4DZ2A

Crystal structure of a peptidyl-prolyl cis-trans isomerase with surface mutation r92g from burkholderia pseudomallei complexed with fk506
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
113
structure length
113
Chain Sequence
STVVTTESGLKYEDLTEGSGAEARAGQTVSVHYTGWLTDGQKFDSSKDRNDPFAFVLGGGMVIKGWDEGVQGMKVGGVRRLTIPPQLGYGAGGAGGVIPPNATLVFEVELLDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase
publication title A structural biology approach enables the development of antimicrobials targeting bacterial immunophilins.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Isomerase
total genus 25
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4dz2A00
2PV1A 2LJ4A 1J6YA 3TCZA 1ZK6A 3KABA 3UI6A 2XP6A 2XPBA 3O5IA 4ODLA 4W9QA 1FJDA 2MF9A 2M08A 2PV2A 1C9HA 4IPXA 3O5FA 3KAFA 3O5KA 3UF8A 2PPNA 4JFJA 4DROA 3NRKA 3OOBA 2RURA 4ODMA 3GPKA 2KFWA 2Y78A 2XP7A 3KAHA 4ODKA 3KCEA 2FAPA 4W9OA 1YW5A 2RUDA 4G2PA 3IK8A 1F40A 4GGQA 2KE0A 4LAVA 3JYJA 2KR7A 5B8IC 1Q6IA 1PBKA 3KAIA 1W26A 4J4NA 2MLZA 3FAPA 1B6CA 2Q5AA 2ITKA 3IKDA 4LAYA 1FKLA 1D7JA 2LPVA 1KT0A 3O5MA 1JNSA 4LAWA 1FAPA 4FN2A 4MSPA 4NNRA 1QZ2A 3B7XA 3RGCA 1JNTA 1BKFA 3O5OA 2ZQSA 3KACA 4DRPA 4TNSA 1BL4A 1R9HA 1EYMA 2KI3A 1FKIA 4FAPA 4QIBA 2MLYA 3I6CA 2AWGA 3O5PA 1M5YA 5BXJA 4DZ2A 2RUCA 1FKBA 1ZCNA 2LKNA 4O2TA 2VN1A 3O5LA 3ODKA 1T11A 1EQ3A 1FKDA 3NTPA 4R0XA 3UI5A 2ZQUA 4DRNA 1HXVA 4N19A 2PV3A 3KAGA 1FKTA 1FKSA 1NSGA 1N1AA 2DG3A 1KT1A 2LGOA 3O5GA 4LAXA 4TW7A 4DRMA 4U85A 1FKRA 2DG9A 3EY6A 5HW6A 5I98A 2L2SA 2PBCA 5GPGA 5HWBA 2XP5A 4ITZA 4J4OA 1L1PA 3JXVA 2IF4A 2F2DA 2MNTA 3KADA 3O5RA 3WH0A 4DH0A 3O5DA 4U84A 2DG4A 2RQSA 3KZ7A 1JVWA 4JYSA 1J4RA 2ZQVA 3VAWA 2JZVA 5HT1A 5HTGA 2PPPA 2VCDA 1FKGA 2ZR4A 4DIPA 4QT3A 1NMWA 2KGJA 3CGNA 5DITA 5HUAA 1Q6HA 1J4HA 5DIUA 3H9RB 4BF8A 3UQBA 4IQ2A 3PA7A 1FKKA 2ZR6A 3CGMA 4IQCA 3UQIA 1FKHA 4TW6A 2D9FA 1J4IA 4DZ3A 3LUOA 2KO7A 1Q6UA 1TCOC 4ODRA 2OFNA 4DRHA 3PRBA 3UI4A 2XP9A 1NMVA 4JFIA 1FKJA 1Y0OA 2XP4A 1FKFA 4DRJA 4DRKA 2K8IA 3O5JA 5HW8A 3IHZA 1PINA 3MDYB 4MGVA 4GIVA 4ODQA 4TX0A 4TYOA 2RUQA 1FD9A 1U79A 2ZR5A 4U86A 5HWCA 5HKGA 1QPFA 2M1IA 4JFLA 1F8AB 2ZQTA 1P5QA 4ODNA 4DRIA 1YATA 2RSEA 5HW7A 2XPAA 5J6EA 3UQAA 3PRDA 3TDBA 1QPLA 1D7IA 4JFKA 4ODPA 1ROUA 4TW8A 5DIVA 3RFWA 1Q1CA 3JYMA 4ODOA 1ROTA 2UZ5A 2XP3A 4QT2A 1D6OA 2MPHA 2MLXA 4G50A 3IKGA 4DRQA 3TC5A 4C02B 2F4EA 2XP8A 4JFMA 1D7HA 2FKEA 2N87A 3O5QA 1A7XA 2F21A 3NI6A 4DT4A 5D75A 2M2AA 3O5EA 4W9PA 2PPOA
chains in the Genus database with same CATH superfamily
1J6YA 2G8ZA 3TCZA 3CHFA 2MF9A 2PV2A 1C9HA 4WJXA 2YBUA 2G41A 4DROA 4Z2HA 3KCEA 3CHEA 2PI6A 2PN0A 4S3KA 3FAPA 1E6PA 4KR0B 4LAYA 1FFRA 5GPRA 1JNSA 4FN2A 4IT6A 4MSPA 1QZ2A 4WKAA 1ZBCA 4HARA 3WD1A 1E44A 1BKFA 3O5OA 1EDQA 1R9HA 3AS1A 1M5YA 5BXJA 4PTMA 2VN1A 3O5LA 3GU0A 4L72B 4DRNA 4ZPVR 2PV3A 3KAGA 1FKSA 4LAXA 3O5GA 4TW7A 1GUVA 1FKRA 2DG9A 3EY6A 5HW6A 5I98A 3WQWA 2PBCA 3EIPA 3JXVA 2MNTA 4XAKA 3KZ7A 1JVWA 4JYSA 1H0IA 3VAWA 2JZVA 5HT1A 2VCDA 2WLZA 5DITA 1X6NA 1EHNA 4TW6A 3G6MA 5HBFA 4ODRA 3PRBA 3UI4A 2WK2A 4MNJA 1LL6A 1GOIA 4IT4A 1FKFA 4DRJA 4DRKA 2K8IA 3IHZA 4TX0A 4Q7NA 4WK9A 2DT1A 1O6IA 1GRJA 1W9PA 4DRIA 1LL4A 1YATA 3ARTA 4WIWA 3UQAA 3PRDA 4ODPA 1NWUA 4QZVB 1ROTA 2XP3A 1EIBA 1D7HA 2FKEA 2N87A 1HKKA 1A7XA 2F21A 1OWQA 4DT4A 1K9TA 1E6RA 1W1TA 4URIA 3KABA 2ESCA 3UI6A 3O5IA 4W9QA 1H0GA 3KAFA 4JFJA 3NRKA 3CH9A 3GTYX 2DSVA 2O9OA 3GPKA 2Y78A 4DWSB 3KAHA 4ODKA 1WAWA 1YW5A 4LGXA 2KE0A 3JYJA 4NZCA 2KR7A 4J4NA 2MLZA 2B5UB 2Q5AA 2ITKA 1ZBVA 3WD4A 4ZS6A 1JCHB 1NWTA 3ARSA 4LAWA 4NNRA 3B7XA 3PR9A 4FAPA 1EYMA 3ARXA 1FKIA 4MPKA 3O5PA 2RUCA 1ZCNA 3ALGA 3ODKA 3NTPA 2ZQUA 4MTVA 3ARZA 4P8XA 4R5EA 2LGOA 1FJDA 2DPEA 1NWRA 4WKHA 3WD3A 2DSWA 3B9DA 3B9EA 2F2DA 1HKMA 4MNLA 3O5RA 5DF0A 3WH0A 4DH0A 3CZ8A 4U84A 3ARUA 1W1PA 2ZR4A 4DIPA 3ARPA 4QT3A 1NMWA 3AQUA 2KGJA 1JNEA 1E15A 3WIJA 3ARWA 5HUAA 4BF8A 3H9RB 4P8UA 3PA7A 1FKKA 1UR8A 1FKHA 1J4IA 1Q6UA 1TCOC 1W9UA 2QF8A 3ARVA 3O5JA 3G6LA 1PINA 3MDYB 4GIVA 4ODQA 1U79A 2ZQTA 1D2KA 1NWSA 1RD6A 3TDBA 1W9VA 4TW8A 1ROUA 5DIVA 4ODOA 1X6LA 4QT2A 1D6OA 2MPHA 2MLXA 1SYTA 4DRQA 4C02B 2OLHA 4JFMA 3O5QA 4MNKA 2M2AA 3UI5A 3OA5A 1ZU8A 2PV1A 2LJ4A 1ZK6A 2XP6A 2XPBA 4ODLA 4IPXA 5DO2A 3WL1A 3UF8A 3O5KA 3OOBA 4HBOA 4W5UA 4ODMA 4UDMA 3AROA 1LQ0A 4G2PA 3IK8A 5GQBA 4GGQA 4LAVA 5B8IC 1Q6IA 3KAIA 1W26A 5JH8A 1XRVA 1CTNA 3RM8A 1FKLA 1D7JA 1KT0A 3O5MA 1FAPA 4ZPTR 3RGCA 1ZBKA 1JNTA 2ZQSA 2EULA 3AS2A 1BL4A 4TNSA 2KI3A 4NSBA 3I6CA 3RM4A 3WKZA 2A3AA 3FXYA 1LJYA 1E6NA 4O2TA 1FKDA 1KT1A 4Z2LA 2L2SA 1XHGA 5HWBA 2XP5A 4J4OA 2IF4A 1LG2A 4P8WA 3KADA 3O5DA 4AY1A 1J4RA 1HKIA 2PPPA 3BMBA 2ETNA 3CGNA 1IX5A 5DIUA 4IQ2A 2ZR6A 3CGMA 3UQIA 1SR0A 3WL0A 4WKFA 1E6ZA 2OFNA 1W1YA 1HKJA 1NMVA 4JFIA 1KFWA 4P8VA 2DT0A 2XP4A 2YBTA 5HW8A 4TYOA 4U86A 2RUQA 1FD9A 5HWCA 1QPFA 2M1IA 4JFLA 4DWSC 2RSEA 5HW7A 2XPAA 5J6EA 2FDMA 4S3JA 2A3BA 1D7IA 4JFKA 3RFWA 3JYMA 2UZ5A 3ALFA 3TC5A 3B9AA 2DSZA 3NI6A 2WLYA 2F23A 3O5EA 4W9PA 2PPOA 2DT3A 2DSUA 1HJWA 1FFQA 1W1VA 4DWSD 2M08A 3O5FA 1LL7A 1ZL1A 2PPNA 2DT2A 2RURA 2KFWA 2XP7A 2FAPA 4W9OA 2A3EA 2RUDA 1F40A 3WQVA 1TFVA 4MNMA 3W4RA 1OGGA 2O92A 2WM0A 1PBKA 1B6CA 3CHCA 4Z2JA 3WD0A 1JNDA 3IKDA 2LPVA 3AS0A 3KACA 4DRPA 1GPFA 4QIBA 2MLYA 2AWGA 4MAVA 1E9LA 4DZ2A 1FKBA 2LKNA 1T11A 1EQ3A 4R0XA 1HXVA 1LG1A 1UR9A 4N19A 1FKTA 2DG3A 1NSGA 1N1AA 4HBEA 3WD2A 4Z2GA 2B31A 4DRMA 4U85A 5GPGA 4KQZA 4ITZA 1L1PA 3AS3A 4ML4A 3ARRA 3CHDA 2DG4A 1ITXA 2RQSA 4Z2KA 3BXWA 4Z2IA 2ZQVA 5HTGA 2AOSA 1FKGA 3PRAA 4ZPWR 1VF8A 1Q6HA 1J4HA 3UQBA 1ZBWA 4IQCA 1WB0A 4DZ3A 2D9FA 3LUOA 2KO7A 4DRHA 2XP9A 1FKJA 3QOKA 1Y0OA 2IUZA 1WNOA 1ZB5A 3ARYA 3RMEA 4MGVA 2A3CA 2ZR5A 3RM9A 5HKGA 1F8AB 1P5QA 4ODNA 4L3NA 1QPLA 1HJXA 4Q22A 1Q1CA 3B8SA 3ARQA 4G50A 3IKGA 2F4EA 2XP8A 1HJVA 1NH6A 3FY1A 1OGBA 2P4VA 4DWSA 5D75A 5DEZA
chains in the Genus database with same CATH topology
1J6YA 2G8ZA 3TCZA 3CHFA 2MF9A 2PV2A 1C9HA 4WJXA 2YBUA 2G41A 4DROA 4Z2HA 3KCEA 3CHEA 2PI6A 4S3KA 3FAPA 1E6PA 4KR0B 4LAYA 1FFRA 5GPRA 1JNSA 4FN2A 4IT6A 4MSPA 1QZ2A 4WKAA 1ZBCA 4HARA 3WD1A 1BKFA 3O5OA 1EDQA 1R9HA 3AS1A 1M5YA 5BXJA 4PTMA 2VN1A 3O5LA 4L72B 4DRNA 4ZPVR 2PV3A 3KAGA 1FKSA 4LAXA 3O5GA 4TW7A 1GUVA 1FKRA 2DG9A 3EY6A 5HW6A 5I98A 3WQWA 2PBCA 3JXVA 2MNTA 4XAKA 3KZ7A 1JVWA 4JYSA 1H0IA 3VAWA 2JZVA 5HT1A 2VCDA 2WLZA 5DITA 1X6NA 1EHNA 4TW6A 3G6MA 5HBFA 4ODRA 3PRBA 3UI4A 2WK2A 4MNJA 1LL6A 1GOIA 4IT4A 1FKFA 4DRJA 4DRKA 2K8IA 3IHZA 4TX0A 4Q7NA 4WK9A 2DT1A 1O6IA 1W9PA 4DRIA 1LL4A 1YATA 3ARTA 4WIWA 3UQAA 3PRDA 4ODPA 1NWUA 4QZVB 1ROTA 2XP3A 1EIBA 1D7HA 2FKEA 2N87A 1HKKA 1A7XA 2F21A 1OWQA 4DT4A 1K9TA 1E6RA 1W1TA 4URIA 3KABA 2ESCA 3UI6A 3O5IA 4W9QA 1H0GA 3KAFA 4JFJA 3NRKA 3CH9A 2DSVA 2O9OA 3GPKA 2Y78A 4DWSB 3KAHA 4ODKA 1WAWA 1YW5A 4LGXA 2KE0A 3JYJA 4NZCA 2KR7A 4J4NA 2MLZA 2Q5AA 2ITKA 1ZBVA 3WD4A 4ZS6A 1NWTA 3ARSA 4LAWA 4NNRA 3B7XA 3PR9A 4FAPA 1EYMA 3ARXA 1FKIA 4MPKA 3O5PA 2RUCA 1ZCNA 3ALGA 3ODKA 3NTPA 2ZQUA 4MTVA 3ARZA 4P8XA 4R5EA 2LGOA 1FJDA 2DPEA 1NWRA 4WKHA 3WD3A 2DSWA 3B9DA 3B9EA 2F2DA 1HKMA 4MNLA 3O5RA 5DF0A 3WH0A 4DH0A 3CZ8A 4U84A 3ARUA 1W1PA 2ZR4A 4DIPA 3ARPA 4QT3A 1NMWA 3AQUA 2KGJA 1JNEA 1E15A 3WIJA 3ARWA 5HUAA 4BF8A 3H9RB 4P8UA 3PA7A 1FKKA 1UR8A 1FKHA 1J4IA 1Q6UA 1TCOC 1W9UA 2QF8A 3ARVA 3O5JA 3G6LA 1PINA 3MDYB 4GIVA 4ODQA 1U79A 2ZQTA 1D2KA 1NWSA 1RD6A 3TDBA 1W9VA 4TW8A 1ROUA 5DIVA 4ODOA 1X6LA 4QT2A 1D6OA 2MPHA 2MLXA 1SYTA 4DRQA 4C02B 2OLHA 4JFMA 3O5QA 4MNKA 2M2AA 3UI5A 3OA5A 1ZU8A 2PV1A 2LJ4A 1ZK6A 2XP6A 2XPBA 4ODLA 4IPXA 5DO2A 3WL1A 3UF8A 3O5KA 3OOBA 4HBOA 4W5UA 4ODMA 3AROA 1LQ0A 4G2PA 3IK8A 5GQBA 4GGQA 4LAVA 5B8IC 1Q6IA 3KAIA 1W26A 5JH8A 1XRVA 1CTNA 3RM8A 1FKLA 1D7JA 1KT0A 3O5MA 1FAPA 4ZPTR 3RGCA 1ZBKA 1JNTA 2ZQSA 3AS2A 1BL4A 4TNSA 2KI3A 4NSBA 3I6CA 3RM4A 3WKZA 2A3AA 3FXYA 1LJYA 1E6NA 4O2TA 1FKDA 1KT1A 4Z2LA 2L2SA 1XHGA 5HWBA 2XP5A 4J4OA 2IF4A 1LG2A 4P8WA 3KADA 3O5DA 4AY1A 1J4RA 1HKIA 2PPPA 3CGNA 1IX5A 5DIUA 4IQ2A 2ZR6A 3CGMA 3UQIA 1SR0A 3WL0A 4WKFA 1E6ZA 2OFNA 1W1YA 1HKJA 1NMVA 4JFIA 1KFWA 4P8VA 2DT0A 2XP4A 2YBTA 5HW8A 4TYOA 4U86A 2RUQA 1FD9A 5HWCA 1QPFA 2M1IA 4JFLA 4DWSC 2RSEA 5HW7A 2XPAA 5J6EA 2FDMA 4S3JA 2A3BA 1D7IA 4JFKA 3RFWA 3JYMA 2UZ5A 3ALFA 3TC5A 3B9AA 2DSZA 3NI6A 2WLYA 3O5EA 4W9PA 2PPOA 2DT3A 2DSUA 1HJWA 1FFQA 1W1VA 4DWSD 2M08A 3O5FA 1LL7A 1ZL1A 2PPNA 2DT2A 2RURA 2KFWA 2XP7A 2FAPA 4W9OA 2A3EA 2RUDA 1F40A 3WQVA 1TFVA 4MNMA 3W4RA 1OGGA 2O92A 2WM0A 1PBKA 1B6CA 3CHCA 4Z2JA 3WD0A 1JNDA 3IKDA 2LPVA 3AS0A 3KACA 4DRPA 1GPFA 4QIBA 2MLYA 2AWGA 4MAVA 1E9LA 4DZ2A 1FKBA 2LKNA 1T11A 1EQ3A 4R0XA 1HXVA 1LG1A 1UR9A 4N19A 1FKTA 2DG3A 1NSGA 1N1AA 4HBEA 3WD2A 4Z2GA 2B31A 4DRMA 4U85A 5GPGA 4KQZA 4ITZA 1L1PA 3AS3A 4ML4A 3ARRA 3CHDA 2DG4A 1ITXA 2RQSA 4Z2KA 3BXWA 4Z2IA 2ZQVA 5HTGA 2AOSA 1FKGA 3PRAA 4ZPWR 1VF8A 1Q6HA 1J4HA 3UQBA 1ZBWA 4IQCA 1WB0A 4DZ3A 2D9FA 3LUOA 2KO7A 4DRHA 2XP9A 1FKJA 3QOKA 1Y0OA 2IUZA 1WNOA 1ZB5A 3ARYA 3RMEA 4MGVA 2A3CA 2ZR5A 3RM9A 5HKGA 1F8AB 1P5QA 4ODNA 4L3NA 1QPLA 1HJXA 4Q22A 1Q1CA 3B8SA 3ARQA 4G50A 3IKGA 2F4EA 2XP8A 1HJVA 1NH6A 3FY1A 1OGBA 4DWSA 5D75A 5DEZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PV1 A;  2LJ4 A;  1J6Y A;  3TCZ A;  1ZK6 A;  3KAB A;  3UI6 A;  2XP6 A;  2XPB A;  3O5I A;  4ODL A;  4W9Q A;  1FJD A;  2MF9 A;  2M08 A;  2PV2 A;  1C9H A;  4IPX A;  3O5F A;  3KAF A;  3O5K A;  3UF8 A;  2PPN A;  4JFJ A;  4DRO A;  3NRK A;  3OOB A;  2RUR A;  4ODM A;  3GPK A;  2KFW A;  2Y78 A;  2XP7 A;  3KAH A;  4ODK A;  3KCE A;  2FAP A;  4W9O A;  1YW5 A;  2RUD A;  4G2P A;  3IK8 A;  1F40 A;  4GGQ A;  2KE0 A;  4LAV A;  3JYJ A;  2KR7 A;  5B8I C;  1Q6I A;  1PBK A;  3KAI A;  1W26 A;  4J4N A;  2MLZ A;  3FAP A;  1B6C A;  2Q5A A;  2ITK A;  3IKD A;  4LAY A;  1FKL A;  1D7J A;  2LPV A;  1KT0 A;  3O5M A;  1JNS A;  4LAW A;  1FAP A;  4FN2 A;  4MSP A;  4NNR A;  1QZ2 A;  3B7X A;  3RGC A;  1JNT A;  1BKF A;  3O5O A;  2ZQS A;  3KAC A;  4DRP A;  4TNS A;  1BL4 A;  1R9H A;  1EYM A;  2KI3 A;  1FKI A;  4FAP A;  4QIB A;  2MLY A;  3I6C A;  2AWG A;  3O5P A;  1M5Y A;  5BXJ A;  4DZ2 A;  2RUC A;  1FKB A;  1ZCN A;  2LKN A;  4O2T A;  2VN1 A;  3O5L A;  3ODK A;  1T11 A;  1EQ3 A;  1FKD A;  3NTP A;  4R0X A;  3UI5 A;  2ZQU A;  4DRN A;  1HXV A;  4N19 A;  2PV3 A;  3KAG A;  1FKT A;  1FKS A;  1NSG A;  1N1A A;  2DG3 A;  1KT1 A;  2LGO A;  3O5G A;  4LAX A;  4TW7 A;  4DRM A;  4U85 A;  1FKR A;  2DG9 A;  3EY6 A;  5HW6 A;  5I98 A;  2L2S A;  2PBC A;  5GPG A;  5HWB A;  2XP5 A;  4ITZ A;  4J4O A;  1L1P A;  3JXV A;  2IF4 A;  2F2D A;  2MNT A;  3KAD A;  3O5R A;  3WH0 A;  4DH0 A;  3O5D A;  4U84 A;  2DG4 A;  2RQS A;  3KZ7 A;  1JVW A;  4JYS A;  1J4R A;  2ZQV A;  3VAW A;  2JZV A;  5HT1 A;  5HTG A;  2PPP A;  2VCD A;  1FKG A;  2ZR4 A;  4DIP A;  4QT3 A;  1NMW A;  2KGJ A;  3CGN A;  5DIT A;  5HUA A;  1Q6H A;  1J4H A;  5DIU A;  3H9R B;  4BF8 A;  3UQB A;  4IQ2 A;  3PA7 A;  1FKK A;  2ZR6 A;  3CGM A;  4IQC A;  3UQI A;  1FKH A;  4TW6 A;  2D9F A;  1J4I A;  4DZ3 A;  3LUO A;  2KO7 A;  1Q6U A;  1TCO C;  4ODR A;  2OFN A;  4DRH A;  3PRB A;  3UI4 A;  2XP9 A;  1NMV A;  4JFI A;  1FKJ A;  1Y0O A;  2XP4 A;  1FKF A;  4DRJ A;  4DRK A;  2K8I A;  3O5J A;  5HW8 A;  3IHZ A;  1PIN A;  3MDY B;  4MGV A;  4GIV A;  4ODQ A;  4TX0 A;  4TYO A;  2RUQ A;  1FD9 A;  1U79 A;  2ZR5 A;  4U86 A;  5HWC A;  5HKG A;  1QPF A;  2M1I A;  4JFL A;  1F8A B;  2ZQT A;  1P5Q A;  4ODN A;  4DRI A;  1YAT A;  2RSE A;  5HW7 A;  2XPA A;  5J6E A;  3UQA A;  3PRD A;  3TDB A;  1QPL A;  1D7I A;  4JFK A;  4ODP A;  1ROU A;  4TW8 A;  5DIV A;  3RFW A;  1Q1C A;  3JYM A;  4ODO A;  1ROT A;  2UZ5 A;  2XP3 A;  4QT2 A;  1D6O A;  2MPH A;  2MLX A;  4G50 A;  3IKG A;  4DRQ A;  3TC5 A;  4C02 B;  2F4E A;  2XP8 A;  4JFM A;  1D7H A;  2FKE A;  2N87 A;  3O5Q A;  1A7X A;  2F21 A;  3NI6 A;  4DT4 A;  5D75 A;  2M2A A;  3O5E A;  4W9P A;  2PPO A; 
#chains in the Genus database with same CATH topology
 1J6Y A;  2G8Z A;  3TCZ A;  3CHF A;  2MF9 A;  2PV2 A;  1C9H A;  4WJX A;  2YBU A;  2G41 A;  4DRO A;  4Z2H A;  3KCE A;  3CHE A;  2PI6 A;  2PN0 A;  4S3K A;  3FAP A;  1E6P A;  4KR0 B;  4LAY A;  1FFR A;  5GPR A;  1JNS A;  4FN2 A;  4IT6 A;  4MSP A;  1QZ2 A;  4WKA A;  1ZBC A;  4HAR A;  3WD1 A;  1E44 A;  1BKF A;  3O5O A;  1EDQ A;  1R9H A;  3AS1 A;  1M5Y A;  5BXJ A;  4PTM A;  2VN1 A;  3O5L A;  3GU0 A;  4L72 B;  4DRN A;  4ZPV R;  2PV3 A;  3KAG A;  1FKS A;  4LAX A;  3O5G A;  4TW7 A;  1GUV A;  1FKR A;  2DG9 A;  3EY6 A;  5HW6 A;  5I98 A;  3WQW A;  2PBC A;  3EIP A;  3JXV A;  2MNT A;  4XAK A;  3KZ7 A;  1JVW A;  4JYS A;  1H0I A;  3VAW A;  2JZV A;  5HT1 A;  2VCD A;  2WLZ A;  5DIT A;  1X6N A;  1EHN A;  4TW6 A;  3G6M A;  5HBF A;  4ODR A;  3PRB A;  3UI4 A;  2WK2 A;  4MNJ A;  1LL6 A;  1GOI A;  4IT4 A;  1FKF A;  4DRJ A;  4DRK A;  2K8I A;  3IHZ A;  4TX0 A;  4Q7N A;  4WK9 A;  2DT1 A;  1O6I A;  1GRJ A;  1W9P A;  4DRI A;  1LL4 A;  1YAT A;  3ART A;  4WIW A;  3UQA A;  3PRD A;  4ODP A;  1NWU A;  4QZV B;  1ROT A;  2XP3 A;  1EIB A;  1D7H A;  2FKE A;  2N87 A;  1HKK A;  1A7X A;  2F21 A;  1OWQ A;  4DT4 A;  1K9T A;  1E6R A;  1W1T A;  4URI A;  3KAB A;  2ESC A;  3UI6 A;  3O5I A;  4W9Q A;  1H0G A;  3KAF A;  4JFJ A;  3NRK A;  3CH9 A;  3GTY X;  2DSV A;  2O9O A;  3GPK A;  2Y78 A;  4DWS B;  3KAH A;  4ODK A;  1WAW A;  1YW5 A;  4LGX A;  2KE0 A;  3JYJ A;  4NZC A;  2KR7 A;  4J4N A;  2MLZ A;  2B5U B;  2Q5A A;  2ITK A;  1ZBV A;  3WD4 A;  4ZS6 A;  1JCH B;  1NWT A;  3ARS A;  4LAW A;  4NNR A;  3B7X A;  3PR9 A;  4FAP A;  1EYM A;  3ARX A;  1FKI A;  4MPK A;  3O5P A;  2RUC A;  1ZCN A;  3ALG A;  3ODK A;  3NTP A;  2ZQU A;  4MTV A;  3ARZ A;  4P8X A;  4R5E A;  2LGO A;  1FJD A;  2DPE A;  1NWR A;  4WKH A;  3WD3 A;  2DSW A;  3B9D A;  3B9E A;  2F2D A;  1HKM A;  4MNL A;  3O5R A;  5DF0 A;  3WH0 A;  4DH0 A;  3CZ8 A;  4U84 A;  3ARU A;  1W1P A;  2ZR4 A;  4DIP A;  3ARP A;  4QT3 A;  1NMW A;  3AQU A;  2KGJ A;  1JNE A;  1E15 A;  3WIJ A;  3ARW A;  5HUA A;  4BF8 A;  3H9R B;  4P8U A;  3PA7 A;  1FKK A;  1UR8 A;  1FKH A;  1J4I A;  1Q6U A;  1TCO C;  1W9U A;  2QF8 A;  3ARV A;  3O5J A;  3G6L A;  1PIN A;  3MDY B;  4GIV A;  4ODQ A;  1U79 A;  2ZQT A;  1D2K A;  1NWS A;  1RD6 A;  3TDB A;  1W9V A;  4TW8 A;  1ROU A;  5DIV A;  4ODO A;  1X6L A;  4QT2 A;  1D6O A;  2MPH A;  2MLX A;  1SYT A;  4DRQ A;  4C02 B;  2OLH A;  4JFM A;  3O5Q A;  4MNK A;  2M2A A;  3UI5 A;  3OA5 A;  1ZU8 A;  2PV1 A;  2LJ4 A;  1ZK6 A;  2XP6 A;  2XPB A;  4ODL A;  4IPX A;  5DO2 A;  3WL1 A;  3UF8 A;  3O5K A;  3OOB A;  4HBO A;  4W5U A;  4ODM A;  4UDM A;  3ARO A;  1LQ0 A;  4G2P A;  3IK8 A;  5GQB A;  4GGQ A;  4LAV A;  5B8I C;  1Q6I A;  3KAI A;  1W26 A;  5JH8 A;  1XRV A;  1CTN A;  3RM8 A;  1FKL A;  1D7J A;  1KT0 A;  3O5M A;  1FAP A;  4ZPT R;  3RGC A;  1ZBK A;  1JNT A;  2ZQS A;  2EUL A;  3AS2 A;  1BL4 A;  4TNS A;  2KI3 A;  4NSB A;  3I6C A;  3RM4 A;  3WKZ A;  2A3A A;  3FXY A;  1LJY A;  1E6N A;  4O2T A;  1FKD A;  1KT1 A;  4Z2L A;  2L2S A;  1XHG A;  5HWB A;  2XP5 A;  4J4O A;  2IF4 A;  1LG2 A;  4P8W A;  3KAD A;  3O5D A;  4AY1 A;  1J4R A;  1HKI A;  2PPP A;  3BMB A;  2ETN A;  3CGN A;  1IX5 A;  5DIU A;  4IQ2 A;  2ZR6 A;  3CGM A;  3UQI A;  1SR0 A;  3WL0 A;  4WKF A;  1E6Z A;  2OFN A;  1W1Y A;  1HKJ A;  1NMV A;  4JFI A;  1KFW A;  4P8V A;  2DT0 A;  2XP4 A;  2YBT A;  5HW8 A;  4TYO A;  4U86 A;  2RUQ A;  1FD9 A;  5HWC A;  1QPF A;  2M1I A;  4JFL A;  4DWS C;  2RSE A;  5HW7 A;  2XPA A;  5J6E A;  2FDM A;  4S3J A;  2A3B A;  1D7I A;  4JFK A;  3RFW A;  3JYM A;  2UZ5 A;  3ALF A;  3TC5 A;  3B9A A;  2DSZ A;  3NI6 A;  2WLY A;  2F23 A;  3O5E A;  4W9P A;  2PPO A;  2DT3 A;  2DSU A;  1HJW A;  1FFQ A;  1W1V A;  4DWS D;  2M08 A;  3O5F A;  1LL7 A;  1ZL1 A;  2PPN A;  2DT2 A;  2RUR A;  2KFW A;  2XP7 A;  2FAP A;  4W9O A;  2A3E A;  2RUD A;  1F40 A;  3WQV A;  1TFV A;  4MNM A;  3W4R A;  1OGG A;  2O92 A;  2WM0 A;  1PBK A;  1B6C A;  3CHC A;  4Z2J A;  3WD0 A;  1JND A;  3IKD A;  2LPV A;  3AS0 A;  3KAC A;  4DRP A;  1GPF A;  4QIB A;  2MLY A;  2AWG A;  4MAV A;  1E9L A;  4DZ2 A;  1FKB A;  2LKN A;  1T11 A;  1EQ3 A;  4R0X A;  1HXV A;  1LG1 A;  1UR9 A;  4N19 A;  1FKT A;  2DG3 A;  1NSG A;  1N1A A;  4HBE A;  3WD2 A;  4Z2G A;  2B31 A;  4DRM A;  4U85 A;  5GPG A;  4KQZ A;  4ITZ A;  1L1P A;  3AS3 A;  4ML4 A;  3ARR A;  3CHD A;  2DG4 A;  1ITX A;  2RQS A;  4Z2K A;  3BXW A;  4Z2I A;  2ZQV A;  5HTG A;  2AOS A;  1FKG A;  3PRA A;  4ZPW R;  1VF8 A;  1Q6H A;  1J4H A;  3UQB A;  1ZBW A;  4IQC A;  1WB0 A;  4DZ3 A;  2D9F A;  3LUO A;  2KO7 A;  4DRH A;  2XP9 A;  1FKJ A;  3QOK A;  1Y0O A;  2IUZ A;  1WNO A;  1ZB5 A;  3ARY A;  3RME A;  4MGV A;  2A3C A;  2ZR5 A;  3RM9 A;  5HKG A;  1F8A B;  1P5Q A;  4ODN A;  4L3N A;  1QPL A;  1HJX A;  4Q22 A;  1Q1C A;  3B8S A;  3ARQ A;  4G50 A;  3IKG A;  2F4E A;  2XP8 A;  1HJV A;  1NH6 A;  3FY1 A;  1OGB A;  2P4V A;  4DWS A;  5D75 A;  5DEZ A; 
#chains in the Genus database with same CATH homology
 1J6Y A;  2G8Z A;  3TCZ A;  3CHF A;  2MF9 A;  2PV2 A;  1C9H A;  4WJX A;  2YBU A;  2G41 A;  4DRO A;  4Z2H A;  3KCE A;  3CHE A;  2PI6 A;  4S3K A;  3FAP A;  1E6P A;  4KR0 B;  4LAY A;  1FFR A;  5GPR A;  1JNS A;  4FN2 A;  4IT6 A;  4MSP A;  1QZ2 A;  4WKA A;  1ZBC A;  4HAR A;  3WD1 A;  1BKF A;  3O5O A;  1EDQ A;  1R9H A;  3AS1 A;  1M5Y A;  5BXJ A;  4PTM A;  2VN1 A;  3O5L A;  4L72 B;  4DRN A;  4ZPV R;  2PV3 A;  3KAG A;  1FKS A;  4LAX A;  3O5G A;  4TW7 A;  1GUV A;  1FKR A;  2DG9 A;  3EY6 A;  5HW6 A;  5I98 A;  3WQW A;  2PBC A;  3JXV A;  2MNT A;  4XAK A;  3KZ7 A;  1JVW A;  4JYS A;  1H0I A;  3VAW A;  2JZV A;  5HT1 A;  2VCD A;  2WLZ A;  5DIT A;  1X6N A;  1EHN A;  4TW6 A;  3G6M A;  5HBF A;  4ODR A;  3PRB A;  3UI4 A;  2WK2 A;  4MNJ A;  1LL6 A;  1GOI A;  4IT4 A;  1FKF A;  4DRJ A;  4DRK A;  2K8I A;  3IHZ A;  4TX0 A;  4Q7N A;  4WK9 A;  2DT1 A;  1O6I A;  1W9P A;  4DRI A;  1LL4 A;  1YAT A;  3ART A;  4WIW A;  3UQA A;  3PRD A;  4ODP A;  1NWU A;  4QZV B;  1ROT A;  2XP3 A;  1EIB A;  1D7H A;  2FKE A;  2N87 A;  1HKK A;  1A7X A;  2F21 A;  1OWQ A;  4DT4 A;  1K9T A;  1E6R A;  1W1T A;  4URI A;  3KAB A;  2ESC A;  3UI6 A;  3O5I A;  4W9Q A;  1H0G A;  3KAF A;  4JFJ A;  3NRK A;  3CH9 A;  2DSV A;  2O9O A;  3GPK A;  2Y78 A;  4DWS B;  3KAH A;  4ODK A;  1WAW A;  1YW5 A;  4LGX A;  2KE0 A;  3JYJ A;  4NZC A;  2KR7 A;  4J4N A;  2MLZ A;  2Q5A A;  2ITK A;  1ZBV A;  3WD4 A;  4ZS6 A;  1NWT A;  3ARS A;  4LAW A;  4NNR A;  3B7X A;  3PR9 A;  4FAP A;  1EYM A;  3ARX A;  1FKI A;  4MPK A;  3O5P A;  2RUC A;  1ZCN A;  3ALG A;  3ODK A;  3NTP A;  2ZQU A;  4MTV A;  3ARZ A;  4P8X A;  4R5E A;  2LGO A;  1FJD A;  2DPE A;  1NWR A;  4WKH A;  3WD3 A;  2DSW A;  3B9D A;  3B9E A;  2F2D A;  1HKM A;  4MNL A;  3O5R A;  5DF0 A;  3WH0 A;  4DH0 A;  3CZ8 A;  4U84 A;  3ARU A;  1W1P A;  2ZR4 A;  4DIP A;  3ARP A;  4QT3 A;  1NMW A;  3AQU A;  2KGJ A;  1JNE A;  1E15 A;  3WIJ A;  3ARW A;  5HUA A;  4BF8 A;  3H9R B;  4P8U A;  3PA7 A;  1FKK A;  1UR8 A;  1FKH A;  1J4I A;  1Q6U A;  1TCO C;  1W9U A;  2QF8 A;  3ARV A;  3O5J A;  3G6L A;  1PIN A;  3MDY B;  4GIV A;  4ODQ A;  1U79 A;  2ZQT A;  1D2K A;  1NWS A;  1RD6 A;  3TDB A;  1W9V A;  4TW8 A;  1ROU A;  5DIV A;  4ODO A;  1X6L A;  4QT2 A;  1D6O A;  2MPH A;  2MLX A;  1SYT A;  4DRQ A;  4C02 B;  2OLH A;  4JFM A;  3O5Q A;  4MNK A;  2M2A A;  3UI5 A;  3OA5 A;  1ZU8 A;  2PV1 A;  2LJ4 A;  1ZK6 A;  2XP6 A;  2XPB A;  4ODL A;  4IPX A;  5DO2 A;  3WL1 A;  3UF8 A;  3O5K A;  3OOB A;  4HBO A;  4W5U A;  4ODM A;  3ARO A;  1LQ0 A;  4G2P A;  3IK8 A;  5GQB A;  4GGQ A;  4LAV A;  5B8I C;  1Q6I A;  3KAI A;  1W26 A;  5JH8 A;  1XRV A;  1CTN A;  3RM8 A;  1FKL A;  1D7J A;  1KT0 A;  3O5M A;  1FAP A;  4ZPT R;  3RGC A;  1ZBK A;  1JNT A;  2ZQS A;  3AS2 A;  1BL4 A;  4TNS A;  2KI3 A;  4NSB A;  3I6C A;  3RM4 A;  3WKZ A;  2A3A A;  3FXY A;  1LJY A;  1E6N A;  4O2T A;  1FKD A;  1KT1 A;  4Z2L A;  2L2S A;  1XHG A;  5HWB A;  2XP5 A;  4J4O A;  2IF4 A;  1LG2 A;  4P8W A;  3KAD A;  3O5D A;  4AY1 A;  1J4R A;  1HKI A;  2PPP A;  3CGN A;  1IX5 A;  5DIU A;  4IQ2 A;  2ZR6 A;  3CGM A;  3UQI A;  1SR0 A;  3WL0 A;  4WKF A;  1E6Z A;  2OFN A;  1W1Y A;  1HKJ A;  1NMV A;  4JFI A;  1KFW A;  4P8V A;  2DT0 A;  2XP4 A;  2YBT A;  5HW8 A;  4TYO A;  4U86 A;  2RUQ A;  1FD9 A;  5HWC A;  1QPF A;  2M1I A;  4JFL A;  4DWS C;  2RSE A;  5HW7 A;  2XPA A;  5J6E A;  2FDM A;  4S3J A;  2A3B A;  1D7I A;  4JFK A;  3RFW A;  3JYM A;  2UZ5 A;  3ALF A;  3TC5 A;  3B9A A;  2DSZ A;  3NI6 A;  2WLY A;  3O5E A;  4W9P A;  2PPO A;  2DT3 A;  2DSU A;  1HJW A;  1FFQ A;  1W1V A;  4DWS D;  2M08 A;  3O5F A;  1LL7 A;  1ZL1 A;  2PPN A;  2DT2 A;  2RUR A;  2KFW A;  2XP7 A;  2FAP A;  4W9O A;  2A3E A;  2RUD A;  1F40 A;  3WQV A;  1TFV A;  4MNM A;  3W4R A;  1OGG A;  2O92 A;  2WM0 A;  1PBK A;  1B6C A;  3CHC A;  4Z2J A;  3WD0 A;  1JND A;  3IKD A;  2LPV A;  3AS0 A;  3KAC A;  4DRP A;  1GPF A;  4QIB A;  2MLY A;  2AWG A;  4MAV A;  1E9L A;  4DZ2 A;  1FKB A;  2LKN A;  1T11 A;  1EQ3 A;  4R0X A;  1HXV A;  1LG1 A;  1UR9 A;  4N19 A;  1FKT A;  2DG3 A;  1NSG A;  1N1A A;  4HBE A;  3WD2 A;  4Z2G A;  2B31 A;  4DRM A;  4U85 A;  5GPG A;  4KQZ A;  4ITZ A;  1L1P A;  3AS3 A;  4ML4 A;  3ARR A;  3CHD A;  2DG4 A;  1ITX A;  2RQS A;  4Z2K A;  3BXW A;  4Z2I A;  2ZQV A;  5HTG A;  2AOS A;  1FKG A;  3PRA A;  4ZPW R;  1VF8 A;  1Q6H A;  1J4H A;  3UQB A;  1ZBW A;  4IQC A;  1WB0 A;  4DZ3 A;  2D9F A;  3LUO A;  2KO7 A;  4DRH A;  2XP9 A;  1FKJ A;  3QOK A;  1Y0O A;  2IUZ A;  1WNO A;  1ZB5 A;  3ARY A;  3RME A;  4MGV A;  2A3C A;  2ZR5 A;  3RM9 A;  5HKG A;  1F8A B;  1P5Q A;  4ODN A;  4L3N A;  1QPL A;  1HJX A;  4Q22 A;  1Q1C A;  3B8S A;  3ARQ A;  4G50 A;  3IKG A;  2F4E A;  2XP8 A;  1HJV A;  1NH6 A;  3FY1 A;  1OGB A;  4DWS A;  5D75 A;  5DEZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...