4DZ2A

Crystal structure of a peptidyl-prolyl cis-trans isomerase with surface mutation r92g from burkholderia pseudomallei complexed with fk506
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
113
structure length
113
Chain Sequence
STVVTTESGLKYEDLTEGSGAEARAGQTVSVHYTGWLTDGQKFDSSKDRNDPFAFVLGGGMVIKGWDEGVQGMKVGGVRRLTIPPQLGYGAGGAGGVIPPNATLVFEVELLDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural biology approach enables the development of antimicrobials targeting bacterial immunophilins.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase
total genus 25
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4dz2A00
1EQ3A 2UZ5A 1A7XA 3KAIA 3KZ7A 3O5JA 1J6YA 1D7JA 4G50A 4ODQA 5HW8A 3B7XA 1Q6IA 2D9FA 5J6EA 3KAHA 4JFMA 5BXJA 4IPXA 3PRDA 1JNSA 2MF9A 4ODRA 3O5LA 2KFWA 4QT3A 3JYMA 5HTGA 4TW7A 2DG4A 2L2SA 2LPVA 3O5MA 2XPAA 3KAGA 1FKJA 3TDBA 3FAPA 2FKEA 2Q5AA 3OOBA 3MDYB 3WH0A 1KT1A 1FAPA 2F2DA 4DZ2A 2F21A 2ZR4A 5HT1A 4G2PA 4N19A 2PPPA 4JYSA 1F40A 4MSPA 1D7IA 4NNRA 3O5IA 1BKFA 2RQSA 4DRHA 4DROA 3GPKA 3KABA 4QT2A 1ROUA 2ZQSA 2ZR6A 1FKLA 3CGNA 4TYOA 2K8IA 2LGOA 2VCDA 4U85A 1QZ2A 4O2TA 4J4NA 1Q1CA 3RFWA 4ODMA 5DITA 2PV3A 3TC5A 2XP4A 1U79A 2DG3A 4ODNA 1C9HA 1T11A 1W26A 2FAPA 4ODPA 4U84A 5HW6A 2JZVA 1P5QA 3JYJA 3O5PA 5HKGA 1FD9A 1Q6UA 2KI3A 2MNTA 1ZCNA 5D75A 1D6OA 2PBCA 2RUCA 2LJ4A 4GGQA 4DH0A 4ODKA 2Y78A 3TCZA 1R9HA 3O5KA 2XP5A 1JVWA 1J4HA 4LAWA 5HW7A 4JFIA 2PV2A 5HUAA 3UQBA 1FJDA 4J4OA 2MLXA 4ODOA 3UF8A 1FKGA 1FKRA 4LAYA 3UQAA 1NSGA 5I98A 1D7HA 2PV1A 4JFJA 3PA7A 4JFLA 3RGCA 2IF4A 2RSEA 1QPLA 2XP7A 4DRNA 4TX0A 4DRJA 1NMWA 2MLZA 4W9OA 2ZR5A 1HXVA 1EYMA 2ITKA 4W9PA 3UQIA 4R0XA 1YATA 2PPNA 3I6CA 2KR7A 3O5EA 1TCOC 1J4IA 1PBKA 1YW5A 3NI6A 1ROTA 2KGJA 3UI6A 4DRQA 5HWBA 4DRMA 1NMVA 2LKNA 2N87A 2F4EA 2XP9A 3KCEA 4DRKA 5HWCA 5DIUA 5B8IC 4BF8A 4DZ3A 4ITZA 1FKIA 2MPHA 2MLYA 2ZQUA 1F8AB 3O5GA 2M08A 3O5FA 4QIBA 4TNSA 2ZQVA 3KACA 2XP8A 3O5DA 2ZQTA 2M2AA 3ODKA 3NTPA 4DIPA 1FKSA 2XPBA 3EY6A 1L1PA 1FKFA 2RUDA 4FN2A 4LAXA 5DIVA 3UI4A 2RURA 4DRPA 2AWGA 1FKDA 1N1AA 1Q6HA 3O5RA 1B6CA 4LAVA 4GIVA 3VAWA 4FAPA 3IK8A 2RUQA 1QPFA 4MGVA 3JXVA 3LUOA 3H9RB 2PPOA 4W9QA 2KE0A 2KO7A 1ZK6A 1M5YA 5GPGA 3UI5A 1J4RA 1FKHA 3NRKA 3PRBA 1Y0OA 2M1IA 1FKKA 4IQ2A 2XP6A 4ODLA 1PINA 4TW8A 3IKDA 2XP3A 4IQCA 1FKBA 1KT0A 2VN1A 3IKGA 3O5QA 2OFNA 4DRIA 3IHZA 1JNTA 3CGMA 4DT4A 1BL4A 4C02B 4U86A 2DG9A 1FKTA 4TW6A 4JFKA 3KAFA 3O5OA 3KADA
chains in the Genus database with same CATH superfamily
3KAIA 4HBEA 1E15A 1D7JA 5J6EA 1Q6IA 2D9FA 3KAHA 3PRDA 2MF9A 4ODRA 4QT3A 4Z2IA 1JNDA 4S3KA 3JYMA 4WIWA 5HTGA 3FAPA 1HJXA 2DSWA 4Q7NA 4MAVA 3WH0A 2B5UB 1KT1A 1NWTA 4NSBA 2A3BA 1HKJA 2ETNA 5HT1A 1KFWA 4N19A 1LL7A 4JYSA 1D7IA 2RQSA 3KABA 2K8IA 4O2TA 2O9OA 4Q22A 1Q1CA 2A3EA 2WM0A 1W26A 3ARXA 4Z2GA 3RM8A 5HKGA 1E6ZA 1H0IA 1Q6UA 1ZCNA 2RUCA 2DPEA 4GGQA 3WKZA 1O6IA 1ZBWA 2OLHA 4P8UA 1J4HA 3UQBA 2PV2A 4ML4A 4WKAA 1FKGA 2AOSA 1W1YA 3UQAA 1X6NA 3PA7A 4DWSB 4ZPWR 4DRNA 1RD6A 1NMWA 2ZR5A 2IUZA 1EYMA 4W9PA 3UQIA 4DWSD 1YATA 4IT4A 1PBKA 3NI6A 3WIJA 1ITXA 1JCHB 1ROTA 2WLYA 1UR8A 2XP9A 5B8IC 2MPHA 1HJVA 1D2KA 3O5FA 4QIBA 4TNSA 3WL0A 1WAWA 1FKSA 1FKFA 2RUDA 4FN2A 4LAXA 4Z2KA 3BMBA 3GTYX 1E6NA 2DSZA 4LAVA 4GIVA 4FAPA 3IK8A 1ZBCA 2RUQA 3ARQA 1QPFA 3H9RB 1XRVA 3B9EA 4AY1A 2PPOA 2P4VA 2KE0A 1ZK6A 4PTMA 3B9AA 4L3NA 2XP6A 2XP3A 4MTVA 4Z2HA 3IKGA 4DT4A 3ARZA 2DG9A 5DO2A 4TW6A 3O5OA 3KZ7A 1SR0A 5GQBA 1W9UA 5BXJA 4JFMA 1JNSA 4MNKA 3AQUA 3AS0A 2DG4A 3KAGA 1GRJA 2WK2A 4S3JA 2Q5AA 3OOBA 3AROA 3CHEA 4ZS6A 4W5UA 2FDMA 2PPPA 1F40A 1BKFA 4DRHA 2DSVA 3B9DA 3RM9A 3PRAA 5DITA 3TC5A 1U79A 2DG3A 1UR9A 5HW6A 3O5PA 3JYJA 1GPFA 2KI3A 2MNTA 3AS3A 3CZ8A 2Y78A 1R9HA 2XP5A 1JVWA 5HUAA 1FJDA 4JFIA 4ODOA 3G6MA 4LAYA 2PN0A 4JFJA 4JFLA 3RGCA 2IF4A 3WD0A 4TX0A 4DRJA 1NH6A 1WB0A 1LG2A 3O5EA 2KR7A 4KR0B 1TCOC 1W1TA 2KGJA 1ZL1A 5DF0A 3KCEA 4DRKA 4WJXA 4BF8A 1FKIA 2ZQUA 2G8ZA 4MNLA 2ZQVA 5DEZA 3OA5A 1K9TA 1LQ0A 4DIPA 3EY6A 1H0GA 4XAKA 2PI6A 2ESCA 2RURA 4DRPA 1X6LA 2AWGA 2G41A 4P8VA 1Q6HA 1W9VA 1B6CA 3VAWA 3WD2A 4MGVA 4URIA 3UI5A 3G6LA 1J4RA 4R5EA 3NRKA 1Y0OA 2EULA 2M1IA 4TW8A 3GU0A 4P8XA 4DRIA 4IT6A 2OFNA 1EIBA 1JNTA 3CGMA 1BL4A 3WD4A 1NWSA 4HBOA 1XHGA 2UZ5A 1J6YA 1EDQA 1LL4A 4G50A 4ODQA 3B7XA 4IPXA 2DT3A 3O5LA 2KFWA 4KQZA 3BXWA 2L2SA 2LPVA 2XPAA 1FAPA 1FFRA 2F2DA 3ARVA 4LGXA 4WK9A 4MSPA 1WNOA 3O5IA 3QOKA 4DROA 3GPKA 1ROUA 2ZQSA 2ZR6A 2LGOA 3RFWA 4ODMA 4Z2JA 2QF8A 2PV3A 2XP4A 4ODNA 1C9HA 1T11A 2FAPA 4ODPA 3AS1A 4U84A 1P5QA 5D75A 4Z2LA 1D6OA 2PBCA 2LJ4A 1FFQA 3RMEA 4ODKA 3RM4A 4MNJA 1LL6A 2MLXA 3CH9A 3CHFA 3FXYA 1ZB5A 1FKRA 1D7HA 1OGBA 1W9PA 2RSEA 2XP7A 4ZPVR 2MLZA 4W9OA 1HXVA 2ITKA 4UDMA 2YBTA 4R0XA 3WQWA 1YW5A 1ZU8A 3UI6A 4DRMA 1GUVA 2F23A 2N87A 2F4EA 1GOIA 4DZ3A 1VF8A 1F8AB 4MNMA 3O5GA 2M08A 2ZQTA 1HKIA 2XPBA 2YBUA 4P8WA 5DIVA 3UI4A 1ZBVA 2A3CA 4WKFA 3JXVA 1IX5A 1EHNA 1FKHA 1FKKA 4ODLA 1PINA 1FKBA 2VN1A 3O5QA 3PR9A 4C02B 1FKTA 1TFVA 3WD1A 3KADA 1EQ3A 2DT2A 3O5JA 1A7XA 4HARA 2DSUA 5HW8A 2B31A 3CHDA 4TW7A 3O5MA 3ARPA 1FKJA 3TDBA 3ALFA 2FKEA 3AS2A 3ALGA 3MDYB 1SYTA 3WL1A 3CHCA 4DZ2A 2DT0A 2F21A 2ZR4A 3W4RA 1CTNA 4G2PA 4NNRA 3ARWA 1HJWA 4L72B 4QT2A 4DRQA 4TYOA 4U85A 1FKLA 3CGNA 5DIUA 2VCDA 1OGGA 1QZ2A 3B8SA 4J4NA 3EIPA 4ZPTR 3ARYA 1JNEA 2JZVA 4QZVB 1FD9A 3ARSA 3WQVA 4DH0A 3TCZA 3O5KA 5HW7A 4LAWA 4J4OA 1E6RA 3UF8A 1NSGA 1LG1A 3ARRA 5I98A 2PV1A 3ARTA 1QPLA 4DWSA 1OWQA 1W1VA 2PPNA 3I6CA 1J4IA 1E6PA 4NZCA 2WLZA 1ZBKA 5HWBA 1NMVA 2LKNA 5HWCA 1LJYA 5GPRA 5HBFA 4ITZA 2MLYA 5JH8A 2A3AA 3KACA 2XP8A 3O5DA 1NWUA 1HKMA 2M2AA 3ODKA 3NTPA 1L1PA 4DWSC 4WKHA 3ARUA 1FKDA 1N1AA 2O92A 3O5RA 1E44A 3LUOA 4W9QA 2KO7A 1M5YA 2DT1A 5GPGA 3PRBA 1E9LA 4IQ2A 3IKDA 1HKKA 1NWRA 3FY1A 4IQCA 1KT0A 3WD3A 3IHZA 4MPKA 4U86A 4JFKA 3KAFA 1W1PA
chains in the Genus database with same CATH topology
3KAIA 4HBEA 1E15A 1D7JA 5J6EA 1Q6IA 2D9FA 3KAHA 3PRDA 2MF9A 4ODRA 4QT3A 4Z2IA 1JNDA 4S3KA 3JYMA 4WIWA 5HTGA 3FAPA 1HJXA 2DSWA 4Q7NA 4MAVA 3WH0A 1KT1A 1NWTA 4NSBA 2A3BA 1HKJA 5HT1A 1KFWA 4N19A 1LL7A 4JYSA 1D7IA 2RQSA 3KABA 2K8IA 4O2TA 2O9OA 4Q22A 1Q1CA 2A3EA 2WM0A 1W26A 3ARXA 4Z2GA 3RM8A 5HKGA 1E6ZA 1H0IA 1Q6UA 1ZCNA 2RUCA 2DPEA 4GGQA 3WKZA 1O6IA 1ZBWA 2OLHA 4P8UA 1J4HA 3UQBA 2PV2A 4ML4A 4WKAA 1FKGA 2AOSA 1W1YA 3UQAA 1X6NA 3PA7A 4DWSB 4ZPWR 4DRNA 1RD6A 1NMWA 2ZR5A 2IUZA 1EYMA 4W9PA 3UQIA 4DWSD 1YATA 4IT4A 1PBKA 3NI6A 3WIJA 1ITXA 1ROTA 2WLYA 1UR8A 2XP9A 5B8IC 2MPHA 1HJVA 1D2KA 3O5FA 4QIBA 4TNSA 3WL0A 1WAWA 1FKSA 1FKFA 2RUDA 4FN2A 4LAXA 4Z2KA 1E6NA 2DSZA 4LAVA 4GIVA 4FAPA 3IK8A 1ZBCA 2RUQA 3ARQA 1QPFA 3H9RB 1XRVA 3B9EA 4AY1A 2PPOA 2KE0A 1ZK6A 4PTMA 3B9AA 4L3NA 2XP6A 2XP3A 4MTVA 4Z2HA 3IKGA 4DT4A 3ARZA 2DG9A 5DO2A 4TW6A 3O5OA 3KZ7A 1SR0A 5GQBA 1W9UA 5BXJA 4JFMA 1JNSA 4MNKA 3AQUA 3AS0A 2DG4A 3KAGA 2WK2A 4S3JA 2Q5AA 3OOBA 3AROA 3CHEA 4ZS6A 4W5UA 2FDMA 2PPPA 1F40A 1BKFA 4DRHA 2DSVA 3B9DA 3RM9A 3PRAA 5DITA 3TC5A 1U79A 2DG3A 1UR9A 5HW6A 3O5PA 3JYJA 1GPFA 2KI3A 2MNTA 3AS3A 3CZ8A 2Y78A 1R9HA 2XP5A 1JVWA 5HUAA 1FJDA 4JFIA 4ODOA 3G6MA 4LAYA 4JFJA 4JFLA 3RGCA 2IF4A 3WD0A 4TX0A 4DRJA 1NH6A 1WB0A 1LG2A 3O5EA 2KR7A 4KR0B 1TCOC 1W1TA 2KGJA 1ZL1A 5DF0A 3KCEA 4DRKA 4WJXA 4BF8A 1FKIA 2ZQUA 2G8ZA 4MNLA 2ZQVA 5DEZA 3OA5A 1K9TA 1LQ0A 4DIPA 3EY6A 1H0GA 4XAKA 2PI6A 2ESCA 2RURA 4DRPA 1X6LA 2AWGA 2G41A 4P8VA 1Q6HA 1W9VA 1B6CA 3VAWA 3WD2A 4MGVA 4URIA 3UI5A 3G6LA 1J4RA 4R5EA 3NRKA 1Y0OA 2M1IA 4TW8A 4P8XA 4DRIA 4IT6A 2OFNA 1EIBA 1JNTA 3CGMA 1BL4A 3WD4A 1NWSA 4HBOA 1XHGA 2UZ5A 1J6YA 1EDQA 1LL4A 4G50A 4ODQA 3B7XA 4IPXA 2DT3A 3O5LA 2KFWA 4KQZA 3BXWA 2L2SA 2LPVA 2XPAA 1FAPA 1FFRA 2F2DA 3ARVA 4LGXA 4WK9A 4MSPA 1WNOA 3O5IA 3QOKA 4DROA 3GPKA 1ROUA 2ZQSA 2ZR6A 2LGOA 3RFWA 4ODMA 4Z2JA 2QF8A 2PV3A 2XP4A 4ODNA 1C9HA 1T11A 2FAPA 4ODPA 3AS1A 4U84A 1P5QA 5D75A 4Z2LA 1D6OA 2PBCA 2LJ4A 1FFQA 3RMEA 4ODKA 3RM4A 4MNJA 1LL6A 2MLXA 3CH9A 3CHFA 3FXYA 1ZB5A 1FKRA 1D7HA 1OGBA 1W9PA 2RSEA 2XP7A 4ZPVR 2MLZA 4W9OA 1HXVA 2ITKA 2YBTA 4R0XA 3WQWA 1YW5A 1ZU8A 3UI6A 4DRMA 1GUVA 2N87A 2F4EA 1GOIA 4DZ3A 1VF8A 1F8AB 4MNMA 3O5GA 2M08A 2ZQTA 1HKIA 2XPBA 2YBUA 4P8WA 5DIVA 3UI4A 1ZBVA 2A3CA 4WKFA 3JXVA 1IX5A 1EHNA 1FKHA 1FKKA 4ODLA 1PINA 1FKBA 2VN1A 3O5QA 3PR9A 4C02B 1FKTA 1TFVA 3WD1A 3KADA 1EQ3A 2DT2A 3O5JA 1A7XA 4HARA 2DSUA 5HW8A 2B31A 3CHDA 4TW7A 3O5MA 3ARPA 1FKJA 3TDBA 3ALFA 2FKEA 3AS2A 3ALGA 3MDYB 1SYTA 3WL1A 3CHCA 4DZ2A 2DT0A 2F21A 2ZR4A 3W4RA 1CTNA 4G2PA 4NNRA 3ARWA 1HJWA 4L72B 4QT2A 4DRQA 4TYOA 4U85A 1FKLA 3CGNA 5DIUA 2VCDA 1OGGA 1QZ2A 3B8SA 4J4NA 4ZPTR 3ARYA 1JNEA 2JZVA 4QZVB 1FD9A 3ARSA 3WQVA 4DH0A 3TCZA 3O5KA 5HW7A 4LAWA 4J4OA 1E6RA 3UF8A 1NSGA 1LG1A 3ARRA 5I98A 2PV1A 3ARTA 1QPLA 4DWSA 1OWQA 1W1VA 2PPNA 3I6CA 1J4IA 1E6PA 4NZCA 2WLZA 1ZBKA 5HWBA 1NMVA 2LKNA 5HWCA 1LJYA 5GPRA 5HBFA 4ITZA 2MLYA 5JH8A 2A3AA 3KACA 2XP8A 3O5DA 1NWUA 1HKMA 2M2AA 3ODKA 3NTPA 1L1PA 4DWSC 4WKHA 3ARUA 1FKDA 1N1AA 2O92A 3O5RA 3LUOA 4W9QA 2KO7A 1M5YA 2DT1A 5GPGA 3PRBA 1E9LA 4IQ2A 3IKDA 1HKKA 1NWRA 3FY1A 4IQCA 1KT0A 3WD3A 3IHZA 4MPKA 4U86A 4JFKA 3KAFA 1W1PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EQ3 A;  2UZ5 A;  1A7X A;  3KAI A;  3KZ7 A;  3O5J A;  1J6Y A;  1D7J A;  4G50 A;  4ODQ A;  5HW8 A;  3B7X A;  1Q6I A;  2D9F A;  5J6E A;  3KAH A;  4JFM A;  5BXJ A;  4IPX A;  3PRD A;  1JNS A;  2MF9 A;  4ODR A;  3O5L A;  2KFW A;  4QT3 A;  3JYM A;  5HTG A;  4TW7 A;  2DG4 A;  2L2S A;  2LPV A;  3O5M A;  2XPA A;  3KAG A;  1FKJ A;  3TDB A;  3FAP A;  2FKE A;  2Q5A A;  3OOB A;  3MDY B;  3WH0 A;  1KT1 A;  1FAP A;  2F2D A;  4DZ2 A;  2F21 A;  2ZR4 A;  5HT1 A;  4G2P A;  4N19 A;  2PPP A;  4JYS A;  1F40 A;  4MSP A;  1D7I A;  4NNR A;  3O5I A;  1BKF A;  2RQS A;  4DRH A;  4DRO A;  3GPK A;  3KAB A;  4QT2 A;  1ROU A;  2ZQS A;  2ZR6 A;  1FKL A;  3CGN A;  4TYO A;  2K8I A;  2LGO A;  2VCD A;  4U85 A;  1QZ2 A;  4O2T A;  4J4N A;  1Q1C A;  3RFW A;  4ODM A;  5DIT A;  2PV3 A;  3TC5 A;  2XP4 A;  1U79 A;  2DG3 A;  4ODN A;  1C9H A;  1T11 A;  1W26 A;  2FAP A;  4ODP A;  4U84 A;  5HW6 A;  2JZV A;  1P5Q A;  3JYJ A;  3O5P A;  5HKG A;  1FD9 A;  1Q6U A;  2KI3 A;  2MNT A;  1ZCN A;  5D75 A;  1D6O A;  2PBC A;  2RUC A;  2LJ4 A;  4GGQ A;  4DH0 A;  4ODK A;  2Y78 A;  3TCZ A;  1R9H A;  3O5K A;  2XP5 A;  1JVW A;  1J4H A;  4LAW A;  5HW7 A;  4JFI A;  2PV2 A;  5HUA A;  3UQB A;  1FJD A;  4J4O A;  2MLX A;  4ODO A;  3UF8 A;  1FKG A;  1FKR A;  4LAY A;  3UQA A;  1NSG A;  5I98 A;  1D7H A;  2PV1 A;  4JFJ A;  3PA7 A;  4JFL A;  3RGC A;  2IF4 A;  2RSE A;  1QPL A;  2XP7 A;  4DRN A;  4TX0 A;  4DRJ A;  1NMW A;  2MLZ A;  4W9O A;  2ZR5 A;  1HXV A;  1EYM A;  2ITK A;  4W9P A;  3UQI A;  4R0X A;  1YAT A;  2PPN A;  3I6C A;  2KR7 A;  3O5E A;  1TCO C;  1J4I A;  1PBK A;  1YW5 A;  3NI6 A;  1ROT A;  2KGJ A;  3UI6 A;  4DRQ A;  5HWB A;  4DRM A;  1NMV A;  2LKN A;  2N87 A;  2F4E A;  2XP9 A;  3KCE A;  4DRK A;  5HWC A;  5DIU A;  5B8I C;  4BF8 A;  4DZ3 A;  4ITZ A;  1FKI A;  2MPH A;  2MLY A;  2ZQU A;  1F8A B;  3O5G A;  2M08 A;  3O5F A;  4QIB A;  4TNS A;  2ZQV A;  3KAC A;  2XP8 A;  3O5D A;  2ZQT A;  2M2A A;  3ODK A;  3NTP A;  4DIP A;  1FKS A;  2XPB A;  3EY6 A;  1L1P A;  1FKF A;  2RUD A;  4FN2 A;  4LAX A;  5DIV A;  3UI4 A;  2RUR A;  4DRP A;  2AWG A;  1FKD A;  1N1A A;  1Q6H A;  3O5R A;  1B6C A;  4LAV A;  4GIV A;  3VAW A;  4FAP A;  3IK8 A;  2RUQ A;  1QPF A;  4MGV A;  3JXV A;  3LUO A;  3H9R B;  2PPO A;  4W9Q A;  2KE0 A;  2KO7 A;  1ZK6 A;  1M5Y A;  5GPG A;  3UI5 A;  1J4R A;  1FKH A;  3NRK A;  3PRB A;  1Y0O A;  2M1I A;  1FKK A;  4IQ2 A;  2XP6 A;  4ODL A;  1PIN A;  4TW8 A;  3IKD A;  2XP3 A;  4IQC A;  1FKB A;  1KT0 A;  2VN1 A;  3IKG A;  3O5Q A;  2OFN A;  4DRI A;  3IHZ A;  1JNT A;  3CGM A;  4DT4 A;  1BL4 A;  4C02 B;  4U86 A;  2DG9 A;  1FKT A;  4TW6 A;  4JFK A;  3KAF A;  3O5O A;  3KAD A; 
#chains in the Genus database with same CATH topology
 3KAI A;  4HBE A;  1E15 A;  1D7J A;  5J6E A;  1Q6I A;  2D9F A;  3KAH A;  3PRD A;  2MF9 A;  4ODR A;  4QT3 A;  4Z2I A;  1JND A;  4S3K A;  3JYM A;  4WIW A;  5HTG A;  3FAP A;  1HJX A;  2DSW A;  4Q7N A;  4MAV A;  3WH0 A;  2B5U B;  1KT1 A;  1NWT A;  4NSB A;  2A3B A;  1HKJ A;  2ETN A;  5HT1 A;  1KFW A;  4N19 A;  1LL7 A;  4JYS A;  1D7I A;  2RQS A;  3KAB A;  2K8I A;  4O2T A;  2O9O A;  4Q22 A;  1Q1C A;  2A3E A;  2WM0 A;  1W26 A;  3ARX A;  4Z2G A;  3RM8 A;  5HKG A;  1E6Z A;  1H0I A;  1Q6U A;  1ZCN A;  2RUC A;  2DPE A;  4GGQ A;  3WKZ A;  1O6I A;  1ZBW A;  2OLH A;  4P8U A;  1J4H A;  3UQB A;  2PV2 A;  4ML4 A;  4WKA A;  1FKG A;  2AOS A;  1W1Y A;  3UQA A;  1X6N A;  3PA7 A;  4DWS B;  4ZPW R;  4DRN A;  1RD6 A;  1NMW A;  2ZR5 A;  2IUZ A;  1EYM A;  4W9P A;  3UQI A;  4DWS D;  1YAT A;  4IT4 A;  1PBK A;  3NI6 A;  3WIJ A;  1ITX A;  1JCH B;  1ROT A;  2WLY A;  1UR8 A;  2XP9 A;  5B8I C;  2MPH A;  1HJV A;  1D2K A;  3O5F A;  4QIB A;  4TNS A;  3WL0 A;  1WAW A;  1FKS A;  1FKF A;  2RUD A;  4FN2 A;  4LAX A;  4Z2K A;  3BMB A;  3GTY X;  1E6N A;  2DSZ A;  4LAV A;  4GIV A;  4FAP A;  3IK8 A;  1ZBC A;  2RUQ A;  3ARQ A;  1QPF A;  3H9R B;  1XRV A;  3B9E A;  4AY1 A;  2PPO A;  2P4V A;  2KE0 A;  1ZK6 A;  4PTM A;  3B9A A;  4L3N A;  2XP6 A;  2XP3 A;  4MTV A;  4Z2H A;  3IKG A;  4DT4 A;  3ARZ A;  2DG9 A;  5DO2 A;  4TW6 A;  3O5O A;  3KZ7 A;  1SR0 A;  5GQB A;  1W9U A;  5BXJ A;  4JFM A;  1JNS A;  4MNK A;  3AQU A;  3AS0 A;  2DG4 A;  3KAG A;  1GRJ A;  2WK2 A;  4S3J A;  2Q5A A;  3OOB A;  3ARO A;  3CHE A;  4ZS6 A;  4W5U A;  2FDM A;  2PPP A;  1F40 A;  1BKF A;  4DRH A;  2DSV A;  3B9D A;  3RM9 A;  3PRA A;  5DIT A;  3TC5 A;  1U79 A;  2DG3 A;  1UR9 A;  5HW6 A;  3O5P A;  3JYJ A;  1GPF A;  2KI3 A;  2MNT A;  3AS3 A;  3CZ8 A;  2Y78 A;  1R9H A;  2XP5 A;  1JVW A;  5HUA A;  1FJD A;  4JFI A;  4ODO A;  3G6M A;  4LAY A;  2PN0 A;  4JFJ A;  4JFL A;  3RGC A;  2IF4 A;  3WD0 A;  4TX0 A;  4DRJ A;  1NH6 A;  1WB0 A;  1LG2 A;  3O5E A;  2KR7 A;  4KR0 B;  1TCO C;  1W1T A;  2KGJ A;  1ZL1 A;  5DF0 A;  3KCE A;  4DRK A;  4WJX A;  4BF8 A;  1FKI A;  2ZQU A;  2G8Z A;  4MNL A;  2ZQV A;  5DEZ A;  3OA5 A;  1K9T A;  1LQ0 A;  4DIP A;  3EY6 A;  1H0G A;  4XAK A;  2PI6 A;  2ESC A;  2RUR A;  4DRP A;  1X6L A;  2AWG A;  2G41 A;  4P8V A;  1Q6H A;  1W9V A;  1B6C A;  3VAW A;  3WD2 A;  4MGV A;  4URI A;  3UI5 A;  3G6L A;  1J4R A;  4R5E A;  3NRK A;  1Y0O A;  2EUL A;  2M1I A;  4TW8 A;  3GU0 A;  4P8X A;  4DRI A;  4IT6 A;  2OFN A;  1EIB A;  1JNT A;  3CGM A;  1BL4 A;  3WD4 A;  1NWS A;  4HBO A;  1XHG A;  2UZ5 A;  1J6Y A;  1EDQ A;  1LL4 A;  4G50 A;  4ODQ A;  3B7X A;  4IPX A;  2DT3 A;  3O5L A;  2KFW A;  4KQZ A;  3BXW A;  2L2S A;  2LPV A;  2XPA A;  1FAP A;  1FFR A;  2F2D A;  3ARV A;  4LGX A;  4WK9 A;  4MSP A;  1WNO A;  3O5I A;  3QOK A;  4DRO A;  3GPK A;  1ROU A;  2ZQS A;  2ZR6 A;  2LGO A;  3RFW A;  4ODM A;  4Z2J A;  2QF8 A;  2PV3 A;  2XP4 A;  4ODN A;  1C9H A;  1T11 A;  2FAP A;  4ODP A;  3AS1 A;  4U84 A;  1P5Q A;  5D75 A;  4Z2L A;  1D6O A;  2PBC A;  2LJ4 A;  1FFQ A;  3RME A;  4ODK A;  3RM4 A;  4MNJ A;  1LL6 A;  2MLX A;  3CH9 A;  3CHF A;  3FXY A;  1ZB5 A;  1FKR A;  1D7H A;  1OGB A;  1W9P A;  2RSE A;  2XP7 A;  4ZPV R;  2MLZ A;  4W9O A;  1HXV A;  2ITK A;  4UDM A;  2YBT A;  4R0X A;  3WQW A;  1YW5 A;  1ZU8 A;  3UI6 A;  4DRM A;  1GUV A;  2F23 A;  2N87 A;  2F4E A;  1GOI A;  4DZ3 A;  1VF8 A;  1F8A B;  4MNM A;  3O5G A;  2M08 A;  2ZQT A;  1HKI A;  2XPB A;  2YBU A;  4P8W A;  5DIV A;  3UI4 A;  1ZBV A;  2A3C A;  4WKF A;  3JXV A;  1IX5 A;  1EHN A;  1FKH A;  1FKK A;  4ODL A;  1PIN A;  1FKB A;  2VN1 A;  3O5Q A;  3PR9 A;  4C02 B;  1FKT A;  1TFV A;  3WD1 A;  3KAD A;  1EQ3 A;  2DT2 A;  3O5J A;  1A7X A;  4HAR A;  2DSU A;  5HW8 A;  2B31 A;  3CHD A;  4TW7 A;  3O5M A;  3ARP A;  1FKJ A;  3TDB A;  3ALF A;  2FKE A;  3AS2 A;  3ALG A;  3MDY B;  1SYT A;  3WL1 A;  3CHC A;  4DZ2 A;  2DT0 A;  2F21 A;  2ZR4 A;  3W4R A;  1CTN A;  4G2P A;  4NNR A;  3ARW A;  1HJW A;  4L72 B;  4QT2 A;  4DRQ A;  4TYO A;  4U85 A;  1FKL A;  3CGN A;  5DIU A;  2VCD A;  1OGG A;  1QZ2 A;  3B8S A;  4J4N A;  3EIP A;  4ZPT R;  3ARY A;  1JNE A;  2JZV A;  4QZV B;  1FD9 A;  3ARS A;  3WQV A;  4DH0 A;  3TCZ A;  3O5K A;  5HW7 A;  4LAW A;  4J4O A;  1E6R A;  3UF8 A;  1NSG A;  1LG1 A;  3ARR A;  5I98 A;  2PV1 A;  3ART A;  1QPL A;  4DWS A;  1OWQ A;  1W1V A;  2PPN A;  3I6C A;  1J4I A;  1E6P A;  4NZC A;  2WLZ A;  1ZBK A;  5HWB A;  1NMV A;  2LKN A;  5HWC A;  1LJY A;  5GPR A;  5HBF A;  4ITZ A;  2MLY A;  5JH8 A;  2A3A A;  3KAC A;  2XP8 A;  3O5D A;  1NWU A;  1HKM A;  2M2A A;  3ODK A;  3NTP A;  1L1P A;  4DWS C;  4WKH A;  3ARU A;  1FKD A;  1N1A A;  2O92 A;  3O5R A;  1E44 A;  3LUO A;  4W9Q A;  2KO7 A;  1M5Y A;  2DT1 A;  5GPG A;  3PRB A;  1E9L A;  4IQ2 A;  3IKD A;  1HKK A;  1NWR A;  3FY1 A;  4IQC A;  1KT0 A;  3WD3 A;  3IHZ A;  4MPK A;  4U86 A;  4JFK A;  3KAF A;  1W1P A; 
#chains in the Genus database with same CATH homology
 3KAI A;  4HBE A;  1E15 A;  1D7J A;  5J6E A;  1Q6I A;  2D9F A;  3KAH A;  3PRD A;  2MF9 A;  4ODR A;  4QT3 A;  4Z2I A;  1JND A;  4S3K A;  3JYM A;  4WIW A;  5HTG A;  3FAP A;  1HJX A;  2DSW A;  4Q7N A;  4MAV A;  3WH0 A;  1KT1 A;  1NWT A;  4NSB A;  2A3B A;  1HKJ A;  5HT1 A;  1KFW A;  4N19 A;  1LL7 A;  4JYS A;  1D7I A;  2RQS A;  3KAB A;  2K8I A;  4O2T A;  2O9O A;  4Q22 A;  1Q1C A;  2A3E A;  2WM0 A;  1W26 A;  3ARX A;  4Z2G A;  3RM8 A;  5HKG A;  1E6Z A;  1H0I A;  1Q6U A;  1ZCN A;  2RUC A;  2DPE A;  4GGQ A;  3WKZ A;  1O6I A;  1ZBW A;  2OLH A;  4P8U A;  1J4H A;  3UQB A;  2PV2 A;  4ML4 A;  4WKA A;  1FKG A;  2AOS A;  1W1Y A;  3UQA A;  1X6N A;  3PA7 A;  4DWS B;  4ZPW R;  4DRN A;  1RD6 A;  1NMW A;  2ZR5 A;  2IUZ A;  1EYM A;  4W9P A;  3UQI A;  4DWS D;  1YAT A;  4IT4 A;  1PBK A;  3NI6 A;  3WIJ A;  1ITX A;  1ROT A;  2WLY A;  1UR8 A;  2XP9 A;  5B8I C;  2MPH A;  1HJV A;  1D2K A;  3O5F A;  4QIB A;  4TNS A;  3WL0 A;  1WAW A;  1FKS A;  1FKF A;  2RUD A;  4FN2 A;  4LAX A;  4Z2K A;  1E6N A;  2DSZ A;  4LAV A;  4GIV A;  4FAP A;  3IK8 A;  1ZBC A;  2RUQ A;  3ARQ A;  1QPF A;  3H9R B;  1XRV A;  3B9E A;  4AY1 A;  2PPO A;  2KE0 A;  1ZK6 A;  4PTM A;  3B9A A;  4L3N A;  2XP6 A;  2XP3 A;  4MTV A;  4Z2H A;  3IKG A;  4DT4 A;  3ARZ A;  2DG9 A;  5DO2 A;  4TW6 A;  3O5O A;  3KZ7 A;  1SR0 A;  5GQB A;  1W9U A;  5BXJ A;  4JFM A;  1JNS A;  4MNK A;  3AQU A;  3AS0 A;  2DG4 A;  3KAG A;  2WK2 A;  4S3J A;  2Q5A A;  3OOB A;  3ARO A;  3CHE A;  4ZS6 A;  4W5U A;  2FDM A;  2PPP A;  1F40 A;  1BKF A;  4DRH A;  2DSV A;  3B9D A;  3RM9 A;  3PRA A;  5DIT A;  3TC5 A;  1U79 A;  2DG3 A;  1UR9 A;  5HW6 A;  3O5P A;  3JYJ A;  1GPF A;  2KI3 A;  2MNT A;  3AS3 A;  3CZ8 A;  2Y78 A;  1R9H A;  2XP5 A;  1JVW A;  5HUA A;  1FJD A;  4JFI A;  4ODO A;  3G6M A;  4LAY A;  4JFJ A;  4JFL A;  3RGC A;  2IF4 A;  3WD0 A;  4TX0 A;  4DRJ A;  1NH6 A;  1WB0 A;  1LG2 A;  3O5E A;  2KR7 A;  4KR0 B;  1TCO C;  1W1T A;  2KGJ A;  1ZL1 A;  5DF0 A;  3KCE A;  4DRK A;  4WJX A;  4BF8 A;  1FKI A;  2ZQU A;  2G8Z A;  4MNL A;  2ZQV A;  5DEZ A;  3OA5 A;  1K9T A;  1LQ0 A;  4DIP A;  3EY6 A;  1H0G A;  4XAK A;  2PI6 A;  2ESC A;  2RUR A;  4DRP A;  1X6L A;  2AWG A;  2G41 A;  4P8V A;  1Q6H A;  1W9V A;  1B6C A;  3VAW A;  3WD2 A;  4MGV A;  4URI A;  3UI5 A;  3G6L A;  1J4R A;  4R5E A;  3NRK A;  1Y0O A;  2M1I A;  4TW8 A;  4P8X A;  4DRI A;  4IT6 A;  2OFN A;  1EIB A;  1JNT A;  3CGM A;  1BL4 A;  3WD4 A;  1NWS A;  4HBO A;  1XHG A;  2UZ5 A;  1J6Y A;  1EDQ A;  1LL4 A;  4G50 A;  4ODQ A;  3B7X A;  4IPX A;  2DT3 A;  3O5L A;  2KFW A;  4KQZ A;  3BXW A;  2L2S A;  2LPV A;  2XPA A;  1FAP A;  1FFR A;  2F2D A;  3ARV A;  4LGX A;  4WK9 A;  4MSP A;  1WNO A;  3O5I A;  3QOK A;  4DRO A;  3GPK A;  1ROU A;  2ZQS A;  2ZR6 A;  2LGO A;  3RFW A;  4ODM A;  4Z2J A;  2QF8 A;  2PV3 A;  2XP4 A;  4ODN A;  1C9H A;  1T11 A;  2FAP A;  4ODP A;  3AS1 A;  4U84 A;  1P5Q A;  5D75 A;  4Z2L A;  1D6O A;  2PBC A;  2LJ4 A;  1FFQ A;  3RME A;  4ODK A;  3RM4 A;  4MNJ A;  1LL6 A;  2MLX A;  3CH9 A;  3CHF A;  3FXY A;  1ZB5 A;  1FKR A;  1D7H A;  1OGB A;  1W9P A;  2RSE A;  2XP7 A;  4ZPV R;  2MLZ A;  4W9O A;  1HXV A;  2ITK A;  2YBT A;  4R0X A;  3WQW A;  1YW5 A;  1ZU8 A;  3UI6 A;  4DRM A;  1GUV A;  2N87 A;  2F4E A;  1GOI A;  4DZ3 A;  1VF8 A;  1F8A B;  4MNM A;  3O5G A;  2M08 A;  2ZQT A;  1HKI A;  2XPB A;  2YBU A;  4P8W A;  5DIV A;  3UI4 A;  1ZBV A;  2A3C A;  4WKF A;  3JXV A;  1IX5 A;  1EHN A;  1FKH A;  1FKK A;  4ODL A;  1PIN A;  1FKB A;  2VN1 A;  3O5Q A;  3PR9 A;  4C02 B;  1FKT A;  1TFV A;  3WD1 A;  3KAD A;  1EQ3 A;  2DT2 A;  3O5J A;  1A7X A;  4HAR A;  2DSU A;  5HW8 A;  2B31 A;  3CHD A;  4TW7 A;  3O5M A;  3ARP A;  1FKJ A;  3TDB A;  3ALF A;  2FKE A;  3AS2 A;  3ALG A;  3MDY B;  1SYT A;  3WL1 A;  3CHC A;  4DZ2 A;  2DT0 A;  2F21 A;  2ZR4 A;  3W4R A;  1CTN A;  4G2P A;  4NNR A;  3ARW A;  1HJW A;  4L72 B;  4QT2 A;  4DRQ A;  4TYO A;  4U85 A;  1FKL A;  3CGN A;  5DIU A;  2VCD A;  1OGG A;  1QZ2 A;  3B8S A;  4J4N A;  4ZPT R;  3ARY A;  1JNE A;  2JZV A;  4QZV B;  1FD9 A;  3ARS A;  3WQV A;  4DH0 A;  3TCZ A;  3O5K A;  5HW7 A;  4LAW A;  4J4O A;  1E6R A;  3UF8 A;  1NSG A;  1LG1 A;  3ARR A;  5I98 A;  2PV1 A;  3ART A;  1QPL A;  4DWS A;  1OWQ A;  1W1V A;  2PPN A;  3I6C A;  1J4I A;  1E6P A;  4NZC A;  2WLZ A;  1ZBK A;  5HWB A;  1NMV A;  2LKN A;  5HWC A;  1LJY A;  5GPR A;  5HBF A;  4ITZ A;  2MLY A;  5JH8 A;  2A3A A;  3KAC A;  2XP8 A;  3O5D A;  1NWU A;  1HKM A;  2M2A A;  3ODK A;  3NTP A;  1L1P A;  4DWS C;  4WKH A;  3ARU A;  1FKD A;  1N1A A;  2O92 A;  3O5R A;  3LUO A;  4W9Q A;  2KO7 A;  1M5Y A;  2DT1 A;  5GPG A;  3PRB A;  1E9L A;  4IQ2 A;  3IKD A;  1HKK A;  1NWR A;  3FY1 A;  4IQC A;  1KT0 A;  3WD3 A;  3IHZ A;  4MPK A;  4U86 A;  4JFK A;  3KAF A;  1W1P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...