4DYDA

Substrate-directed dual catalysis of dicarbonyl compounds by diketoreductase
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
283
structure length
283
Chain Sequence
b'MTGITNVTVLGTGVLGSQIAFQTAFHGFAVTAYDINTDALDAAKKRFEGLAAVYEKEVAGAADGAAQKALGGIRYSDDLAQAVKDADLVIEAVPESLDLKRDIYTKLGELAPAKTIFATNSSTLLPSDLVGYTGRGDKFLALHFANHVWVNNTAEVMGTTKTDPEVYQQVVEFASAIGMVPIELKKEKAGYVLNSLLVPLLDAAAELLVDGIADPETIDKTWRIGTGAPKGPFEIFDIVGLTTAYNISSVSGPKQREFAAYLKENYIDKGKLGLATGEGFYRY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dual catalysis mode for the dicarbonyl reduction catalyzed by diketoreductase
pubmed doi rcsb
molecule keywords Diketoreductase
molecule tags Oxidoreductase
total genus 108
structure length 283
sequence length 283
ec nomenclature
pdb deposition date 2012-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 4dydA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4dydA01
1YDWA 4FN4A 1LLUA 2BD0A 3PWKA 3L4BC 4WLNA 2AW5A 5ES3A 5C3MA 3RIHA 5IZCC 4UREA 5G2OA 3NT2A 1PGQA 2CFCA 4BGEA 3QVTA 1KEVA 1MXHA 4CMHA 4DXHA 4IJUA 4MJLA 5B4UA 3M1LA 4TSKA 3WFIA 1QV6A 2OP1A 4ZJUA 1UAYA 2VNAA 2AHRA 3ZZNA 4URFA 3IJRA 3VAZA 4XYLA 1QYXA 4L0QA 1ZCJA 4KTTE 1QYCA 5CPFA 2FOIA 4Z0TA 1UDAA 2JCVA 4BHTA 1B0AA 4PLFA 2Q1UA 1IY8A 4BQPA 2B37A 4JJGA 3CMCO 4RQUA 3K73O 4CM9A 2O23A 1I2CA 1I10A 5EQDA 3FNHA 3PEFA 3GVPA 2YHIA 3HDHA 1EQUA 4EITA 4MVJE 1Q0HA 4CM9D 2AE2A 3ZV5A 4KUGA 1QV7A 2GUGA 3PI7A 3RQSA 1E1MA 3AY6A 1DBVO 2VWHA 3MTGA 3PHJA 2JHFA 3OEWA 4TKMA 1X1EA 3H9JA 4CQMA 3E1KA 3EYWA 1GDHA 4G2NA 3K30A 3NJ8A 1CEQA 5ADHA 5IJZA 1N5DA 3DAGA 4L4XA 1KY4A 5HBRA 1LBEA 3WBFA 2VUTA 4BNXA 5A1TA 3PIIA 5JNLA 4CM4A 1PR9A 1HDYA 1HXHA 3KYCB 2IXBA 4RPJA 4GI2A 4UUMA 1NPTO 3RVDA 3TN7A 3ONDA 3DMTA 4PG8A 4OKNA 3SX2A 5JMPA 3GAFA 1T2EA 3RBVA 5A9TA 4GGPA 1EQ2A 1IHXA 3GVXA 2RBEA 1VJ1A 9LDBA 3V8BA 1SCUA 2Q49A 2Q3EA 5F1KA 2OORA 1DIRA 1F8FA 1H94A 4FC6A 2VZ8A 2UDPA 4GWGA 1WPQA 4AJPA 4BV9A 4YB8A 4ZQBA 5I8ZA 2OXIA 3NDRA 1PEDA 1RM0A 1EFKA 3U4DA 4YRDA 1S6YA 3PRJA 5A5FA 4MINA 3R3JA 7MDHA 4GGOA 4MVJH 2PD3A 4Z9FA 3H5AA 1GZ6A 3WJAA 4OO3A 2UUOA 4HADA 4N5LA 5AOVA 1ZVMA 1B8VA 1X0XA 3GFGA 1C1XA 1DIHA 4CLDA 1ZEJA 2HJRA 2OMEA 1WP4A 2PD4A 3EZYA 3WLFA 1U9JA 2CY0A 1XSEA 3GZNB 1JLLA 1GQ2A 5JCJD 1FMCA 4Q3NA 5DCWA 2ZTUA 5DP1A 1EVJA 5JAZA 2C59A 5JW6A 1CRWG 3A06A 2GN6A 3PDUA 5JMWA 1B8PA 5JAIA 2NACA 3OH8A 4L4SA 4EJ0A 2R2GA 4ND2A 4TVBA 2HU2A 2HK7A 4TQGA 1JWBB 3VDRA 4CMBA 2VZ0A 1GD1O 3GOHA 2DC1A 4LGVA 3WOHA 5A9RA 2BF7A 2WD7A 1QR6A 4ZHSA 3TZCA 2H9IA 2W4QA 3H9EO 2HAEA 3ZI0A 4D79A 3D0OA 4GLOA 1HYEA 3SLGA 1V3VA 1GFSA 2PGDA 5FI3A 2DPGA 2VHWA 3GDOA 4ZQHA 2V6FA 4B7XA 2UAGA 5ILOA 1FXSA 2FN7A 1M75A 3GMDA 5KJEA 3VPFA 2FSVA 1N2SA 4JCOA 1GUYA 4R51A 2I9PA 1YO6A 2YZ7A 2Q1SA 1FK8A 3H6KA 4B3JA 4RL6A 3BA1A 4I08A 2QYTA 3ZWAA 3IUSA 2FPIA 4PVCA 5I7VA 1NR1A 2HRZA 1A9ZA 1LDMA 1YGYA 3FHLA 1PJ4A 3GH3A 3L4BA 3PZBA 2J3IA 2CVZA 1X7GA 5CDUA 4ZVVA 1UXKA 1O9BA 2D1YA 4AJJA 2GO1A 3DHNA 4OKIA 4LISA 1GV0A 2P4HX 3C1TA 1ADCA 4MP6A 4DA9A 4YT4A 4QUKA 4NFHA 2C82A 3DWFA 4NJMA 4EBFA 2WWRA 4BO1A 5A03A 4D0SA 3RKRA 2X9GA 4Y98A 3NV9A 2AMFA 3OA2A 4BNZA 3OJFA 2A92A 5K0ZA 2XF8A 1XQ1A 1C0KA 1DRWA 4Y6RA 4GH5A 2EP5A 1QSGA 1TLTA 2ZTMA 3KUXA 1HZJA 4EEZA 3ETEA 4EYEA 1VSUA 3MJSA 2X9NA 2ZKLA 4CPDA 2HK9A 1A7KA 4NBWA 1NYTA 3ENKA 2IRWA 3V1YA 3HB4X 4KP7A 1EVIA 1C1DA 2G5CA 4J49A 4OAQA 1MXFA 2W90A 1E3JA 4AJ4A 2O7QA 3VKUA 1Y7TA 4J4TA 4RVSA 4B79A 3E6AA 3H5RA 2O4UX 1QORA 1MA0A 5F5LA 3TRIA 5B37A 5JLAA 1XLTA 2ZYDA 3EVNA 4HFRA 3ZHBA 3BHMA 1DFHA 1P77A 1MUUA 2IXAA 4UVIA 3HFSA 3LDHA 5JY1A 3ENNA 4IDCA 5AXBA 4A2CA 4NFSA 1T2FA 1GYRA 3RJ9A 3GZ4A 4B8WA 4Z0HO 5C7OO 1GL3A 4GPD1 2GF2A 3RBZA 4BUCA 1KBZA 2O48X 2EGGA 1KERA 3TL2A 3GUYA 4BL5A 3SBOA 4J2HA 1HDZA 1Y8RA 2ZIZA 2H6EA 5TJHA 4DL9A 4RF5A 4GAEA 1X13A 3AUSA 3PDJA 5KOIA 4DLAA 1ZK2A 3D4OA 4BQRA 3OHSX 2YV2A 1GADO 3AY7A 2IZZA 2DTXA 5JSFA 4IDBA 2VYVA 1SPXA 5IDQA 4U5QA 1NBOA 5I8WA 3NTQA 1PGJA 2EJVA 2QHXA 2GLXA 2B83A 2YJZA 3P7MA 3KLMX 5T64A 1K0UA 2PK3A 1R4NA 2VYVD 3U0BA 4BNHA 4FSHA 2O4CA 3JQAB 2NM0A 2UYYA 3GK3A 2DLDA 5IAAA 3SEFA 4FOOA 4EUHA 1I5RA 3Q6IA 5ENDA 2PTGA 3UHAA 4XWYA 4QX6A 3DOJA 4WE3A 1DOHA 4EZBA 4IQGA 1PGOA 5A3VA 3U4HA 3BMOB 3G49A 3F1LA 1OI7A 4RLSA 4NFYA 1GPJA 1KC1A 2OBYA 1C0IA 2O3QA 4B3IA 2C5EA 1YKFA 2Q2WA 1T2DA 2VHYA 2BGMA 5J23A 3G1TA 1ZK0A 4BB6A 3DFUA 1ZMOA 3U49A 1BMDA 1UXJA 2GCGA 4OXKA 2IDZA 4WLUA 3I9MA 3DB2A 3TZHA 1D4FA 4K1LA 5KKAA 6ADHA 1E0DA 3VZPA 4XYEA 2W2LD 1UP4A 1V6AA 5JC1A 5HA5A 1Z6ZA 4GSLA 4M54A 4H7PA 2EG9A 8LDHA 1K5HA 2VWPA 1ISFA 4F45A 4TRMA 3U09A 4CMCA 1TT7A 1ZMTA 5G4LA 1NVGA 2G0TA 1B2LA 3WSVA 1U4SA 2I67A 2ZTVA 1B3RA 2POQX 3U4CA 3D64A 2H1SA 2FR8A 2GN9A 2UV8A 3PGJA 3INGA 1UXIA 2YW9A 3QVXA 4U0KA 9LDTA 3NUGA 4JBHA 4AJ1A 1ADBA 4Y6SA 3SXPA 3ROMA 3Q0EA 3ZU5A 1RM4A 5A9SB 1E6EA 1KC3A 5DCYA 1OC4A 3IL2A 2D4AA 2ZCUA 3LT0A 5MDHA 5HRUA 3AK4A 3H65A 4WOJA 3IQDB 4IPTA 2FMUA 4W99A 3JYOA 3U9LA 2RCYA 4OH1A 1HTBA 4NR0A 4ALNA 1XIVA 3KHUA 5JO9A 4KQWA 4ZRNA 1EVYA 4DYVA 3N74A 3ULKA 1XEAA 1PJSA 4JN6B 4E5KA 2BH9A 1TEHA 2HO5A 4RVGA 2ILTA 3PJGA 1GEEA 4XGNA 4RQTA 1UR5A 1VM6A 4TRJA 2ZB7A 3RUDA 4BNNA 3W6UA 3AUTA 3TFOA 2VYNA 3JQ8A 2C20A 1YBAA 2EERA 2W2KA 1O89A 2BFAA 3D5TA 5KVSA 3L6EA 3BXXA 2VYND 5DULA 5H81A 3WYEA 1P1KA 4BO3A 3Q9UA 3JQCA 2O3TA 4IUYA 1BRMA 1LDNA 2RHRA 1AUPA 3M6IA 2DU8A 1E1LA 1FDUA 3DBLB 2VRCA 3E5MA 4IJWA 1U1IA 1CWUA 1K6JA 4R1SA 4E6PA 5B4VA 3QIVA 1JW9B 1DSSG 3MWDB 3WMXA 5CDSA 4WASA 4IM7A 2DPHA 3A1NA 4CMEC 3COSA 4ILKA 4XB1A 4G81A 4WEQA 1I2BA 2ZYGA 1H9BA 2X0NA 3BMCA 3DZKA 3UCEA 3S2GA 1YVEI 4RF3A 3BAZA 5CG2A 1BW9B 4FFOA 1P31A 4G5HA 4ZQGA 3IUPA 5G0SA 5T6BA 4FR5A 3FRJA 4KWIA 3ZWPA 5JDIC 4M89A 2F00A 3ZNQA 4JK3A 3Q9NA 2Q2QA 2B4TO 3PWZA 4TWRA 3TF5A 1M6HA 3MJ4A 4RORA 1ENPA 1DIBA 1I24A 4HKTA 3EK2A 2BKAA 5DT9A 1EEHA 3MZ0A 2IZ1A 4GMGA 3Q2IA 1Q7GA 2Y1GA 5GZ1A 1B16A 2LDBA 3GG9A 3BZUA 4YJGA 1PX0A 4Z0PA 2O2SA 1R4MA 2PGJA 3I5MA 4H16A 4WLFA 1HF3A 3GNQA 3NYWA 4TRRA 4W7IA 3T7CA 3MJEA 3MWEB 3PWSA 4MIOA 4DIOA 1CETA 4E12A 5DF1A 1Q2XA 2NTNA 1D1SA 3RUIA 2GR9A 3KEOA 4ALIA 4J7CA 1B26A 3V2HA 2ZTLA 1LJ8A 1NNUA 2CDAA 4AFNA 1ZK1A 1N9GA 3L9XA 4RVFA 1WMBA 2VOJA 4CV3A 3LF2A 4ID9A 3U62A 1Y5RA 3PYLA 1YB4A 4G65A 4O5OA 4CJXA 1TI7A 1JVSA 2ZK7A 1JQBA 2E37A 3LC7O 4J7XA 1QKIA 1QG6A 1TB4A 3I9NA 2AA3A 4BNTA 1E77A 3VTZA 4BMNA 2X1HA 3UH1A 3RFXA 4NZ9A 3LC1O 4GL4A 3V2GA 2JJYA 4IIVA 1PJ3A 3ANMA 2P68A 1DRVA 1K6IA 3EW7A 4E5YA 1H9AA 2J5KA 1U8FO 4B8ZA 2OO5A 3OBBA 1OAAA 1JA9A 1SNYA 1I2ZA 1C0LA 2D8AA 3DBRA 1O5IA 1PWZA 4J1SA 4BKPA 3ANLA 2HMVA 2VHZA 3PYXA 1NFRA 2WE8A 2YHIB 3QA9A 1HETA 5TSDA 2DM6A 3UVEA 4RO0A 2B69A 1PS9A 3ZH2A 3OJEA 3UFXA 4KWHA 3OEYA 3ZWWA 5K9ZA 3OP4A 1PJLA 4IQ8A 5BSFA 3WGOA 1CQIA 1JU9A 2QZZA 3W8FA 1KVQA 5CEJA 1MLDA 1RYEA 7ADHA 3GPDG 3R0IA 3LVFO 4KZPA 4ND3A 4CQMB 4DRYA 2Q50A 4IDFA 5U4QA 3ZW8A 4NNJA 3G3EA 3OQBA 3KETA 1A5ZA 1ZXBA 3D5QA 4WOKA 1JN0A 3FPCA 3O03A 1WDLA 5DOZA 4CM4B 1XA0A 4XIJA 1DLIA 1I36A 1DDOA 3C24A 4WCFC 3ZWMA 1UZNA 4PG5A 1Y8QA 4AVYA 4IGEA 4IJKA 4JBGA 1C3VA 4LMRA 3RASA 4NH4A 3RUHA 3K5PA 1ZK4A 2FHSA 3NAQA 1LQTA 1W4ZA 4ND1A 4CV0A 3UOGA 2NNLD 3WIEA 3CKYA 2AEFA 3E03A 4BNKA 4BNVA 5L4SA 2J3JA 3HDQA 4AJIA 4BO7A 1LA2A 2YYYA 4BO4A 3LZ6A 4OOEA 4Q3CA 1DJNA 3KYDA 1NXQA 1LSOA 4E2WA 1C1XB 1PQPA 5IZ4A 2WD8A 5AYVA 1P1IA 2CSUA 1U2GA 4R41A 5I7SA 4J7UA 4II3A 2Q1WA 1DEHA 2XOXA 4CMEA 5L7TA 4NK4A 4O1MA 3F9IA 3PPIA 3MJCA 3CXRA 2EJWA 4YACA 4FCCA 3E9NA 1VJTA 1DHTA 3A9WA 4XDYA 2EW8A 2GSDA 1B3BA 4XYBA 5ER9A 3PJEA 3RKUA 8ADHA 4Z6KA 1HDCA 1H6CA 4YRBA 1I01A 2D3TA 4YAJA 4R3NA 1IE3A 1OBFO 4U6QA 4W7HA 4FGWA 4P8RA 4TVOA 4D41A 3WTBA 1E7SA 1Q0LA 3PP8A 5CP8A 2I65A 2TMDA 5G0TA 4DYDA 2DFDA 3FPLA 3WJ7A 2I3GA 4TZKA 4K28A 3HZZA 3NT4A 1M2WA 2OL4A 4LW8A 3I52A 5A3JA 3SVTA 1B15A 1ENYA 4FOSA 3KV3O 1XR3A 4I9NA 4MIYA 5CHEA 2HKIA 4PZDA 2I3AA 1ZZEA 3IP1A 2Y0CA 2Y1OA 5F5NA 4FJ2A 4UUOA 4CLEA 3C8MA 5JAQA 1RM3A 1GYQA 2B5WA 4YJDA 4YXFA 3PLNA 4NBRA 4D46A 2JD1A 1N7HA 1AE1A 3VPHA 3PZRA 3ZNPA 3ITDA 3ZWNA 4DVJA 1O0SA 1NQ5A 3NGXA 4IMRA 4NBTA 2WDZA 3FWZA 1SOVA 1I3MA 2XPCA 4JX8A 3TZ6A 3LLSA 4LSMA 1LX6A 1TA4A 2HLPA 3I9OA 4BNUA 2DUUA 1D1TA 1AGNA 3CIFA 3QSGA 3CZMA 4KMSA 2H5LA 4W4TA 5FI5A 3RWBA 3ZV3A 4RVHA 2VT2A 5KTKA 4PLGA 1R0KA 1X14A 1P74A 3JQ6A 3LQFA 3RUFA 3BMQA 3U3XA 5BNTA 4W82A 5ILGA 1YWGO 2XAAA 4NQZA 1U28A 2BFOA 3HWRA 2DTDA 1ZBQA 1LC0A 3QWHA 3GY0A 4WLOA 5DP2A 2P9CA 1VE9A 1N1GA 2G17A 1BXZA 4LVUA 1C1DB 4YRAA 1XU9A 4IDGA 4YDRA 2FPPA 3FNEA 3HB5X 3JD4A 2GPTA 4RPLA 2EKQA 3JQ7A 4DPMA 3W8DA 3QVSA 4JIGA 3KXDA 1M76A 4CLHA 2P91A 4EJMA 3NDIA 2FZEA 1VKOA 3GNSA 3I9LA 2AG8A 3PQDA 4RDIA 4MIEA 1U7TA 4EEXA 4MKXA 2C2XA 4HBGA 4J4HA 2VT3A 4YT2A 3CE6A 3WGGA 4WPGA 4AJ2A 4R9SA 1TT5A 4WK6A 1E7RA 5JCJA 4BGIA 1YJ8A 3SJ7A 1KETA 2PH3A 1BXGA 4J1TA 3LC2O 2CUKA 1LTHR 1HLDA 1PU2A 1JTVA 4CR7A 4HV4A 5ER6A 3ZNNA 1G1AA 1MFPA 1Z74A 2P4QA 3DBVO 4ZU3A 3WICA 3OJLA 4FIZA 4CR8A 3QWBA 2Q2VA 2DVMA 1EVZA 3AOEC 3BMNB 1UJMA 2NU9A 3VOSA 4B4VA 3HDJA 2DBQA 1YL6A 3LT2A 4E0BA 3DMYA 1A72A 3L07A 1BDBA 4WECA 5LDHA 3VH3A 4YBZA 1R4NB 1XDWA 2IEDA 4XIYA 2DBRA 2YQ5A 1E3EA 1V9LA 5L53A 4IGFA 2JFFA 3QLJA 3C1AA 3WWZA 3ZHZA 5JFOA 1SO8A 5L45A 1UP6A 2Z5LA 1UDCA 4JJFA 5G0UA 1GUZA 2DFVA 2WEKA 1RYDA 3WYBA 5K6AC 3WGIA 3P2YA 2BMAA 4E4YA 1B14A 4YEDA 3DL2A 1UXHA 1YXMA 4XYMA 1X0VA 4FDAA 1PS0A 3VVCA 1IPEA 1PSDA 4RF2A 3KYBA 3R3SA 2C29D 4MP8A 1BXKA 3IC5A 3KB6A 4CLRA 2WTBA 3T7EA 3DDNA 3G79A 4RPGA 2VWGA 4L8VA 4P38A 1GZ3A 5KIAA 3BTOA 3FR7A 4LVCA 1E3IA 2DKNA 4IZIA 1XELA 1SAYA 3RJ5A 3RC9A 4L74A 4O63O 3ZU2A 3ZV4A 3QRWA 1YE3A 4YAKA 5BNIA 5KKCA 2O3UA 5IZCA 3W4IA 1E3WB 3GDGA 4MVJI 4CUJA 1NHWA 3VPGA 3WG9A 4WKGA 2FP4A 3VZQA 1A9YA 4GKVA 4HNHA 4BO8A 3C7DB 2CD9A 2D5AA 2DBZA 3UN1A 4AJOA 4ZICA 4RJTA 4PLCA 3V1TC 4OXNA 4OM8A 4ND5A 2HRBA 4A7PA 4II2A 4R9RA 1P45A 3GQVA 3WX0A 1HKUA 1R16A 3F4BA 4PCVA 5TT0A 4DQVA 4RGBA 2I6TA 4M55A 3W4JA 3DBHA 4D7AA 4DMMA 3GEDA 3PHLA 3GHYA 4TKLA 2QW8A 5FEUA 1AXGA 2Y0DA 1DC6A 3FD8A 1J0XO 2GDZA 4RF4A 4RPKA 3H8VA 3KSZO 4FJ1A 4O59O 3VHRA 2CNBA 4CMIA 2BI7A 2EHDA 3KRTA 1WDMA 4GBJA 4Q3BA 2B35A 2EW2A 1KVSA 3AWDA 5IDWA 3E82A 4B4OA 4OSPA 2NUAA 4IJVA 4XKJA 3UKOA 1YONA 4NIMA 2CMDA 4LN1A 2F1KA 4U6SA 3OIGA 1DB3A 4J6FA 3ZWVA 2ET6A 4A0SA 4DQUA 2JAHA 1DIGA 3GUCA 4ZQFA 5DN9A 2Y1EA 3I4CA 3SC6A 3WYCA 4B7CA 1P1RA 1V8BA 2UUPA 2FY8A 5DBIA 1ZJYA 3GHHA 4ZGWA 3S55A 4XYGA 4NDNE 1LDEA 1LXCA 2QIOA 4CM7A 1PL7A 4UVHA 1HRDA 1GY8A 1VL6A 1AHHA 2JHGA 3TZQA 3L6DA 2W2KB 1JWAB 1ISGA 1DJQA 1H2BA 4D3DA 4P4NA 2X23A 3Q3CA 3FI9A 4E5MA 1CYDA 4ALKA 3AY3A 1EE2A 3BTVA 3IOYA 5THKA 1ZSVA 2Y67A 1I0ZA 1W0CA 2VNSA 3NDJA 2Y0EA 5L4NA 3QVOA 1PL8A 3IIEA 5B1YA 2PKRA 1F8GA 1R15A 3DTTA 3QQPA 5L4LA 1UDBA 3R6DA 3D1LA 3F5SA 3PQFA 1UAGA 5AVOA 4PG6A 1Y81A 1MC5A 3TZKA 1NPYA 4A27A 1GUFA 2HJSA 1F14A 3PGXA 1ML3A 4XDZA 4DUPA 4BNFA 4O0LA 3D3WA 3BMCB 3JQDA 3OIFA 4J0EA 2EXXA 1V3TA 1QP8A 5EL0A 4DC0A 5BSEA 1A7AA 4I5GA 3UAGA 2J6IA 3TJRA 1B8UA 2GRAA 2NQTA 1LC3A 3H5NA 1D8AA 2GN8A 3ADPA 2GZ2A 3ON5A 4XZ3A 5I9LA 4WEOA 4DIBA 3JQGA 5EN4A 4JP3A 2E6UX 1NFFA 3AM5A 1CERA 2B36A 2J5RA 1F0YA 2D2IA 3Q2KA 5HS6A 1LRLA 4Q39A 3EDMA 4BGVA 4ZN6A 1WMAA 4A73A 5CAEA 3EY4A 4IDAA 4YJGB 2OUIA 4HP8A 1DC3A 2W2LA 1T4DA 1R4MB 1ZH8A 5IG2A 4ROSA 4ONEA 2C0CA 4PIVA 1KVRA 4UVEA 5BR7A 3EMKA 4HWKA 3N58A 4ALJA 2WSBA 2YFHA 5H82A 1CQJA 3MTJA 4PFJA 4J1NA 3I6QA 3GLQA 2P5UA 1IL0A 4JLWA 1E3LA 5DBFA 2VUSA 4FS3A 4OMUA 1Q1NA 5KNLA 3IS3A 4D44A 4BOYA 2J3HA 1SOWA 1O6ZA 4FBGA 1MP0A 4OGWA 3WBBA 5KJ1A 3O26A 2BFMA 2NVWA 3BHIA 4PG4A 1Y9EA 5KJFA 5KJCA 1GQYA 5HTOA 4W9NC 5C37A 5BT9A 1N8KA 4DPLA 1GZ4A 3A28A 3K2BA 3AUUA 2NWQA 4UVDA 2V65A 3H9UA 4EJ6A 4L9RA 2ZATA 3WDSA 2SCUA 5TJ9A 1U3TA 1DC4A 5BQFA 1NWHA 4QT0A 4OJNA 3QW2A 4B7UA 3V1UA 3SLKA 3RC7A 3MOGA 2X0JA 3P5SA 3A14A 3WQSB 3K9QO 4M87A 4GVXA 5CG1A 3DBRB 1ZFNA 4PN3A 4ZD6A 4DLBA 3WQQA 4NU6A 3DC2A 2C2YA 2J8ZA 1JAXA 1HT0A 2CZCA 2R00C 1Z7EA 3QWIA 1PJ2A 3BHJA 4QXMA 3UGKA 5LDGA 4C4OA 2JKVA 3JQ9C 4HUJA 3R1IA 5JC8A 4CMJA 3F47A 3HSKA 2X0IA 2Q1TA 3ZGYA 4CLOA 2VOEA 1P0FA 2P5YA 3QHAA 4BNMA 3I3OA 5CDGA 3JQFC 4P4GA 2Y1FA 4E5PA 1EUZA 3CINA 2VWQA 1XHLA 3WSWA 4IXTA 1SZJG 4B3HA 3I83A 1V3UA 1FDSA 3GVHA 5AXAA 1LLDA 1X7HA 3P2OA 4AJEA 2Y1DA 1KVUA 4R4JA 4QSMA 2PA3A 4JQCA 2ZB8A 3ADOA 1BHSA 1XG5A 1KEWA 5EPOA 2Y93A 1VI2A 4M49A 1H6BA 1SMKA 5A02A 3JSAA 5FFFA 5CEEA 3D7LA 2OBNA 4GX2A 3GMSA 1K2WA 1UP7A 4RVDA 3B70A 1LLCA 3DAFA 3LT4A 4DLLA 1QLJA 3ZNOA 4JROA 4OXYA 4MDHA 4HFNA 4E21A 3U4IA 1HDRA 1K6XA 2H63A 3WR5A 2G76A 1FDWA 1ZEMA 2WYVA 1X7DA 4XQEA 3KBOA 3KYDB 1HEUA 5F3RA 3ZN2A 3UCXA 1QYVA 1Z45A 4XEHA 2QX7A 3I6IA 3KM0A 1H6DA 4D3FA 5FWNA 1SEVA 3AM3A 1ZW1A 3QWFA 4YJHA 4BO5A 1E7YA 3MJTA 4IZHA 1YOVA 3OM9A 3PYMA 3ZWOA 2X58A 3CUKA 3O8QA 3WIDA 1LEHA 4Q3AA 2FR0A 2AXQA 3S2FA 2PLAA 3IKTA 4I9HA 1YL5A 2Q4BA 3N7UA 1XQ6A 3DEYX 4DQXA 2PD6A 3HG7A 4IDEA 4DTIA 3NRCA 2RH4A 2E82A 3EUWA 4PLWA 2JFGA 5IXSA 3QV1A 4K26A 4FFLA 4YAEA 3ZU3A 3JV7A 1HZZA 3GF4A 4OIMA 4S1VA 4BNWA 5JYEA 1J4AA 2PWZA 3L0DA 4UUNA 3IKVA 5CDYA 3EVTA 3ZWYA 3WXBA 1HYGA 2GZ1A 2HCTA 4UULA 4XR4A 4E2YA 1WW8A 4U7WA 3OQ6A 3NKLA 4BS9A 4B4UA 1NX6A 4CL3A 2VRBA 1Q7CA 5IN4A 2BFPA 4HFMA 3NJ4A 5G4KA 3JTMA 1BDMA 5THQA 1U3VA 1T25A 5T8KC 4CM8A 1ENOA 2YUTA 4Y8VA 5TNXA 3EZLA 3DFZA 5GY7A 3L77A 1Y9AA 4FFMA 5TX7A 4LCJA 4CM5A 5L7WA 2V7PA 1W73A 4WJZA 4NI5A 3ASVA 2ZB4A 2G82A 3K8ZA 4UEKA 1NAIA 4LRSB 4QQRA 3W1VA 4EW6A 1PIWA 5C5IA 3DOCA 1U2DA 2QRJA 2PV7A 3TOXA 2BHLA 3I9JA 5HS4A 4CMAA 4WNIA 5JAMA 2XXJA 2PKQP 4EI2A 3GC6A 3JYPA 5I9MA 1EDOA 4TZTA 2FR1A 4M8SA 4WLEA 4YJFA 1WNTA 3RFVA 3ZDFA 4NPCA 2A94A 2O3SA 1F12A 2DAPA 5BSHA 3C3XA 4FQ8A 2VHXA 4Z9YA 3CTMA 4L75A 3PQEA 4DMLA 1LDYA 2EWMA 2OZPA 1IULA 3CZRA 4GX1A 4CLXA 5TIIA 3CTVA 1GPDG 1I3LA 2QZ9A 2Y1CA 3UXYA 4NHEA 3AFNA 3FN4A 1Q0QA 2CDBA 3FSRA 3HUDA 3JQ9A 5LC1A 1E1KA 1JAYA 1PZGA 1NQTA 2VCYA 3BYZA 3DMTC 3H9GA 3NT5A 3JCZA 3ROKA 1QRRA 1YH3A 3JD0A 3JQ7B 4IDDA 5KVCA 3F4LA 3O38A 1P33A 3RC1A 3GRPA 1P1FA 3QVWA 1GYPA 1CF2O 3ZHYA 2X9VA 3L6OO 3RD5A 2Y99A 5IN5A 1ULSA 3RI3A 5ITVA 1AHIA 3RUEA 3NGLA 2X5JO 1R66A 4D45A 3DOOA 1IB6A 2D59A 5BSGA 4Y9DA 1O8CA 3MCVA 1N1EA 1GQQA 4U8GA 4L73A 4CUKA 1FDTA 1ID1A 1TT5B 3W4KA 5L51A 4IBOA 1PJQA 3DBLA 3EGOA 3RAJA 3S8MA 5FF9A 2PZKA 1NTOA 4YT8A 2B5VA 1BXGB 4JP2A 3OSUA 1SBYA 4AJNA 5TRTA 2HMTA 2YHUA 2WMDA 2NU8A 2Q99A 3TSCA 3K2EA 3S2EA 3VPSA 4IQ0A 3VZSA 4KQXA 1KY5A 5T5QA 2PR2A 2VZ9A 4IS2A 4RDHA 5EQFA 2AG5A 4GX0A 4HXYA 3G0OA 3C85A 1OC2A 5JDIA 3HHPA 2C7VA 3QWAA 3GRKA 2GD1O 2OGUA 1JKIA 3AFMA 3AW9A 4P4LA 5TS3A 4HY3A 1GAEO 3WFJA 2YQ4A 3B1JA 2WJPA 2WD7B 3HFGA 3ICPA 4JNKA 5DDIP 4B4WA 1IHYA 5TGDA 1P1JA 2YDXA 1E5QA 1NVTA 3H3FA 4I1IA 1J49A 1J5PA 1I33A 4ND4A 3RU7A 5T57A 2O3RA 1UUFA 4L76A 4I9UA 5L7YA 1ZIDA 1DC5A 3AOGA 1WZIA 1KOLA 3UUWA 1ONOA 1LI4A 2V6BA 5C7IO 1HL3A 3K31A 4PRKA 3F5QA 3O9ZA 3PXXA 1WAMA 2OHXA 2YDYA 1WZEA 1KIFA 3L4SO 3RSHA 2BGLA 2E48A 2FWMX 3NTOA 1ISIA 1T26A 5JPIA 2UVDA 2X4GA 1ZNQO 3ONFA 5EMHA 1AN9A 1G0OA 3NX4A 5I7EA 2RHCA 4WLVA 4HX5A 3JQEA 4LK3A 6LDHA 1E92A 1TVEA 1DXYA 3ZW9A 5JXWA 3HJAA 3G17A 3FCOA 4CODB 5T8KA 5L9AA 4R16A 1JKFA 1Y6JA 3RFTA 3T4XA 4MOWA 4Q3EA 3CPSA 1G0NA 1JVBA 1L1FA 4P22A 2G1UA 4NJMB 3OQ1A 4UAGA 1YRLA 4D3SA 3AU9A 4NJOA 1LNQA 2J5QA 2IYOA 4X54A 4GSKA 3ROPA 4XQCA 1E6UA 4GMFA 4RV9A 4WNCA 3ONEA 4XRGA 1LDBA 3AI3A 3QP9A 1BVUA 2GNAA 1K89A 1LLQA 3OETA 3PHGA 3H2ZA 5COAA 4DIFA 1QYDA 4EUFA 2PZMA 5AXDA 3B1FA 4MVJA 1ISMA 3VDQA 2YV1A 2AQKA 5JBIA 4LRTB 3DBHB 3OA0A 4GLLA 5F1OA 2CDCA 2GGSA 4IIUA 4YYZA 4MVJD 2VQ3A 1QMGA 3JYLA 4BKRA 3JD1A 5ICSA 2HSDA 3INRA 4CMIB 2Z1NA 5DBGA 3GG2A 5L40A 5HWSA 2I5PO 3GN2A 3E5RA 2YV3A 3P19A 3WGHA 2AEJA 3AUAA 3E18A 2HDHA 1E1NA 2Y68A 2B4RO 5JE8A 1LU9A 4XGIA 2C7GA 2P2SA 4CQMD 5EINA 1BGVA 1NP3A 1NM5A 1XYGA 2B0JA 2NVUA 1ENZA 1V0JA 2B4QA 3ZWCA 4J9VA 3ZWBA 4ITUA 4WCFA 4CQLA 4AJLA 1NAHA 2JD2A 4FC7A 4QTZA 4KOAA 4XA8A 1ISJA 3D4NA 3GGOA 5KVVA 1Y8RB 4E13A 2Y05A 2PNFA 1FF9A 1HLPA 3H2SA 3LT1A 2ZB3A 3GAZA 2NTJA 3FF4A 4DBZA 4I5FA 1UZMA 4YTEA 2P9EA 3WLEA 1EBUA 3DZHA 4C7JA 1X15A 1PZEA 2NLOA 4R1NA 1ADGA 3M2PA 5TQVA 4CM1A 4AICA 3D3EA 3FNGA 5KCZA 3STHA 3C1OA 2Z95A 2GASA 1NVMB 1H6AA 1HSOA 3DAPA 3ASUA 2AQ8A 1PL6A 4OQYA 4DBVO 2JD0A 1LRJA 4WGGA 3WQRA 2QG4A 2PKQO 3ANNA 3D3WB 3LU1A 4M86A 3HNPA 3FNFA 1E7QA 1R0SA 3FTNA 5GZ6A 4YR9A 2EEZA 2Q45A 1V35A 5CDTA 3DXFA 1VJ0A 3WWYA 4ALMA 4KUHA 3JQGB 5JO0A 2ZYAA 3H9QA 3PHIA 1BVRA 3GA0A 4YWJA 4QEDA 3F6YA 4D0RA 3EAGA 4R54A 1S7CA 4IMPA 4H3VA 1P9LA 2VN8A 3ZU4A 4R5MA 2AQIA 2WE7A 4K9DA 3ZHXA 4WUVA 4Q3DA 2X6TA 1R12A 3O4RA 5JDCC 5A04A 2E49A 1O94A 2J3KA 5A06A 3SC4A 5I7FA 1P0CA 1YL7A 1GU7A 1I3KA 1T24A 3UICA 5IFLA 1I30A 1NQAO 1QYWA 4OSOA 3K92A 4YAIA 3WS7A 3WNQA 2WM3A 3OJOA 4CR6A 1R6DA 4PG7A 1OOEA 3ST7A 4NBUA 4IXWA 4J4BA 1QLHA 4RVUA 3GGGA 4J43A 3V2UA 3E48A 3WGYA 4AJHA 3I9KA 4MVJM 1IZ0A 5JYDA 1IZ9A 2V6GA 1L7DA 3BIOA 5BNFA 3WTCA 1JDJA 4OL9A 1LSUA 3W8EA 4PLPA 4PLTA 4BIIA 1R37A 1WWKA 4CL8A 1I3NA 1M67A 1BSVA 1P44A 4CUZA 5CFZA 2CVOA 2IODA 4IS3A 3RCBA 1MC4A 1PZHA 2EF1A 4BNGA 1ORRA 5IDYA 1GR0A 1HDOA 3DR3A 3TNLA 1Z75A 3L9WA 3ORFA 1B7GO 1XWFA 2QYSA 1VPDA 1LRKA 3KO8A 1LSSA 5H83A 3JQBC 5DCUA 2OP0A 3E8XA 2NV6A 5COBA 3VPXA 3GVCA 1CJCA 2PZLA 3DHYA 4A5OA 4CMGA 3TPCA 3JD2A 3WGTA 1U4OA 3WGQA 2EV9A 3KYCA 2BELA 3AI2A 1QXSA 2HK8A 3GN1A 5COQA 2IZ0A 3Q11A 5EERA 1KVTA 1WDKA 1X1TA 1DAOA 4J9UE 1A4UA 2A9FA 3UW3A 2X22A 4CLOB 1IPFA 1NASA 5ENVA 1KEUA 1VL0A 3RC2A 1E7WA 2XXBA 2VUUA 3JQ8B 1LUAA 3CMMA 4MPDA 4DREA 1NWCA 4J1QA 1RJWA 3GFBA 1NFQA 4CMKA 4YAGA 5CEFA 1MV8A 2HMWA 2P9GA 1GEGA 1SB9A 2DUWA 4YT5A 4Z3DA 4J0FA 1J6UA 3CH6A 5TF4A 1R0LA 4TROA 3MEQA 2A35A 3EHEA 4K6CA 4LCEA 3F1KA 4CV2A 1ONPA 1PQUA 2X5OA 5GMOA 1ZUD1 1C14A 1YB1A 4PZEA 4ZQEA 5KVQA 1L7EA 3LK7A 3W6ZA 2BI8A 3V5NA 3GZNA 4YQYA 1PR3A 5A4DA 3Q1LA 4E33A 2O7SA 4WCDA 1ADFA 4KUEA 2JCYA 3CSDA 1Y5MA 4A10A 1Z7BA 2JFHA 4XJSA 3AOEA 3WNVA 4EDFA 1EUCA 1PGNA 3AM4A 1HE3A 3BMNA 3PFFA 1D7OA 1YBMA 3F3SA 1MG0A 4RZIA 5AXCA 3MJVA 1HE4A 4D42A 4PLYA 3DZJA 2C5AA 3D4PA 4JBIA 1E3SA 1VRWA 4OHUA 2GZ3A 1P3DA 5A5EA 4N18A 1WXDA 2VTDA 4YJHB 3FBTA 1YOVB 3OICA 4KDFA 3CEAA 1G6KA 4R5HA 4E3ZA 3DZGA 3O8QB 1SC6A 5K6AA 3TWOA 3GEMA 2DTEA 4A26A 2ZJ0A 4FW8A 4I5EA 3GVIA 3RU9A 2IYPA 1ZSNA 4BO0A 2AEMA 3KLPX 4R1UA 4DGSA 1RM5A 1YQGA 4E30A 3PJFA 2W98A 2QRKA 2ZJ1A 3FBGA 4BO6A 1D3AA 2E4AA 1F06A 1LQUA 2AE1A 2X0RA 3BTUA 3DHEA 3JYNA 4J2OA 1HDGO 1NHGA 4JJIA 2NSDA 4BO9A 1N9GB 5AQ1A 2O50A 1HE2A 4XD2A 3PVZA 4UEJA 1NQOA 5IXYA 5DNAA 4R01A 2BRUA 5TT1A 1DAPA 1YQDA 3OMLA 3WGZA 5CPBA 2NU6A 2HQ1A 4BNIA 5JDCA 1ZXLA 2RIRA 2AQHA 1RPNA 5G4KB 4R1TA 4HNGA 3VKVA 1YJQA 1PGPA 4DPKA 1E3WA 1EBFA 1FDVA 4RCVA 5ICMA 2WYUA 4CM8B 3QY9A 3M1AA 1PJBA 3C7AA 2O2YA 4XGKA 4ALLA 1ZKMA 3KOUA 2YY7A 4JXKA 3ROQA 4R68A 4MVJG 1DFIA 3H3JA 1LSJA 4J16A 1PS8A 1MB4A 4C7KA 4DWVA 1T1SA 4CV1A 1XKQA 4S3MA 1PJTA 1W8DA 1H93A 2GN4A 3K96A 4UVGA 4BO2A 1PJCA 5LCXA 1MFZA 5KJ6A 2HMSA 2JAPA 1YBVA 4U0JA 4AG3A 4W6ZA 3OECA 3OIDA 4QFDA 1ISHA 4UEOA 1U5AA 2NADA 1DRUA 4PLVA 2HMUA 3GR6A 4PRLA 4XQGA 1Z73A 4YJFB 1XCBA 4KTVE 3X2FA 5IF3A 1DHRA 1HE5A 1EK6A 1HYHA 3JQBA 3AI1A 3PFWO 2PH5A 1MX3A 1T1RA 3C7CB 2PGLA 2I99A 3I4FA 5U9CA 3OF2A 5FYDA 1NPDA 4BB5A 1UH5A 1UXGA 5KWEA 2OFPA 1VL8A 2BGKA 4Z9XA 1Y8QB 3B1KA 4EGFA 4PLZA 3LSYA 1VSVA 3AU8A 4OOFA 3VZRA 1EMDA 3NEPX 1AXEA 3ZCXA 3ZWXA 4F46A 4MVJF 3T4EA 3A4VA 1GV1A 3RROA 4BMVA 3HE3A 2X86A 4FB5A 1T2CA 3H7AA 1WVGA 1ZK3A 4XCVA 4AL4A 1PQWA 4PLHA 5B4TA 4R3WA 1U5CA 2NU7A 4NBVA 1KYQA 2NTVA 2GERA 4PZCA 3VC7A 1DIAA 1EE9A 2DBVO 5C7LO 5JS6A 2R6JA 4GX5A 1YS4A 2ZQZA 5F1PA 3ITKA 3M2TA 5ITWA 3FWNA 4GKBA 4TMFA 1DPGA 2X8LA 5DOVA 3G1UA 3PLRA 3PJDA 5U1PA 3S2IA 5DZSA 4MO2A 5L3ZA 4MKZA 2Q4EA 3JQAA 2Q46A 4JGBA 1A4IA 1JKJA 1I8TA 4PVDA 2VRCD 3DZIA 4L4RA 1GCOA 5TLSA 4ESOA 1LDGA 1IUKA 2EP7A 3HDYA 3TFQA 2VHVA 3VH2A 1XGKA 4QFCA 2IE0A 3ETGA 4INAA 3JQAD 3NTRA 1ARZA 1EK5A 4YA6A 1FJHA 4BV8A 2O3JA 4MKRA 3GPIA 4IINA 3BMOA 4RPHA 2JCXA 4AJKA 3K6JA 4F6LA 3WMWA 1OFGA 4QO8A 3QE3A 2NVBA 4FFPA 1PTJA 2CF5A 1M6WA 4N5MA 4NMHA 3GNTA 1ZO8A 1T2AA 1BWSA 3B20A 3VTFA 3ZV6A 4N7RA 1A71A 4A03A 3RBXA 3EC7A 2YFQA 3FTPA 3I1JA 2EKLA 4F6CA 1DFGA 3PTZA 4NG5A 2EKPA 3H4VA 4OQZA 4GQAA 2I76A 1MG5A 4Q9NA 4BNJA 4CM3A 2PY6A 3PK0A 3F46A 4O6VA 1N7GA 5L95A 3DZFA 3IP3A 4UUPA 2Y66A 4GWKA 2FRDA 1ZSYA 1YB5A 1WLYA 1O95A 2C07A 4LSWA 5G0WA 1ULUA 5JY6A 3IDSA 3KSUA 1YDEA 3OFSA 4DC1A 4J90A 1HDXA 1BTOA 3HADA 2WYWA 1IYZA 4E5NA 1EUDA 4W9NA 1SEPA 4XRRA 4MP3A 3DO5A 4BKOA 3DTYA 2QRLA 4J3FA 1YQXA 4NK5A 2Z1MA 3DZBA 2V6MA 1VKNA 3HQ4O 4CM6A 4TRNA 2C54A 4Y6PA 4BMSA 3JYQA 1DLJA 5A9SA 3S1LA 1PZFA 1Z82A 1U7HA 1U3UA 4F3YA 3IAHA 1HWYA 2OOSA 4BKUA 1SB8A 3OJ0A 1A27A 1H0KA 1VC2A 2A4KA 2IEBA 4ZRMA 3BMQB 4EUEA 1PWXA 4YQZA 3IMFA 4N54A 1OMOA 3KZVA 5IDXA 3TL3A 1UZLA 3KTDA 1NR7A 1U3WA 1GCUA 2D0IA 2R00A 1E6WA 1GTMA 4LMPA 2ZQYA 5MGBA 4YPOA 4QECA 4RZHA 4XQ9A 3U5TA 4Y67A 4E32A 2X7HA 3ETDA 1ONNA 2LDXA 3SJUA 1DO8A 4D43A 3KEQA 3KSDO 4R69A 3VH4A 1VLLA 2RAFA 4XB2A 5A05A 3JQFA 4FPXA 4PGFA 3E9MA 3WB9A 3GDFA 3QJ5A 5B12A 2GYYA 1EFLA 3HN2A 1XU7A 4BGUA 1W6UA 3GEGA 3KVOA 2NVUB 3JD3A 1U8XX 2NQ8A 4BNYA 4FJ0A 3MOIA 3BTSA 3I23A 3RUCA 3VVBA 4WCFB 4HFJA 3GGPA 4CQLB 4BKQA 2RH8A 5HM8A 5T67A 3DONA 5EJ2A 1M66A 4FFRA 3B6ZA 1H2HA 4QO7A 3HN7A 1E7MA 4Z3KA 2BLLA 4KDEA 1TXGA 4E2XA 3INTA 5G0VA 3DQPA 5GZ3A 4MVJP 4ZA2A 1F17A 2EIHA 4RLHA 3E9QA 2FSSA 1H5QA 1T4BA 1EZ4A 1ZJZA 2TMGA 1Y1PA 1C0PA 1HSZA 2EGHA 4XR9A 3TDKA 3IJPA 3RUAA 1BW9A 3GT0A 1CIVA 1RWBA 2FPGA 4FFNA 2PZJA 4GVLA 4I5DA 4FD3A 4E2ZA 5I9NA 2DT5A 4NU5A 3TQHA 2VTEA 1MGOA 1RKXA 3X2EA 4N5NA 5F21A 2CVQA 4IY1A 5EESA 4BNLA 1IOLA 3ABIA 3UF0A 1CDOA 3LYLA 4H15A 1EDZA 3PIDA 1E5LA 3AJRA 1KEPA 3LF1A 4I8XA 2FZWA 4XJTA 4K6FA 4M1QA 4E31A 4YCAA 1P1HA 1BG6A 1KS9A 3VH1A 3LLVA 1N92A 2W8ZA 2X5KO 1I32A 4J91A 2PFGA 4BVAA 5EIOA 2QQ5A 2DQ4A 3ICCA 2ZCVA 3UCFA 4CLRB 4XX0A 2CF6A 3TOZA 1OZAA 5TC4A 3FR8A 5JCXA 2HUNA 4YVFA 2I66A 4FGSA 2D5CA 1K3TA 2JL1A 1Q7BA 4OYRA 3PHHA
chains in the Genus database with same CATH superfamily
4FN4A 4TLEA 4YV2A 1FQKA 2BD0A 1RWMA 1M1NB 2OR3A 1E8MA 4Y0NA 2FA9A 1R0WA 3K4HA 5H59A 1PGQA 2QEQA 4QYTA 4Z1MA 1AUQA 4RM2A 1KE1A 3MRXA 4NJEB 4F6RB 3UJNA 4EO4A 4YR7A 4ZJUA 1UAYA 1NSYA 1EX7A 2VNAA 2H06A 4QEKA 1FEZA 1L7QA 1U99A 2WFZA 2GBPA 2FZVA 1LV7A 1SFRA 3CX4A 4JOBA 1ZCZA 3GAAA 4D96A 1X8LA 3VAZA 4DLNA 1YHYA 1XZJA 1SC9A 5CPFA 1UDAA 1KP9A 2H29A 1U31A 4FU0A 4Q19A 1B0AA 4BHTA 4F3KA 2Q1UA 1RZUA 2B37A 3EIWA 1BIFA 3B5JA 3QLTA 4JJGA 1VMKA 2EX4A 1S2NA 3FNHA 1V16A 2WAYA 4UFOA 3N8IA 1MOZA 3C45A 2L82A 3HEAA 3UH0A 3PPVA 4EITA 3S40A 1XZEA 3T5DA 3KFXA 4FFBA 3RRBA 2WRZA 2GX6A 2G80A 2AE2A 3ECCA 4WVLA 3W90A 1LBSA 3Q88A 3ZV5A 1E9RA 4CM9D 3LOUA 3N59A 4K0RA 1FZQA 4NFLA 3B2NA 4RY9A 1F2DA 3E9EA 3IOEA 3KKQA 2J48A 3WRYC 1QTIA 1X1CA 1GPNA 2G63A 3IR6A 4ZOLB 1FNMA 2R87A 5J59A 3T9FA 1A2BA 3H9JA 3VMFA 3G82C 1YA4A 2RGDA 3EYWA 4NZYA 1ZGCA 3L8MA 5A2QA 5ADHA 3ZEAA 1N5DA 1SURA 1EM8A 1LBEA 2Q28A 2VUTA 4IOLA 5A1TA 5DSTA 3PIIA 4HLDA 5B3JC 1RPTA 4CM4A 1PR9A 4HSGA 2IXBA 4RPJA 1RKUA 3TSWA 1FFEA 3CNNA 4TTJA 1PFVA 1QQ6A 1WTCA 2J5XA 3DMTA 4U4AA 4UATA 3WRWA 1J90A 2VA8A 5BNZA 1T2EA 5EE3A 4ZT4A 5BV8A 1SXJC 2JG3A 3T12A 1AUVA 3GVXA 1VJ1A 3F6PA 4HDAA 4PHTA 2Q49A 3NYQA 3D54D 2Q3EA 3LY9A 2R8PA 3VNAA 3NEJA 1W4AA 4QAQA 3GJZA 1ONSA 1DAIA 1ACJA 3KT0A 2UDPA 4GWGA 1WPQA 3HYSA 2C8VA 4ZQBA 4HX2A 1MHTA 3SCZA 4YP1A 4FM9A 3FAKA 4Z5XA 1Z8FA 2V7WA 2IL1A 3FKSA 4N0QA 1S6YA 1ESDA 1WMSA 1NVVQ 5DYWA 1U0LA 4DCGA 1SXQA 1KZYC 3H5AA 1GZ6A 1X94A 2QORA 4OO3A 4HADA 4N5LA 3CX3A 4JBYA 4A8JC 2QPLA 3GFGA 1F8YA 1A1SA 2WTMA 4C4TA 3CWQA 1DIHA 4QRDA 5CD1A 1ZEJA 3WQHA 5DLPA 1WP4A 4EGJA 3UIEA 4MHSA 4QYMA 3WLFA 1XSEA 1E6KA 1WU7A 2C78A 3GZNB 1GVHA 3WLAA 4DILA 3NWJA 1EVJA 3DLBA 4DRXA 2CK3A 3K0AB 4LQCA 3I1IA 3A06A 2GN6A 1B8PA 5JAIA 2BFBA 1ULHA 4MZXA 1NXPA 1ATZA 1WHTA 3ROTA 1BMQA 3FDFA 3OH8A 1E3TA 1MO2A 3T1HB 2R2GA 3O1LA 2V7VA 4TVBA 3IIMA 1A9OA 1DV1A 2C9MA 2HK7A 3I32A 4NYMQ 3DYIA 1JWBB 4TQGA 3E22A 5EC8A 1GD1O 3ZC3A 1CXZA 1N7IA 3HY6A 1B00A 4DDUA 4ZFNA 4Z86A 2JIOA 2B1IA 1H4QA 5BORA 2FPMA 2HU7A 3NFRA 2IPOA 5K0GA 1JAZA 4ZHSA 2ZOSA 4H7KA 4L95C 1RLOA 1Z12A 2W4QA 4ZEOA 1OBCA 2O1XA 3FUVA 4XJXA 4F1JA 1GTSA 1XZKA 3TNFA 3PXGA 5G53C 4D79A 4MWEA 3SLGA 4MV4A 5EMJA 3KR2A 5SY6A 3RF7A 1QCYA 2DFPA 3AB3A 1QWSA 2VHWA 4ZQHA 1YKGA 3D0RA 4OM7A 4UM9B 1QHYA 1J22A 2WNIA 3EPPA 4G9GA 1QGYA 3IDQA 4PX9A 2FN7A 4UJ3A 3TGLA 3M6LA 1UFQA 3A6GA 4R7GA 1G7SA 2DJIA 2RGAA 1I2AA 4JJAA 2IUUA 3AR5A 1ODKA 3L8YA 5IWCA 2I9PA 3W05A 1TA9A 3TCXB 2GI4A 2YZ7A 3THXA 1KZ4A 4Z7JA 5HIAA 2P40A 4ZAWA 4WBSA 5JQWA 4WESA 4L5BA 5LBTA 2VNIA 3S5UA 1DC7A 1KI1A 4HVLA 3BDAA 4AS1A 1M1YB 1JQKA 1ZOPA 5FBKA 3TKLA 3RVRA 1RYHA 3BA1A 4G84A 4NESA 3H1EA 3AG6A 3Q5GA 3ZWAA 3K8YA 3PT9A 3A25A 4I3FA 1OCEA 5I7VA 1QQAA 4LY9A 3FHLA 4KQHA 4EMTA 2J3IA 4QXRA 1OI3A 4W5HA 1UXKA 1O9BA 4AZ0A 2GO1A 3DHNA 4P80A 2XDQB 3L7DA 3VGPA 1EBBA 2AR9A 2EFYA 2NUTB 2ECFA 2Y0PA 1PI3A 3F3MA 4MAAA 1CUAA 2VYQA 4RPCA 1M7BA 3LT5A 4GM0A 3W06A 4TS3A 3LDFA 4WFQA 3L1VA 1E66A 4A16A 3PC7A 1QRSA 4BO1A 1NIPA 5A03A 3RKRA 3LAWA 1IRIA 1MU0A 2X9GA 3IOMA 4PEVA 4C30A 1YR1A 1UT6A 2PU5A 2VQSA 3K9BA 5F35A 2JFPA 4AF7A 5DW3A 4XUEA 2XF8A 1Z6XA 1C0KA 3G2HA 4M0DA 5FLXA 4GH5A 1NF9A 3E4CA 3ILVA 4LJSA 4AY5A 1RQ7A 3A10A 3IVRA 3KUXA 1HZJA 2LKCA 4EEZA 3ER8A 1UMCB 2VSYA 2JI7A 2W6PA 4C03A 4TWAA 4C2UA 3HUUA 5J40A 5IT0A 1HR0B 2QUHA 2IRWA 3FGOA 3V1YA 5I9TA 3PQ8A 3HB4X 1GNRA 3PC8C 2QT0A 1C1DA 2VJYA 3UW1A 1AQ6A 4BMPB 4J49A 4D56A 5KTMA 1ZJWA 6GPBA 4EENA 5EWLA 4HUQA 3VKUA 3FSGA 1NGSA 1TOAA 2PKWA 4J4TA 3SHWA 4RVSA 2RC5A 5HIKA 4B79A 3FMVA 2O4UX 4XUDA 1QOZA 3NXKA 3M49A 1XRSB 4LI0A 1U80A 5KOJB 3D6MA 1JA1A 1VLVA 3D9QX 3EVBA 2E3JA 1C5KA 1GSOA 2WJYA 3KJHA 4HFRA 4CRWB 4U2FA 3M33A 4WY2A 2FW8A 2H92A 3DE4X 4UVIA 2NZXA 3HFSA 3R9XB 3LDHA 3G88A 2ID4A 2J0SA 1AKRA 2GF0A 1JI0A 3VKWA 1VCOA 3Q3HA 3RJ9A 3WK5A 4UTNA 1O4VA 1QQ7A 2VDWB 3ZD6A 2QBYA 4B8WA 1FRFS 3NWEA 3PXAA 4RE5A 1L5VA 3MCZA 3B3JA 2Y1LA 3WJ1A 4R6XA 1KBZA 5REQA 4TS9A 5LBIA 3RAGA 3TL2A 4KXMA 5B1SA 3GLIA 2XB2A 1JHYA 1MIOB 2ZIZA 1PV1A 3D59A 3UKJA 4DL9A 5DEOA 4IRMA 1F7UA 1K8ZB 3AUSA 5F76A 3HB1A 3WXMA 4MGHA 1S3IA 2KS6A 3P9YA 1ZK2A 2IYUA 3F96A 1B2RA 3IUQA 1GADO 3CN9A 2JZOA 1RAEA 5FPHA 1YS6A 4ZKDA 1QQTA 1SVOA 2D13A 4RFLA 2WTAA 1KY2A 1WB6A 1PGJA 4G85A 1H1LB 1IEWA 2B83A 4IKPA 5T64A 3T1TA 1I4LD 5DI3B 2VYVD 1H22A 2A67A 4AQYB 3JQAB 3OIYA 4M1WA 2QV0A 1XQXA 3GK3A 1SKBA 2WFAA 2IJGX 2FW6A 4D4JA 4LNUA 3OQIA 4DLTA 5BR4A 1DX4A 4HGOA 5MFPA 2GT1A 2OHJA 3UHAA 1KAGA 1USGA 2IYAA 1QPBA 2PTGA 1P18A 2VZLA 4Q0MA 4XWYA 1UC9A 1YMUA 2UKDA 4WE3A 4QLAA 1KH1A 3CRNA 3LUJA 3OX1A 4YAFA 1JS1X 3FVQA 4AECA 4H35A 3NORA 1SG6A 3KT3A 5F9HA 4HX9A 2DULA 5JZOA 4RLSA 1Z17A 3TZLA 5FBQB 3AINA 2FKAA 4O8ZA 1C0IA 3U4QA 1XMJA 4B3IA 1J8DA 2DH6A 1Z15A 3RK4A 1Z0JA 4U1RA 2LUOA 5HQ3B 3STUA 1TTPB 4YI3A 2X1LA 4BN5A 4RV4A 1L8QA 2BGMA 4CCYA 1R0RE 3G1TA 2FFRA 2VDKB 4AN0A 1ESCA 2P9JA 4IXNA 4ZI7F 5AVQA 1CUVA 1D0VA 1H65A 1OFHA 1ZMOA 2H4HA 4LDRA 3UJ6A 4DJFC 1M1YE 2R84A 4PSDA 4EYGA 2I03A 3G2NA 5BSVA 3VV3A 3ZDRA 2GCGA 1M0WA 3O5AA 4JT8A 2IHZA 4HEJA 1S2MA 2RI1A 4K5QA 5ALIA 2OCXA 3TZHA 3AF3A 3CW2A 4JOSA 5KYTA 3VO1A 4F3NA 3J80A 3ILYA 1E9BA 2DHEA 2NVOA 2ZRDA 1LVHA 3BEDA 3SK0A 2OENG 5HA5A 1Z0IA 4GSLA 3Q5DA 2XYRA 1UBRS 1C4XA 4UAVA 3O2QB 2EG9A 2C98A 1TIPA 2IXGA 3CLKA 3TRJA 3CZQA 2A5GA 2CLEB 1JIJA 3TM4A 3AVXA 3D5EA 1RJDA 2O8CA 1XPJA 4HQRA 5AHRA 3WSVA 2ZTVA 1B3RA 3N76A 3D64A 1Y8ZA 1DBPA 1LVUA 4OHFA 3PGJA 3JAKB 3F7TA 4U0KA 1OXSC 3SFVA 2AOTB 9LDTA 1WXIA 3NUGA 4JBHA 1RBZA 4FNOA 3USZA 4E46A 2FHPA 4G5YA 1TCUA 4GM4A 4ZCRA 2COEA 1QX4A 1RHUA 5KX5B 2GM5A 3Q0EA 1M2FA 2JCGA 2IU0A 4XUCA 3W9YA 2VP3A 3MWLA 4JB0A 4MMXB 4AZ3A 2D4AA 3LT0A 1Z4JA 1YQ9A 3DD1A 4FYIA 4ZI3A 3NAZA 3LBHA 4KH0A 1USKA 3IQDB 2C1XA 2FMUA 5ICCA 5FPPA 3ZCPA 4OH1A 1C7IA 1M72A 3H1TA 4ALNA 3CC8A 3KHUA 1PVVA 1Z38A 4L08A 4L16A 5FJIA 3WO0A 1RLTA 1BD3A 1CVIA 1XCGB 1EVYA 1Z0FA 4JQSA 5FI0B 4CMBA 4N6GA 3N74A 3TW8B 1N0VC 4ZI2A 2EZ9A 2VSQA 2VRWA 3S0JA 3PA6A 5KSZA 3AEQA 3DUFB 3ANTA 1GEEA 3WNZA 1BN7A 3QFSA 4RQTA 5E1OA 4ZAFA 1JEYB 1UR5A 4UJ5A 1G5QA 1RMTA 3GPBA 3EIEA 2ZB7A 1E2EA 3RUDA 3H6GA 4BNNA 3M4YA 2ZE5A 3AUTA 1ZCFA 3QGMA 3HXKA 3ZXSA 4GICA 3LXXA 1RAIA 2FNAA 1YBAA 5HNKA 2W2KA 1R5JA 4CG1A 4D2IA 4EO7A 5K3EA 3EOZA 4QODA 3WYEA 1XZBA 1IQUA 1CY2A 2C2GA 4DCMA 3L2OB 4B4KA 4GXTA 2RHRA 2P9QA 3HZHA 1X86B 3JALB 2QAGC 1RI2A 4L9SA 4IJWA 2TMKA 5KWVA 5EZSA 1DG1G 1K6JA 1O6CA 2Y2VA 4RAQA 4Y1FA 5B4VA 3MWDB 5IX8A 1SH7A 5CDSA 2CNNA 2ONZA 1R0XA 3PL1A 4OX9B 2YQZA 2SHKA 1I2BA 2IZOA 4WEQA 3ZY6A 1VPWA 2XNJA 5FBRB 3BMCA 3P9RA 3QW4B 3S2GA 3FJYA 5LQMA 3K0HA 1Z83A 1ODTC 3OZVA 4FFOA 2AX4A 3BK7A 1QVAA 1UODA 2VJBA 3DQQA 4ZQGA 3LI2A 4GLFA 5T6BA 4J3NA 3WRXC 4MB6A 3LKDA 3ZWPA 2IHKA 2J3DA 2LZ0A 2P79A 1YR7A 2YJ5A 5JD5A 2PFSA 2YWDA 3DFMA 1EESA 2AN3A 2ZI5A 1FFXB 1KDTA 2RCNA 4R8LA 2RHDA 2Q6LA 3MJ4A 1U0FA 1ZC4A 4IGIA 4X9XA 2I7CA 2A1UB 4JJ4A 1DIBA 2C4TA 3O73A 1QO9A 4YX9A 2BKAA 5DT9A 3MT8A 2HGSA 4HLQB 1EEHA 1XNGA 5BMVF 1MA3A 3GLGB 4PZAA 1Q7GA 5GZ1A 1B16A 2LDBA 3MCUA 1LBTA 1TTHA 1ZRSA 3CF6R 2VHTA 3DAYA 4EI7A 4S12A 4X93A 2BEUB 4KSCA 3DF7A 4HLNA 3W5AA 4WLFA 1D2CA 4D9FA 5B6IA 1ZXXA 4W7IA 4GL2A 2BCEA 3CPHA 3MJEA 4ZZIA 3STXA 5IYZB 2OBMA 3R0QA 1FC0A 2FG7C 3EMBA 3FOCA 5FQNA 3LUDA 1KTVA 3KEOA 5F77A 1N6RA 2GFIA 2ZTLA 5DJ5A 3V4OA 5K0CA 2DPXA 3K1ZA 5IARA 4AFNA 1QIIA 4CV3A 2ORED 1SCDA 3ES9A 3JU3A 3PYLA 1YB4A 2Q5QA 4Q02A 3L7IA 3UAVA 4CJXA 1E62A 3OZIA 4ARVA 5IT9A 4UCQA 1QH1B 5AO9A 1RXVA 1TD9A 2X14A 3B13B 4W5NA 1DEOA 3NGMA 3IT2A 1KQOA 1F20A 4N5HX 4PINA 3C3PA 3W9SA 3S28A 4URZR 4BNTA 2Z4SA 5BR1A 1UKCA 4D80A 3FZNA 2L69A 4DCTA 2H2WA 3GO4A 3VTZA 2QKYA 2FGKA 4ENWA 3L8EA 2QRQA 3VISA 3FMOB 5I5EA 1XXHB 5B57C 3PXUA 4JI1B 1EHIA 3F5FA 5KYGA 2QR2A 5EUCA 1H9AA 1VBFA 1K5DA 2OO5A 3MMZA 1JA9A 4J3JA 1NVKA 1Z5NA 3THOA 4LJ5A 4D26A 3L1UA 1ZGHA 3NHRA 2Q5JA 3HYCA 3NBKA 4V39A 1GXSA 3NBXX 2IKQA 2JIRA 1FLDA 1KPHA 1MORA 4EPYA 4ZVRA 1NFRA 2WE8A 4IIDA 5TSDA 5CNKA 3W9BA 4UDYX 5IKMA 2WIAA 2OFXA 3TAXA 1K7SN 1MQAA 1XT6A 3OJEA 4UU8A 1EM6A 2I71A 4M9UA 1CP2A 4MRVA 1EP2B 4O4HA 1C9KA 4DF3A 4H3SA 4WY5A 4IQ8A 5K9ZA 3KQKA 1AS2A 4UMFA 2E9SA 1YE8A 1U1GA 7ADHA 2FOXA 4H31A 5FKJA 1XMSA 3FUTA 2GZAA 4QXPA 3AWIA 4CQMB 2OHIA 4TLLB 3D43A 3BWXA 3G3EA 3PEVA 1YU9A 1A5ZA 4MW4A 2XXAB 1JN0A 3VJLA 4WK2B 3FPCA 2LIVA 4BFVA 5K8JB 1U9ZA 1PT5A 1FYEA 2Z2IA 3BD6A 3HYNA 2XTZA 1U98A 1N0IA 4LZPA 4NVRA 2HD4A 3U44B 1VBKA 2WILA 4C0BA 3TUZC 1UZNA 3UBMA 4OXIA 1GCIA 1JLMA 3RASA 5AM5A 1MAVA 4NH4A 4EW1A 5HJ2A 4LJRA 4CKZA 3ELBA 1UC4B 1QHHA 3N5CA 3QE0A 2WHRA 1LLFA 4PPQA 4RNDB 3ZY2A 1LW7A 2NO4A 5EZYF 5DWDA 3PNQA 4BWYA 5CNMA 3U31A 4FUTA 4M0MA 4OL0A 2W6QA 4BNVA 3UT5A 4FNMA 5DM1A 4E2FA 4ENUA 4GT1A 4M60A 1YRWA 1G3IA 1HE8B 4CT4B 4JA0A 2C7OA 4BO7A 1LA2A 2YYYA 4GLJA 3S44A 3ZJ4A 1TIBA 1WA5A 4FHCA 1E79A 1F0NA 2W70A 5KQRA 2IBTA 3AVWA 5KSWB 1SUIA 3KYDA 4RD2A 1P2SA 1PQPA 4L6CA 4LWOA 4RD4A 3WDLA 4AULA 5KNBD 4WIAA 1XZGA 4PFSA 1P8AA 3G13A 4II3A 1K8RA 1OTXA 1RWWA 4N0EA 4A92A 3VKFA 4QTXA 2DLCX 4O1MA 4BZWA 3PPIA 4Q37A 1GU1A 4HRYA 2JAXA 1XN4A 2EJWA 1LFDB 3DKKA 1Q17A 1MX1A 1DHTA 3GLGE 2FMFA 3K4QA 3Q6NA 5JAPA 2AMVA 5CM2Z 3ZDZB 1M9NA 2ODWA 2ZRKA 3ZQ6A 5ER9A 2H1OA 4G25A 4MA0A 3IRUA 3GPLA 3IQGX 4JAVC 1H6CA 3CVUA 4O3FA 1D1QA 1PR5A 1PQYA 2Q5CA 3DT6A 3GROA 2HPAA 1OBFO 1NMZA 4XI9A 3TBFA 1L7MA 2IHYA 1H66A 4MR9A 2B21A 3D3JA 4NZNA 3EFOA 4P8RA 4UDOA 4B6EA 4D41A 1UANA 3WTBA 1MJNA 2H2DA 3T1YB 2I3BA 1KMIY 5H4GA 5JSUA 4M6WB 5ANRB 3WE7A 5EMKA 2TMDA 4DYDA 3FPLA 4JS0A 3M9XA 5JOQA 4MI3A 3O90A 4TKZA 2I3GA 4TZKA 4KSBA 3G89A 1J24A 3NT4A 4K2AA 2WWIA 4R98A 3ZJYA 4KBFA 1FRNA 5J5VA 4W8GA 3DG9A 4C3ZA 2JGLA 2NV0A 5AIBA 2GK7A 4JX9A 4MR7B 2J31A 5A3JA 5AUNB 1ENYA 2FW7A 6REQB 5E4TA 2XB9A 3F6BX 4KMOA 2RGYA 3SQOA 3FGNA 3H2BA 1DJPA 5BWBA 5F2NA 2Y0CA 3GJ6A 4IRUB 3PNSA 4TYPA 1JHUA 4C4PA 5AVSA 1ZJJA 1Z2CA 5JAQA 4M22A 1QHXA 1DVRA 3D0KA 1WUKS 4P4SB 2FPIB 2PEYA 4D46A 2HRRA 4KQCA 4AP5A 4N0MA 3ESBA 2G77B 1AE1A 3M6VA 1TW3A 3UB4A 1BC5A 3H1BA 2H4YA 1AKVA 3ITDA 3PZRA 4I1OA 1Z6AA 1CUUA 3C5HA 5K3SA 3ZWNA 4ZIRB 4A15A 4RK0A 4YUXA 2WVHA 2YN4A 4IMRA 1Y6QA 2WDZA 4JUAA 2XPCA 1I3MA 2W2OA 1ESMA 4RZ2A 4EAAA 3DDWA 5HK9A 3H4MA 3MW8A 4Z1OA 1TA4A 1TRKA 2BMVA 1ZOSA 2R6AA 2M6SA 3QU7A 4RZXA 1BFKA 3BH0A 3C3MA 2DUUA 1U0SY 3RVMA 3FYCA 4RMGA 1DOZA 1AGNA 3FVTA 3K8OE 3QFFA 2AOWA 5CDHA 5JWOA 3LBIA 4W4TA 5FI5A 2IDJA 4RVHA 3EGXA 2VT2A 4UHHA 1KJWA 2VDVE 4CI0B 1RBQA 2WZQA 3BMQA 4MWZA 4A91A 5ILGA 3DE6X 3K32A 1JUDA 4NQZA 1U28A 3P9XA 4LYFA 3EPJA 3JASB 3SKVA 1MW8X 4N0DA 3HU5A 5DP2A 3PNVA 4BLRA 2P9CA 3TCKA 2G17A 1W5EA 3EVFA 4UMEA 4YRAA 3IEUA 4YDRA 3O4GA 2FPPA 4N8DA 3JD4A 1F5NA 4Q1VA 1GAWA 5CLIA 5KU7A 2QTLA 4BY9E 4KVZA 1WUJS 3KOOA 4JIGA 3KXDA 5CTAA 3C7KA 2ONCA 5H3HA 3LIIA 4EG5A 1O96A 5LR6A 5JROA 4HI0E 1YSCA 3RIEA 1ESNA 1P1BA 1VYHA 3LH5A 4KQ2A 2XA9A 2ZRNA 3NHYA 4WZZA 1F3LA 2AG8A 1NBMD 3PC2A 2YNMC 3PQDA 2XUOA 3PSAA 4PSUA 3C14C 4RDIA 3GCXA 4XX1A 1GTVA 3LFHA 4MKXA 4ZYUA 2JZNA 4LJLA 2B6HA 4C43A 2VT3A 1SQ0A 1JU4A 3CE6A 2ZS8A 3VBCA 4R9SA 2DR3A 3ZE2B 1QGAA 1Y3FE 2BFFA 1XD9A 4WNAB 4BWFB 1Z5PA 4OQPA 1UBHS 3C43A 1C8VB 3N0VA 1RAGA 5B1DA 5IKEA 1C9JA 5M5BA 1KETA 2PH3A 1BXGA 2GYWA 3LMKA 4ITVA 4BFSA 1F0KA 2CUKA 1LTHR 1HLDA 2TRSB 2WWFA 3LCUA 3R3YA 4EY7A 1G1AA 2HRQA 5A7HA 2P4QA 1SR8A 4ZU3A 3WICA 1DAFA 5JADA 5M7EA 2XUGA 2NPOA 1EGAA 4CR8A 1D5WA 2XUKA 3QXSA 4IF6A 4TGLA 1R8JA 1J0DA 2DVMA 2Q2VA 3QY0A 1UM9A 3I2YX 3AOEC 3B82A 4N6NA 4RHFA 3VZCA 1UJMA 2QI9F 2FETA 3CJQA 3LRPA 4D5EA 3HDJA 3DTVD 2BFDA 3LT2A 5IAGA 1BA3A 3L07A 1Z5VA 4QGHA 4S2EA 3KUKA 5IEJA 2XQKA 1PDOA 3FFWA 4YC7A 1R4NB 4YJ2A 4F04A 1XDWA 4YIHA 3W5BA 4DLSA 4XIYA 2FXIA 1ZG3A 4YLEA 5IVIA 2EOAA 1K9SA 2JFFA 4C6TA 2PTHA 3NP7A 1BWQA 5EKSA 1QFMA 2WHQA 4RAOA 5FWAA 1FS5A 3CLUD 5ECWA 5B3AA 2DFVA 1XMPA 3HO6A 3O31A 1I5EA 2WEKA 5TQ2A 4GPTA 2C7QA 5COBA 3HCAA 1YMQA 5AI4A 3FPAA 3WRVA 5AKGA 2AR0A 3UJ9A 1YZNA 3VR2D 2BMAA 3QI7A 1B14A 3AHHA 2OILA 3DL2A 4LXQA 2YXBA 4YEDA 3USCS 1SXGA 1YXMA 1ZJ6A 1X0VA 4C4AA 1PS0A 2ZWOA 1N77A 1IPEA 3GFPA 1PSDA 3NBMA 1V71A 1ZN9A 4RLFA 2PQ6A 5DXJA 4QOHA 4RF2A 2O2DA 1R1DA 3AESA 2OCGA 4HD8A 2DE0X 4MP8A 1BXKA 2IELA 4RHXA 5EKXA 5FNVF 1AUOA 4MA5A 1YHNA 5GGYA 5JS2A 4C06A 4EY3A 4AKIA 2NXEA 1CJKC 4O2AF 5F1YA 3A3NA 4B6SA 2VWGA 5KU1A 1TECE 4L8VA 2DR2A 4GE3A 4LVCA 4TMZA 3ZHCA 1E3IA 2DKNA 4BASA 3V4ZA 1SAYA 4DR1B 4TWIA 1K7CA 2PJUA 1VE7A 4FBMA 4L74A 3FTQA 1YI8A 3MM4A 5TY0A 4UOEA 1USVA 5JHGB 3PQ3A 1E3DA 2DPLA 3W4IA 3ZXIA 5IZCA 5JH7A 3ERCA 2QDXA 3AVTA 5KMGA 2JH8A 2YVUA 1MJGA 4Z9AA 2FP4A 3ZD7A 3VZQA 4K9RA 3S70A 1A9YA 4GKVA 4YO7A 4YREA 4PHHA 2ODPA 1Y3CE 1PHPA 4EKIA 4L5IA 1Z4KA 4ABYA 4Y2UA 2DBZA 1HK7A 3FDIA 4PC6A 4OXNA 3HR8A 1SG9A 3BKXA 2X2PA 3OTHA 4UFNA 2DPYA 4R9RA 1M8GA 1Z7WA 2MR5A 4X7PA 3WX0A 2C97A 1HKUA 1R16A 4K0KB 1E18A 2VK1A 3SF8B 3U81A 1J1ZA 4OI1A 1DKUA 3PC3A 2I6TA 2GLTA 3FWKA 2ZE7A 2FSHA 2G40A 3UYLA 2AC4A 1T2VA 5ECDA 2WM2A 3I2KA 3R44A 4DMMA 3GEDA 3PHLA 3GHYA 1FPQA 1G20A 2H3EA 4TKLA 3OG9A 5FI1B 3O4IA 4P36A 5LB4A 5SICE 4F3CA 2PX8A 1CX9B 2Y0DA 3EC1A 1J0XO 5FEUA 4RPKA 3H8VA 1TK3A 1S2GA 5TVKA 1N34B 4O59O 3I0MA 1NG1A 3HU2A 4FHZA 4K40A 4WKOA 5AKIA 1X9IA 2EHDA 4AC9A 1N2GA 1TJNA 3E35A 3N0WA 1XQ9A 1LVGA 4BLQA 4HWPA 4MLCA 5ABPA 5IDWA 1TF2A 1XDBA 2NUAA 5EP3A 3DSRA 3UKOA 1YONA 2HA3A 4GOOD 4U6SA 4D9CA 3I37X 4J6FA 3MGGA 2PMBA 3AZQA 3PQ6A 2WT9A 5LQNA 4J0DA 2VYFA 4QWMA 4D81A 1DIGA 2PEZA 4GECA 1T3HA 2HRCA 3QF7A 3I4CA 3SC6A 1KJQA 4DV6B 4I4TF 4FYKA 2ZI7A 4JI4B 1P1RA 1V8BA 2CNLA 2OYSA 2UUPA 2OO7A 4CIAA 4S1WA 3JWEA 5DBIA 2VF7A 2I0FA 3HGQA 4DHWA 2OVBA 2AN1A 2JEOA 2V7UA 2RAPA 1ISPA 4G36A 4NDNE 1DUVG 1LXCA 1NZDA 3WZMA 5KVCA 2OV2A 1GG8A 1ZHFA 1PL7A 2YWRA 2ZYUX 2DWOA 4YIKA 1AHHA 1XDUA 3USES 1P7ZA 1QYIA 3UK0A 5DGCA 2WZBA 3GCGA 2IFTA 3B48A 1P7WA 5IM5A 1M2GA 3UJCA 1ISGA 1TM4E 1X77A 2VK8A 4ML3A 2X23A 5MN4A 2D8MA 1TYAE 4E5MA 4ALKA 1JDNA 3K9GA 1TFRA 4EG3A 4JUCA 2OGWA 2PLWA 1U2RA 1G7RA 2Y67A 3A0UA 1W0CA 3IULA 3N1UA 4HNQA 5EFOA 1CJUC 2CUZA 3B12A 3NM6B 2YYZA 3IIEA 5B1YA 3QPWA 6NULA 1TLFA 1R15A 3EMDA 2VJNA 3QQPA 4OLFA 2J9XB 5L4LA 1A97A 3L5KA 3R6DA 1WSDA 3D1LA 1S8AA 2GB4A 3F5SA 4BZPA 4DJ5X 3OE7D 1UAGA 1Z0AA 3QFCA 5AVOA 2BEWA 2VTBA 5D5QA 1ZHHA 1J8MF 1T6ZA 3CSSA 1KARA 4H4EA 5AKXA 4EYSA 2CLSA 2AJTA 4A27A 1M33A 4NZMA 4KAAA 2OHHA 1F14A 1JXAA 1B41A 2HNBA 2HO4A 3PGXA 4KX3A 4TTAA 3SMVA 4RXUA 3UXMA 5CIYA 3JQDA 4DC0A 4J0EA 2EXXA 5HFAA 2VXBA 2Q3JA 1A7AA 5HF8A 4EHKA 5IMSA 4I5GA 3D8TA 3UAGA 2J6IA 1V8OA 4LOJA 2F3QA 3ADPA 3PF8A 2YHBA 1A9SA 2IH2A 4HHEA 4RYLA 1FBTA 5I9LA 2R8ZA 1NUAA 5CM8B 1PTJC 5EN4A 1K0FA 5AKYA 2E6UX 3AM5A 3NC1C 1CERA 2J5RA 5A3SA 2FG5A 1DTWA 2QTVB 4ARSA 5EJEA 3Q7RA 3GFFA 1L5OA 2WU0A 4Y2PA 3M5PA 4D9IA 2VPQA 5ARBA 4YY3B 1R10A 1GPYA 3UJPA 1HNNA 4A73A 4YJGB 2LRHA 3OKAA 3C6QA 2DXIA 1R4MB 4P5DA 1QZXA 1KVRA 3JQQA 1MX5A 4UVEA 3ZE9A 5BR7A 3OEED 4YGXB 2YFHA 4CT5A 3REQB 2IXEA 1DAHA 1JRLA 1CQJA 1NLZA 1S8OA 3MTJA 1SWVA 1UL1X 4BX8A 4C87A 3SQWA 1E9VA 2YWHA 1G4UR 1EVEA 4YAOA 5E1BA 5KYVA 3MYRA 3UATA 1QK5A 2NTEA 7AT1A 1QCCA 2G7MC 1IXZA 3QUSA 1RP7A 1QIEA 1Q1NA 5KNLA 3WZLA 2J3HA 4N9QA 1IHOA 2XB8A 1ADYA 4OGWA 1E9SA 1Z06A 1IN1A 2PU7A 3KKOA 1ODCA 1JMVA 1Y3IA 2WIDA 3O26A 2B8WA 2KLHA 3WP1B 4PG4A 3Q5EA 3ZHOA 1Y9EA 2YIVX 3CEMA 2CC2A 1O58A 1GQYA 5HTOA 2AYXA 1NP7A 3ZD9A 3D6JA 1ODIA 4F2PA 1T3GA 3S2YA 2A9RA 5C37A 3QTBA 4ZDWA 4R8RA 2JI8A 5J2TF 3R7AA 1N2BA 3SZOA 5I8PA 2XUDA 3A6EA 1Q1AA 3I0NA 1LWNA 3G59A 5KYWB 4E70A 3I6ZA 4DB2A 2ZATA 1S02A 1G3QA 5LBUA 2SCUA 5TJ9A 4L85A 3PEUA 1NWHA 1RQNA 2VHCA 3RPEA 4GP6A 3WLKX 3NAMA 3OMXA 5JRJA 3N0TA 2X0JA 4IEFB 1ZVKA 4JUDX 2VDOB 4IIFA 3DF9A 3WQSB 3BH6A 3RHSA 1LI7A 4ZD6A 4DLBA 3JZDA 4CBVA 3DC2A 4CKEB 1JAXA 2WVGA 5KAMA 3TH5A 3EYAA 3I6MA 5CYFA 4TTTS 5M04A 2JJ1A 1FP4A 1MTZA 2M9MA 3UFXB 3BHJA 2CL0X 2UUAB 1CJVC 5LDGA 5HM6A 2JKVA 1MAAA 3OLYA 4A23A 2VDRB 4HUJA 1CUWA 3VO2A 2A5FA 5JC8A 2GCNA 3TE7A 3GZJA 5EMNA 4W5OA 2XCOA 4CU2A 3K9FC 2O8BA 5AUQA 4BNMA 4BXOA 4RACA 3JQFC 3BL5A 3LRTA 4EFDA 1NSTA 2NZWA 1X87A 4PPNA 3T1OA 4LJ7A 2A9KA 3I83A 2HXYA 5AXAA 2D54A 4WFKA 3BMXA 2XI4A 2WG2A 4M0PA 3U7EB 4R4JA 4QSMA 4WQMA 4NMXB 1L4KA 2GEVA 3PHCA 3A58B 4L0DA 1OWOA 3LPMA 1RC8A 1FYFA 1XG5A 1XJ0A 1KEWA 1M6VB 2BCGY 1JVNA 4IWNA 4BVLA 4O5AA 2NGRA 3G9XA 5AI0A 2CYCA 4QBTA 4DR7B 4PRZA 1YR9A 3D7LA 3DW1X 3GEBA 1YJAA 4TM7A 3OT4A 4ZGGA 3ABZA 2A86A 2PSSA 4RVDA 4EJ2A 1LLCA 5FX2A 1R6BX 2QMZA 2G08A 1SWWA 3R23A 4E21A 1M8FA 3TTYA 1KJIA 5C46F 4TTQA 1NVFA 3HWX1 1MGPA 1FDWA 2FX2A 2QRPA 3CPEA 2XUIA 5E3IA 3E0XA 1TZKA 3K5IA 1SGWA 2GEFA 5B58T 2FPGB 2B2CA 2GARA 3KB8A 4MWBA 4QUEA 3ZN2A 4BIMA 1A8IA 4QOGA 3FWPA 3CVOA 2AZXA 2COKA 3N8NA 4DBLE 2W6JD 1K97A 4ZARA 2F90A 3C98A 4UNNA 5JARA 3HEMA 3AM3A 2PFKA 4BN4A 3LX6A 2G71A 1E7YA 3CLTC 3MJTA 3O21A 4IZHA 2JIZD 4O08A 1IVNA 4RNCA 1N5MA 3KAKA 3LCMA 4HQFA 3O47A 3WIDA 2NAFA 1R88A 1JJFA 1P2GA 4DA8A 1BMFA 2VHUA 4JL8A 3S2FA 4PZLA 2KW5A 2Q4BA 1W36B 3R5KA 3HYLA 1KSJA 1NXSA 4TSFD 4RQBA 1YGPA 2JGFA 1OAKA 3G6WA 1JR3D 2Y3IA 2O2XA 2NUPB 1IWOA 3DE2X 4JJZA 4DTIA 4DNQA 3U9TA 4UBLA 3CU5A 2G04A 2E4XA 3ZJVA 1CR0A 2IHVA 4FFLA 1TQHA 4J0GA 5J2UA 5DSZA 1BXRA 3JV7A 2YBEA 3CLSD 5HKAA 4S1VA 3WNCA 3ESXA 4PZUA 4UUNA 4XX0B 1AM4D 3IKVA 4L1KA 4X6LA 5K0NA 3ZWYA 2QV7A 3LW8A 3WXBA 2A0YA 2GZ1A 4JJ6A 4XR4A 1GCGA 4G0QA 3O74A 4U7WA 4EOGA 3OQ6A 3NKLA 3HEBA 3UM9A 1F1JA 1PZNA 4DA4A 2HW8A 2ZZMA 4CL3A 4YJ2F 4XVHA 2BFPA 1A82A 4GFDA 1SCQA 4MUYA 1VB3A 5LMCA 3A8TA 4AG6A 3JTMA 1BDMA 2JJMA 3QUBA 4F97A 3KSBC 1T25A 5LQJA 5FIUA 2X40A 1KMMA 4HWRA 3BT7A 1ENOA 4IVNA 3KPYA 2BHTA 5K2MA 3N2EA 5AQEA 1W2WB 1N2JA 4RCYA 1VIVA 1ZLYA 4AIRA 3DFZA 3EEBA 2JHPA 5GY7A 3R09A 5T4EA 1WCWA 4Q66C 4WJZA 3TBHA 2PO7A 3A1FA 4NBSA 2XCTB 1IC6A 4U2GA 2ZB4A 1XZAA 4MJ3A 5DTJA 1ZM3A 2O5RA 3W1VA 1Y1LA 1PIWA 1UDXA 3PR3A 4BRUA 1Y9JA 1F2TB 2ZRGA 5CYOA 1U2DA 3VA7A 2BN4A 4JNCA 5JRDS 4OJQA 1A8PA 1R50A 4WHMA 8ATCA 4H6WA 1SU6A 3LUPA 4DSUA 4WNIA 3G2IA 4MYRA 2PKQP 4XCXA 3RHZA 3WNDA 2REXB 4GKJB 1M8KA 3I04M 2IQ5A 1XC7A 1BYIA 1JR2A 3IT0A 5JR3A 4JWTA 4M8SA 3EPKA 1BE0A 1WNTA 4HGPA 4YJFA 3OFVA 3FG9A 4MWDA 3M83A 1RADA 3EUFA 3PFCA 1VCHA 4JY7A 2VHXA 1CY4A 1XVVA 4ISCA 1EFVA 5F2EA 2OXTA 1I4TD 2XNSA 3LJKA 2ZREA 3NH6A 4QYSA 4ZEXA 1U0TA 2O5VA 5TIIA 1VPVA 2H85A 4JB2A 1RYMA 3LYAA 2XZDA 3BBLA 4X3CA 4IFBA 5KWSA 5T7BA 2O14A 2AFIA 2I2DA 4EG8A 1T9HA 5T4HA 5DVZA 3IELA 2J85A 2BHNA 4ESOA 5J9FA 7MHTA 3FSRA 2QSZA 4ZKEA 2P2DA 4LHYA 4B1FA 5IASA 1E69A 1JAYA 1PZGA 3BYZA 3X1DA 3WLJA 1V8PA 5FXMA 3ROKA 4ER0A 2O52A 3W8NA 4BLPA 3JQ7B 1JU3A 1ZM7A 2BR3A 2JCBA 3F4LA 3GJ8A 3IVMA 1AK1A 3O38A 3LCJA 3RC1A 3TX2A 4LYJA 2IHJA 3V1KA 3G0GA 4F86A 5FNZA 2QN1A 1CF2O 5SZJA 2X9VA 4FVTA 4RHCA 3TQFA 5I4BA 3U4GA 5KQSA 2Y99A 2YWCA 4TQAA 3CPJB 4WJKB 5IN5A 4C2TA 4P3PA 1MQ9A 4E4RA 1FNNA 2IW3A 2E5WA 3N6XA 1J8QA 4U63A 2X5JO 5A7GA 4D45A 4WT7A 4LFAB 2D0PB 2QGZA 3JWHA 3RS5A 2P90A 3WL8A 1B74A 1YHZA 1WBBA 1N1EA 2XYPA 1Q0ZA 5BMVB 1EP9A 1KDYA 1L7VC 4L73A 2AX3A 1FDTA 4YRSA 1TT5B 3DBLA 2FV8A 5FNVA 2E4VA 3W2GA 3EDCA 2PZKA 2ZBDA 2I2XB 5FF9A 2JIMA 1HDEA 3BA6A 4FZ3A 4Y18A 3U4MA 4N76A 3HSSA 1KK3A 2FFJA 3QUCA 5TRTA 2FEKA 4JI5B 2JLAA 2RKOA 4QAJA 5KUTA 1P75A 5BSTA 2WVJA 1MVNA 2JAQA 5A4MS 4MYHA 3DTVB 4UBNA 3VPSA 4IHJA 3IVAA 2JGEA 1O9HA 4Q4AB 4LEIA 3GIWA 2AG5A 2V5VA 4HXYA 3G0OA 1IDN1 1G291 4U2BA 5J3JA 3G1WA 1P60A 2JFXA 2ZYSA 3AHGA 3C85A 3U7QA 2B0CA 5B58C 1CLEA 2O2IA 1E3MA 1V43A 3LBFA 5EE9A 2R97A 3HHPA 1ECCA 1QIDA 2D62A 4HEHA 3CONA 5JDIA 3IUJA