4DYYA

Crystal structure of the cu-adduct of human h-ferritin variant mic1
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
172
structure length
172
Chain Sequence
TSQVRQNYHQDSEAAINRQINLELYASYVYLSMSEYFDRDDVALKNFAKYFHHQSHEEHEHAHKLMKLQEQRGGRIFLQDIQKADEDDWESGLNAMEAALHLEKNVNQSLLELHKLATDKNDPHLADFIETHYLNEQVKAIKELGDHVTNLRKMGAPESGLAEYLFDKHTLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferritin heavy chain
publication title Re-engineering protein interfaces yields copper-inducible ferritin cage assembly.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 77
structure length 172
sequence length 172
ec nomenclature ec 1.16.3.1: Ferroxidase.
pdb deposition date 2012-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 4dyyA00
1VEIA 5K53A 2BJYA 1RCCA 5JKMG 1JKVA 3E6SA 2CLUA 2C2FA 5J93A 1MOJA 2CEIA 4U3GA 2IB0A 3FI6A 2ZURX 3EZUA 5JKLA 1DVBA 4TOCA 2V2IA 3BVIA 3R2SA 3AJOA 2V2LA 3BVLA 3RE7A 2FG8A 5J9VA 2IY4A 3SH6A 4LQNA 3BT5A 2YW6A 5GN8B 3RBCA 2C2UA 1LKMA 1Z6OA 4RC7A 2XGWA 4ZJKA 2V2NA 3AF7X 2ZG9X 4CYAA 4MN9A 5FEJA 4ERUA 2ZA6A 4ML5A 1Z4AA 4KVRA 1LKPA 1F33A 2RBDA 1AEWA 5E2DA 4AM2A 1MFRA 3PW8C 4TW3A 2W0OA 1EUMA 4A25A 3A9QA 1S30A 2VXIA 3IS7A 1S2ZA 4ZLWA 1BFRA 3PW1A 1YV1A 3GHQA 2D5KA 5JKLG 3KA8A 4CMYV 4MY7A 2XJNA 2CF7A 4M33A 3E1LA 4LQJA 2C2JA 3UNOA 2CHIA 4DZ0A 4AM4A 2CIHA 5FFCA 5D8YA 4TOAA 4ETRA 1SOFA 5C6FA 4CVPA 2JD70 2FKZA 2HTNA 5D8OA 4QUWA 2ZG7X 1TK6A 5CZUA 2Z90A 1LB3A 3F34A 1F30A 1YUZA 4EVBA 4REUA 4TOGA 2XJMA 5GU2X 3QHBA 1XZ3A 1DATA 4CVTA 5D8QA 2FHAA 4M35A 5CMQA 1QGHA 4PGIA 4ZKXA 3R2RA 3PW8A 2UX1A 3F37A 4EVEA 3E6RA 2G4HA 3BVKA 4CYBA 5D8XA 5GN8A 2FL0A 4CMYA 5K52A 5GU3X 1TKPA 3RGDA 3F36A 1RCEA 1NF6A 5AXSA 2VZBA 3UOFA 5CMRA 3VNXA 3QVDA 5FFBA 1VJXA 4DASA 1RYTA 4ZKHA 1S3QA 1JYBA 4ZL5A 3AK9A 4ZKWA 2JD80 3ISFA 3NOZX 3KA4A 3OJ5A 3E1OA 4YKHA 3RD0A 3R2OA 5J8WA 4CY9A 2YJJA 2V2PA 4TODA 4M32A 3Q4NA 1IERA 3H7GA 4OYNA 2OC5A 2VXXA 4CVSA 3E1QA 3NP0X 2ZA8A 3ISEA 5HQOA 4Z5SA 2YJKA 3A68A 3E2CA 5D8RA 3AF8X 4KVQA 1KRQA 3R2KA 2WLAA 3F38A 1R03A 3BKNA 1JIGA 4II4B 4LYUA 1BG7A 3PVYA 4TOHA 2QF9A 3PVTB 4RC6B 1H96A 4PG0A 3Q4QA 1NFVA 3UOIA 1RCDA 4DYUA 2C6RA 4RC8A 4ZMCA 1QYBA 3O7SA 2Y3QA 4M34A 3FVBA 4TO9A 3T9JA 1HRSA 3U90A 3QD8A 3Q4RA 4DYXA 1NNQA 5JKMA 3WVWA 2WLUA 4MKUA 3F35A 3EGMA 5HJHA 2X170 3WVVA 4DYZA 2QQYA 2CLBA 3F39A 1O9IA 2BK6A 3NP2X 3E1JA 2CN7A 3GE4A 4LQVA 3E1MA 3PZAA 3PWQA 4ZTTA 1SQ3A 3E1PA 3KA3A 2GYDA 3PVRB 5FFDA 4R42A 3F32A 4P18A 1ZUJA 1JTSA 1NF4A 3KA6A 5FFAA 1J30A 2FJCA 1BCFA 2V2SA 5D8PA 3KWOA 3HIUA 3QHCA 4ITTA 3PWFA 4TOBA 4LYXA 4XKUA 3SIDA 5ERKA 3OGHA 2C41A 5E1UA 3ERZA 5LG8A 5IX6A 2PYBA 3RAVA 2YW7A 2XJOA 3R2LA 1LKOA 2ZG8X 4RC5B 1IESA 5GOUA 5GU0X 1L8HA 4XKSA 3GVYA 1ZS3A 3IS8A 4Z3BA 4XKTA 4EVCA 5D8SA 1DPSA 3ES3A 5FFEA 4ZL6A 4II4A 3AF9X 1RCIA 1VELA 2GS4A 3PVTA 4RC6A 4Y08A 2ITBA 2IU2A 2GYQA 4ITWA 1YUXA 5ERJA 1JREA 3BVEA 1RCGA 4LPMA 3PWQC 1JI4A 4CVRA 2JD60 1N1QA 3WNWA 2XKQA 3Q4OA 2V2MA 1JI5A 4LQHA 4IXKA 5HJFA 2CHPA 3QZ3A 5LS9A 3AJPA 1B71A 2Z5QA 3PVRA 3WVUA 1O9RA 1UVHA 4EVDA 2OH3A 4IWJA 4E6KA 1VEQA 1TJOA 4ISPA 2FFXJ 3MPSA 3R2MA 1OTKA 2V2OA 2Z6MA 4PG1A 1XZ1A 3E1NA 3KXUA 3F33A 4KVSA 1FHAA 4MJYA 4MUDA 5I4JA 2CN6A 3AJQA 3AK8A 4LPNA 4RC5A 2V2JA 4RC7B 1L8IA 3FSEA 2F7NA 3IQ1A 3QB9A 3KX9A 5LG2A 2HR5A 3TA8A 1JGCA 2BKCA 2Z5RA 4LPJA 2BW1A 2ZA7A 1JKUA 4DYYA 3HL1A 4PGKA 3PVYB 3R2HA 3SE1A 5GU1X 5LBHA 1Z6OM 1TKOA 4DE6A 4DI0A 2Z5PA 2V2RA 3KA9A 3PW1B 2FG4A 2WTLA 1UMNA 3BVFA 2FZFA 3O7RA 3SHXA 4TOFA 4AM5A 4ISMA 1GWGA 3EZ0A 1VLGA 5J8SA 2V15A 5JACA 4XGSA 4TOEA 4IWKA
chains in the Genus database with same CATH superfamily
1VEIA 5K53A 2BJYA 1RCCA 5JKMG 1JKVA 3E6SA 2CLUA 2C2FA 5J93A 1MOJA 2CEIA 4U3GA 2V8UA 2IB0A 3VVAA 3FI6A 2ZURX 3EZUA 5JKLA 1DVBA 4TOCA 2V2IA 3BVIA 3R2SA 3AJOA 2V2LA 3BVLA 3RE7A 2FG8A 5J9VA 2IY4A 3SH6A 4LQNA 3BT5A 2YW6A 5GN8B 3RBCA 4KXRB 2C2UA 1LKMA 1Z6OA 4RC7A 2WWXB 2XGWA 4ZJKA 3GGYA 2V2NA 3AF7X 2ZG9X 4CYAA 4MN9A 5FEJA 4ERUA 2ZA6A 4ML5A 1Z4AA 4KVRA 1LKPA 1F33A 2RBDA 1AEWA 5E2DA 4AM2A 1MFRA 3PW8C 4TW3A 2W0OA 1EUMA 4A25A 3A9QA 1S30A 2VXIA 4X0JA 3IS7A 1S2ZA 4ZLWA 1BFRA 3PW1A 1YV1A 3GHQA 2D5KA 5JKLG 3KA8A 4CMYV 4MY7A 2XJNA 2CF7A 4M33A 3E1LA 4LQJA 2C2JA 3UNOA 2CHIA 4DZ0A 4AM4A 2CIHA 5FFCA 5D8YA 4TOAA 4ETRA 1SOFA 5C6FA 4CVPA 2JD70 2FKZA 3M6JA 2HTNA 5D8OA 4QUWA 2ZG7X 3FRSA 4YXMA 1TK6A 5CZUA 2Z90A 1LB3A 4MXPA 3F34A 1F30A 3KDQA 1YUZA 3GGZA 4EVBA 3C21A 4REUA 2XJMA 4TOGA 5GU2X 3QHBA 1XZ3A 1DATA 4CVTA 5D8QA 2FHAA 4M35A 5CMQA 1QGHA 4PGIA 4ZKXA 3R2RA 3PW8A 2UX1A 3F37A 4EVEA 3E6RA 2G4HA 3BVKA 4CYBA 2CWLA 5D8XA 5GN8A 2FL0A 3L0MA 5HU6D 4CMYA 5K52A 5GU3X 1TKPA 3RGDA 3F36A 1RCEA 1NF6A 5AXSA 2VZBA 3UOFA 5CMRA 3VNXA 3W54A 3QVDA 5FFBA 1VJXA 4DASA 1RYTA 4ZKHA 1S3QA 1JYBA 4YVZA 3AK9A 4ZL5A 2N02A 4ZKWA 2JD80 3ISFA 3NOZX 3KA4A 3OJ5A 3V3KB 3E1OA 4YKHA 3RD0A 3R2OA 5J8WA 4CY9A 2YJJA 2V2PA 4TODA 4M32A 3Q4NA 1IERA 3H7GA 4OYNA 2OC5A 2VXXA 4CVSA 3E1QA 3NP0X 2ZA8A 3ISEA 5HQOA 4Z5SA 2YJKA 2OKCA 3A68A 3E2CA 5D8RA 3AF8X 4KVQA 1KRQA 3R2KA 2WLAA 3F38A 1R03A 3BKNA 1JIGA 4II4B 4LYUA 1BG7A 3PVYA 4TOHA 2QF9A 3PVTB 4RC6B 1H96A 4PG0A 3Q4QA 1NFVA 3UOIA 4YXJA 1RCDA 4DYUA 2C6RA 4RC8A 4ZMCA 1QYBA 3JZ9A 3O7SA 2Y3QA 4M34A 3FVBA 4TO9A 3T9JA 1HRSA 3U90A 3QD8A 3Q4RA 4DYXA 1NNQA 5JKMA 3WVWA 2MGYA 2WLUA 4MKUA 3F35A 3EGMA 5HJHA 2X170 3WVVA 4DYZA 2QQYA 2CLBA 3F39A 1O9IA 2BK6A 3NP2X 3E1JA 3VV9A 2CN7A 3GE4A 4LQVA 3E1MA 3PZAA 3PWQA 4ZTTA 1SQ3A 3E1PA 3DBYA 3KA3A 2GYDA 3PVRB 5FFDA 4R42A 3F32A 4P18A 1ZUJA 1JTSA 1NF4A 3KA6A 5FFAA 1J30A 2FJCA 1BCFA 2V2SA 5D8PA 3KWOA 3HIUA 3QHCA 4ITTA 3PWFA 4TOBA 4LYXA 4XKUA 2V8TA 3SIDA 5ERKA 3OGHA 2C41A 5E1UA 3ERZA 5LG8A 5IX6A 2PYBA 3RAVA 2Y44A 2YW7A 4W4KB 2XJOA 3R2LA 1LKOA 2ZG8X 4RC5B 1IESA 5GOUA 5GU0X 1L8HA 4XKSA 3GVYA 1ZS3A 3IS8A 4Z3BA 4XKTA 3UFBA 4EVCA 5D8SA 1DPSA 3ES3A 3LKDA 5FFEA 4ZL6A 4II4A 3AF9X 1RCIA 3C23A 1VELA 3C1YA 5JDOB 2GS4A 3PVTA 4RC6A 4Y08A 4E40A 2ITBA 2IU2A 2G38B 3N6OA 2GYQA 4ITWA 1YUXA 5ERJA 1JREA 3BVEA 1RCGA 4LPMA 3PWQC 1JI4A 4CVRA 2JD60 1N1QA 3WNWA 2XKQA 3Q4OA 2V2MA 1JI5A 4LQHA 4IXKA 5HJFA 2CHPA 3QZ3A 5LS9A 3AJPA 1B71A 2Z5QA 3PVRA 3WVUA 1O9RA 1UVHA 4EVDA 2OH3A 4IWJA 4E6KA 1VEQA 1TJOA 4ISPA 2FFXJ 3MPSA 3R2MA 1OTKA 2V2OA 3FRRA 2Z6MA 4PG1A 1XZ1A 3E1NA 3KXUA 3F33A 4KVSA 1FHAA 4MJYA 4MUDA 5I4JA 2CN6A 3AJQA 3AK8A 4LPNA 4RC5A 2V2JA 4RC7B 1L8IA 4WJG4 3FSEA 4W4LB 2F7NA 3IQ1A 3QB9A 3KX9A 5LG2A 2HR5A 3TA8A 3D19A 1JGCA 2BKCA 2Z5RA 4LPJA 2BW1A 2ZA7A 5JDOA 1JKUA 4DYYA 3HL1A 4PGKA 3PVYB 3R2HA 3SE1A 5GU1X 5LBHA 1Z6OM 1TKOA 4DE6A 3C1ZA 4DI0A 2Z5PA 2V2RA 3KA9A 3PW1B 2FG4A 2WTLA 1UMNA 3BVFA 3KHKA 2FZFA 3O7RA 3SHXA 4TOFA 4AM5A 3JZAB 1GWGA 3EZ0A 4ISMA 1VLGA 2AR0A 2V15A 5J8SA 5JACA 4XGSA 4TOEA 4IWKA
chains in the Genus database with same CATH topology
1VEIA 5K53A 2BJYA 1RCCA 5JKMG 1JKVA 3E6SA 2CLUA 2C2FA 5J93A 1MOJA 2CEIA 4U3GA 2V8UA 2IB0A 3VVAA 3FI6A 2ZURX 3EZUA 5JKLA 1DVBA 4TOCA 2V2IA 3BVIA 3R2SA 3AJOA 2V2LA 3BVLA 3RE7A 2FG8A 5J9VA 2IY4A 3SH6A 4LQNA 3BT5A 2YW6A 5GN8B 3RBCA 4KXRB 2C2UA 1LKMA 1Z6OA 4RC7A 2WWXB 2XGWA 4ZJKA 3GGYA 2V2NA 3AF7X 2ZG9X 4CYAA 4MN9A 5FEJA 4ERUA 2ZA6A 4ML5A 1Z4AA 4KVRA 1LKPA 1F33A 2RBDA 1AEWA 5E2DA 4AM2A 1MFRA 3PW8C 4TW3A 2W0OA 1EUMA 4A25A 3A9QA 1S30A 2VXIA 4X0JA 3IS7A 1S2ZA 4ZLWA 1BFRA 3PW1A 1YV1A 3GHQA 2D5KA 5JKLG 3KA8A 4CMYV 4MY7A 2XJNA 2CF7A 4M33A 3E1LA 4LQJA 2C2JA 3UNOA 2CHIA 4DZ0A 4AM4A 2CIHA 5FFCA 5D8YA 4TOAA 4ETRA 1SOFA 5C6FA 4CVPA 2JD70 2FKZA 3M6JA 2HTNA 5D8OA 4QUWA 2ZG7X 3FRSA 4YXMA 1TK6A 5CZUA 2Z90A 1LB3A 4MXPA 3F34A 1F30A 3KDQA 1YUZA 3GGZA 4EVBA 3C21A 4REUA 2XJMA 4TOGA 5GU2X 3QHBA 1XZ3A 1DATA 4CVTA 5D8QA 2FHAA 4M35A 5CMQA 1QGHA 4PGIA 4ZKXA 3R2RA 3PW8A 2UX1A 3F37A 4EVEA 3E6RA 2G4HA 3BVKA 4CYBA 2CWLA 5D8XA 5GN8A 2FL0A 3L0MA 5HU6D 4CMYA 5K52A 5GU3X 1TKPA 3RGDA 3F36A 1RCEA 1NF6A 5AXSA 2VZBA 3UOFA 5CMRA 3VNXA 3W54A 3QVDA 5FFBA 1VJXA 4DASA 1RYTA 4ZKHA 1S3QA 1JYBA 4YVZA 3AK9A 4ZL5A 2N02A 4ZKWA 2JD80 3ISFA 3NOZX 3KA4A 3OJ5A 3V3KB 3E1OA 4YKHA 3RD0A 3R2OA 5J8WA 4CY9A 2YJJA 2V2PA 4TODA 4M32A 3Q4NA 1IERA 3H7GA 4OYNA 2OC5A 2VXXA 4CVSA 3E1QA 3NP0X 2ZA8A 3ISEA 5HQOA 4Z5SA 2YJKA 2OKCA 3A68A 3E2CA 5D8RA 3AF8X 4KVQA 1KRQA 3R2KA 2WLAA 3F38A 1R03A 3BKNA 1JIGA 4II4B 4LYUA 1BG7A 3PVYA 4TOHA 2QF9A 3PVTB 4RC6B 1H96A 4PG0A 3Q4QA 1NFVA 3UOIA 4YXJA 1RCDA 4DYUA 2C6RA 4RC8A 4ZMCA 1QYBA 3JZ9A 3O7SA 2Y3QA 4M34A 3FVBA 4TO9A 3T9JA 1HRSA 3U90A 3QD8A 3Q4RA 4DYXA 1NNQA 5JKMA 3WVWA 2MGYA 2WLUA 4MKUA 3F35A 3EGMA 5HJHA 2X170 3WVVA 4DYZA 2QQYA 2CLBA 3F39A 1O9IA 2BK6A 3NP2X 3E1JA 3VV9A 2CN7A 3GE4A 4LQVA 3E1MA 3PZAA 3PWQA 4ZTTA 1SQ3A 3E1PA 3DBYA 3KA3A 2GYDA 3PVRB 5FFDA 4R42A 3F32A 4P18A 1ZUJA 1JTSA 1NF4A 3KA6A 5FFAA 1J30A 2FJCA 1BCFA 2V2SA 5D8PA 3KWOA 3HIUA 3QHCA 4ITTA 3PWFA 4TOBA 4LYXA 4XKUA 2V8TA 3SIDA 5ERKA 3OGHA 2C41A 5E1UA 3ERZA 5LG8A 5IX6A 2PYBA 3RAVA 2Y44A 2YW7A 4W4KB 2XJOA 3R2LA 1LKOA 2ZG8X 4RC5B 1IESA 5GOUA 5GU0X 1L8HA 4XKSA 3GVYA 1ZS3A 3IS8A 4Z3BA 4XKTA 3UFBA 4EVCA 5D8SA 1DPSA 3ES3A 3LKDA 5FFEA 4ZL6A 4II4A 3AF9X 1RCIA 3C23A 1VELA 3C1YA 5JDOB 2GS4A 3PVTA 4RC6A 4Y08A 4E40A 2ITBA 2IU2A 2G38B 3N6OA 2GYQA 4ITWA 1YUXA 5ERJA 1JREA 3BVEA 1RCGA 4LPMA 3PWQC 1JI4A 4CVRA 2JD60 1N1QA 3WNWA 2XKQA 3Q4OA 2V2MA 1JI5A 4LQHA 4IXKA 5HJFA 2CHPA 3QZ3A 5LS9A 3AJPA 1B71A 2Z5QA 3PVRA 3WVUA 1O9RA 1UVHA 4EVDA 2OH3A 4IWJA 4E6KA 1VEQA 1TJOA 4ISPA 2FFXJ 3MPSA 3R2MA 1OTKA 2V2OA 3FRRA 2Z6MA 4PG1A 1XZ1A 3E1NA 3KXUA 3F33A 4KVSA 1FHAA 4MJYA 4MUDA 5I4JA 2CN6A 3AJQA 3AK8A 4LPNA 4RC5A 2V2JA 4RC7B 1L8IA 4WJG4 3FSEA 4W4LB 2F7NA 3IQ1A 3QB9A 3KX9A 5LG2A 2HR5A 3TA8A 3D19A 1JGCA 2BKCA 2Z5RA 4LPJA 2BW1A 2ZA7A 5JDOA 1JKUA 4DYYA 3HL1A 4PGKA 3PVYB 3R2HA 3SE1A 5GU1X 5LBHA 1Z6OM 1TKOA 4DE6A 3C1ZA 4DI0A 2Z5PA 2V2RA 3KA9A 3PW1B 2FG4A 2WTLA 1UMNA 3BVFA 3KHKA 2FZFA 3O7RA 3SHXA 4TOFA 4AM5A 3JZAB 1GWGA 3EZ0A 4ISMA 1VLGA 2AR0A 2V15A 5J8SA 5JACA 4XGSA 4TOEA 4IWKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VEI A;  5K53 A;  2BJY A;  1RCC A;  5JKM G;  1JKV A;  3E6S A;  2CLU A;  2C2F A;  5J93 A;  1MOJ A;  2CEI A;  4U3G A;  2IB0 A;  3FI6 A;  2ZUR X;  3EZU A;  5JKL A;  1DVB A;  4TOC A;  2V2I A;  3BVI A;  3R2S A;  3AJO A;  2V2L A;  3BVL A;  3RE7 A;  2FG8 A;  5J9V A;  2IY4 A;  3SH6 A;  4LQN A;  3BT5 A;  2YW6 A;  5GN8 B;  3RBC A;  2C2U A;  1LKM A;  1Z6O A;  4RC7 A;  2XGW A;  4ZJK A;  2V2N A;  3AF7 X;  2ZG9 X;  4CYA A;  4MN9 A;  5FEJ A;  4ERU A;  2ZA6 A;  4ML5 A;  1Z4A A;  4KVR A;  1LKP A;  1F33 A;  2RBD A;  1AEW A;  5E2D A;  4AM2 A;  1MFR A;  3PW8 C;  4TW3 A;  2W0O A;  1EUM A;  4A25 A;  3A9Q A;  1S30 A;  2VXI A;  3IS7 A;  1S2Z A;  4ZLW A;  1BFR A;  3PW1 A;  1YV1 A;  3GHQ A;  2D5K A;  5JKL G;  3KA8 A;  4CMY V;  4MY7 A;  2XJN A;  2CF7 A;  4M33 A;  3E1L A;  4LQJ A;  2C2J A;  3UNO A;  2CHI A;  4DZ0 A;  4AM4 A;  2CIH A;  5FFC A;  5D8Y A;  4TOA A;  4ETR A;  1SOF A;  5C6F A;  4CVP A;  2JD7 0;  2FKZ A;  2HTN A;  5D8O A;  4QUW A;  2ZG7 X;  1TK6 A;  5CZU A;  2Z90 A;  1LB3 A;  3F34 A;  1F30 A;  1YUZ A;  4EVB A;  4REU A;  4TOG A;  2XJM A;  5GU2 X;  3QHB A;  1XZ3 A;  1DAT A;  4CVT A;  5D8Q A;  2FHA A;  4M35 A;  5CMQ A;  1QGH A;  4PGI A;  4ZKX A;  3R2R A;  3PW8 A;  2UX1 A;  3F37 A;  4EVE A;  3E6R A;  2G4H A;  3BVK A;  4CYB A;  5D8X A;  5GN8 A;  2FL0 A;  4CMY A;  5K52 A;  5GU3 X;  1TKP A;  3RGD A;  3F36 A;  1RCE A;  1NF6 A;  5AXS A;  2VZB A;  3UOF A;  5CMR A;  3VNX A;  3QVD A;  5FFB A;  1VJX A;  4DAS A;  1RYT A;  4ZKH A;  1S3Q A;  1JYB A;  4ZL5 A;  3AK9 A;  4ZKW A;  2JD8 0;  3ISF A;  3NOZ X;  3KA4 A;  3OJ5 A;  3E1O A;  4YKH A;  3RD0 A;  3R2O A;  5J8W A;  4CY9 A;  2YJJ A;  2V2P A;  4TOD A;  4M32 A;  3Q4N A;  1IER A;  3H7G A;  4OYN A;  2OC5 A;  2VXX A;  4CVS A;  3E1Q A;  3NP0 X;  2ZA8 A;  3ISE A;  5HQO A;  4Z5S A;  2YJK A;  3A68 A;  3E2C A;  5D8R A;  3AF8 X;  4KVQ A;  1KRQ A;  3R2K A;  2WLA A;  3F38 A;  1R03 A;  3BKN A;  1JIG A;  4II4 B;  4LYU A;  1BG7 A;  3PVY A;  4TOH A;  2QF9 A;  3PVT B;  4RC6 B;  1H96 A;  4PG0 A;  3Q4Q A;  1NFV A;  3UOI A;  1RCD A;  4DYU A;  2C6R A;  4RC8 A;  4ZMC A;  1QYB A;  3O7S A;  2Y3Q A;  4M34 A;  3FVB A;  4TO9 A;  3T9J A;  1HRS A;  3U90 A;  3QD8 A;  3Q4R A;  4DYX A;  1NNQ A;  5JKM A;  3WVW A;  2WLU A;  4MKU A;  3F35 A;  3EGM A;  5HJH A;  2X17 0;  3WVV A;  4DYZ A;  2QQY A;  2CLB A;  3F39 A;  1O9I A;  2BK6 A;  3NP2 X;  3E1J A;  2CN7 A;  3GE4 A;  4LQV A;  3E1M A;  3PZA A;  3PWQ A;  4ZTT A;  1SQ3 A;  3E1P A;  3KA3 A;  2GYD A;  3PVR B;  5FFD A;  4R42 A;  3F32 A;  4P18 A;  1ZUJ A;  1JTS A;  1NF4 A;  3KA6 A;  5FFA A;  1J30 A;  2FJC A;  1BCF A;  2V2S A;  5D8P A;  3KWO A;  3HIU A;  3QHC A;  4ITT A;  3PWF A;  4TOB A;  4LYX A;  4XKU A;  3SID A;  5ERK A;  3OGH A;  2C41 A;  5E1U A;  3ERZ A;  5LG8 A;  5IX6 A;  2PYB A;  3RAV A;  2YW7 A;  2XJO A;  3R2L A;  1LKO A;  2ZG8 X;  4RC5 B;  1IES A;  5GOU A;  5GU0 X;  1L8H A;  4XKS A;  3GVY A;  1ZS3 A;  3IS8 A;  4Z3B A;  4XKT A;  4EVC A;  5D8S A;  1DPS A;  3ES3 A;  5FFE A;  4ZL6 A;  4II4 A;  3AF9 X;  1RCI A;  1VEL A;  2GS4 A;  3PVT A;  4RC6 A;  4Y08 A;  2ITB A;  2IU2 A;  2GYQ A;  4ITW A;  1YUX A;  5ERJ A;  1JRE A;  3BVE A;  1RCG A;  4LPM A;  3PWQ C;  1JI4 A;  4CVR A;  2JD6 0;  1N1Q A;  3WNW A;  2XKQ A;  3Q4O A;  2V2M A;  1JI5 A;  4LQH A;  4IXK A;  5HJF A;  2CHP A;  3QZ3 A;  5LS9 A;  3AJP A;  1B71 A;  2Z5Q A;  3PVR A;  3WVU A;  1O9R A;  1UVH A;  4EVD A;  2OH3 A;  4IWJ A;  4E6K A;  1VEQ A;  1TJO A;  4ISP A;  2FFX J;  3MPS A;  3R2M A;  1OTK A;  2V2O A;  2Z6M A;  4PG1 A;  1XZ1 A;  3E1N A;  3KXU A;  3F33 A;  4KVS A;  1FHA A;  4MJY A;  4MUD A;  5I4J A;  2CN6 A;  3AJQ A;  3AK8 A;  4LPN A;  4RC5 A;  2V2J A;  4RC7 B;  1L8I A;  3FSE A;  2F7N A;  3IQ1 A;  3QB9 A;  3KX9 A;  5LG2 A;  2HR5 A;  3TA8 A;  1JGC A;  2BKC A;  2Z5R A;  4LPJ A;  2BW1 A;  2ZA7 A;  1JKU A;  4DYY A;  3HL1 A;  4PGK A;  3PVY B;  3R2H A;  3SE1 A;  5GU1 X;  5LBH A;  1Z6O M;  1TKO A;  4DE6 A;  4DI0 A;  2Z5P A;  2V2R A;  3KA9 A;  3PW1 B;  2FG4 A;  2WTL A;  1UMN A;  3BVF A;  2FZF A;  3O7R A;  3SHX A;  4TOF A;  4AM5 A;  4ISM A;  1GWG A;  3EZ0 A;  1VLG A;  5J8S A;  2V15 A;  5JAC A;  4XGS A;  4TOE A;  4IWK A; 
#chains in the Genus database with same CATH topology
 1VEI A;  5K53 A;  2BJY A;  1RCC A;  5JKM G;  1JKV A;  3E6S A;  2CLU A;  2C2F A;  5J93 A;  1MOJ A;  2CEI A;  4U3G A;  2V8U A;  2IB0 A;  3VVA A;  3FI6 A;  2ZUR X;  3EZU A;  5JKL A;  1DVB A;  4TOC A;  2V2I A;  3BVI A;  3R2S A;  3AJO A;  2V2L A;  3BVL A;  3RE7 A;  2FG8 A;  5J9V A;  2IY4 A;  3SH6 A;  4LQN A;  3BT5 A;  2YW6 A;  5GN8 B;  3RBC A;  4KXR B;  2C2U A;  1LKM A;  1Z6O A;  4RC7 A;  2WWX B;  2XGW A;  4ZJK A;  3GGY A;  2V2N A;  3AF7 X;  2ZG9 X;  4CYA A;  4MN9 A;  5FEJ A;  4ERU A;  2ZA6 A;  4ML5 A;  1Z4A A;  4KVR A;  1LKP A;  1F33 A;  2RBD A;  1AEW A;  5E2D A;  4AM2 A;  1MFR A;  3PW8 C;  4TW3 A;  2W0O A;  1EUM A;  4A25 A;  3A9Q A;  1S30 A;  2VXI A;  4X0J A;  3IS7 A;  1S2Z A;  4ZLW A;  1BFR A;  3PW1 A;  1YV1 A;  3GHQ A;  2D5K A;  5JKL G;  3KA8 A;  4CMY V;  4MY7 A;  2XJN A;  2CF7 A;  4M33 A;  3E1L A;  4LQJ A;  2C2J A;  3UNO A;  2CHI A;  4DZ0 A;  4AM4 A;  2CIH A;  5FFC A;  5D8Y A;  4TOA A;  4ETR A;  1SOF A;  5C6F A;  4CVP A;  2JD7 0;  2FKZ A;  3M6J A;  2HTN A;  5D8O A;  4QUW A;  2ZG7 X;  3FRS A;  4YXM A;  1TK6 A;  5CZU A;  2Z90 A;  1LB3 A;  4MXP A;  3F34 A;  1F30 A;  3KDQ A;  1YUZ A;  3GGZ A;  4EVB A;  3C21 A;  4REU A;  2XJM A;  4TOG A;  5GU2 X;  3QHB A;  1XZ3 A;  1DAT A;  4CVT A;  5D8Q A;  2FHA A;  4M35 A;  5CMQ A;  1QGH A;  4PGI A;  4ZKX A;  3R2R A;  3PW8 A;  2UX1 A;  3F37 A;  4EVE A;  3E6R A;  2G4H A;  3BVK A;  4CYB A;  2CWL A;  5D8X A;  5GN8 A;  2FL0 A;  3L0M A;  5HU6 D;  4CMY A;  5K52 A;  5GU3 X;  1TKP A;  3RGD A;  3F36 A;  1RCE A;  1NF6 A;  5AXS A;  2VZB A;  3UOF A;  5CMR A;  3VNX A;  3W54 A;  3QVD A;  5FFB A;  1VJX A;  4DAS A;  1RYT A;  4ZKH A;  1S3Q A;  1JYB A;  4YVZ A;  3AK9 A;  4ZL5 A;  2N02 A;  4ZKW A;  2JD8 0;  3ISF A;  3NOZ X;  3KA4 A;  3OJ5 A;  3V3K B;  3E1O A;  4YKH A;  3RD0 A;  3R2O A;  5J8W A;  4CY9 A;  2YJJ A;  2V2P A;  4TOD A;  4M32 A;  3Q4N A;  1IER A;  3H7G A;  4OYN A;  2OC5 A;  2VXX A;  4CVS A;  3E1Q A;  3NP0 X;  2ZA8 A;  3ISE A;  5HQO A;  4Z5S A;  2YJK A;  2OKC A;  3A68 A;  3E2C A;  5D8R A;  3AF8 X;  4KVQ A;  1KRQ A;  3R2K A;  2WLA A;  3F38 A;  1R03 A;  3BKN A;  1JIG A;  4II4 B;  4LYU A;  1BG7 A;  3PVY A;  4TOH A;  2QF9 A;  3PVT B;  4RC6 B;  1H96 A;  4PG0 A;  3Q4Q A;  1NFV A;  3UOI A;  4YXJ A;  1RCD A;  4DYU A;  2C6R A;  4RC8 A;  4ZMC A;  1QYB A;  3JZ9 A;  3O7S A;  2Y3Q A;  4M34 A;  3FVB A;  4TO9 A;  3T9J A;  1HRS A;  3U90 A;  3QD8 A;  3Q4R A;  4DYX A;  1NNQ A;  5JKM A;  3WVW A;  2MGY A;  2WLU A;  4MKU A;  3F35 A;  3EGM A;  5HJH A;  2X17 0;  3WVV A;  4DYZ A;  2QQY A;  2CLB A;  3F39 A;  1O9I A;  2BK6 A;  3NP2 X;  3E1J A;  3VV9 A;  2CN7 A;  3GE4 A;  4LQV A;  3E1M A;  3PZA A;  3PWQ A;  4ZTT A;  1SQ3 A;  3E1P A;  3DBY A;  3KA3 A;  2GYD A;  3PVR B;  5FFD A;  4R42 A;  3F32 A;  4P18 A;  1ZUJ A;  1JTS A;  1NF4 A;  3KA6 A;  5FFA A;  1J30 A;  2FJC A;  1BCF A;  2V2S A;  5D8P A;  3KWO A;  3HIU A;  3QHC A;  4ITT A;  3PWF A;  4TOB A;  4LYX A;  4XKU A;  2V8T A;  3SID A;  5ERK A;  3OGH A;  2C41 A;  5E1U A;  3ERZ A;  5LG8 A;  5IX6 A;  2PYB A;  3RAV A;  2Y44 A;  2YW7 A;  4W4K B;  2XJO A;  3R2L A;  1LKO A;  2ZG8 X;  4RC5 B;  1IES A;  5GOU A;  5GU0 X;  1L8H A;  4XKS A;  3GVY A;  1ZS3 A;  3IS8 A;  4Z3B A;  4XKT A;  3UFB A;  4EVC A;  5D8S A;  1DPS A;  3ES3 A;  3LKD A;  5FFE A;  4ZL6 A;  4II4 A;  3AF9 X;  1RCI A;  3C23 A;  1VEL A;  3C1Y A;  5JDO B;  2GS4 A;  3PVT A;  4RC6 A;  4Y08 A;  4E40 A;  2ITB A;  2IU2 A;  2G38 B;  3N6O A;  2GYQ A;  4ITW A;  1YUX A;  5ERJ A;  1JRE A;  3BVE A;  1RCG A;  4LPM A;  3PWQ C;  1JI4 A;  4CVR A;  2JD6 0;  1N1Q A;  3WNW A;  2XKQ A;  3Q4O A;  2V2M A;  1JI5 A;  4LQH A;  4IXK A;  5HJF A;  2CHP A;  3QZ3 A;  5LS9 A;  3AJP A;  1B71 A;  2Z5Q A;  3PVR A;  3WVU A;  1O9R A;  1UVH A;  4EVD A;  2OH3 A;  4IWJ A;  4E6K A;  1VEQ A;  1TJO A;  4ISP A;  2FFX J;  3MPS A;  3R2M A;  1OTK A;  2V2O A;  3FRR A;  2Z6M A;  4PG1 A;  1XZ1 A;  3E1N A;  3KXU A;  3F33 A;  4KVS A;  1FHA A;  4MJY A;  4MUD A;  5I4J A;  2CN6 A;  3AJQ A;  3AK8 A;  4LPN A;  4RC5 A;  2V2J A;  4RC7 B;  1L8I A;  4WJG 4;  3FSE A;  4W4L B;  2F7N A;  3IQ1 A;  3QB9 A;  3KX9 A;  5LG2 A;  2HR5 A;  3TA8 A;  3D19 A;  1JGC A;  2BKC A;  2Z5R A;  4LPJ A;  2BW1 A;  2ZA7 A;  5JDO A;  1JKU A;  4DYY A;  3HL1 A;  4PGK A;  3PVY B;  3R2H A;  3SE1 A;  5GU1 X;  5LBH A;  1Z6O M;  1TKO A;  4DE6 A;  3C1Z A;  4DI0 A;  2Z5P A;  2V2R A;  3KA9 A;  3PW1 B;  2FG4 A;  2WTL A;  1UMN A;  3BVF A;  3KHK A;  2FZF A;  3O7R A;  3SHX A;  4TOF A;  4AM5 A;  3JZA B;  1GWG A;  3EZ0 A;  4ISM A;  1VLG A;  2AR0 A;  2V15 A;  5J8S A;  5JAC A;  4XGS A;  4TOE A;  4IWK A; 
#chains in the Genus database with same CATH homology
 1VEI A;  5K53 A;  2BJY A;  1RCC A;  5JKM G;  1JKV A;  3E6S A;  2CLU A;  2C2F A;  5J93 A;  1MOJ A;  2CEI A;  4U3G A;  2V8U A;  2IB0 A;  3VVA A;  3FI6 A;  2ZUR X;  3EZU A;  5JKL A;  1DVB A;  4TOC A;  2V2I A;  3BVI A;  3R2S A;  3AJO A;  2V2L A;  3BVL A;  3RE7 A;  2FG8 A;  5J9V A;  2IY4 A;  3SH6 A;  4LQN A;  3BT5 A;  2YW6 A;  5GN8 B;  3RBC A;  4KXR B;  2C2U A;  1LKM A;  1Z6O A;  4RC7 A;  2WWX B;  2XGW A;  4ZJK A;  3GGY A;  2V2N A;  3AF7 X;  2ZG9 X;  4CYA A;  4MN9 A;  5FEJ A;  4ERU A;  2ZA6 A;  4ML5 A;  1Z4A A;  4KVR A;  1LKP A;  1F33 A;  2RBD A;  1AEW A;  5E2D A;  4AM2 A;  1MFR A;  3PW8 C;  4TW3 A;  2W0O A;  1EUM A;  4A25 A;  3A9Q A;  1S30 A;  2VXI A;  4X0J A;  3IS7 A;  1S2Z A;  4ZLW A;  1BFR A;  3PW1 A;  1YV1 A;  3GHQ A;  2D5K A;  5JKL G;  3KA8 A;  4CMY V;  4MY7 A;  2XJN A;  2CF7 A;  4M33 A;  3E1L A;  4LQJ A;  2C2J A;  3UNO A;  2CHI A;  4DZ0 A;  4AM4 A;  2CIH A;  5FFC A;  5D8Y A;  4TOA A;  4ETR A;  1SOF A;  5C6F A;  4CVP A;  2JD7 0;  2FKZ A;  3M6J A;  2HTN A;  5D8O A;  4QUW A;  2ZG7 X;  3FRS A;  4YXM A;  1TK6 A;  5CZU A;  2Z90 A;  1LB3 A;  4MXP A;  3F34 A;  1F30 A;  3KDQ A;  1YUZ A;  3GGZ A;  4EVB A;  3C21 A;  4REU A;  2XJM A;  4TOG A;  5GU2 X;  3QHB A;  1XZ3 A;  1DAT A;  4CVT A;  5D8Q A;  2FHA A;  4M35 A;  5CMQ A;  1QGH A;  4PGI A;  4ZKX A;  3R2R A;  3PW8 A;  2UX1 A;  3F37 A;  4EVE A;  3E6R A;  2G4H A;  3BVK A;  4CYB A;  2CWL A;  5D8X A;  5GN8 A;  2FL0 A;  3L0M A;  5HU6 D;  4CMY A;  5K52 A;  5GU3 X;  1TKP A;  3RGD A;  3F36 A;  1RCE A;  1NF6 A;  5AXS A;  2VZB A;  3UOF A;  5CMR A;  3VNX A;  3W54 A;  3QVD A;  5FFB A;  1VJX A;  4DAS A;  1RYT A;  4ZKH A;  1S3Q A;  1JYB A;  4YVZ A;  3AK9 A;  4ZL5 A;  2N02 A;  4ZKW A;  2JD8 0;  3ISF A;  3NOZ X;  3KA4 A;  3OJ5 A;  3V3K B;  3E1O A;  4YKH A;  3RD0 A;  3R2O A;  5J8W A;  4CY9 A;  2YJJ A;  2V2P A;  4TOD A;  4M32 A;  3Q4N A;  1IER A;  3H7G A;  4OYN A;  2OC5 A;  2VXX A;  4CVS A;  3E1Q A;  3NP0 X;  2ZA8 A;  3ISE A;  5HQO A;  4Z5S A;  2YJK A;  2OKC A;  3A68 A;  3E2C A;  5D8R A;  3AF8 X;  4KVQ A;  1KRQ A;  3R2K A;  2WLA A;  3F38 A;  1R03 A;  3BKN A;  1JIG A;  4II4 B;  4LYU A;  1BG7 A;  3PVY A;  4TOH A;  2QF9 A;  3PVT B;  4RC6 B;  1H96 A;  4PG0 A;  3Q4Q A;  1NFV A;  3UOI A;  4YXJ A;  1RCD A;  4DYU A;  2C6R A;  4RC8 A;  4ZMC A;  1QYB A;  3JZ9 A;  3O7S A;  2Y3Q A;  4M34 A;  3FVB A;  4TO9 A;  3T9J A;  1HRS A;  3U90 A;  3QD8 A;  3Q4R A;  4DYX A;  1NNQ A;  5JKM A;  3WVW A;  2MGY A;  2WLU A;  4MKU A;  3F35 A;  3EGM A;  5HJH A;  2X17 0;  3WVV A;  4DYZ A;  2QQY A;  2CLB A;  3F39 A;  1O9I A;  2BK6 A;  3NP2 X;  3E1J A;  3VV9 A;  2CN7 A;  3GE4 A;  4LQV A;  3E1M A;  3PZA A;  3PWQ A;  4ZTT A;  1SQ3 A;  3E1P A;  3DBY A;  3KA3 A;  2GYD A;  3PVR B;  5FFD A;  4R42 A;  3F32 A;  4P18 A;  1ZUJ A;  1JTS A;  1NF4 A;  3KA6 A;  5FFA A;  1J30 A;  2FJC A;  1BCF A;  2V2S A;  5D8P A;  3KWO A;  3HIU A;  3QHC A;  4ITT A;  3PWF A;  4TOB A;  4LYX A;  4XKU A;  2V8T A;  3SID A;  5ERK A;  3OGH A;  2C41 A;  5E1U A;  3ERZ A;  5LG8 A;  5IX6 A;  2PYB A;  3RAV A;  2Y44 A;  2YW7 A;  4W4K B;  2XJO A;  3R2L A;  1LKO A;  2ZG8 X;  4RC5 B;  1IES A;  5GOU A;  5GU0 X;  1L8H A;  4XKS A;  3GVY A;  1ZS3 A;  3IS8 A;  4Z3B A;  4XKT A;  3UFB A;  4EVC A;  5D8S A;  1DPS A;  3ES3 A;  3LKD A;  5FFE A;  4ZL6 A;  4II4 A;  3AF9 X;  1RCI A;  3C23 A;  1VEL A;  3C1Y A;  5JDO B;  2GS4 A;  3PVT A;  4RC6 A;  4Y08 A;  4E40 A;  2ITB A;  2IU2 A;  2G38 B;  3N6O A;  2GYQ A;  4ITW A;  1YUX A;  5ERJ A;  1JRE A;  3BVE A;  1RCG A;  4LPM A;  3PWQ C;  1JI4 A;  4CVR A;  2JD6 0;  1N1Q A;  3WNW A;  2XKQ A;  3Q4O A;  2V2M A;  1JI5 A;  4LQH A;  4IXK A;  5HJF A;  2CHP A;  3QZ3 A;  5LS9 A;  3AJP A;  1B71 A;  2Z5Q A;  3PVR A;  3WVU A;  1O9R A;  1UVH A;  4EVD A;  2OH3 A;  4IWJ A;  4E6K A;  1VEQ A;  1TJO A;  4ISP A;  2FFX J;  3MPS A;  3R2M A;  1OTK A;  2V2O A;  3FRR A;  2Z6M A;  4PG1 A;  1XZ1 A;  3E1N A;  3KXU A;  3F33 A;  4KVS A;  1FHA A;  4MJY A;  4MUD A;  5I4J A;  2CN6 A;  3AJQ A;  3AK8 A;  4LPN A;  4RC5 A;  2V2J A;  4RC7 B;  1L8I A;  4WJG 4;  3FSE A;  4W4L B;  2F7N A;  3IQ1 A;  3QB9 A;  3KX9 A;  5LG2 A;  2HR5 A;  3TA8 A;  3D19 A;  1JGC A;  2BKC A;  2Z5R A;  4LPJ A;  2BW1 A;  2ZA7 A;  5JDO A;  1JKU A;  4DYY A;  3HL1 A;  4PGK A;  3PVY B;  3R2H A;  3SE1 A;  5GU1 X;  5LBH A;  1Z6O M;  1TKO A;  4DE6 A;  3C1Z A;  4DI0 A;  2Z5P A;  2V2R A;  3KA9 A;  3PW1 B;  2FG4 A;  2WTL A;  1UMN A;  3BVF A;  3KHK A;  2FZF A;  3O7R A;  3SHX A;  4TOF A;  4AM5 A;  3JZA B;  1GWG A;  3EZ0 A;  4ISM A;  1VLG A;  2AR0 A;  2V15 A;  5J8S A;  5JAC A;  4XGS A;  4TOE A;  4IWK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...