4DZ2A

Crystal structure of a peptidyl-prolyl cis-trans isomerase with surface mutation r92g from burkholderia pseudomallei complexed with fk506
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
113
structure length
113
Chain Sequence
STVVTTESGLKYEDLTEGSGAEARAGQTVSVHYTGWLTDGQKFDSSKDRNDPFAFVLGGGMVIKGWDEGVQGMKVGGVRRLTIPPQLGYGAGGAGGVIPPNATLVFEVELLDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase
publication title A structural biology approach enables the development of antimicrobials targeting bacterial immunophilins.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Isomerase
total genus 25
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4dz2A00
1YATA 2KFWA 1NMWA 2MLYA 4IQCA 2RQSA 4DRMA 3UQIA 4G50A 4JFLA 3NTPA 2KI3A 4IPXA 4LAYA 1FKJA 2ZQUA 3CGMA 1D7HA 2XP7A 3KABA 4BF8A 3O5JA 3MDYB 2K8IA 2F2DA 1J6YA 3ODKA 4C02B 2PPNA 1BKFA 4DH0A 5DITA 3KAFA 4G2PA 2PV1A 4ODPA 4TYOA 1JVWA 1KT1A 1PBKA 2PBCA 4J4NA 2FAPA 4JFKA 4QT2A 1U79A 3PRDA 3KZ7A 3O5KA 4U86A 4ODNA 4ODOA 4FAPA 1P5QA 2M1IA 2XP8A 1FKHA 1FKLA 2ZQSA 1FKRA 1FKTA 2F21A 3OOBA 3NRKA 1Q1CA 1F8AB 5B8IC 1JNTA 2OFNA 4NNRA 4DROA 3O5QA 2PPOA 2RSEA 1YW5A 2XP6A 4TNSA 2XP3A 1FKGA 1T11A 5HUAA 3IKDA 4TW6A 4DRHA 3KAHA 1Q6HA 2XPAA 3PA7A 1ROUA 4TW8A 4DIPA 3KAGA 1PINA 2L2SA 1J4HA 4ODLA 4JFJA 1FAPA 2ZR6A 4LAXA 3I6CA 2Y78A 2AWGA 1BL4A 4LAWA 3TCZA 2UZ5A 3FAPA 3EY6A 4R0XA 2MPHA 2M2AA 4J4OA 5I98A 1A7XA 4DRKA 1R9HA 4DRNA 3O5IA 4ODQA 2ZQVA 4QT3A 5HW7A 2XP5A 2ZR5A 3B7XA 4DRQA 2MF9A 3KAIA 2DG9A 4DRIA 3O5MA 1FKFA 4ITZA 2DG4A 2LGOA 5HWCA 4FN2A 1N1AA 1D7IA 1FKSA 2KR7A 2PV2A 1NSGA 2RUDA 3JXVA 3JYJA 4QIBA 2MLXA 1ROTA 4U84A 3UI4A 3VAWA 3KADA 3IK8A 2LKNA 4ODKA 3IHZA 5D75A 1Y0OA 1Q6UA 5HW6A 1EQ3A 4W9QA 1ZK6A 2RUQA 2MLZA 3UQBA 1JNSA 2KE0A 1W26A 4JFMA 2ZR4A 1FKDA 2VN1A 1HXVA 4U85A 4DRJA 3PRBA 4LAVA 2M08A 4JYSA 1J4RA 2F4EA 3RFWA 3TC5A 2RURA 3O5GA 3O5LA 4GGQA 2DG3A 3JYMA 1J4IA 3KCEA 4GIVA 3RGCA 4MGVA 2XP9A 5DIUA 2N87A 5HW8A 3LUOA 1D7JA 3H9RB 4MSPA 4W9PA 4IQ2A 1FD9A 1QZ2A 5DIVA 2PV3A 3UI5A 3O5OA 1QPLA 2PPPA 2RUCA 4DZ3A 5J6EA 3IKGA 2ITKA 3O5FA 1FKBA 2XP4A 4N19A 4ODMA 5HTGA 1QPFA 1NMVA 2ZQTA 4ODRA 4DRPA 4JFIA 1B6CA 2KO7A 2LPVA 1FKIA 3WH0A 1EYMA 2VCDA 1FKKA 3UI6A 1ZCNA 3NI6A 3CGNA 3O5RA 5GPGA 2JZVA 2Q5AA 3GPKA 3O5PA 5HKGA 1C9HA 3O5EA 3KACA 4DT4A 2IF4A 3UF8A 4W9OA 5HWBA 3O5DA 2FKEA 2MNTA 3TDBA 5BXJA 4TW7A 1D6OA 2KGJA 1M5YA 5HT1A 2LJ4A 1KT0A 1TCOC 2D9FA 2XPBA 4TX0A 4DZ2A 3UQAA 4O2TA 1F40A 1FJDA 1L1PA 1Q6IA
chains in the Genus database with same CATH superfamily
1YATA 3UQIA 4G50A 3ARVA 4LAYA 4Q7NA 2F2DA 4S3KA 3ARSA 2PPNA 1BKFA 1D2KA 4G2PA 4ODPA 1JVWA 1PBKA 4J4NA 4JFKA 3PRDA 4U86A 4ODNA 5JH8A 1HJWA 3B9DA 1FKHA 1FKTA 4IT4A 3OOBA 3NRKA 1F8AB 3RM4A 4L72B 3CHFA 2RSEA 1OGBA 4TNSA 2XP3A 5HBFA 3KAHA 4DIPA 1FAPA 2A3EA 2Y78A 1BL4A 4R0XA 5GPRA 4DRKA 1R9HA 3O5IA 3B7XA 2ZR5A 3KAIA 4DRIA 3O5MA 4ITZA 1ZBKA 4FN2A 1N1AA 3AQUA 3JXVA 3JYJA 3UI4A 3VAWA 3KADA 3WD3A 2LKNA 5D75A 3ARRA 2PI6A 4WIWA 4DWSB 2MLZA 3AROA 1LG2A 4WKHA 4P8VA 4U85A 4MPKA 1SYTA 2RURA 3O5GA 3O5LA 4DRJA 2DG3A 3RGCA 2XP9A 2PN0A 5DIUA 4P8WA 3H9RB 1E6NA 3UI5A 4MAVA 1QPLA 2PPPA 2RUCA 2OLHA 4MNMA 1KFWA 3O5FA 1FKBA 4ODMA 1QPFA 2ZQTA 3CHEA 3ARYA 1JNDA 4DRPA 1W1VA 3ARPA 2JZVA 4WKAA 1W9PA 3UF8A 3WL1A 1XHGA 3CHCA 1D6OA 3ARWA 2KGJA 1TCOC 4TX0A 3UQAA 4O2TA 1L1PA 3WD1A 3AS2A 1GOIA 2KFWA 1NMWA 4DRMA 3NTPA 4NZCA 3CH9A 1NWSA 2XP7A 4BF8A 1UR8A 3O5JA 4IT6A 3ODKA 2AOSA 3CZ8A 4DH0A 2A3AA 2FAPA 1U79A 4DWSA 4MNJA 2WK2A 2ZQSA 1FKRA 2F21A 3ALFA 1NWTA 1W1PA 4Q22A 4NNRA 1YW5A 1FKGA 1EDQA 2IUZA 5HUAA 3PA7A 1Q6HA 2DSUA 3EIPA 1ROUA 3FY1A 5GQBA 1O6IA 4ODLA 2ZR6A 3I6CA 4WKFA 4LAWA 3EY6A 1H0IA 2DG9A 1FKFA 2DG4A 1D7IA 1HKJA 1FKSA 3ARQA 1XRVA 4U84A 4Z2GA 1E9LA 4QZVB 3IHZA 1ZK6A 3UQBA 4HBOA 2KE0A 3WD4A 3FXYA 4LAVA 4JYSA 2F4EA 4FAPA 2P4VA 1ITXA 3JYMA 1J4IA 3KCEA 4GIVA 3LUOA 1D7JA 4MSPA 4P8XA 1QZ2A 3WQWA 4S3JA 4HARA 3WQVA 1E6ZA 2KO7A 2LPVA 1EHNA 4L3NA 5DEZA 1RD6A 1EYMA 3UI6A 4DWSD 1K9TA 3CGNA 3GU0A 1LG1A 2Q5AA 3GPKA 2ETNA 1GRJA 1HKIA 3KACA 1OGGA 4ZPVR 2IF4A 4LGXA 1E15A 1W9UA 5HWBA 2FKEA 4Z2HA 5BXJA 1UR9A 1NH6A 1M5YA 1WNOA 2LJ4A 2D9FA 4Z2KA 1HKMA 1LL4A 2MLYA 4IQCA 2RQSA 1IX5A 2KI3A 1WB0A 1LQ0A 4XAKA 2DSVA 3KABA 4MNKA 3AS3A 4C02B 5DITA 5DF0A 2ESCA 2PV1A 3CHDA 1KT1A 4QT2A 3ARUA 2F23A 3KZ7A 3O5KA 1P5QA 2M1IA 2XP8A 3WIJA 1W1YA 2O9OA 3WD2A 1Q1CA 1JNTA 3AS1A 3O5QA 1JNEA 1EIBA 2XP6A 2O92A 2DPEA 3IKDA 4TW6A 4DRHA 2XPAA 3GTYX 2L2SA 1J4HA 1HJVA 4JFJA 4MNLA 2AWGA 1SR0A 3TCZA 3FAPA 1E6RA 3B8SA 4J4OA 4NSBA 5I98A 1A7XA 4ODQA 3B9AA 5HW7A 1HJXA 1W1TA 4Z2LA 2FDMA 5HWCA 2PV2A 1VF8A 2KR7A 1NSGA 2WLZA 1NWUA 2DT3A 3IK8A 1LJYA 4WJXA 1LL6A 1Q6UA 1TFVA 5HW6A 1JNSA 4JFMA 1W26A 2VN1A 1HXVA 3RFWA 1X6NA 3ALGA 2QF8A 4MGVA 1FFRA 1FD9A 5DIVA 4MTVA 2XP4A 4N19A 1NWRA 1GPFA 1NMVA 3ARXA 1H0GA 4UDMA 2VCDA 3WKZA 1ZCNA 3NI6A 3O5RA 2DT0A 5GPGA 1JCHB 5HKGA 3QOKA 2WLYA 3O5EA 1HKKA 4DT4A 3O5DA 1GUVA 3BXWA 5HT1A 3ARZA 1KT0A 2XPBA 4DZ2A 1ZU8A 3G6LA 1CTNA 2N87A 5HW8A 2DT2A 1E6PA 4KQZA 4JFLA 4IPXA 1FKJA 3PRAA 4AY1A 2ZQUA 3CGMA 1D7HA 3RM8A 3MDYB 2K8IA 1J6YA 3RM9A 3KAFA 2EULA 4TYOA 2YBTA 2PBCA 4ODOA 1FKLA 2A3BA 2B31A 2A3CA 1OWQA 2DSWA 2DT1A 5B8IC 1E44A 2OFNA 4DROA 3AS0A 2PPOA 3OA5A 4P8UA 1T11A 4TW8A 1LL7A 3KAGA 1PINA 2G8ZA 4LAXA 4HBEA 2UZ5A 3PR9A 2MPHA 3WD0A 2M2AA 4DRNA 4QT3A 2ZQVA 2YBUA 2XP5A 4DRQA 4W5UA 3W4RA 2MF9A 2LGOA 2RUDA 4QIBA 2MLXA 1ROTA 4ODKA 1Y0OA 1FFQA 1ZB5A 1EQ3A 4W9QA 2RUQA 2ZR4A 1FKDA 4Z2IA 3PRBA 2M08A 1J4RA 4ZPWR 3TC5A 4GGQA 4R5EA 2G41A 4W9PA 4IQ2A 4KR0B 2PV3A 3O5OA 4DZ3A 3G6MA 5J6EA 1ZBCA 3IKGA 2ITKA 1ZL1A 3WL0A 4DWSC 2DSZA 2B5UB 4PTMA 5DO2A 3RMEA 3B9EA 5HTGA 4ODRA 1WAWA 4JFIA 1B6CA 4WK9A 1FKIA 1W9VA 3WH0A 1FKKA 4Z2JA 1ZBWA 3BMBA 3O5PA 1C9HA 4W9OA 4ZS6A 2MNTA 3TDBA 3ARTA 4TW7A 4URIA 4ZPTR 1X6LA 2WM0A 1ZBVA 1F40A 1FJDA 4ML4A 1Q6IA
chains in the Genus database with same CATH topology
1YATA 3UQIA 4G50A 3ARVA 4LAYA 4Q7NA 2F2DA 4S3KA 3ARSA 2PPNA 1BKFA 1D2KA 4G2PA 4ODPA 1JVWA 1PBKA 4J4NA 4JFKA 3PRDA 4U86A 4ODNA 5JH8A 1HJWA 3B9DA 1FKHA 1FKTA 4IT4A 3OOBA 3NRKA 1F8AB 3RM4A 4L72B 3CHFA 2RSEA 1OGBA 4TNSA 2XP3A 5HBFA 3KAHA 4DIPA 1FAPA 2A3EA 2Y78A 1BL4A 4R0XA 5GPRA 4DRKA 1R9HA 3O5IA 3B7XA 2ZR5A 3KAIA 4DRIA 3O5MA 4ITZA 1ZBKA 4FN2A 1N1AA 3AQUA 3JXVA 3JYJA 3UI4A 3VAWA 3KADA 3WD3A 2LKNA 5D75A 3ARRA 2PI6A 4WIWA 4DWSB 2MLZA 3AROA 1LG2A 4WKHA 4P8VA 4U85A 4MPKA 1SYTA 2RURA 3O5GA 3O5LA 4DRJA 2DG3A 3RGCA 2XP9A 5DIUA 4P8WA 3H9RB 1E6NA 3UI5A 4MAVA 1QPLA 2PPPA 2RUCA 2OLHA 4MNMA 1KFWA 3O5FA 1FKBA 4ODMA 1QPFA 2ZQTA 3CHEA 3ARYA 1JNDA 4DRPA 1W1VA 3ARPA 2JZVA 4WKAA 1W9PA 3UF8A 3WL1A 1XHGA 3CHCA 1D6OA 3ARWA 2KGJA 1TCOC 4TX0A 3UQAA 4O2TA 1L1PA 3WD1A 3AS2A 1GOIA 2KFWA 1NMWA 4DRMA 3NTPA 4NZCA 3CH9A 1NWSA 2XP7A 4BF8A 1UR8A 3O5JA 4IT6A 3ODKA 2AOSA 3CZ8A 4DH0A 2A3AA 2FAPA 1U79A 4DWSA 4MNJA 2WK2A 2ZQSA 1FKRA 2F21A 3ALFA 1NWTA 1W1PA 4Q22A 4NNRA 1YW5A 1FKGA 1EDQA 2IUZA 5HUAA 3PA7A 1Q6HA 2DSUA 3FY1A 1ROUA 5GQBA 1O6IA 4ODLA 2ZR6A 3I6CA 4WKFA 4LAWA 3EY6A 1H0IA 2DG9A 1FKFA 2DG4A 1D7IA 1HKJA 1FKSA 3ARQA 1XRVA 4U84A 4Z2GA 1E9LA 4QZVB 3IHZA 1ZK6A 3UQBA 4HBOA 2KE0A 3WD4A 3FXYA 4LAVA 4JYSA 2F4EA 4FAPA 1ITXA 3JYMA 1J4IA 3KCEA 4GIVA 3LUOA 1D7JA 4MSPA 4P8XA 1QZ2A 3WQWA 4S3JA 4HARA 3WQVA 1E6ZA 2KO7A 2LPVA 1EHNA 4L3NA 5DEZA 1RD6A 1EYMA 3UI6A 4DWSD 1K9TA 3CGNA 1LG1A 2Q5AA 3GPKA 1HKIA 3KACA 1OGGA 4ZPVR 2IF4A 4LGXA 1E15A 1W9UA 5HWBA 2FKEA 4Z2HA 5BXJA 1UR9A 1NH6A 1M5YA 1WNOA 2LJ4A 2D9FA 4Z2KA 1HKMA 1LL4A 2MLYA 4IQCA 2RQSA 1IX5A 2KI3A 1WB0A 1LQ0A 4XAKA 2DSVA 3KABA 4MNKA 3AS3A 4C02B 5DITA 5DF0A 2ESCA 2PV1A 3CHDA 1KT1A 4QT2A 3ARUA 3KZ7A 3O5KA 1P5QA 2M1IA 2XP8A 3WIJA 1W1YA 2O9OA 3WD2A 1Q1CA 1JNTA 3AS1A 3O5QA 1JNEA 1EIBA 2XP6A 2O92A 2DPEA 3IKDA 4TW6A 4DRHA 2XPAA 2L2SA 1J4HA 1HJVA 4JFJA 4MNLA 2AWGA 1SR0A 3TCZA 3FAPA 1E6RA 3B8SA 4J4OA 4NSBA 5I98A 1A7XA 4ODQA 3B9AA 5HW7A 1HJXA 1W1TA 4Z2LA 2FDMA 5HWCA 2PV2A 1VF8A 2KR7A 1NSGA 2WLZA 1NWUA 2DT3A 3IK8A 1LJYA 4WJXA 1LL6A 1Q6UA 1TFVA 5HW6A 1JNSA 4JFMA 1W26A 2VN1A 1HXVA 3RFWA 1X6NA 3ALGA 2QF8A 4MGVA 1FFRA 1FD9A 5DIVA 4MTVA 2XP4A 4N19A 1NWRA 1GPFA 1NMVA 3ARXA 1H0GA 2VCDA 3WKZA 1ZCNA 3NI6A 3O5RA 2DT0A 5GPGA 5HKGA 3QOKA 2WLYA 3O5EA 1HKKA 4DT4A 3O5DA 1GUVA 3BXWA 5HT1A 3ARZA 1KT0A 2XPBA 4DZ2A 1ZU8A 3G6LA 1CTNA 2N87A 5HW8A 2DT2A 1E6PA 4KQZA 4JFLA 4IPXA 1FKJA 3PRAA 4AY1A 2ZQUA 3CGMA 1D7HA 3RM8A 3MDYB 2K8IA 1J6YA 3RM9A 3KAFA 4TYOA 2YBTA 2PBCA 4ODOA 1FKLA 2A3BA 2B31A 2A3CA 1OWQA 2DSWA 2DT1A 5B8IC 2OFNA 4DROA 3AS0A 2PPOA 3OA5A 4P8UA 1T11A 4TW8A 1LL7A 3KAGA 1PINA 2G8ZA 4LAXA 4HBEA 2UZ5A 3PR9A 2MPHA 3WD0A 2M2AA 4DRNA 4QT3A 2ZQVA 2YBUA 2XP5A 4DRQA 4W5UA 3W4RA 2MF9A 2LGOA 2RUDA 4QIBA 2MLXA 1ROTA 4ODKA 1Y0OA 1FFQA 1ZB5A 1EQ3A 4W9QA 2RUQA 2ZR4A 1FKDA 4Z2IA 3PRBA 2M08A 1J4RA 4ZPWR 3TC5A 4GGQA 4R5EA 2G41A 4W9PA 4IQ2A 4KR0B 2PV3A 3O5OA 4DZ3A 3G6MA 5J6EA 1ZBCA 3IKGA 2ITKA 1ZL1A 3WL0A 4DWSC 2DSZA 4PTMA 5DO2A 3RMEA 3B9EA 5HTGA 4ODRA 1WAWA 4JFIA 1B6CA 4WK9A 1FKIA 1W9VA 3WH0A 1FKKA 4Z2JA 1ZBWA 3O5PA 1C9HA 4W9OA 4ZS6A 2MNTA 3TDBA 3ARTA 4TW7A 4URIA 4ZPTR 1X6LA 2WM0A 1ZBVA 1F40A 1FJDA 4ML4A 1Q6IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YAT A;  2KFW A;  1NMW A;  2MLY A;  4IQC A;  2RQS A;  4DRM A;  3UQI A;  4G50 A;  4JFL A;  3NTP A;  2KI3 A;  4IPX A;  4LAY A;  1FKJ A;  2ZQU A;  3CGM A;  1D7H A;  2XP7 A;  3KAB A;  4BF8 A;  3O5J A;  3MDY B;  2K8I A;  2F2D A;  1J6Y A;  3ODK A;  4C02 B;  2PPN A;  1BKF A;  4DH0 A;  5DIT A;  3KAF A;  4G2P A;  2PV1 A;  4ODP A;  4TYO A;  1JVW A;  1KT1 A;  1PBK A;  2PBC A;  4J4N A;  2FAP A;  4JFK A;  4QT2 A;  1U79 A;  3PRD A;  3KZ7 A;  3O5K A;  4U86 A;  4ODN A;  4ODO A;  4FAP A;  1P5Q A;  2M1I A;  2XP8 A;  1FKH A;  1FKL A;  2ZQS A;  1FKR A;  1FKT A;  2F21 A;  3OOB A;  3NRK A;  1Q1C A;  1F8A B;  5B8I C;  1JNT A;  2OFN A;  4NNR A;  4DRO A;  3O5Q A;  2PPO A;  2RSE A;  1YW5 A;  2XP6 A;  4TNS A;  2XP3 A;  1FKG A;  1T11 A;  5HUA A;  3IKD A;  4TW6 A;  4DRH A;  3KAH A;  1Q6H A;  2XPA A;  3PA7 A;  1ROU A;  4TW8 A;  4DIP A;  3KAG A;  1PIN A;  2L2S A;  1J4H A;  4ODL A;  4JFJ A;  1FAP A;  2ZR6 A;  4LAX A;  3I6C A;  2Y78 A;  2AWG A;  1BL4 A;  4LAW A;  3TCZ A;  2UZ5 A;  3FAP A;  3EY6 A;  4R0X A;  2MPH A;  2M2A A;  4J4O A;  5I98 A;  1A7X A;  4DRK A;  1R9H A;  4DRN A;  3O5I A;  4ODQ A;  2ZQV A;  4QT3 A;  5HW7 A;  2XP5 A;  2ZR5 A;  3B7X A;  4DRQ A;  2MF9 A;  3KAI A;  2DG9 A;  4DRI A;  3O5M A;  1FKF A;  4ITZ A;  2DG4 A;  2LGO A;  5HWC A;  4FN2 A;  1N1A A;  1D7I A;  1FKS A;  2KR7 A;  2PV2 A;  1NSG A;  2RUD A;  3JXV A;  3JYJ A;  4QIB A;  2MLX A;  1ROT A;  4U84 A;  3UI4 A;  3VAW A;  3KAD A;  3IK8 A;  2LKN A;  4ODK A;  3IHZ A;  5D75 A;  1Y0O A;  1Q6U A;  5HW6 A;  1EQ3 A;  4W9Q A;  1ZK6 A;  2RUQ A;  2MLZ A;  3UQB A;  1JNS A;  2KE0 A;  1W26 A;  4JFM A;  2ZR4 A;  1FKD A;  2VN1 A;  1HXV A;  4U85 A;  4DRJ A;  3PRB A;  4LAV A;  2M08 A;  4JYS A;  1J4R A;  2F4E A;  3RFW A;  3TC5 A;  2RUR A;  3O5G A;  3O5L A;  4GGQ A;  2DG3 A;  3JYM A;  1J4I A;  3KCE A;  4GIV A;  3RGC A;  4MGV A;  2XP9 A;  5DIU A;  2N87 A;  5HW8 A;  3LUO A;  1D7J A;  3H9R B;  4MSP A;  4W9P A;  4IQ2 A;  1FD9 A;  1QZ2 A;  5DIV A;  2PV3 A;  3UI5 A;  3O5O A;  1QPL A;  2PPP A;  2RUC A;  4DZ3 A;  5J6E A;  3IKG A;  2ITK A;  3O5F A;  1FKB A;  2XP4 A;  4N19 A;  4ODM A;  5HTG A;  1QPF A;  1NMV A;  2ZQT A;  4ODR A;  4DRP A;  4JFI A;  1B6C A;  2KO7 A;  2LPV A;  1FKI A;  3WH0 A;  1EYM A;  2VCD A;  1FKK A;  3UI6 A;  1ZCN A;  3NI6 A;  3CGN A;  3O5R A;  5GPG A;  2JZV A;  2Q5A A;  3GPK A;  3O5P A;  5HKG A;  1C9H A;  3O5E A;  3KAC A;  4DT4 A;  2IF4 A;  3UF8 A;  4W9O A;  5HWB A;  3O5D A;  2FKE A;  2MNT A;  3TDB A;  5BXJ A;  4TW7 A;  1D6O A;  2KGJ A;  1M5Y A;  5HT1 A;  2LJ4 A;  1KT0 A;  1TCO C;  2D9F A;  2XPB A;  4TX0 A;  4DZ2 A;  3UQA A;  4O2T A;  1F40 A;  1FJD A;  1L1P A;  1Q6I A; 
#chains in the Genus database with same CATH topology
 1YAT A;  3UQI A;  4G50 A;  3ARV A;  4LAY A;  4Q7N A;  2F2D A;  4S3K A;  3ARS A;  2PPN A;  1BKF A;  1D2K A;  4G2P A;  4ODP A;  1JVW A;  1PBK A;  4J4N A;  4JFK A;  3PRD A;  4U86 A;  4ODN A;  5JH8 A;  1HJW A;  3B9D A;  1FKH A;  1FKT A;  4IT4 A;  3OOB A;  3NRK A;  1F8A B;  3RM4 A;  4L72 B;  3CHF A;  2RSE A;  1OGB A;  4TNS A;  2XP3 A;  5HBF A;  3KAH A;  4DIP A;  1FAP A;  2A3E A;  2Y78 A;  1BL4 A;  4R0X A;  5GPR A;  4DRK A;  1R9H A;  3O5I A;  3B7X A;  2ZR5 A;  3KAI A;  4DRI A;  3O5M A;  4ITZ A;  1ZBK A;  4FN2 A;  1N1A A;  3AQU A;  3JXV A;  3JYJ A;  3UI4 A;  3VAW A;  3KAD A;  3WD3 A;  2LKN A;  5D75 A;  3ARR A;  2PI6 A;  4WIW A;  4DWS B;  2MLZ A;  3ARO A;  1LG2 A;  4WKH A;  4P8V A;  4U85 A;  4MPK A;  1SYT A;  2RUR A;  3O5G A;  3O5L A;  4DRJ A;  2DG3 A;  3RGC A;  2XP9 A;  2PN0 A;  5DIU A;  4P8W A;  3H9R B;  1E6N A;  3UI5 A;  4MAV A;  1QPL A;  2PPP A;  2RUC A;  2OLH A;  4MNM A;  1KFW A;  3O5F A;  1FKB A;  4ODM A;  1QPF A;  2ZQT A;  3CHE A;  3ARY A;  1JND A;  4DRP A;  1W1V A;  3ARP A;  2JZV A;  4WKA A;  1W9P A;  3UF8 A;  3WL1 A;  1XHG A;  3CHC A;  1D6O A;  3ARW A;  2KGJ A;  1TCO C;  4TX0 A;  3UQA A;  4O2T A;  1L1P A;  3WD1 A;  3AS2 A;  1GOI A;  2KFW A;  1NMW A;  4DRM A;  3NTP A;  4NZC A;  3CH9 A;  1NWS A;  2XP7 A;  4BF8 A;  1UR8 A;  3O5J A;  4IT6 A;  3ODK A;  2AOS A;  3CZ8 A;  4DH0 A;  2A3A A;  2FAP A;  1U79 A;  4DWS A;  4MNJ A;  2WK2 A;  2ZQS A;  1FKR A;  2F21 A;  3ALF A;  1NWT A;  1W1P A;  4Q22 A;  4NNR A;  1YW5 A;  1FKG A;  1EDQ A;  2IUZ A;  5HUA A;  3PA7 A;  1Q6H A;  2DSU A;  3EIP A;  1ROU A;  3FY1 A;  5GQB A;  1O6I A;  4ODL A;  2ZR6 A;  3I6C A;  4WKF A;  4LAW A;  3EY6 A;  1H0I A;  2DG9 A;  1FKF A;  2DG4 A;  1D7I A;  1HKJ A;  1FKS A;  3ARQ A;  1XRV A;  4U84 A;  4Z2G A;  1E9L A;  4QZV B;  3IHZ A;  1ZK6 A;  3UQB A;  4HBO A;  2KE0 A;  3WD4 A;  3FXY A;  4LAV A;  4JYS A;  2F4E A;  4FAP A;  2P4V A;  1ITX A;  3JYM A;  1J4I A;  3KCE A;  4GIV A;  3LUO A;  1D7J A;  4MSP A;  4P8X A;  1QZ2 A;  3WQW A;  4S3J A;  4HAR A;  3WQV A;  1E6Z A;  2KO7 A;  2LPV A;  1EHN A;  4L3N A;  5DEZ A;  1RD6 A;  1EYM A;  3UI6 A;  4DWS D;  1K9T A;  3CGN A;  3GU0 A;  1LG1 A;  2Q5A A;  3GPK A;  2ETN A;  1GRJ A;  1HKI A;  3KAC A;  1OGG A;  4ZPV R;  2IF4 A;  4LGX A;  1E15 A;  1W9U A;  5HWB A;  2FKE A;  4Z2H A;  5BXJ A;  1UR9 A;  1NH6 A;  1M5Y A;  1WNO A;  2LJ4 A;  2D9F A;  4Z2K A;  1HKM A;  1LL4 A;  2MLY A;  4IQC A;  2RQS A;  1IX5 A;  2KI3 A;  1WB0 A;  1LQ0 A;  4XAK A;  2DSV A;  3KAB A;  4MNK A;  3AS3 A;  4C02 B;  5DIT A;  5DF0 A;  2ESC A;  2PV1 A;  3CHD A;  1KT1 A;  4QT2 A;  3ARU A;  2F23 A;  3KZ7 A;  3O5K A;  1P5Q A;  2M1I A;  2XP8 A;  3WIJ A;  1W1Y A;  2O9O A;  3WD2 A;  1Q1C A;  1JNT A;  3AS1 A;  3O5Q A;  1JNE A;  1EIB A;  2XP6 A;  2O92 A;  2DPE A;  3IKD A;  4TW6 A;  4DRH A;  2XPA A;  3GTY X;  2L2S A;  1J4H A;  1HJV A;  4JFJ A;  4MNL A;  2AWG A;  1SR0 A;  3TCZ A;  3FAP A;  1E6R A;  3B8S A;  4J4O A;  4NSB A;  5I98 A;  1A7X A;  4ODQ A;  3B9A A;  5HW7 A;  1HJX A;  1W1T A;  4Z2L A;  2FDM A;  5HWC A;  2PV2 A;  1VF8 A;  2KR7 A;  1NSG A;  2WLZ A;  1NWU A;  2DT3 A;  3IK8 A;  1LJY A;  4WJX A;  1LL6 A;  1Q6U A;  1TFV A;  5HW6 A;  1JNS A;  4JFM A;  1W26 A;  2VN1 A;  1HXV A;  3RFW A;  1X6N A;  3ALG A;  2QF8 A;  4MGV A;  1FFR A;  1FD9 A;  5DIV A;  4MTV A;  2XP4 A;  4N19 A;  1NWR A;  1GPF A;  1NMV A;  3ARX A;  1H0G A;  4UDM A;  2VCD A;  3WKZ A;  1ZCN A;  3NI6 A;  3O5R A;  2DT0 A;  5GPG A;  1JCH B;  5HKG A;  3QOK A;  2WLY A;  3O5E A;  1HKK A;  4DT4 A;  3O5D A;  1GUV A;  3BXW A;  5HT1 A;  3ARZ A;  1KT0 A;  2XPB A;  4DZ2 A;  1ZU8 A;  3G6L A;  1CTN A;  2N87 A;  5HW8 A;  2DT2 A;  1E6P A;  4KQZ A;  4JFL A;  4IPX A;  1FKJ A;  3PRA A;  4AY1 A;  2ZQU A;  3CGM A;  1D7H A;  3RM8 A;  3MDY B;  2K8I A;  1J6Y A;  3RM9 A;  3KAF A;  2EUL A;  4TYO A;  2YBT A;  2PBC A;  4ODO A;  1FKL A;  2A3B A;  2B31 A;  2A3C A;  1OWQ A;  2DSW A;  2DT1 A;  5B8I C;  1E44 A;  2OFN A;  4DRO A;  3AS0 A;  2PPO A;  3OA5 A;  4P8U A;  1T11 A;  4TW8 A;  1LL7 A;  3KAG A;  1PIN A;  2G8Z A;  4LAX A;  4HBE A;  2UZ5 A;  3PR9 A;  2MPH A;  3WD0 A;  2M2A A;  4DRN A;  4QT3 A;  2ZQV A;  2YBU A;  2XP5 A;  4DRQ A;  4W5U A;  3W4R A;  2MF9 A;  2LGO A;  2RUD A;  4QIB A;  2MLX A;  1ROT A;  4ODK A;  1Y0O A;  1FFQ A;  1ZB5 A;  1EQ3 A;  4W9Q A;  2RUQ A;  2ZR4 A;  1FKD A;  4Z2I A;  3PRB A;  2M08 A;  1J4R A;  4ZPW R;  3TC5 A;  4GGQ A;  4R5E A;  2G41 A;  4W9P A;  4IQ2 A;  4KR0 B;  2PV3 A;  3O5O A;  4DZ3 A;  3G6M A;  5J6E A;  1ZBC A;  3IKG A;  2ITK A;  1ZL1 A;  3WL0 A;  4DWS C;  2DSZ A;  2B5U B;  4PTM A;  5DO2 A;  3RME A;  3B9E A;  5HTG A;  4ODR A;  1WAW A;  4JFI A;  1B6C A;  4WK9 A;  1FKI A;  1W9V A;  3WH0 A;  1FKK A;  4Z2J A;  1ZBW A;  3BMB A;  3O5P A;  1C9H A;  4W9O A;  4ZS6 A;  2MNT A;  3TDB A;  3ART A;  4TW7 A;  4URI A;  4ZPT R;  1X6L A;  2WM0 A;  1ZBV A;  1F40 A;  1FJD A;  4ML4 A;  1Q6I A; 
#chains in the Genus database with same CATH homology
 1YAT A;  3UQI A;  4G50 A;  3ARV A;  4LAY A;  4Q7N A;  2F2D A;  4S3K A;  3ARS A;  2PPN A;  1BKF A;  1D2K A;  4G2P A;  4ODP A;  1JVW A;  1PBK A;  4J4N A;  4JFK A;  3PRD A;  4U86 A;  4ODN A;  5JH8 A;  1HJW A;  3B9D A;  1FKH A;  1FKT A;  4IT4 A;  3OOB A;  3NRK A;  1F8A B;  3RM4 A;  4L72 B;  3CHF A;  2RSE A;  1OGB A;  4TNS A;  2XP3 A;  5HBF A;  3KAH A;  4DIP A;  1FAP A;  2A3E A;  2Y78 A;  1BL4 A;  4R0X A;  5GPR A;  4DRK A;  1R9H A;  3O5I A;  3B7X A;  2ZR5 A;  3KAI A;  4DRI A;  3O5M A;  4ITZ A;  1ZBK A;  4FN2 A;  1N1A A;  3AQU A;  3JXV A;  3JYJ A;  3UI4 A;  3VAW A;  3KAD A;  3WD3 A;  2LKN A;  5D75 A;  3ARR A;  2PI6 A;  4WIW A;  4DWS B;  2MLZ A;  3ARO A;  1LG2 A;  4WKH A;  4P8V A;  4U85 A;  4MPK A;  1SYT A;  2RUR A;  3O5G A;  3O5L A;  4DRJ A;  2DG3 A;  3RGC A;  2XP9 A;  5DIU A;  4P8W A;  3H9R B;  1E6N A;  3UI5 A;  4MAV A;  1QPL A;  2PPP A;  2RUC A;  2OLH A;  4MNM A;  1KFW A;  3O5F A;  1FKB A;  4ODM A;  1QPF A;  2ZQT A;  3CHE A;  3ARY A;  1JND A;  4DRP A;  1W1V A;  3ARP A;  2JZV A;  4WKA A;  1W9P A;  3UF8 A;  3WL1 A;  1XHG A;  3CHC A;  1D6O A;  3ARW A;  2KGJ A;  1TCO C;  4TX0 A;  3UQA A;  4O2T A;  1L1P A;  3WD1 A;  3AS2 A;  1GOI A;  2KFW A;  1NMW A;  4DRM A;  3NTP A;  4NZC A;  3CH9 A;  1NWS A;  2XP7 A;  4BF8 A;  1UR8 A;  3O5J A;  4IT6 A;  3ODK A;  2AOS A;  3CZ8 A;  4DH0 A;  2A3A A;  2FAP A;  1U79 A;  4DWS A;  4MNJ A;  2WK2 A;  2ZQS A;  1FKR A;  2F21 A;  3ALF A;  1NWT A;  1W1P A;  4Q22 A;  4NNR A;  1YW5 A;  1FKG A;  1EDQ A;  2IUZ A;  5HUA A;  3PA7 A;  1Q6H A;  2DSU A;  3FY1 A;  1ROU A;  5GQB A;  1O6I A;  4ODL A;  2ZR6 A;  3I6C A;  4WKF A;  4LAW A;  3EY6 A;  1H0I A;  2DG9 A;  1FKF A;  2DG4 A;  1D7I A;  1HKJ A;  1FKS A;  3ARQ A;  1XRV A;  4U84 A;  4Z2G A;  1E9L A;  4QZV B;  3IHZ A;  1ZK6 A;  3UQB A;  4HBO A;  2KE0 A;  3WD4 A;  3FXY A;  4LAV A;  4JYS A;  2F4E A;  4FAP A;  1ITX A;  3JYM A;  1J4I A;  3KCE A;  4GIV A;  3LUO A;  1D7J A;  4MSP A;  4P8X A;  1QZ2 A;  3WQW A;  4S3J A;  4HAR A;  3WQV A;  1E6Z A;  2KO7 A;  2LPV A;  1EHN A;  4L3N A;  5DEZ A;  1RD6 A;  1EYM A;  3UI6 A;  4DWS D;  1K9T A;  3CGN A;  1LG1 A;  2Q5A A;  3GPK A;  1HKI A;  3KAC A;  1OGG A;  4ZPV R;  2IF4 A;  4LGX A;  1E15 A;  1W9U A;  5HWB A;  2FKE A;  4Z2H A;  5BXJ A;  1UR9 A;  1NH6 A;  1M5Y A;  1WNO A;  2LJ4 A;  2D9F A;  4Z2K A;  1HKM A;  1LL4 A;  2MLY A;  4IQC A;  2RQS A;  1IX5 A;  2KI3 A;  1WB0 A;  1LQ0 A;  4XAK A;  2DSV A;  3KAB A;  4MNK A;  3AS3 A;  4C02 B;  5DIT A;  5DF0 A;  2ESC A;  2PV1 A;  3CHD A;  1KT1 A;  4QT2 A;  3ARU A;  3KZ7 A;  3O5K A;  1P5Q A;  2M1I A;  2XP8 A;  3WIJ A;  1W1Y A;  2O9O A;  3WD2 A;  1Q1C A;  1JNT A;  3AS1 A;  3O5Q A;  1JNE A;  1EIB A;  2XP6 A;  2O92 A;  2DPE A;  3IKD A;  4TW6 A;  4DRH A;  2XPA A;  2L2S A;  1J4H A;  1HJV A;  4JFJ A;  4MNL A;  2AWG A;  1SR0 A;  3TCZ A;  3FAP A;  1E6R A;  3B8S A;  4J4O A;  4NSB A;  5I98 A;  1A7X A;  4ODQ A;  3B9A A;  5HW7 A;  1HJX A;  1W1T A;  4Z2L A;  2FDM A;  5HWC A;  2PV2 A;  1VF8 A;  2KR7 A;  1NSG A;  2WLZ A;  1NWU A;  2DT3 A;  3IK8 A;  1LJY A;  4WJX A;  1LL6 A;  1Q6U A;  1TFV A;  5HW6 A;  1JNS A;  4JFM A;  1W26 A;  2VN1 A;  1HXV A;  3RFW A;  1X6N A;  3ALG A;  2QF8 A;  4MGV A;  1FFR A;  1FD9 A;  5DIV A;  4MTV A;  2XP4 A;  4N19 A;  1NWR A;  1GPF A;  1NMV A;  3ARX A;  1H0G A;  2VCD A;  3WKZ A;  1ZCN A;  3NI6 A;  3O5R A;  2DT0 A;  5GPG A;  5HKG A;  3QOK A;  2WLY A;  3O5E A;  1HKK A;  4DT4 A;  3O5D A;  1GUV A;  3BXW A;  5HT1 A;  3ARZ A;  1KT0 A;  2XPB A;  4DZ2 A;  1ZU8 A;  3G6L A;  1CTN A;  2N87 A;  5HW8 A;  2DT2 A;  1E6P A;  4KQZ A;  4JFL A;  4IPX A;  1FKJ A;  3PRA A;  4AY1 A;  2ZQU A;  3CGM A;  1D7H A;  3RM8 A;  3MDY B;  2K8I A;  1J6Y A;  3RM9 A;  3KAF A;  4TYO A;  2YBT A;  2PBC A;  4ODO A;  1FKL A;  2A3B A;  2B31 A;  2A3C A;  1OWQ A;  2DSW A;  2DT1 A;  5B8I C;  2OFN A;  4DRO A;  3AS0 A;  2PPO A;  3OA5 A;  4P8U A;  1T11 A;  4TW8 A;  1LL7 A;  3KAG A;  1PIN A;  2G8Z A;  4LAX A;  4HBE A;  2UZ5 A;  3PR9 A;  2MPH A;  3WD0 A;  2M2A A;  4DRN A;  4QT3 A;  2ZQV A;  2YBU A;  2XP5 A;  4DRQ A;  4W5U A;  3W4R A;  2MF9 A;  2LGO A;  2RUD A;  4QIB A;  2MLX A;  1ROT A;  4ODK A;  1Y0O A;  1FFQ A;  1ZB5 A;  1EQ3 A;  4W9Q A;  2RUQ A;  2ZR4 A;  1FKD A;  4Z2I A;  3PRB A;  2M08 A;  1J4R A;  4ZPW R;  3TC5 A;  4GGQ A;  4R5E A;  2G41 A;  4W9P A;  4IQ2 A;  4KR0 B;  2PV3 A;  3O5O A;  4DZ3 A;  3G6M A;  5J6E A;  1ZBC A;  3IKG A;  2ITK A;  1ZL1 A;  3WL0 A;  4DWS C;  2DSZ A;  4PTM A;  5DO2 A;  3RME A;  3B9E A;  5HTG A;  4ODR A;  1WAW A;  4JFI A;  1B6C A;  4WK9 A;  1FKI A;  1W9V A;  3WH0 A;  1FKK A;  4Z2J A;  1ZBW A;  3O5P A;  1C9H A;  4W9O A;  4ZS6 A;  2MNT A;  3TDB A;  3ART A;  4TW7 A;  4URI A;  4ZPT R;  1X6L A;  2WM0 A;  1ZBV A;  1F40 A;  1FJD A;  4ML4 A;  1Q6I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...