ZIDA 3OQ1A 3JD4A 3KETA 3DBHB 2PWZA 3K6JA 1GFSA 2Q4EA 2D8AA 4DPKA 1SAYA 2Y99A 1TI7A 2PH3A 3KRTA 1MXFA 4R9SA 3U4CA 2QX7A 2ZCUA 4IZIA 2FR8A 3OQBA 1GAEO 4JBGA 3W6ZA 4UEOA 4AJ4A 5DP1A 5I7EA 3GOHA 1R16A 4BNZA 3B1KA 1Z74A 4HP8A 3FWZA 2V7PA 1LNQA 2C59A 2NU9A 2GN9A 5TLSA 2Q45A 3F1KA 3BMQB 3VVCA 4RLSA 3LZ6A 1KVSA 4IDEA 4W82A 4II2A 1NQOA 2X5KO 1O5IA 2QZ9A 4U0JA 3JQ9A 1T1RA 2GERA 4XIYA 4F45A 1K6XA 5G0UA 4GSLA 3JQGB 3JQBC 1HDZA 4KUHA 3AM3A 3UUWA 2FMUA 5K6AC 1E7WA 2PD6A 4LSWA 2E37A 3KSZO 3AFMA 4JX8A 5KJCA 1SEPA 1FDSA 1XGKA 4BNJA 2B5VA 3ZHZA 4G65A 5DZSA 1AUPA 2C0CA 2YW9A 3JQAA 3DZGA 2C5AA 4RVUA 4UVDA 3NTRA 3DBLA 2IZZA 3CE6A 4IJKA 5KVVA 3F5SA 2I65A 1DRWA 1H6CA 4MP8A 4OQZA 5BSHA 1DXYA 5IDYA 1JU9A 4BNLA 1C1XA 1HEUA 4RORA 3GVPA 1JQBA 1T1SA 4FS3A 4J4HA 5CDUA 4DPLA 3JQ7A 2OP0A 2PZMA 3GNQA 3HUDA 4FR5A 1RWBA 4HWKA 4ND2A 4OXNA 3WQSB 1EBFA 4YJFA 3Q9UA 2G5CA 1ULSA 3CH6A 4J49A 5TSDA 4R3NA 4BUCA 1BW9B 3O8QB 5EQFA 1L1FA 4CMCA 4K28A 2A35A 1XQ6A 3E03A 2B4QA 1E7QA 4GPD1 4NU6A 2XPCA 4FW8A 1NQAO 1KVTA 1AHHA 4HFRA 3TQHA 4YQZA 2DU8A 1JDJA 3DBRA 5AXDA 4PG8A 2NVBA 2VTDA 3PHHA 3QWAA 1P0FA 1P74A 3GT0A 1X7GA 3SLKA 3ZV3A 1YBMA 3WTCA 1V0JA 1T24A 2VRCA 1PZFA 3VOSA 1ENYA 4PLHA 1EMDA 5G0SA 1GUYA 1ZKMA 1D3AA 1XQ1A 1PJLA 1L7DA 1VL8A 4NBTA 3ST7A 2Q1SA 4FOSA 3SBOA 2JKVA 4IINA 3K73O 3EYWA 3H5RA 4GVXA 4XR4A 4J2HA 2Q2QA 5T8KC 3P7MA 1H94A 3GEGA 2OL4A 1UUFA 2NADA 3RI3A 4AJ1A 1IL0A 4FJ1A 1JW9B 4NI5A 4BGIA 1D1SA 2IODA 4BO0A 5JDCC 4C7JA 4L4RA 4DLBA 3VZPA 2E6UX 1KEUA 3LF2A 4FC6A 2AEMA 4XYMA 3W6UA 1K6JA 2GDZA 3ICPA 3ON5A 3GN2A 3ZV4A 3ROMA 1EK6A 3B20A 1LLUA 1NFQA 2O3JA 3PJGA 3LLSA 2GASA 2HQ1A 2OFPA 3N74A 4D3SA 4YRBA 4U8GA 4WCDA 2BGKA 3A4VA 3OECA 4YRAA 4E0BA 3K9QO 4KOAA 4ALJA 4E5YA 5ITWA 1X13A 3HJAA 4P4NA 1E3LA 1E7RA 1UH5A 3WGQA 3BMOB 5MDHA 4RVSA 1IULA 2NU7A 3QWBA 3ZNPA 2FSSA 4OH1A 3ZU5A 5JSFA 3FNEA 3KO8A 4NU5A 3NYWA 3WJAA 1YONA 1JLLA 1WAMA 4TRMA 1MC4A 4R01A 4JIGA 3HFGA 1WXDA 4FFLA 4RJTA 1H9AA 2X1HA 4NPCA 5F1KA 2O23A 1C1DA 3VHRA 3ZI0A 3I83A 4GGOA 3U0BA 4BO7A 3HG7A 1XG5A 4QXMA 3KYCB 1N1EA 4E12A 1N92A 3OJ0A 1E5QA 2HJSA 3IP3A 5LCXA 4EBFA 3I52A 2V65A 4B3HA 1E1KA 1ONOA 1VM6A 4E5NA 5JAIA 3G49A 4BGVA 1E3WA 1Y8RB 4RDIA 4HXYA 4YXFA 5A3VA 1LDGA 1N2SA 1EE9A 3GNSA 3VTFA 3LF1A 5ILOA 1JWBB 3T4XA 5HA5A 4ROSA 2RH4A 3FPLA 1YXMA 1U7TA 1I36A 3AW9A 1QP8A 5ENDA 3GPIA 4ZVVA 3S2EA 1ONNA 2YDYA 1QLJA 1PL7A 1HDOA 1EUZA 2GN6A 1N5DA 2JCYA 3DL2A 5FFFA 4BNYA 1P45A 1MUUA 1O89A 1M75A 2C5EA 2PNFA 5JMPA 4O63O 5JW6A 2VTEA 5CG2A 2NWQA 4WLFA 1IPFA 2EWMA 4M8SA 2H9IA 4M55A 2Y05A 5FF9A 3GF4A 2J6IA 4ND3A 3OETA 4MVJE 4J9VA 1LRLA 1M6HA 3QVXA 1Z75A 4PLTA 3WS7A 1RM5A 4TSKA 1P3DA 1KYQA 3OJEA 3VKVA 3RC2A 4CMEA 3D3WB 3JYOA 3E8XA 4H3VA 1ADFA 4J1QA 1DFHA 4FGSA 3PJDA 4PGFA 1A27A 3R0IA 3R3JA 3C3XA 3JD2A 3HWRA 1ZO8A 2Q2VA 1JKIA 3A1NA 1K6IA 3GC6A 1IHXA 1V8BA 3UN1A 2WM3A 1F8GA 2PD3A 3ZWVA 3G17A 3DC2A 1V35A 3GPDG 1X1EA 5TJ9A 3FNGA 2AQ8A 1Q0QA 4PZCA 3GZ4A 4IBOA 4MIOA 1VRWA 2W2LA 3P2YA 5DCWA 1HTBA 1NPTO 2I66A 1MB4A 4PLPA 2GSDA 3WSWA 3QW2A 1M76A 4YJDA 5LDGA 2GYYA 2GZ2A 2W2KA 3E9QA 2OP1A 4OHUA 2NVUA 2BI7A 4J0FA 1LDNA 4PRLA 4L8VA 4MVJD 4BNNA 2NTVA 3ASUA 5DF1A 4ZQEA 3ITDA 3MTGA 3PWSA 3UH1A 1E6EA 3C7CB 1XU7A 3GVHA 4UUMA 3L0DA 4L4XA 4XX0A 3JSAA 2J3IA 2I3GA 2WD8A 3HZZA 4HFJA 4CMIB 4JJFA 1HDYA 2R00A 4BO8A 1VC2A 1B16A 4QEDA 3TOZA 2DC1A 5C5IA 4CLRA 2F00A 2UDPA 4HADA 4YDRA 4RDHA 4TVBA 4JK3A 5L4LA 1VPDA 1QLHA 3JQ6A 4WEOA 3SC4A 1I3NA 3AI3A 3P5SA 4GLOA 1KC3A 1C14A 2PR2A 3TFOA 1PU2A 2Y68A 1UDBA 2DTXA 4N5MA 5EMHA 3AOGA 3DBHA 1CF2O 5THKA 1ZXLA 3BTUA 4OXKA 5L7WA 3RC1A 5A9SB 3IP1A 4BS9A 4ALKA 2EV9A 1V3TA 4TWRA 2VWGA 1HSOA 1Y5RA 1UDAA 5JDIA 2O7SA 2HK9A 3DFUA 5KWEA 5JC1A 2UUPA 4H7PA 4Z0TA 4FFOA 4PN3A 2Q1TA 4BKRA 2BGMA 2Q49A 2P9EA 2RBEA 1QMGA 4BB6A 1PEDA 2H6EA 3M2PA 1YGYA 4EI2A 5COAA 2AG5A 4RL6A 2JFGA 1H5QA 3ZNOA 3RJ9A 3DZJA 1QYWA 3OQ6A 2B69A 3PWKA 4CMEC 3ZWNA 1HLPA 3D1LA 1I2CA 4O59O 3LQFA 4A5OA 2P9GA 5TC4A 2Q99A 4DQXA 4ZJUA 4IDDA 2EJVA 1T2FA 4FJ2A 2P5UA 2YDXA 5JMWA 3WBFA 4BVAA 2GGSA 2D1YA 2O3TA 5A4DA 4CMKA 2FY8A 5COBA 3W8EA 3G0OA 3OP4A 5F5LA 4BO5A 1LSUA 3OBBA 4H15A 4QFCA 1I3KA 2HMVA 3SC6A 7MDHA 1GDHA 4GQAA 2Q3EA 4DA9A 3DBLB 3FBGA 2XF8A 4IMPA 3WLFA 3GMDA 1E3JA 3GRKA 1LDYA 1TT7A 5KTKA 2B83A 1ZFNA 4J9UE 2IYPA 3LU1A 1GEGA 1X1TA 3CZMA 5CEJA 2Q2WA 3W8FA 4NH4A 3D3EA 1BSVA 1SC6A 4IPTA 3PIIA 4LRSB 4YJFB 4TVOA 3V5NA 3OJFA 4D3FA 5CEFA 3I1JA 4RQTA 2R00C 1PTJA 3PJFA 2QIOA 3ZV5A 3KB6A 2GD1O 2HKIA 2NACA 4BGUA 2DTDA 2Q50A 2I9PA 5DOVA 3CTVA 3KZVA 4XQCA 3DBRB 1A9YA 1H93A 1NTOA 4BNXA 1WNTA 4TQGA 4YJGA 3IUPA 4L75A 1T2EA 2BELA 5EPOA 1NAHA 2H63A 3ABIA 1HE3A 3TL2A 4AJJA 1WLYA 2JD0A 3WOHA 3TZ6A 1JKJA 5KVCA 1UDCA 1Y9AA 1Q1NA 3U3XA 4JP3A 1NP3A 4QECA 4BQRA 1MXHA 1DEHA 4WNCA 4QT0A 4BL5A 4TRNA 1CIVA 3RQSA 4JJIA 4Q3EA 4WEQA 3RUHA 3WWYA 1DSSG 2BFMA 2VWPA 2VUSA 1P1HA 3KVOA 4I5FA 1K5HA 3WYCA 4UULA 2W98A 4L4SA 4EW6A 4IIVA 4E5PA 1VKOA 3RBXA 4KUGA 1BMDA 1DAOA 3RWBA 5JO0A 5I9NA 4OL9A 1PGNA 2D3TA 3PLNA 1KIFA 1B3BA 4IDCA 3L6OO 4LVUA 1X15A 5L9AA 4CPDA 4EUFA 3NEPX 4OSPA 3RBVA 1ZK0A 1OC4A 5JCJD 1YKFA 2GZ1A 2HK8A 1EVJA 2DKNA 3Q9NA 4DMMA 3EVNA 4PLZA 2EF1A 3BMOA 1FDUA 1XEAA 2FRDA 1R66A 3MOIA 4AG3A 1LLQA 2Q1UA 4WLVA 5IFLA 4RZHA 3S2FA 5AYVA 1KVRA 3RUEA 3QLJA 3TZKA 3VPSA 4IDBA 3E18A 3ANNA 4J7UA 3C85A 4ZGWA 5B37A 4E6PA 1I01A 5KJFA 2FR0A 1GQ2A 4YAEA 3DHNA 4JLWA 3S8MA 4DVJA 3KYCA 2JL1A 4EJMA 3SX2A 5A9TA 1KETA 3FBTA 5JPIA 3PZRA 1WDLA 2J5RA 1C0IA 2JD2A 5U9CA 1C1DB 1GQQA 4II3A 1P1RA 4F46A 4J43A 2O7QA 5H83A 2VZ9A 4XWYA 2P9CA 1B14A 2X9GA 1K89A 1HYGA 1ADCA 4IJUA 1Y1PA 2WYUA 3VPFA 5KKCA 4W9NA 3TZCA 3UHAA 2V6GA 1GCUA 3NRCA 4CV2A 4Z3KA 4Z3DA 3VKUA 1JA9A 2CD9A 6ADHA 2D2IA 4UVGA 5B1YA 1LDEA 4Z9YA 2ZTMA 4RPHA 3SXPA 4K9DA 2G82A 3FTPA 5A5EA 3RU7A 4DC1A 1GZ3A 1A7AA 2OO5A 1WP4A 1XELA 3OJOA 4GLLA 1ISJA 4I5GA 4K1LA 4MINA 3EDMA 1U1IA 1ULUA 1JAXA 4PLFA 2LDXA 2Z5LA 3TRIA 1OFGA 1YQDA 2G0TA 2HSDA 1GZ4A 1MX3A 1QRRA 1Y5MA 1ADGA 2YY7A 4CM3A 4CM9D 2ET6A 1E1LA 5JO9A 1G0NA 3HN7A 1K0UA 3UW3A 5L7TA 4WLOA 3H9UA 2DLDA 1HLDA 4BO3A 1XA0A 1DFGA 1W6UA 1CERA 1ENOA 3PHJA 1PZGA 4M87A 1M67A 1QYXA 2FSVA 3JQBA 1YDEA 3LC1O 2C29D 3GAFA 3ZW9A 3IS3A 4YEDA 2SCUA 1NHWA 1LA2A 1UJMA 2UVDA 1GZ6A 2X8LA 5F21A 1W8DA 3IKTA 1HDRA 1IZ9A 4WOJA 3H3FA 4YACA 3H9GA 3F6YA 4LMRA 3SLGA 4CLDA 4W7HA 1FMCA 4NR0A 4D79A 5JYEA 2AQHA 3VTZA 3GGGA 5DBFA 1X0VA 2WEKA 4XIJA 1CDOA 5TF4A 5CHEA 2X4GA 3H5NA
chains in the Genus database with same CATH superfamily
2RFLA 2C82A 2PAAA 3LNTA 5LZ8A 1QF6A 3AF3A 3EUEA 4KE7A 5CK4A 2NVUB 3TAXA 4Z4IA 2FEPA 1PV2A 1AF7A 2CMGA 4NBVA 5KNDA 3CONA 3I8SA 4V1CI 3SZ3A 3C8DA 3NQ41 4KHZA 3DLCA 5KTOA 1EFVA 4L9WA 2CXNA 1DELA 2B2NA 2WR8A 4M0DA 2FPIB 3NTVA 2WT4A 2AUNA 3NBKA 4ILKA 1XEXA 4NZZA 2JJQA 5ER6A 1VHWA 1XTPA 1ZSNA 2IXEA 3KYDA 2PRIA 3NBQA 4TKUB 3TUIC 5IXSA 1RZ3A 1GTG1 3FCSB 1UBEA 3PHGA 2AFIA 5K03A 3IHTA 1YZVA 4JLAA 1SZJG 4YRZA 2XJ9A 1WV1A 1D6SA 2IEBA 5I45A 1ISHA 2QGZA 4HBGA 4BNWA 3LE8A 3ZCSA 1WB5A 4QXOA 1RYEA 4OHMA 3LW7A 2ZJYA 4Z4GA 4ENSA 4EQZA 3B3GA 4S1PA 1G8GA 4D44A 1A72A 2FG5A 3HY4A 4H18A 1IE3A 3EGCA 3GLFA 2C9CA 1WG8A 4DCVA 4L57A 3I9OA 4EFMA 1Z5NA 3MXTA 1EAYA 3BE6A 5AXCA 4BUJA 1EUYA 2F9MA 3NIFB 4QU5A 2C00A 2FWAA 1N2EA 5H80A 5CVTA 1T8WA 1CDDA 3FVRA 3H5OA 5L8VA 2JD1A 1VHJA 2VK1A 3MGCA 1XEFA 2I8CA 3QPCA 1RMTA 1G291 1T6YA 2ZI7A 3MOSA 4WK4B 4AJIA 1PNRA 1NVAA 3E8SA 3WGOA 3OVMA 1QPBA 2FR1A 4K9SA 3WL7A 5MN6A 2D3WA 1R5OA 1QHSA 5JD6A 4I50B 1SCKA 1ADBA 2JHPA 1Z4PX 2NXJA 1H6DA 1RZUA 2C4NA 1LZKA 2R25B 2XX3A 3NU1A 3S5UA 3ODPA 1E1QA 4B43A 1VSUA 1CXZA 2GJ9A 5DNEA 3DXYA 2HQOA 2H06A 4BJHB 1PI3A 1T3SA 1NP7A 2Z4RA 1OXKB 2YXEA 3EMBA 3NDIA 1NU6A 2PVSA 3E9ZA 1SXJC 3H9BA 4OJQA 2NUBA 4R05A 5CLGA 1KK0A 3CQ9A 1T8UA 1P0CA 3OQPA 4G9BA 4KZKA 2JA2A 4CE6A 4YJ3B 4REQA 2EX1A 2SECE 2FW9A 1Q50A 4QGAA 3RYCA 1QVZA 1DIGA 2V7QD 3D1VA 2HO4A 4QTUB 1XNQB 1E79D 3AM5A 8ADHA 1UBGA 5C37A 2VXYA 2YN2A 3PQEA 1YNOA 4MKFA 2JFXA 3RROA 4DWOA 1WEKA 5GY7A 4XB1A 1YASA 2GPNA 1XVVA 2HO5A 4YR7A 3FNHA 3ELWA 1KJWA 4FUTA 4P98A 3PDCA 1WKVA 1QO0A 4WKOA 1TYDE 2ZR0A 4LSMA 3WRVA 2NSJA 2GT1A 4EL0A 1YV9A 3M6IA 2D5AA 3DZHA 4U9HS 3UJBA 1XRSB 2XUDA 3OPXA 4A91A 3FTNA 2W0SA 1I8TA 4I55A 2RHDA 3QIVA 3W79A 3VYUB 5H02A 2C4UA 2VP3A 4GZ6A 3BZUA 4ND1A 5EE0A 2ZI6A 4CL0A 4BCBA 5BPFA 2BGRA 3EIWA 2AHRA 1RPZA 3ZBTA 4HUJA 5EXXA 4DQ0A 1RWOA 1E3EA 3O1IC 1C3JA 2IU3A 4DR7B 1U2GA 4E5MA 2OO3A 2XV1A 3EIFA 1ESCA 1TIBA 3EIHA 3LK6A 2OBXA 5DB4A 4Y8VA 4AWAA 4Q05A 3ADKA 4U2DA 1GTMA 3RSOA 3IVMA 2PGIA 4QGFA 3CXRA 2VIIA 4WECA 3DQPA 1YB5A 4UEWA 1PZXA 1PW5A 3CN7A 3NWBA 3FFWA 4NWIA 4O4HF 1GPMA 3H04A 3NDPA 4KAFA 3C1OA 2OLEA 3RNOA 4KWCA 3QE9Y 3Q2KA 4F8YA 2KHZA 2J7PA 2CFIA 2O1EA 3HCEA 3CYFA 2FWIA 4MQBA 3ZI4A 3CCCA 4D3YA 4AZTA 4RFSB 5H3HA 3EXG2 1DINA 1UMDA 1V5EA 1RPTA 3P0FA 2ECQA 3PPVA 3T1QA 4OHFA 2R7NA 2ZJ7A 4YUVA 4O6VA 1B74A 3E53A 3VZDA 1RYFA 1ZZEA 2GUWA 2A0WA 2RMKA 4GPIB 3OIGA 3DT8A 1RXWA 1O5TA 2GLUA 3C1TA 3EQ9A 1L4NA 2C5LA 3LC0A 3FCAA 4PTLA 4E88A 2HM7A 4QVIA 5C3MA 3K8ZA 2ZAIA 3T1OA 4CM7A 2PSEA 4COOA 3DVQX 1YT5A 3AU9A 4KUEA 3GLIE 1N2BA 2QLLA 3P9YA 1PZEA 1P2DA 1DARA 2BEUA 3U39A 1GYQA 1T4BA 3ZS8A 2JARA 3RIMA 4TTAA 1P7PA 3TSYA 2CJYA 5HOEA 2BIFA 1E5VA 2J45A 4FYXA 5C8VA 3AM1A 3CNEA 2HRZA 3G2KA 3IUBA 4E11A 4A26A 2IW3A 2DHQA 4BQQA 2IW1A 4PZ0A 3QEMB 3T4EA 1KYIA 4QJBA 2O2JA 1EWYA 5ER9A 1S4MA 1LD3A 1Z6XA 4ITUA 2TYSB 3X1KA 3IULA 2G8NA 2COKA 2YTZA 1N5OX 3ESRA 4FILA 3WQRA 3PQCA 4GI2A 4GW3A 2UZ1A 3PQFA 1OXXK 4MJ7A 4EB6A 4FE4A 4UW9A 3W8NA 3UGQA 1W0CA 4TLMB 2LCFA 5IJAA 3VBCA 3MTBA 4M0MA 1Y4UA 1YZHA 3PNLA 3RODA 1ZM9A 3R3SA 1U8ZA 2PNJA 2QJRA 2X7JA 3Q10A 1YNSA 3P9KA 3SS8A 1SCAA 1NE7A 2BV3A 1XCLA 2AWOA 1RWVA 3COZA 3DFZA 1J5PA 2EW1A 2OUIA 3IR7A 3HSKA 2ZQZA 4B2IA 1ECFA 3M1YA 1YMVA 1VA5A 3CT4A 3C7KA 3ULKA 1PHPA 5LYJA 3IBYA 3X2SA 4YMVA 1EWQA 1JA0A 4M86A 1PNOA 3KLOA 4JBHA 4JH0A 2V0GA 2HK6A 4XEHA 3QOYA 3G2QA 2X4IA 3NAQA 2OQ2A 2WWHA 2BUAA 2OG1A 2QJFA 3K9WA 4J91A 3ZLTA 4F3KA 4RVFA 5KI6A 1PE0A 3SJCA 4F5EA 1JSCA 4Q02A 3B7WA 2FEWB 2DKOA 4PX5A 3N2ZB 3M7IA 3EZGA 3PNMA 1GDTA 3ONFA 4U2GA 3LBNA 1ZGZA 4X91A 3Q7PA 3C5VA 3RJZA 5FOUA 1N6NA 4DF3A 3DZFA 5HHTA 3C7DB 1ZH6A 5MF6A 3IOEA 2BDEA 3VSEA 1GU0A 1KPHA 3FKSA 4CKWA 3Q0IA 4K87A 4U3JA 4CU5A 1PK7A 1WXWA 2WTEA 3COYA 4F97A 3QY9A 2PLNA 2AE2A 1G60A 4GU5A 4EW2A 2WMDA 2VT2A 4EPXA 4J0JA 3IBFA 4YAJA 1TC2A 4D3ZA 3HJHA 4JGGA 1LQUA 1G3UA 1AKRA 2Y1EA 3SC2A 1N5JA 5LQJA 2V8OA 2XT0A 3VDXA 4FFBA 4MUBA 4RTRA 3MEQA 1JG6A 3EC2A 3FOEC 4OMCA 1F20A 4HPXB 4Y2YA 4YPFA 2OWDA 3RYTC 1A71A 2GFIA 3D0QA 5DHRA 3WXBA 1XL1A 3EZ2A 4HGRA 4KPUA 1CUZA 1JSZA 4Y6SA 9ABPA 2P8JA 1L4FA 1NXTA 3C0KA 3OF5A 4BRWA 1XNRB 2QMQA 3MCUA 5BVHA 1CZUA 3FMVA 4ISBA 2WHYA 2W6ID 2GCOB 3ITNA 3LX6A 4JJAA 4PS1A 2GBGA 1CUGA 3E9MA 4OAPA 3ROXA 4EI7A 1JHPA 4FLFA 4B87A 2JHFA 3QU5A 1H2HA 5BYJA 3SJUA 3GFFA 3J80A 1JEQB 2NT3A 1B1CA 3EFEA 4O2AB 1NLZA 1F9EA 1KJIA 1X9IA 1Y1KE 3H99A 5ISMA 3CEAA 2ZRGA 1UKZA 5DOZA 3Q3JB 1FCJA 1NJ8A 1Z8FA 3ENVA 3HLKA 3V4PB 4D41A 3CF6R 1U3DA 4CFSA 4EJ2A 1DC5A 3I2YX 3ELDA 3F6SA 3IYLW 4DCGA 2Z3WA 3K20A 5FHQA 2IYZA 3RSCA 1H4QA 4FKMA 2FW8A 3B6ZA 4ICIA 1X7DA 2BMFA 4IVRA 1J5EB 5JADA 3LJKA 2YJ5A 1Q1QA 2NP7A 1CF9A 1S7GA 2R84A 1EGQA 3OIVA 4LKOA 4F6CA 3ZCQA 2ZBGA 4JBYA 3UENA 4HCJA 1GL7A 3IOBA 2VL7A 3QFCA 4MA5A 3TCXB 1MU0A 4EHNA 1OH7A 1N3LA 3SJZA 4D8WA 1PUIA 3N8GA 5JQWA 2C1XA 1YTUA 1UZNA 1G59A 3VNQA 1ISFA 1GUAA 4RL4A 2YMQA 4TV9B 4Y2UA 1JDBB 5A4MS 1IN1A 4YUZA 1ND5A 4QC2A 1W1UA 2GZAA 3HJGA 1QFJA 4R16A 1SOMA 3PUKA 5HMMA 3AL0C 1X8KA 2G70A 5C8YA 2AR9A 1F12A 4MV0A 1IN7A 2NYUA 2RHWA 3ME5A 4ZQBA 4QBTA 2IYOA 1V95A 4ES6A 2WHRA 1L8QA 1Y3IA 4IQGA 4NDNE 5K0CA 2RB5A 5IJWA 3K9CA 3L6DA 1ES9A 1S2IA 2BCGY 1YQ9A 2NSHA 2A59A 2WNSA 3DP9A 4JQSA 4NYIQ 4YCBA 3BK1A 4E21A 5D87A 2X3UA 4RCVA 4AJEA 3W7VA 2WT9A 5E4JA 4AX8A 1WVGA 3V8RA 2F8TA 3EIEA 3OZUA 3BIXA 3GGOA 3MT9A 3INYA 1XCGB 2O4CA 3K7EA 1IXRC 2FPIA 2Q8PA 3U44A 3L4SO 5LXTA 5BR1A 4B4KA 2O0MA 4CW7A 1YOVB 4ENWA 2VQ6A 1U7UA 3PPWA 1E9SA 2OYSA 3WAGA 1W73A 3DGEC 4LZJA 4RW0A 3USZA 1AUOA 4RJIA 2GNPA 3AR4A 3DLAA 1S8NA 1SBTA 5AI4A 4GE0A 3RS4A 5AOCA 2WW8A 3T3MB 1RQXA 1T13A 1RXCA 1TUGA 5EE3A 4D7AA 3S8EA 5H82A 2NW6A 4MTLA 1S6YA 3PNPA 1OAAA 3BOSA 8ABPA 3IR6A 5DYGA 4J0EA 2DB3A 1V9SA 2NT4A 4K8OA 2CL7X 2Z8ZA 3QVJA 1DTWB 2HX1A 3ND5A 5BXQC 3QI2A 2VPPA 1T1IA 1VI2A 2W6NA 3ET4A 4DUYB 4B3GA 2ZSKA 3HDYA 3EAFA 3ZDZB 1XO1A 3DPIA 4I1RA 3ZGVA 3OZ7A 4MYRA 4OV6B 4BQFA 4DLRA 2VHEA 4LE1A 1MPXA 3UIEA 3KELA 4EGQA 1UXGA 2DYKA 3AXSA 3LVBA 4DNQA 1IIBA 2HNKA 4TTQA 1E32A 4URUR 1QVRA 4AUEA 4D92A 3TG8A 2XMRA 4DA0A 1K7XB 1JN0A 2K6GA 4X84A 5FA6A 4INOA 3M0EA 1RWQA 4AP9A 4XWWA 5JD3A 4BBPA 3AEUB 2XNDA 4RIFA 3BXEA 3IA2A 4X6XA 4NNPA 4FD2A 2CNOA 3VSBA 1E66A 2B35A 3HXKA 2XXAA 3ILVA 1P61B 4NBWA 3AF1A 4MI9A 5B4VA 2W2VA 1T25A 4YGXB 1GP2A 2CFCA 4R1SA 5TRTA 1J8VA 1OX4B 1WS6A 2WWWA 4IZHA 2O3SA 4I8XA 4NAUA 3TQCA 3W2IA 1MOQA 1NXPA 5B1IA 1D03A 4ZIRB 1N32B 4QHSA 1X77A 3D8NA 4NOKA 3V42A 5EZYA 4MYTA 3AINA 5LP6F 2M1ZA 1OH8A 4X6UA 4EEXA 5CFLA 1H9BA 1SUAA 3LQRA 1N6LA 4MKZA 1IXKA 3BG5A 1SVWA 2N3ZA 2JPDA 4G9GA 1TKCA 2VDUE 2JFZA 1N4DA 1WD7A 1URPA 2ZUTA 1N0HA 4IHJF 2BEJA 4MVXA 3QYPA 5DTEA 3H9JA 1BO6A 1XHLA 4UM9D 1G5TA 4K9OA 4U00A 3C1AA 4QREA 2RJNA 1YL7A 1C1HA 2ZIXB 3CVJA 4YJ2B 5DTQA 4BVKA 1GM5A 5IU6A 4MGEA 1GG9A 1UL1X 2ZWOA 5IN5A 3ZU3A 2VC2B 4D4GA 4YONB 4JELA 3TJMA 3QEBZ 3AVVA 4O4HB 3COWA 2Q0HA 1N3BA 3MTJA 3OM1A 5BNTA 3BMCA 1VGRA 2EF0A 2AD1A 2ERYA 2QRNA 2ZOSA 3IOYA 3NDJA 1XZIA 1S02A 4XJSA 2VDLB 3EY9A 1WHTA 4HB4A 3UGKA 4EKEA 4GECA 4MR8B 2E82A 2OHHA 2XB8A 2BE7A 4OP3A 4RHUA 4I5IA 4QXRA 2OUKA 3BHMA 4XOUA 3D9QX 3DE6X 3T95A 4DAOA 1SQ5A 3MBKA 3IE1A 2HL6A 2FF7A 3G79A 1V9LA 1KJJA 4AWBA 1FE8A 4PICA 2I6SA 3ZDCA 1BROA 2FUNB 3G9XA 2CDCA 1EJBA 4I6JA 4NNJA 1IATA 4EMUA 3V8BA 1N33B 3HRKA 1SXPA 1GR1A 3DPUA 2VQ3A 3CLKA 3PDHA 4LMAA 1O57A 5FBHA 2ACEA 3TR6A 2EEZA 5JXHA 1HK7A 2ZBQA 4YJHB 3AIMA 3IODA 4MVJA 1G5QA 1U04A 4HGZA 3K96A 1RHRA 1R9MA 1HZZC 1KOFA 2DKFA 2GI4A 2XMSA 4OGFA 1IK6A 1PX0A 2H08A 3DTYA 4FN5A 1XF1A 5KYGA 1YJ8A 4EW1A 2NSDA 3NV7A 2Z3VA 3VHQA 2RGWA 2QTVB 2EFGA 3KKOA 3VAZA 1RAIA 1YE3A 4LECA 2A5GA 3R24A 4JI3B 3X1WA 4EYSA 5A02A 3NWPA 2G88A 1SXQA 4J03A 1L7OA 3F6RA 2C92A 1H1LB 2F1OA 3AMVA 3OTHA 4IXDA 1K6MA 1I2ZA 1D09A 1TJPB 1FL9A 3GAZA 2IYAA 3HVHA 1QDLB 3EPPA 3H5IA 4UMFA 4MRRA 5JZVA 1BXRB 5DH9A 4OIMA 2LBPA 2ZZMA 3EZXA 5C32A 1J0BA 5F7XA 2G4LA 2HRRA 4DV2B 1P2BA 5ARBA 2QP3A 1PUJA 3EXIB 3VNUA 1JBEA 1F2UA 1RAAA 4BC0A 4TVSA 4BX3A 3KQOA 1CR4A 4CKCB 2JG3A 2VYQA 1TVMA 2NIPA 3PFKA 4XM1A 4CGYA 4KODA 4Q7LA 3S2GA 3C98A 5LNK6 4YI5A 3M6FA 5A05A 5KHAA 3S2SA 4UEJA 3L7OA 4BLTA 4DLKA 4XWAA 1I2AA 3S6JA 4BMXA 3M1IA 4NP6A 4ABYA 5A4JA 1NY5A 1CD5A 2J9FB 5KWVA 1SBHA 4DR4B 4JI8B 3TNJA 3TW0A 4JHXA 2PT9A 3KLPX 3WRYC 2DFDA 3H3XA 3V1NA 1A8PA 1S2NA 2IYQA 4ZRNA 3EFBA 1O95A 3TJZA 1NFFA 4AZWA 5FOQA 5JJLA 3UUFA 4TLDA 1E2LA 5DHFA 4CN8A 4OL0A 3A4TA 5SICE 4ZCIA 2EL9A 4RF3A 1HGXA 4AXBA 3U61B 4N1AA 3NKFA 4ZAZA 5E4TA 3DVLA 3L7LA 2G67A 3QK7A 2JAQA 1FYEA 4UTPA 3O3CA 1PT9A 4GQBA 4TLCA 1ZSYA 1QB8A 4JR1A 4MRNA 3VO2A 2A9VA 5KVAA 1N2OA 2BH2A 1ZRHA 3AERB 2VI5A 2R7KA 2Y1CA 1L4LA 1DIRA 2LUOA 1FRQA 5HIKA 1ZVQA 2JIQA 2X22A 3OD5A 3HVUA 4KQHA 3H8VA 4Y0NA 3SMQA 1AMNA 2B3DA 4MI1A 1ETHA 3EPJA 2IIQA 3K9LA 3FAZA 5HFJA 3ZJ5A 1YHYA 2G25A 4QU9A 4CT0A 1JEAA 1YQWA 2QNIA 3V2GA 3D6JA 3ICQB 4PIPA 4EY4A 5EJ2A 3QVKA 4WWHA 4YV2A 4GMFA 2Y4OA 4GPBA 1MX1A 4NFSA 4DLWA 1NT4A 3TTVA 1CJVC 2V9PA 3T3OA 4DR6B 3AUXA 1JIIA 1GPH1 3H7AA 4IYJA 4OI4A 3ZWWA 3ZJVA 4CJXA 3G5AA 4YFVA 3GL9A 1NPDA 2QSYA 4X8HA 4YTEA 5GIOE 4OI0A 1GQFA 1FNSA 1JEQA 4BRUA 4F93B 1JR3E 4FOTA 1I4EB 1HLFA 5I7FA 1UPFA 1QK5A 1QG2A 1YS9A 4KACA 4EMSA 4MKHA 4TKZA 1U8YA 1Q7GA 4BWVA 1R0LA 2NMVA 2ZIAA 4L5IA 5I7RA 3UJ7A 4KK3A 2RHCA 1MIHA 2MYPA 2DFVA 3BSFA 4FQ5A 4LDRA 2JFNA 2ZAMA 4O4IF 1TAUA 2VO1A 1IUOA 1ISIA 2ZW9A 1E2FA 3ADBA 1T0BA 1H69A 4K8RB 2ZB8A 4YGYA 1XZNA 2XSZD 3L7MA 3UEOA 2EG9A 2HUNA 4YXWD 3G0DA 2UVPB 4ETMA 1KAHA 4LE2A 2H0AA 4FDMA 5T6MA 4H4DA 4BQPA 1JAHA 3EE6A 2VYFA 5LMZA 2G72A 1ZWLA 1Z88A 2ZEJA 1R4NB 4MUFA 4OK6A 3IT0A 5D3QA 4P4GA 4BMNA 1DQYA 5EEHA 4ESOA 1OA1A 5AW4A 3OTWA 4KFSA 1TZBA 5C1PA 1RQ2A 1YE5A 4C3UA 2CDNA 2V9ZA 1CIPA 1US8B 3DB1A 2M6RA 1P31A 3BXOA 2XZPA 5K7SA 2VTBA 1WZNA 1MTZA 1ZUWA 3AR9A 3W5VA 4LTNA 4EUKA 1G20E 1SVIA 5LBUA 1SMKA 2YZNA 3HUEA 3LKZA 4E2YA 3FOCA 3GZNB 2V7TA 1JR3D 3LY9A 4QPCA 3D3KA 1O8CA 1RHQA 4BZPA 2UXBB 2POQX 1P44A 4PYQA 1MHTA 1YU9A 3H3JA 1E9BA 3H8SA 4ZQIA 4GOLD 3EZ7A 5EHXA 2G06A 3CMMA 4O4LA 3E0QA 4MGKR 5TEWA 4PC3A 4LPSA 4CQNA 3KOXA 1YOVA 3ZDAA 1F7UA 3ILYA 5EJEA 4R54A 5MFPA 4HDKB 3DL7A 4MUJA 4ENTA 2PTGA 2R4TA 2ZS7A 5IG2A 1FRFS 3R7DA 3GZJA 4LF4B 2BFDB 4H3KB 5IT4A 1PJRA 1TCCA 3LDUA 4RMHA 1E4VA 3L8FA 2Y77A 5CTJA 5P21A 4F2DA 2CLLB 2FPKA 1L3BA 2BRUC 2HLNA 1LKZA 2E4AA 3HUUA 2UZIR 3KD2A 1VL6A 3LP8A 3Q12A 1L5VA 3DNMA 3IKLA 4HRVA 3TO5A 4F11A 3IUJA 3RW9A 4FE3A 4QJ5A 1JTEA 3G0BA 2Y66A 3H6GA 5ENZA 5IDWA 2ZJFA 1Z6YA 5AVYA 4F2GA 4HNHA 2P41A 5K0LA 3CNNA 5FQOA 3CRRA 1A2KC 3A9TA 1T91A 2A7XA 3PA6A 4NFLA 4LCEA 3LC2O 4LN1A 1K7FB 4LS3A 4S24A 5BQOA 1KQNA 1ACMA 4AUKA 3ER8A 5KTTA 5I8WA 1RM0A 3RAFC 4B8ZA 3K09A 3NGXA 1Q6YA 1JVNA 2I55A 2VSXA 3D0OA 1DCTA 1VJDA 4CWAA 3NGLA 3UATA 3AEUA 3PFGA 4REMA 1A3CA 1CUDA 5I9MA 3RU2A 1QS0A 4G1FA 4M6WB 4QUJA 3G85A 1IY0A 3V1MA 3B6JA 5A62A 2Y6VA 3TLAA 4JB2A 1RHJA 5CX4A 5ALWA 4LCBA 2D5LA 1QKIA 1EWVA 2ZIZA 1KVUA 4XFJA 5F23A 5LP6B 1PGQA 2QTGA 1H2RS 3L5KA 3FJOA 1MABA 1CZRA 4GR9A 4ZIRA 4RVNA 1TLLA 2YNMA 1HDIA 4KQWA 4Y2RA 2C1ZA 1B76A 1DTEA 3WIUA 4WN3A 4OD0A 5B3KA 4NARA 1Q2UA 1QVAA 3EDRA 2AUMA 3IMGA 3KU4A 3VJKA 4IHJB 1JJAA 5HIIA 1L7QA 1FQJA 1PJAA 3AUTA 3K2QA 4UEKA 1FTNA 1GTVA 1WOYA 1G16A 1UFOA 2C99A 2H5LA 3PHCA 3PICA 1KEEB 1AKQA 3PWZA 3Q3GE 2V6BA 5FWDA 4EHKA 5ETJA 4AMYA 2IZ5A 4ZALA 2FUKA 5IFKA 2QRHA 2IXTA 4N0MA 4K0RA 3WLSA 4B2LA 5AVXA 3HEMA 1W49A 1UKVY 3VX4A 1TB4A 2FHPA 2ZJBA 3I2KA 2ZIXA 5J2TF 4CM9A 1AKWA 4LWOA 4YJ2A 1QPGA 3PNKA 4CDNA 2OORC 3ASVA 4ZYXA 2IEZA 4A0GA 3OURA 2AFHE 2XQJA 3OHMA 4X90A 4TROA 2HJHA 3PUIA 4MP6A 3WC4A 4N7JA 1PFKA 2CLOB 3OTGA 1E1RA 4BFTA 4CQMD 4LF8B 2V4MA 2YWHA 4DE5A 4YLYA 3DHEA 1HFEL 4WNIA 4D9MA 1Y3BE 2IZOA 2O3UA 2PKRA 1WDMA 2LXNA 3BWEA 3SZOA 1WXQA 2HNBA 4YMSA 1GADO 1WMFA 1JIQA 4FOOA 4L5JA 1RS0A 2PMWB 4MR8A 3VR4A 4S1TA 3RSSA 4Z6KA 4YMLA 4M8LA 1R12A 4L2IB 4W9MC 2O54A 1O6ZA 1TA0A 3AVXA 3G2JA 4QUHA 5U4QA 2HSZA 3I04M 3LLCA 4FLMA 4BPRA 2A1UB 1XTJA 2B1JA 3TN7A 2IKSA 3P94A 3RSHA 2GVDC 3IV9A 3W2EA 3EIXA 5LWHA 2GK4A 3D8UA 3A1CA 5AJHA 5ERGB 1FP7A 2NSLA 3THSA 4P83A 4XFKA 5JS8A 4BLUA 3CW8X 2XOEA 5G1PA 1IU9A 2OXIA 3HDVA 2CNWD 2J6HA 2Y2UA 4Q1FA 1EFLA 1U3GA 4HQFA 4MQMA 3U49A 1Q21A 3PXXA 2QYTA 3A6GA 3MERA 3DMDA 1GA6A 2YC4C 3ZWVA 4BE4A 1XSEA 1P17A 2GN1A 5CPFA 1Q0LA 2IYEA 3ZHTA 4ND6A 2D4HA 4RZQA 4UUNA 1CS0A 3UFXB 3M5DA 3G13A 3SJBA 3ZK8A 1QZXA 3FOWA 4AJKA 1KZ7B 4G5OA 1AO3A 4AICA 2P2ZA 3IUQA 3IFSA 4DY6A 1I3MA 1N9GB 3C6XA 3H8WA 2H59A 5B12A 3IIKA 1BHSA 3JQ8B 4CCWA 1F06A 1PJBA 2QTVA 3EUFA 3QJ5A 5KREA 4BE7B 4UJ3A 3FN4A 1SOVA 5AK6A 1P60A 1PT6A 1PZNA 3PRJA 1DO8A 3MWKA 3WWPA 3HDJA 3I5UA 1X8LA 4PC1A 1T2VA 4PCAA 2QTRA 1AK9A 1VFPA 4IGAA 2B61A 4M1SA 3UJNA 4YRMA 2DY1A 3G0IA 4WCFC 3QKRB 2Z2JA 2X3FA 5EXPA 1E96A 4GE3A 4MMZB 4URXR 1ESEA 4I9GA 3SQLA 3QTTA 2RAVA 3ZQ4A 1U5CA 4NCNA 2LIPA 2O48X 4K5QA 1NWHA 3IQZA 3M9XA 5TPZD 2V5AA 1ZVMA 4LJ9A 4HFNA 1TCUA 2OV1A 2FK7A 4RPKA 4UVIA 4YRRA 3DOJA 4OHWA 2FR8C 3CINA 3UJDA 1UF9A 2UYYA 5K1ZA 1RBQA 3RTGA 1EP3B 1VIAA 4TQ9A 4DLYA 1P1KA 4JJ4A 1KFBB 2IH5A 3A1DA 3LCJA 3ORHA 5FWYB 1EGAA 2GEUA 5I4IA 3T15A 4Y9RA 3RFUA 1N1DA 4Z1MD 4KGVA 1T29A 3K1AA 2QZPA 4JN6B 1DAPA 2J09A 3HP1A 1O7JA 3OIWA 1SC4A 4ME6A 3JQ9C 2XZTA 5EJFA 4XVQA 5KQRA 2YRWA 3FYUA 5E6RA 3ZQJA 2QYHA 3FRJA 3OTQA 3HE3A 4GZ3A 4RKYA 3QQ5A 4WNYA 3ZWYA 3PC7A 4W5QA 5DP2A 3HBLA 4Q3BA 1HDXA 2W7TA 2WA2A 2CV1A 4L3VA 1FFDA 4I4TF 1CE8B 4FGWA 3E9NA 3ABRB 4TS3A 2G9ZA 4HWPA 5D84A 3WZ2A 5CDSA 2ZAGA 1T9GS 1QYCA 4YP0A 1UBMS 3DFFA 1TXGA 4ZAWA 5JYCA 1JWLA 1FLVA 2P6OA 4LBYA 4A2QA 1V7CA 2L2QA 1CR2A 2JF0A 3KJQA 4UAJA 5CYOA 1ILEA 4IGEA 1EH5A 1KU6A 4MCJA 3ETDA 5KNCD 2ZTUA 2BGLA 2EGUA 2JFHA 3EEFA 5KDOA 1EA7A 3KCQA 3QF7A 4TT8A 3NHUA 3RYIB 1ZX1A 2X6QA 2IRWA 3B38A 2RKWA 3IJ5A 5I8ZA 4EH1A 4NZNA 2EU8A 3PF9A 1PJ4A 2V7QA 4LHXA 5FA5A 1AZWA 1Y7TA 2R66A 1E79A 2FUEA 4QU8A 4OQDA 4U7FA 3AR7A 3W8RA 4UBNA 1HXHA 1CC1S 3RGWS 2ZB3A 2ATXA 1OLSB 3QXCA 2CUKA 5KC9A 4BJ6A 1GNLA 3B1XA 4OOEA 2J0EA 1YCGA 2JDID 4EHLA 3CURA 5FORA 2NUAB 5BNFA 4GGPA 1Z4JA 2OV6A 2NQ2C 2W2TA 2QU7A 4HYQA 1TZJA 4MHOA 2IYXA 2BTEA 1Q7RA 2AOVA 2QAGA 2Y9PB 3W4IA 1PEAA 4KVZA 1Y4ZA 4UM9B 3I01A 3U4GA 2A58A 4MVWA 2A6PA 1BDJA 2XDWA 4RD0A 3HU1A 4OH7A 3M34A 4B4WA 4TZKA 1W25A 5G4KA 3UCFA 2H7YA 1LJ8A 1YVEI 3BJMA 5JCOA 4AKEA 3UZUA 1J1ZA 3AR8A 3B70A 2DUWA 4HLDA 5F7OA 2WLTA 1JJBA 4L5BA 1JMVA 2EBWA 4UU7A 5CYFA 3V1UA 1DKRA 1Y3CE 1E4EB 1JZTA 3QEJA 4ZK6A 1K8XB 1CRQA 4N5NA 5JNUA 4PCVA 2P27A 2A9OA 4NL4H 5E8JA 3WGKA 4C29A 3EB9A 3R8FA 4GWKA 2E1PA 2GK7A 1ACJA 2B1IA 3O0DA 3VKFA 1R4NA 2OFOA 1C81A 3NT4A 4B8YA 4EF4A 2YQ5A 1F6BA 4KAXA 2XA1A 5GZ6A 2C9BA 1A9OA 3RUPA 4BKMA 4Q9AA 5BWNA 4Y2JA 3VZRA 2XTMA 5LVAA 4UPEA 1US8A 4B3JA 1OJLA 4CI0B 1OCEA 1VA4A 3UXYA 4QUKA 1R5BA 1U28C 4DADA 5AUPB 2H2IA 4AUMA 1J23A 4MGYR 2FA9A 1NF8A 2IGTA 4K9RA 3EEOA 3D59A 3UBMA 1ZDMA 2C94A 3BS4A 1RRGA 4OOFA 7AT1A 2RH8A 3GZNA 3ZTWA 3HDQA 4XGKA 3T1VA 2AMLA 3HL4A 2PX5A 2RIRA 4Y9SA 3ZCVA 2GBPA 4FCCA 3NBZC 1F1JA 4MPPA 4RLHA 1JF8A 1S8FA 2FWRA 4XGRA 4D81A 4YRNA 2OWEA 2HYDA 2P4HX 1JHRA 2ISQA 2RCYA 2Y0DA 1D9XA 1U0SY 3MWEB 3O90A 3VR1A 5CD9A 4G0MA 4CL2A 2WABA 5F1PA 4HVCA 4I66A 5AHKA 4AW9A 4ER0A 3ZE8A 2VF7A 2WAXA 3ABZA 1M3SA 1PKEA 2BGTA 4RHXA 5B3LA 3LUBA 4R68A 3ZC3A 2VT6A 2HT1A 4LJLA 4WCVA 5G41A 5ICGA 1TGVA 5CH5A 3ZHCA 3M2TA 1QNFA 4E07A 1T35A 1ODSA 1PJ2A 2XUHA 5IVKA 4YAFA 2HRDA 5BSWA 4YA6A 5LQAA 3X1XA 1OX6A 5LD2B 2UXDB 4XW2A 2ZYUX 4QSMA 4IDPA 4S1OA 1W96A 1L5LA 3Q7EA 1Z68A 3H65A 3PC2A 2A1IA 2FLVA 2Z98A 1ZMOA 3AFOA 3B51X 3RUIA 3TLJA 2J48A 3ZDXB 4BAGA 1GU7A 2J5QA 2QTAA 4M9UA 5IKMA 3AVUA 2FK8A 3PHIA 3O1HB 1S1MA 3P9XA 3ZD6A 1UWCA 3G2NA 3IQXA 2Y0PA 5ADHA 1AQNA 4PSUA 4DV0B 2OY0A 2JFOA 3EFHA 3DHYA 3F3MA 1MPTA 1W4AA 2WUFA 1P2TA 3SZMA 3A06A 2IQIA 3BSSA 5B4TA 3OCYA 4Y18A 1C2TA 1RKQA 4PX3A 1N6IA 1KOLA 3O2QB 2VYCA 4EG5A 5FUBA 5G4LA 2XVZA 3LQKA 3RT7A 4JLJA 2VSQA 1XLTA 3SR3A 4D98A 5JEEA 5EESA 3LCUA 5JD4A 3U62A 1Y89A 2FZGA 4HEA6 2D0IA 1D6JA 3NHPA 4RLQA 2IPMA 1EFKA 1JLKA 1TPZA 2J3HA 3LDHA 4NCKA 2C2HA 1BXGA 1KE2A 3UXMA 4FGZA 3X2FA 4D45A 2EIHA 2H8GA 4JLPA 4Y6PA 1IB0A 1FK8A 1SIOA 3HR4A 1LI7A 1W9MA 3PD0A 4FQ7A 4LCJA 2IZ1A 2CSUA 1B4DA 3DVSX 3AFIA 3NHFA 3Q3IA 4FBGA 2EVWX 4OY3A 3VJLA 4H31A 4BO9A 5LDDC 4B4VA 2XOKD 2IHJA 2VXBA 3DVAB 1RXEA 2EJWA 3UJ9A 3U7FB 2VPTA 4Y6RA 5EUMA 1RACA 4I99A 2RGYA 3MGGA 1YI1A 4XA8A 1HZJA 3UMSA 4QVGA 4XM0A 4F06A 2PGDA 3PT9A 3TZHA 4QXQA 1PDWA 3INTA 1KEEA 1ECCA 3BMQA 1DC6A 3RS2A 5J2TB 1SNYA 5KYTA 5ICSA 1X9HA 3TQOA 3AH8A 3PNVA 3KJNA 1XLWA 4I08A 5DDIP 4P5EA 5BQPA 3SJ7A 5JV5A 1ML3A 4G1MB 5AJVB 2HWWA 2W6IA 3HCNA 1R3UA 3SHVA 1KPGA 1M2EA 3VO9A 3TW4A 2ABWA 3JQGA 1EBUA 4IM7A 3L1HA 3L01A 4IF4A 1FXWF 1U6IA 2NQ8A 1I0ZA 3RDPA 3TMAA 3K8OE 3PRYA 5IXYA 3CBQA 5BSVA 1QG0A 2DPMA 4ENVA 2GHTA 1X80A 1T5IA 2R48A 1ZUNA 1CHDA 4ZT3A 4EA9A 4UARA 5H5JA 1UJ4A 3MRXA 3P8ZA 4F2WA 1KI1A 1V8PA 1HR0B 4TLAA 5D1NA 3KUUA 1BS1A 3F67A 4MITA 4YRTA 1WQ4A 5J4HA 4LRWA 1T5DX 4UMDA 1CNMA 4L2IA 4N9QA 2WFAA 4BEBA 4Y9DA 2G3YA 2AC4A 2QMYA 3Q15C 2PN1A 2BMWA 3JRWA 1XXHE 2XDQB 1A1VA 2DSNA 1GAWA 3R7FA 1DBIA 4H1HA 2BSXA 2EKBA 3EBPA 1YS6A 3FUUA 3I42A 4WXHA 3QI7A 1ISGA 1ZD8A 1TDJA 3GPLA 4L16A 1Z7EA 4BC1A 5FPPA 5GZ1A 1G4UR 5ALYA 1GVHA 5AI6A 1TA9A 1DVRA 1GG2A 3D7KA 4LISA 1XA3A 4OGGA 2BBWA 4EHBA 4PW0A 4N0QA 1RI1A 3DTVD 1JQ3A 2ADOA 2F17A 1U2DC 2JEZA 4KB5A 4MW9A 2BFEB 2RHBA 3TF5A 1C1XB 2QUHA 4IDGA 4RGYA 1J0EA 1JXMA 3O6VA 3QLUA 5EY5B 2X8BA 3G02A 1WOMA 1FW8A 1RM4A 3QNWA 3FUXA 3N6VA 4IF6A 4WHMA 5K4AA 4P32A 3UFXA 1K5GA 4CMJA 4WDQA 3EEYA 1Q17A 1JMYA 2ANCA 1KXJA 4H4EA 3T1NA 1SBCA 3UICA 4CUJA 3QXHA 3ZD8A 5LQUA 3JQ8A 4N7BA 1NNI1 2XGOA 3B5IA 1BFDA 4Z51A 3F4LA 1OFIA 2D7CA 1NI5A 4B81A 2X14A 2XB2A 3I37X 3AF2A 3R74A 5LOVF 1B15A 2OZPA 3CPHA 3IRUA 2XRZA 1P0PA 3DH0A 1GLGA 2HA7A 4JBIA 1GPYA 2VHZA 3G68A 4RENA 5PNTA 2QRUA 1T1JA 3F1LA 3G9ZA 4BVEA 1FMLA 2CE2X 2PH5A 5J43A 3H2KA 3TPZA 4WOBA 3ZV7A 2RC5A 4ZREA 2GJAA 1IB6A 5BV0A 4K03A 4Y2PA 2E3JA 4F3NA 5EE1A 6Q21A 3DL4A 3IV7A 3FGZA 4JDUA 1LTHR 2NNWB 3G2IA 5C81A 1DBWA 5FUWA 3AYXB 1NN0A 1LV8A 4Z9AA 3VYSB 5FWYA 3RFCA 5HNKA 3TNLA 2PUAA 1JPNA 1SIBE 1QOQB 3QUTA 1FZQA 1O54A 1PT8A 1U31A 4CQJA 1XAIA 1IAQA 3TSCA 4BQEA 1N0VC 4KP7A 5ARDA 1JXOA 1XYGA 4ENUA 2OTCA 2QR3A 1V11A 2PUBA 1Y33E 2P0YA 3RC8A 4PC7A 4DIOA 1OBOA 4UE2A 3TIGA 5KOIA 1WB9A 3V6MA 1ISSA 1BDIA 1W4CA 4BTEA 5EMNA 2OFXA 1CE8A 4ITVA 4NV3A 1KAOA 2ZRKA 3E2IA 4FLEA 2IWRA 1IHOA 3K0AB 4TYNA 3GJ3A 1EM6A 3K9HA 3Q8WA 4C30A 4U1RA 1NPYA 3L46A 1WDKA 3R3HA 5E1MA 5FO1A 2A9KA 5F64A 2PHZA 5K8IA 1WCV1 2Q6OA 4AJPA 1I6WA 1W85A 3PC8C 1IUKA 3K4HA 1SHKA 1NVWQ 3IAAA 1EVZA 4QIHA 1B0ZA 3WWZA 1I33A 4AJ2A 2IEAA 3BHNA 1V6SA 1FFXB 1XRLA 4OVKA 4EARA 4C6HA 3C8UA 3LIPA 3QLVA 3RYIA 5K0JA 4XIFA 5EZSA 4IJWA 4ARUA 5HEKA 4B4UA 2CY0A 4GT1A 4MSUA 5HCUA 1UC5B 3DMRA 2C78A 3IQEA 4AKGA 3FG9A 1Y6FA 4MJLA 2HMUA 2W9XA 4COKA 1HL7A 3NJRA 4EGJA 3I6YA 3L18A 1ODTC 4GOJA 2OPBA 1OLSA 4J3FA 3AIIA 1CJSA 1JLLB 3O4RA 1AXGA 5DM1A 5JWRA 4DJFC 1V8DA 4DNXA 1H4TA 4GRIA 5JAUA 2HDHA 2CNBA 2PUJA 4N7RA 2NUAA 2G9UA 3ZCXA 2F1KA 2QWXA 5IJXA 3UOAB 1BDMA 1VYHA 1T2CA 3K4QA 4IJ6A 1DP4A 1Y8RA 3PFBA 1SULA 2I71A 4FWIB 2REQA 4OJMX 3EXAA 5IAJA 4OXYA 5BWLA 2VBGA 2H4ZA 1EGVB 2HA2A 1YDHA 2Q4DA 3KKLA 3L92A 3MT8A 2RKBA 2ORED 3I23A 4HAYA 4QPDA 1SK9A 4DBZA 1YACA 3LO8A 2A94A 5HF9A 2WV9A 4CQMB 2C98A 1NNLA 1TFUA 3NZEA 1FFWA 2E21A 1OB5A 1E4EA 3HR8A 2QRVA 5E4FA 3VC7A