4DZ2A

Crystal structure of a peptidyl-prolyl cis-trans isomerase with surface mutation r92g from burkholderia pseudomallei complexed with fk506
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
113
structure length
113
Chain Sequence
b'STVVTTESGLKYEDLTEGSGAEARAGQTVSVHYTGWLTDGQKFDSSKDRNDPFAFVLGGGMVIKGWDEGVQGMKVGGVRRLTIPPQLGYGAGGAGGVIPPNATLVFEVELLDV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase
publication title A structural biology approach enables the development of antimicrobials targeting bacterial immunophilins.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Isomerase
total genus 25
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4dz2A00
4J4NA 1Y0OA 2LJ4A 3UI4A 4W9PA 1FKKA 1FD9A 4TNSA 5HUAA 3UQAA 4TW7A 2MLYA 3O5RA 4J4OA 4DRIA 1FKRA 1A7XA 2VN1A 1FKGA 2F21A 3UI6A 3JYJA 1J6YA 4NNRA 2PV2A 4FAPA 3PRBA 4ODRA 4U84A 1EQ3A 2F2DA 2AWGA 3EY6A 1BKFA 4ODPA 2M1IA 4ODNA 2MLZA 3O5LA 3KADA 1Q6HA 1JNSA 2XPBA 4TX0A 3IHZA 3KAHA 5HWBA 1F8AB 2RSEA 1D6OA 4U86A 1U79A 1T11A 2VCDA 2Y78A 4JFMA 5DIVA 1Q6IA 5HW6A 4DRJA 4BF8A 3I6CA 3H9RB 2LPVA 2XP7A 3IKDA 1Q1CA 3O5KA 4JFKA 4O2TA 4DRHA 1D7IA 1ROUA 4ODOA 3NRKA 2KO7A 4LAWA 1FAPA 3VAWA 3KACA 4QT2A 2KR7A 4G50A 3O5JA 2RUQA 1FKTA 2RURA 3IK8A 2ZQVA 4FN2A 3WH0A 2XP3A 3O5IA 2RUDA 2N87A 4DRPA 2M08A 2XP8A 1L1PA 4N19A 2PPNA 3TCZA 3JYMA 4JYSA 1J4RA 3CGNA 2XP9A 3KAIA 2ZR5A 1F40A 2K8IA 4R0XA 5HWCA 1TCOC 3PRDA 3O5DA 4ITZA 3UQIA 5HKGA 4IPXA 1KT1A 2ZQTA 5J6EA 1HXVA 3PA7A 2ITKA 2PPPA 3ODKA 2PPOA 1KT0A 2MNTA 2ZR4A 4IQ2A 4DT4A 2D9FA 1QPFA 4GGQA 3TC5A 1QPLA 4ODMA 2Q5AA 2KGJA 3CGMA 4G2PA 1BL4A 1FKFA 1QZ2A 3RFWA 5B8IC 3UQBA 2DG9A 4MGVA 2PV3A 1N1AA 3O5GA 4JFIA 4DRQA 3TDBA 1ROTA 3O5EA 3KZ7A 4W9OA 3GPKA 1FKBA 4U85A 1C9HA 2JZVA 2XP6A 4W9QA 1PINA 1NSGA 2PBCA 4DZ3A 2F4EA 3O5QA 3OOBA 4DH0A 2UZ5A 4DROA 1NMWA 4TW6A 4C02B 3KCEA 4DIPA 5I98A 2OFNA 3RGCA 2ZR6A 3NI6A 3NTPA 2XP4A 1D7HA 1JNTA 4TW8A 1YATA 2DG3A 1FJDA 2KFWA 5DITA 5DIUA 2DG4A 1FKLA 1FKIA 4LAXA 1ZK6A 2FKEA 2RQSA 1Q6UA 1ZCNA 3MDYB 3O5OA 3UI5A 4DRKA 2M2AA 3LUOA 5GPGA 4LAVA 2KE0A 2FAPA 4LAYA 4DRMA 3B7XA 2MF9A 5HT1A 4DRNA 3O5FA 2IF4A 5HW7A 4IQCA 4QIBA 1FKHA 3JXVA 1FKJA 2MPHA 4DZ2A 4ODLA 2LGOA 4MSPA 1PBKA 1B6CA 1M5YA 1J4HA 2RUCA 1YW5A 2XPAA 3KAFA 4ODKA 4QT3A 2MLXA 1R9HA 2ZQUA 1FKDA 5HW8A 4TYOA 4JFJA 1W26A 3UF8A 1J4IA 1FKSA 3FAPA 3KAGA 2LKNA 3KABA 5BXJA 2ZQSA 3O5PA 5HTGA 2PV1A 2XP5A 4ODQA 1D7JA 1EYMA 4JFLA 5D75A 3O5MA 4GIVA 1JVWA 1NMVA 1P5QA 2KI3A 3IKGA 2L2SA
chains in the Genus database with same CATH superfamily
1FKKA 1FD9A 4TNSA 1A7XA 1J6YA 4WJXA 1GOIA 4L3NA 1WB0A 1RD6A 1CTNA 4FAPA 3PRBA 4ODNA 2AWGA 3EY6A 2WLZA 3KADA 1LG2A 3GU0A 4TX0A 3IHZA 1F8AB 1XRVA 2DPEA 2O9OA 4DRJA 4BF8A 1W9VA 3H9RB 2WM0A 2KO7A 4LAWA 3RM4A 3WD2A 3O5IA 1UR8A 4NZCA 4ZPWR 3ARSA 3CHEA 1HKMA 1E6ZA 1FFRA 2ZR5A 2K8IA 3ARVA 3B9AA 1TCOC 3O5DA 1HKJA 1KT1A 1HXVA 3ODKA 4DWSA 3WD1A 2D9FA 3TC5A 3WKZA 5GQBA 1BL4A 1FKFA 1ZU8A 3B8SA 3RFWA 5B8IC 3AS3A 2F23A 4DWSB 2DG9A 3UQBA 2PV3A 4JFIA 3FXYA 4DRQA 3TDBA 4W9OA 4W9QA 2XP6A 4Z2KA 4DZ3A 1NSGA 3O5QA 1ZBKA 3ARRA 2EULA 3RGCA 4ZS6A 1FKIA 2FKEA 4Z2HA 2DT1A 2M2AA 3WQVA 4HBEA 4MNKA 1E9LA 2AOSA 4MNMA 1LJYA 1O6IA 2MPHA 1H0IA 4DZ2A 2LGOA 1ZBWA 1PBKA 1NWUA 4MSPA 2RUCA 3BMBA 4P8XA 1OGBA 3UF8A 1ZL1A 1NWSA 5BXJA 2ZQSA 3O5PA 2IUZA 1TFVA 1D7JA 1W1TA 4JFLA 1NMVA 5JH8A 1W9PA 3WL1A 4DRIA 3EIPA 4NNRA 2PV2A 1EIBA 4ODPA 2MLZA 3O5LA 1Q6HA 1JNSA 1LQ0A 3RM8A 2XPBA 1JNEA 4ZPTR 4Z2IA 4NSBA 1D6OA 4U86A 1U79A 1T11A 2VCDA 2Y78A 4JFMA 5DIVA 1Q6IA 4JFKA 2G8ZA 1ROUA 4QT2A 4G50A 3WH0A 3CZ8A 2XP3A 2RUDA 3PR9A 2N87A 3W4RA 1K9TA 3TCZA 3B9DA 2OLHA 3WD3A 3ARTA 3JYMA 1J4RA 3QOKA 3WQWA 1F40A 4R0XA 4QZVB 5HWCA 3ARQA 2DT3A 1WNOA 5J6EA 2DSWA 2P4VA 4WIWA 2PPPA 1QPFA 1NH6A 4WKHA 4XAKA 1QPLA 4Q22A 5GPRA 3AS0A 4KQZA 1QZ2A 3RMEA 3OA5A 3O5GA 3O5EA 1NWTA 3ARZA 4IT4A 3AROA 1C9HA 1PINA 2F4EA 2UZ5A 3BXWA 3CHDA 1NMWA 4C02B 4DIPA 2ZR6A 3NI6A 1XHGA 4P8UA 4DWSD 1D7HA 1E6NA 2DG3A 1FJDA 2KFWA 2DG4A 4LAXA 1SYTA 1ZK6A 1Q6UA 3LUOA 1VF8A 2B5UB 4Z2JA 4WKFA 2KE0A 4LAYA 1X6LA 5HT1A 4WKAA 3O5FA 5HW7A 3PRAA 4ODLA 1B6CA 1J4HA 2XPAA 4ODKA 4KR0B 3GTYX 2ZQUA 3ALGA 1FKDA 4JFJA 2PI6A 2LKNA 1E6RA 2XP5A 4ODQA 1EYMA 3O5MA 1P5QA 3VAWA 5HUAA 3UI4A 3UQAA 1GPFA 1LL4A 5DF0A 4HARA 1JNDA 1WAWA 1W1PA 3ARUA 4PTMA 4ODRA 1ZBCA 3ARWA 2F2DA 1EQ3A 1E6PA 2A3AA 4P8VA 5HW6A 1GUVA 3O5KA 2LPVA 1W1VA 1NWRA 1Q1CA 3IKDA 3ARXA 4Q7NA 4L72B 2B31A 1HKKA 2DT0A 3B9EA 2KR7A 3O5JA 2RUQA 3IK8A 1SR0A 3AS1A 3WL0A 1LL6A 1L1PA 4JYSA 3CGNA 2XP9A 3KAIA 2A3EA 3ALFA 4IPXA 2WLYA 1KFWA 2PPOA 2MNTA 4DT4A 4WK9A 2DSVA 4ODMA 1HJVA 1E15A 2Q5AA 3CGMA 2A3BA 3ARYA 1HJXA 4Z2GA 1N1AA 1ROTA 1W9UA 3KZ7A 3GPKA 1FKBA 3G6LA 1D2KA 4DROA 4DH0A 4TW6A 1H0GA 3KCEA 5I98A 2OFNA 4HBOA 5DIUA 4ZPVR 2FDMA 3MDYB 3UI5A 4DRKA 1FFQA 3CH9A 3WD0A 2FAPA 4DRNA 3FY1A 2IF4A 4IQCA 4QIBA 1FKHA 1FKJA 2DSZA 1M5YA 1HKIA 1UR9A 1X6NA 3RM9A 1W26A 1J4IA 1FKSA 3FAPA 5HTGA 2PV1A 5D75A 1JVWA 4UDMA 2A3CA 4LGXA 3IKGA 2L2SA 4J4NA 1Y0OA 2LJ4A 4W9PA 1FKRA 2O92A 4TW7A 2MLYA 3O5RA 4J4OA 2VN1A 1FKGA 2F21A 3UI6A 3JYJA 1LL7A 1ITXA 4U84A 1GRJA 3WD4A 1BKFA 2M1IA 1W1YA 3WIJA 5DEZA 3KAHA 5HWBA 2RSEA 3I6CA 4ML4A 2XP7A 4O2TA 4DRHA 1D7IA 4ODOA 1E44A 3NRKA 1FAPA 4IT6A 3KACA 1JCHB 1FKTA 2RURA 4FN2A 2ZQVA 4DRPA 2M08A 2XP8A 2ESCA 1HJWA 4N19A 2PPNA 4Z2LA 1EHNA 3PRDA 5HKGA 4ITZA 3UQIA 2ZQTA 3PA7A 1OGGA 2ITKA 1KT0A 2ZR4A 4IQ2A 4DWSC 4URIA 4GGQA 4MNJA 4P8WA 2YBUA 1OWQA 2KGJA 4G2PA 2ETNA 3CHCA 2YBTA 2G41A 1EDQA 4MGVA 1ZBVA 4U85A 2DSUA 2JZVA 3G6MA 2PBCA 3OOBA 3CHFA 3NTPA 2XP4A 1JNTA 4TW8A 1YATA 1LG1A 5DITA 1FKLA 2RQSA 1ZCNA 4MNLA 3O5OA 3ARPA 5GPGA 2DT2A 4MTVA 4LAVA 4DRMA 3AQUA 1ZB5A 2MF9A 3B7XA 4MPKA 4S3KA 1IX5A 3JXVA 5HBFA 4S3JA 1YW5A 3KAFA 2PN0A 4QT3A 4AY1A 4MAVA 2MLXA 3AS2A 4R5EA 1R9HA 5HW8A 4TYOA 2QF8A 3KAGA 5DO2A 2WK2A 3KABA 4W5UA 4GIVA 2KI3A
chains in the Genus database with same CATH topology
1FKKA 1FD9A 4TNSA 1A7XA 1J6YA 4WJXA 1GOIA 4L3NA 1WB0A 1RD6A 1CTNA 4FAPA 3PRBA 4ODNA 2AWGA 3EY6A 2WLZA 3KADA 1LG2A 4TX0A 3IHZA 1F8AB 1XRVA 2DPEA 2O9OA 4DRJA 4BF8A 1W9VA 3H9RB 2WM0A 2KO7A 4LAWA 3RM4A 3WD2A 3O5IA 1UR8A 4NZCA 4ZPWR 3ARSA 3CHEA 1HKMA 1E6ZA 1FFRA 2ZR5A 2K8IA 3ARVA 3B9AA 1TCOC 3O5DA 1HKJA 1KT1A 1HXVA 3ODKA 4DWSA 3WD1A 2D9FA 3TC5A 3WKZA 5GQBA 1BL4A 1FKFA 1ZU8A 3B8SA 3RFWA 5B8IC 3AS3A 3UQBA 4DWSB 2DG9A 2PV3A 4JFIA 3FXYA 4DRQA 3TDBA 4W9OA 4W9QA 2XP6A 4Z2KA 4DZ3A 1NSGA 3O5QA 1ZBKA 3ARRA 3RGCA 4ZS6A 1FKIA 2FKEA 4Z2HA 2DT1A 2M2AA 3WQVA 4HBEA 4MNKA 1E9LA 2AOSA 4MNMA 1LJYA 1O6IA 2MPHA 1H0IA 4DZ2A 2LGOA 1ZBWA 1PBKA 1NWUA 4MSPA 2RUCA 4P8XA 1OGBA 3UF8A 1ZL1A 1NWSA 5BXJA 2ZQSA 3O5PA 2IUZA 1TFVA 1D7JA 1W1TA 4JFLA 1NMVA 5JH8A 1W9PA 3WL1A 4DRIA 4NNRA 2PV2A 1EIBA 4ODPA 2MLZA 3O5LA 1Q6HA 1JNSA 1LQ0A 3RM8A 2XPBA 1JNEA 4ZPTR 4Z2IA 4NSBA 1D6OA 4U86A 1U79A 1T11A 2VCDA 2Y78A 4JFMA 5DIVA 1Q6IA 4JFKA 2G8ZA 1ROUA 4QT2A 4G50A 3WH0A 3CZ8A 2XP3A 2RUDA 3PR9A 2N87A 3W4RA 1K9TA 3TCZA 3B9DA 2OLHA 3WD3A 3ARTA 3JYMA 1J4RA 3QOKA 3WQWA 1F40A 4R0XA 4QZVB 5HWCA 3ARQA 2DT3A 1WNOA 5J6EA 2DSWA 4WIWA 2PPPA 1QPFA 1NH6A 4WKHA 4XAKA 1QPLA 4Q22A 5GPRA 3AS0A 4KQZA 1QZ2A 3RMEA 3OA5A 3O5GA 3O5EA 1NWTA 3ARZA 4IT4A 3AROA 1C9HA 1PINA 2F4EA 2UZ5A 3BXWA 3CHDA 1NMWA 4C02B 4DIPA 2ZR6A 3NI6A 1XHGA 4P8UA 4DWSD 1D7HA 1E6NA 2DG3A 1FJDA 2KFWA 2DG4A 4LAXA 1SYTA 1ZK6A 1Q6UA 3LUOA 1VF8A 4Z2JA 4WKFA 2KE0A 4LAYA 1X6LA 5HT1A 4WKAA 3O5FA 5HW7A 3PRAA 4ODLA 1B6CA 1J4HA 2XPAA 4ODKA 4KR0B 2ZQUA 3ALGA 1FKDA 4JFJA 2PI6A 2LKNA 1E6RA 2XP5A 4ODQA 1EYMA 3O5MA 1P5QA 3VAWA 5HUAA 3UI4A 3UQAA 1GPFA 1LL4A 5DF0A 4HARA 1JNDA 1WAWA 1W1PA 3ARUA 4PTMA 4ODRA 1ZBCA 3ARWA 2F2DA 1EQ3A 1E6PA 2A3AA 4P8VA 5HW6A 1GUVA 3O5KA 2LPVA 1W1VA 1NWRA 1Q1CA 3IKDA 3ARXA 4Q7NA 4L72B 2B31A 1HKKA 2DT0A 3B9EA 2KR7A 3O5JA 2RUQA 3IK8A 1SR0A 3AS1A 3WL0A 1LL6A 1L1PA 4JYSA 3CGNA 2XP9A 3KAIA 2A3EA 3ALFA 4IPXA 2WLYA 1KFWA 2PPOA 2MNTA 4DT4A 4WK9A 2DSVA 4ODMA 1HJVA 1E15A 2Q5AA 3CGMA 2A3BA 3ARYA 1HJXA 4Z2GA 1N1AA 1ROTA 1W9UA 3KZ7A 3GPKA 1FKBA 3G6LA 1D2KA 4DROA 4DH0A 4TW6A 1H0GA 3KCEA 5I98A 2OFNA 4HBOA 5DIUA 4ZPVR 2FDMA 3MDYB 3UI5A 4DRKA 1FFQA 3CH9A 3WD0A 2FAPA 4DRNA 3FY1A 2IF4A 4IQCA 4QIBA 1FKHA 1FKJA 2DSZA 1M5YA 1HKIA 1UR9A 1X6NA 3RM9A 1W26A 1J4IA 1FKSA 3FAPA 5HTGA 2PV1A 5D75A 1JVWA 2A3CA 4LGXA 3IKGA 2L2SA 4J4NA 1Y0OA 2LJ4A 4W9PA 1FKRA 2O92A 4TW7A 2MLYA 3O5RA 4J4OA 2VN1A 1FKGA 2F21A 3UI6A 3JYJA 1LL7A 1ITXA 4U84A 3WD4A 1BKFA 2M1IA 1W1YA 3WIJA 5DEZA 3KAHA 5HWBA 2RSEA 3I6CA 4ML4A 2XP7A 4O2TA 4DRHA 1D7IA 4ODOA 3NRKA 1FAPA 4IT6A 3KACA 1FKTA 2RURA 4FN2A 2ZQVA 4DRPA 2M08A 2XP8A 2ESCA 1HJWA 4N19A 2PPNA 4Z2LA 1EHNA 3PRDA 5HKGA 4ITZA 3UQIA 2ZQTA 3PA7A 1OGGA 2ITKA 1KT0A 2ZR4A 4IQ2A 4DWSC 4URIA 4GGQA 4MNJA 4P8WA 2YBUA 1OWQA 2KGJA 4G2PA 3CHCA 2YBTA 2G41A 1EDQA 4MGVA 1ZBVA 4U85A 2DSUA 2JZVA 3G6MA 2PBCA 3OOBA 3CHFA 3NTPA 2XP4A 1JNTA 4TW8A 1YATA 1LG1A 5DITA 1FKLA 2RQSA 1ZCNA 4MNLA 3O5OA 3ARPA 5GPGA 2DT2A 4MTVA 4LAVA 4DRMA 3AQUA 1ZB5A 2MF9A 3B7XA 4MPKA 4S3KA 1IX5A 3JXVA 5HBFA 4S3JA 1YW5A 3KAFA 4QT3A 4AY1A 4MAVA 2MLXA 3AS2A 4R5EA 1R9HA 5HW8A 4TYOA 2QF8A 3KAGA 5DO2A 2WK2A 3KABA 4W5UA 4GIVA 2KI3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J4N A;  1Y0O A;  2LJ4 A;  3UI4 A;  4W9P A;  1FKK A;  1FD9 A;  4TNS A;  5HUA A;  3UQA A;  4TW7 A;  2MLY A;  3O5R A;  4J4O A;  4DRI A;  1FKR A;  1A7X A;  2VN1 A;  1FKG A;  2F21 A;  3UI6 A;  3JYJ A;  1J6Y A;  4NNR A;  2PV2 A;  4FAP A;  3PRB A;  4ODR A;  4U84 A;  1EQ3 A;  2F2D A;  2AWG A;  3EY6 A;  1BKF A;  4ODP A;  2M1I A;  4ODN A;  2MLZ A;  3O5L A;  3KAD A;  1Q6H A;  1JNS A;  2XPB A;  4TX0 A;  3IHZ A;  3KAH A;  5HWB A;  1F8A B;  2RSE A;  1D6O A;  4U86 A;  1U79 A;  1T11 A;  2VCD A;  2Y78 A;  4JFM A;  5DIV A;  1Q6I A;  5HW6 A;  4DRJ A;  4BF8 A;  3I6C A;  3H9R B;  2LPV A;  2XP7 A;  3IKD A;  1Q1C A;  3O5K A;  4JFK A;  4O2T A;  4DRH A;  1D7I A;  1ROU A;  4ODO A;  3NRK A;  2KO7 A;  4LAW A;  1FAP A;  3VAW A;  3KAC A;  4QT2 A;  2KR7 A;  4G50 A;  3O5J A;  2RUQ A;  1FKT A;  2RUR A;  3IK8 A;  2ZQV A;  4FN2 A;  3WH0 A;  2XP3 A;  3O5I A;  2RUD A;  2N87 A;  4DRP A;  2M08 A;  2XP8 A;  1L1P A;  4N19 A;  2PPN A;  3TCZ A;  3JYM A;  4JYS A;  1J4R A;  3CGN A;  2XP9 A;  3KAI A;  2ZR5 A;  1F40 A;  2K8I A;  4R0X A;  5HWC A;  1TCO C;  3PRD A;  3O5D A;  4ITZ A;  3UQI A;  5HKG A;  4IPX A;  1KT1 A;  2ZQT A;  5J6E A;  1HXV A;  3PA7 A;  2ITK A;  2PPP A;  3ODK A;  2PPO A;  1KT0 A;  2MNT A;  2ZR4 A;  4IQ2 A;  4DT4 A;  2D9F A;  1QPF A;  4GGQ A;  3TC5 A;  1QPL A;  4ODM A;  2Q5A A;  2KGJ A;  3CGM A;  4G2P A;  1BL4 A;  1FKF A;  1QZ2 A;  3RFW A;  5B8I C;  3UQB A;  2DG9 A;  4MGV A;  2PV3 A;  1N1A A;  3O5G A;  4JFI A;  4DRQ A;  3TDB A;  1ROT A;  3O5E A;  3KZ7 A;  4W9O A;  3GPK A;  1FKB A;  4U85 A;  1C9H A;  2JZV A;  2XP6 A;  4W9Q A;  1PIN A;  1NSG A;  2PBC A;  4DZ3 A;  2F4E A;  3O5Q A;  3OOB A;  4DH0 A;  2UZ5 A;  4DRO A;  1NMW A;  4TW6 A;  4C02 B;  3KCE A;  4DIP A;  5I98 A;  2OFN A;  3RGC A;  2ZR6 A;  3NI6 A;  3NTP A;  2XP4 A;  1D7H A;  1JNT A;  4TW8 A;  1YAT A;  2DG3 A;  1FJD A;  2KFW A;  5DIT A;  5DIU A;  2DG4 A;  1FKL A;  1FKI A;  4LAX A;  1ZK6 A;  2FKE A;  2RQS A;  1Q6U A;  1ZCN A;  3MDY B;  3O5O A;  3UI5 A;  4DRK A;  2M2A A;  3LUO A;  5GPG A;  4LAV A;  2KE0 A;  2FAP A;  4LAY A;  4DRM A;  3B7X A;  2MF9 A;  5HT1 A;  4DRN A;  3O5F A;  2IF4 A;  5HW7 A;  4IQC A;  4QIB A;  1FKH A;  3JXV A;  1FKJ A;  2MPH A;  4DZ2 A;  4ODL A;  2LGO A;  4MSP A;  1PBK A;  1B6C A;  1M5Y A;  1J4H A;  2RUC A;  1YW5 A;  2XPA A;  3KAF A;  4ODK A;  4QT3 A;  2MLX A;  1R9H A;  2ZQU A;  1FKD A;  5HW8 A;  4TYO A;  4JFJ A;  1W26 A;  3UF8 A;  1J4I A;  1FKS A;  3FAP A;  3KAG A;  2LKN A;  3KAB A;  5BXJ A;  2ZQS A;  3O5P A;  5HTG A;  2PV1 A;  2XP5 A;  4ODQ A;  1D7J A;  1EYM A;  4JFL A;  5D75 A;  3O5M A;  4GIV A;  1JVW A;  1NMV A;  1P5Q A;  2KI3 A;  3IKG A;  2L2S A; 
#chains in the Genus database with same CATH topology
 1FKK A;  1FD9 A;  4TNS A;  1A7X A;  1J6Y A;  4WJX A;  1GOI A;  4L3N A;  1WB0 A;  1RD6 A;  1CTN A;  4FAP A;  3PRB A;  4ODN A;  2AWG A;  3EY6 A;  2WLZ A;  3KAD A;  1LG2 A;  3GU0 A;  4TX0 A;  3IHZ A;  1F8A B;  1XRV A;  2DPE A;  2O9O A;  4DRJ A;  4BF8 A;  1W9V A;  3H9R B;  2WM0 A;  2KO7 A;  4LAW A;  3RM4 A;  3WD2 A;  3O5I A;  1UR8 A;  4NZC A;  4ZPW R;  3ARS A;  3CHE A;  1HKM A;  1E6Z A;  1FFR A;  2ZR5 A;  2K8I A;  3ARV A;  3B9A A;  1TCO C;  3O5D A;  1HKJ A;  1KT1 A;  1HXV A;  3ODK A;  4DWS A;  3WD1 A;  2D9F A;  3TC5 A;  3WKZ A;  5GQB A;  1BL4 A;  1FKF A;  1ZU8 A;  3B8S A;  3RFW A;  5B8I C;  3AS3 A;  2F23 A;  4DWS B;  2DG9 A;  3UQB A;  2PV3 A;  4JFI A;  3FXY A;  4DRQ A;  3TDB A;  4W9O A;  4W9Q A;  2XP6 A;  4Z2K A;  4DZ3 A;  1NSG A;  3O5Q A;  1ZBK A;  3ARR A;  2EUL A;  3RGC A;  4ZS6 A;  1FKI A;  2FKE A;  4Z2H A;  2DT1 A;  2M2A A;  3WQV A;  4HBE A;  4MNK A;  1E9L A;  2AOS A;  4MNM A;  1LJY A;  1O6I A;  2MPH A;  1H0I A;  4DZ2 A;  2LGO A;  1ZBW A;  1PBK A;  1NWU A;  4MSP A;  2RUC A;  3BMB A;  4P8X A;  1OGB A;  3UF8 A;  1ZL1 A;  1NWS A;  5BXJ A;  2ZQS A;  3O5P A;  2IUZ A;  1TFV A;  1D7J A;  1W1T A;  4JFL A;  1NMV A;  5JH8 A;  1W9P A;  3WL1 A;  4DRI A;  3EIP A;  4NNR A;  2PV2 A;  1EIB A;  4ODP A;  2MLZ A;  3O5L A;  1Q6H A;  1JNS A;  1LQ0 A;  3RM8 A;  2XPB A;  1JNE A;  4ZPT R;  4Z2I A;  4NSB A;  1D6O A;  4U86 A;  1U79 A;  1T11 A;  2VCD A;  2Y78 A;  4JFM A;  5DIV A;  1Q6I A;  4JFK A;  2G8Z A;  1ROU A;  4QT2 A;  4G50 A;  3WH0 A;  3CZ8 A;  2XP3 A;  2RUD A;  3PR9 A;  2N87 A;  3W4R A;  1K9T A;  3TCZ A;  3B9D A;  2OLH A;  3WD3 A;  3ART A;  3JYM A;  1J4R A;  3QOK A;  3WQW A;  1F40 A;  4R0X A;  4QZV B;  5HWC A;  3ARQ A;  2DT3 A;  1WNO A;  5J6E A;  2DSW A;  2P4V A;  4WIW A;  2PPP A;  1QPF A;  1NH6 A;  4WKH A;  4XAK A;  1QPL A;  4Q22 A;  5GPR A;  3AS0 A;  4KQZ A;  1QZ2 A;  3RME A;  3OA5 A;  3O5G A;  3O5E A;  1NWT A;  3ARZ A;  4IT4 A;  3ARO A;  1C9H A;  1PIN A;  2F4E A;  2UZ5 A;  3BXW A;  3CHD A;  1NMW A;  4C02 B;  4DIP A;  2ZR6 A;  3NI6 A;  1XHG A;  4P8U A;  4DWS D;  1D7H A;  1E6N A;  2DG3 A;  1FJD A;  2KFW A;  2DG4 A;  4LAX A;  1SYT A;  1ZK6 A;  1Q6U A;  3LUO A;  1VF8 A;  2B5U B;  4Z2J A;  4WKF A;  2KE0 A;  4LAY A;  1X6L A;  5HT1 A;  4WKA A;  3O5F A;  5HW7 A;  3PRA A;  4ODL A;  1B6C A;  1J4H A;  2XPA A;  4ODK A;  4KR0 B;  3GTY X;  2ZQU A;  3ALG A;  1FKD A;  4JFJ A;  2PI6 A;  2LKN A;  1E6R A;  2XP5 A;  4ODQ A;  1EYM A;  3O5M A;  1P5Q A;  3VAW A;  5HUA A;  3UI4 A;  3UQA A;  1GPF A;  1LL4 A;  5DF0 A;  4HAR A;  1JND A;  1WAW A;  1W1P A;  3ARU A;  4PTM A;  4ODR A;  1ZBC A;  3ARW A;  2F2D A;  1EQ3 A;  1E6P A;  2A3A A;  4P8V A;  5HW6 A;  1GUV A;  3O5K A;  2LPV A;  1W1V A;  1NWR A;  1Q1C A;  3IKD A;  3ARX A;  4Q7N A;  4L72 B;  2B31 A;  1HKK A;  2DT0 A;  3B9E A;  2KR7 A;  3O5J A;  2RUQ A;  3IK8 A;  1SR0 A;  3AS1 A;  3WL0 A;  1LL6 A;  1L1P A;  4JYS A;  3CGN A;  2XP9 A;  3KAI A;  2A3E A;  3ALF A;  4IPX A;  2WLY A;  1KFW A;  2PPO A;  2MNT A;  4DT4 A;  4WK9 A;  2DSV A;  4ODM A;  1HJV A;  1E15 A;  2Q5A A;  3CGM A;  2A3B A;  3ARY A;  1HJX A;  4Z2G A;  1N1A A;  1ROT A;  1W9U A;  3KZ7 A;  3GPK A;  1FKB A;  3G6L A;  1D2K A;  4DRO A;  4DH0 A;  4TW6 A;  1H0G A;  3KCE A;  5I98 A;  2OFN A;  4HBO A;  5DIU A;  4ZPV R;  2FDM A;  3MDY B;  3UI5 A;  4DRK A;  1FFQ A;  3CH9 A;  3WD0 A;  2FAP A;  4DRN A;  3FY1 A;  2IF4 A;  4IQC A;  4QIB A;  1FKH A;  1FKJ A;  2DSZ A;  1M5Y A;  1HKI A;  1UR9 A;  1X6N A;  3RM9 A;  1W26 A;  1J4I A;  1FKS A;  3FAP A;  5HTG A;  2PV1 A;  5D75 A;  1JVW A;  4UDM A;  2A3C A;  4LGX A;  3IKG A;  2L2S A;  4J4N A;  1Y0O A;  2LJ4 A;  4W9P A;  1FKR A;  2O92 A;  4TW7 A;  2MLY A;  3O5R A;  4J4O A;  2VN1 A;  1FKG A;  2F21 A;  3UI6 A;  3JYJ A;  1LL7 A;  1ITX A;  4U84 A;  1GRJ A;  3WD4 A;  1BKF A;  2M1I A;  1W1Y A;  3WIJ A;  5DEZ A;  3KAH A;  5HWB A;  2RSE A;  3I6C A;  4ML4 A;  2XP7 A;  4O2T A;  4DRH A;  1D7I A;  4ODO A;  1E44 A;  3NRK A;  1FAP A;  4IT6 A;  3KAC A;  1JCH B;  1FKT A;  2RUR A;  4FN2 A;  2ZQV A;  4DRP A;  2M08 A;  2XP8 A;  2ESC A;  1HJW A;  4N19 A;  2PPN A;  4Z2L A;  1EHN A;  3PRD A;  5HKG A;  4ITZ A;  3UQI A;  2ZQT A;  3PA7 A;  1OGG A;  2ITK A;  1KT0 A;  2ZR4 A;  4IQ2 A;  4DWS C;  4URI A;  4GGQ A;  4MNJ A;  4P8W A;  2YBU A;  1OWQ A;  2KGJ A;  4G2P A;  2ETN A;  3CHC A;  2YBT A;  2G41 A;  1EDQ A;  4MGV A;  1ZBV A;  4U85 A;  2DSU A;  2JZV A;  3G6M A;  2PBC A;  3OOB A;  3CHF A;  3NTP A;  2XP4 A;  1JNT A;  4TW8 A;  1YAT A;  1LG1 A;  5DIT A;  1FKL A;  2RQS A;  1ZCN A;  4MNL A;  3O5O A;  3ARP A;  5GPG A;  2DT2 A;  4MTV A;  4LAV A;  4DRM A;  3AQU A;  1ZB5 A;  2MF9 A;  3B7X A;  4MPK A;  4S3K A;  1IX5 A;  3JXV A;  5HBF A;  4S3J A;  1YW5 A;  3KAF A;  2PN0 A;  4QT3 A;  4AY1 A;  4MAV A;  2MLX A;  3AS2 A;  4R5E A;  1R9H A;  5HW8 A;  4TYO A;  2QF8 A;  3KAG A;  5DO2 A;  2WK2 A;  3KAB A;  4W5U A;  4GIV A;  2KI3 A; 
#chains in the Genus database with same CATH homology
 1FKK A;  1FD9 A;  4TNS A;  1A7X A;  1J6Y A;  4WJX A;  1GOI A;  4L3N A;  1WB0 A;  1RD6 A;  1CTN A;  4FAP A;  3PRB A;  4ODN A;  2AWG A;  3EY6 A;  2WLZ A;  3KAD A;  1LG2 A;  4TX0 A;  3IHZ A;  1F8A B;  1XRV A;  2DPE A;  2O9O A;  4DRJ A;  4BF8 A;  1W9V A;  3H9R B;  2WM0 A;  2KO7 A;  4LAW A;  3RM4 A;  3WD2 A;  3O5I A;  1UR8 A;  4NZC A;  4ZPW R;  3ARS A;  3CHE A;  1HKM A;  1E6Z A;  1FFR A;  2ZR5 A;  2K8I A;  3ARV A;  3B9A A;  1TCO C;  3O5D A;  1HKJ A;  1KT1 A;  1HXV A;  3ODK A;  4DWS A;  3WD1 A;  2D9F A;  3TC5 A;  3WKZ A;  5GQB A;  1BL4 A;  1FKF A;  1ZU8 A;  3B8S A;  3RFW A;  5B8I C;  3AS3 A;  3UQB A;  4DWS B;  2DG9 A;  2PV3 A;  4JFI A;  3FXY A;  4DRQ A;  3TDB A;  4W9O A;  4W9Q A;  2XP6 A;  4Z2K A;  4DZ3 A;  1NSG A;  3O5Q A;  1ZBK A;  3ARR A;  3RGC A;  4ZS6 A;  1FKI A;  2FKE A;  4Z2H A;  2DT1 A;  2M2A A;  3WQV A;  4HBE A;  4MNK A;  1E9L A;  2AOS A;  4MNM A;  1LJY A;  1O6I A;  2MPH A;  1H0I A;  4DZ2 A;  2LGO A;  1ZBW A;  1PBK A;  1NWU A;  4MSP A;  2RUC A;  4P8X A;  1OGB A;  3UF8 A;  1ZL1 A;  1NWS A;  5BXJ A;  2ZQS A;  3O5P A;  2IUZ A;  1TFV A;  1D7J A;  1W1T A;  4JFL A;  1NMV A;  5JH8 A;  1W9P A;  3WL1 A;  4DRI A;  4NNR A;  2PV2 A;  1EIB A;  4ODP A;  2MLZ A;  3O5L A;  1Q6H A;  1JNS A;  1LQ0 A;  3RM8 A;  2XPB A;  1JNE A;  4ZPT R;  4Z2I A;  4NSB A;  1D6O A;  4U86 A;  1U79 A;  1T11 A;  2VCD A;  2Y78 A;  4JFM A;  5DIV A;  1Q6I A;  4JFK A;  2G8Z A;  1ROU A;  4QT2 A;  4G50 A;  3WH0 A;  3CZ8 A;  2XP3 A;  2RUD A;  3PR9 A;  2N87 A;  3W4R A;  1K9T A;  3TCZ A;  3B9D A;  2OLH A;  3WD3 A;  3ART A;  3JYM A;  1J4R A;  3QOK A;  3WQW A;  1F40 A;  4R0X A;  4QZV B;  5HWC A;  3ARQ A;  2DT3 A;  1WNO A;  5J6E A;  2DSW A;  4WIW A;  2PPP A;  1QPF A;  1NH6 A;  4WKH A;  4XAK A;  1QPL A;  4Q22 A;  5GPR A;  3AS0 A;  4KQZ A;  1QZ2 A;  3RME A;  3OA5 A;  3O5G A;  3O5E A;  1NWT A;  3ARZ A;  4IT4 A;  3ARO A;  1C9H A;  1PIN A;  2F4E A;  2UZ5 A;  3BXW A;  3CHD A;  1NMW A;  4C02 B;  4DIP A;  2ZR6 A;  3NI6 A;  1XHG A;  4P8U A;  4DWS D;  1D7H A;  1E6N A;  2DG3 A;  1FJD A;  2KFW A;  2DG4 A;  4LAX A;  1SYT A;  1ZK6 A;  1Q6U A;  3LUO A;  1VF8 A;  4Z2J A;  4WKF A;  2KE0 A;  4LAY A;  1X6L A;  5HT1 A;  4WKA A;  3O5F A;  5HW7 A;  3PRA A;  4ODL A;  1B6C A;  1J4H A;  2XPA A;  4ODK A;  4KR0 B;  2ZQU A;  3ALG A;  1FKD A;  4JFJ A;  2PI6 A;  2LKN A;  1E6R A;  2XP5 A;  4ODQ A;  1EYM A;  3O5M A;  1P5Q A;  3VAW A;  5HUA A;  3UI4 A;  3UQA A;  1GPF A;  1LL4 A;  5DF0 A;  4HAR A;  1JND A;  1WAW A;  1W1P A;  3ARU A;  4PTM A;  4ODR A;  1ZBC A;  3ARW A;  2F2D A;  1EQ3 A;  1E6P A;  2A3A A;  4P8V A;  5HW6 A;  1GUV A;  3O5K A;  2LPV A;  1W1V A;  1NWR A;  1Q1C A;  3IKD A;  3ARX A;  4Q7N A;  4L72 B;  2B31 A;  1HKK A;  2DT0 A;  3B9E A;  2KR7 A;  3O5J A;  2RUQ A;  3IK8 A;  1SR0 A;  3AS1 A;  3WL0 A;  1LL6 A;  1L1P A;  4JYS A;  3CGN A;  2XP9 A;  3KAI A;  2A3E A;  3ALF A;  4IPX A;  2WLY A;  1KFW A;  2PPO A;  2MNT A;  4DT4 A;  4WK9 A;  2DSV A;  4ODM A;  1HJV A;  1E15 A;  2Q5A A;  3CGM A;  2A3B A;  3ARY A;  1HJX A;  4Z2G A;  1N1A A;  1ROT A;  1W9U A;  3KZ7 A;  3GPK A;  1FKB A;  3G6L A;  1D2K A;  4DRO A;  4DH0 A;  4TW6 A;  1H0G A;  3KCE A;  5I98 A;  2OFN A;  4HBO A;  5DIU A;  4ZPV R;  2FDM A;  3MDY B;  3UI5 A;  4DRK A;  1FFQ A;  3CH9 A;  3WD0 A;  2FAP A;  4DRN A;  3FY1 A;  2IF4 A;  4IQC A;  4QIB A;  1FKH A;  1FKJ A;  2DSZ A;  1M5Y A;  1HKI A;  1UR9 A;  1X6N A;  3RM9 A;  1W26 A;  1J4I A;  1FKS A;  3FAP A;  5HTG A;  2PV1 A;  5D75 A;  1JVW A;  2A3C A;  4LGX A;  3IKG A;  2L2S A;  4J4N A;  1Y0O A;  2LJ4 A;  4W9P A;  1FKR A;  2O92 A;  4TW7 A;  2MLY A;  3O5R A;  4J4O A;  2VN1 A;  1FKG A;  2F21 A;  3UI6 A;  3JYJ A;  1LL7 A;  1ITX A;  4U84 A;  3WD4 A;  1BKF A;  2M1I A;  1W1Y A;  3WIJ A;  5DEZ A;  3KAH A;  5HWB A;  2RSE A;  3I6C A;  4ML4 A;  2XP7 A;  4O2T A;  4DRH A;  1D7I A;  4ODO A;  3NRK A;  1FAP A;  4IT6 A;  3KAC A;  1FKT A;  2RUR A;  4FN2 A;  2ZQV A;  4DRP A;  2M08 A;  2XP8 A;  2ESC A;  1HJW A;  4N19 A;  2PPN A;  4Z2L A;  1EHN A;  3PRD A;  5HKG A;  4ITZ A;  3UQI A;  2ZQT A;  3PA7 A;  1OGG A;  2ITK A;  1KT0 A;  2ZR4 A;  4IQ2 A;  4DWS C;  4URI A;  4GGQ A;  4MNJ A;  4P8W A;  2YBU A;  1OWQ A;  2KGJ A;  4G2P A;  3CHC A;  2YBT A;  2G41 A;  1EDQ A;  4MGV A;  1ZBV A;  4U85 A;  2DSU A;  2JZV A;  3G6M A;  2PBC A;  3OOB A;  3CHF A;  3NTP A;  2XP4 A;  1JNT A;  4TW8 A;  1YAT A;  1LG1 A;  5DIT A;  1FKL A;  2RQS A;  1ZCN A;  4MNL A;  3O5O A;  3ARP A;  5GPG A;  2DT2 A;  4MTV A;  4LAV A;  4DRM A;  3AQU A;  1ZB5 A;  2MF9 A;  3B7X A;  4MPK A;  4S3K A;  1IX5 A;  3JXV A;  5HBF A;  4S3J A;  1YW5 A;  3KAF A;  4QT3 A;  4AY1 A;  4MAV A;  2MLX A;  3AS2 A;  4R5E A;  1R9H A;  5HW8 A;  4TYO A;  2QF8 A;  3KAG A;  5DO2 A;  2WK2 A;  3KAB A;  4W5U A;  4GIV A;  2KI3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...